
Sample records for mendelevium 246

  1. Studies of neutron-deficient mendelevium isotopes at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)


    The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

  2. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.


    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  3. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.


    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  4. 7 CFR 246.3 - Administration. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 246.3 Section 246.3 Agriculture... § 246.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, SFPD and the Regional Offices are responsible...

  5. 48 CFR 2453.246 - Quality Assurance. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Quality Assurance. 2453.246 Section 2453.246 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.246 Quality Assurance. ...

  6. 7 CFR 246.11 - Nutrition education. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 246.11 Section 246.11 Agriculture... Participant Benefits § 246.11 Nutrition education. (a) General. (1) Nutrition education shall be considered a benefit of the Program, and shall be made available at no cost to the participant. Nutrition education...

  7. 7 CFR 246.10 - Supplemental foods. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Supplemental foods. 246.10 Section 246.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... nutritional needs of the participant. The food packages are as follows: (1) Food Package I—Infants birth...

  8. Dicty_cDB: VHK246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK246 (Link to dictyBase) - - - Contig-U16440-1 VHK246P (Link to Original site) VHK2...46F 617 VHK246Z 760 VHK246P 1357 - - Show VHK246 Library VH (Link to library) Clone ID VHK2...e URL Representative seq. ID VHK2...46P (Link to Original site) Representative DNA sequence >VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2

  9. 32 CFR 246.4 - Policy. (United States)


    ... through newspaper sales, resale of commercial publications, authorized advertising, job printing, and... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.4 Policy. It is DoD policy that: (a) The U.S... the Stars and Stripes editorial staffs the same help provided to commercial newspapers, in compliance...

  10. 32 CFR 246.1 - Purpose. (United States)


    ... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.1 Purpose. This part: (a) Establishes policy... the S&S newspapers. (c) Authorizes the establishment, management, operation, and oversight of the... mission, production, distribution authority, and business operations as mission-essential activities of...

  11. 32 CFR 246.6 - Procedures. (United States)


    ... costs and to increase the efficiency and effectiveness of these audits. Information copies of the audit... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.6 Procedures. (a) General. (1) Authority to...) The Stars and Stripes and the S&S business operations shall conform to applicable regulations and laws...

  12. 40 CFR 246.200 - High-grade paper recovery. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-grade paper recovery. 246.200 Section 246.200 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE... paper recovery. ...

  13. 12 CFR 19.246 - Petition for reinstatement. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Petition for reinstatement. 19.246 Section 19.246 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19.246 Petition...

  14. 48 CFR 52.246-14 - Inspection of Transportation. (United States)


    ... Transportation. 52.246-14 Section 52.246-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....246-14 Inspection of Transportation. As prescribed in 46.314, insert the following clause in solicitations and contracts for freight transportation services (including local drayage) by rail, motor...

  15. 7 CFR 246.1 - General purpose and scope. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 246.1 Section 246.1... General § 246.1 General purpose and scope. This part announces regulations under which the Secretary of... health by reason of inadequate nutrition or health care, or both. The purpose of the Program is to...

  16. 7 CFR 246.13 - Financial management system. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 246.13 Section 246.13... State Agency Provisions § 246.13 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete...

  17. 48 CFR 852.246-72 - Frozen processed foods. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Frozen processed foods. 852.246-72 Section 852.246-72 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... Frozen processed foods. As prescribed in 846.302-72, insert the following clause: Frozen Processed Foods...

  18. 7 CFR 246.6 - Agreements with local agencies. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Agreements with local agencies. 246.6 Section 246.6 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN...

  19. 7 CFR 246.5 - Selection of local agencies. (United States)


    ... consider how much of the current need is being met at each priority level. The selection criteria cited in... 7 Agriculture 4 2010-01-01 2010-01-01 false Selection of local agencies. 246.5 Section 246.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF...

  20. Decay study of {sup 246}Fm at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Venhart, M. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Slovak Academy of Sciences, Institute of Physics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Gray-Jones, C.; Herzberg, R.D.; Papadakis, P. [University of Liverpool, Department of Physics, Liverpool (United Kingdom); Greenlees, P.T.; Ketelhut, S.; Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Rostron, D. [Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Rudolph, D. [Lund University, Department of Physics, Lund (Sweden); Sulignano, B. [CEA Saclay, DAPNIA/SPhN, Gif/Yvette Cedex (France)


    The decay chain of {sup 246}Fm has been investigated employing the SHIP separator at GSI Darmstadt. The {sup 246}Fm nuclei were produced via the {sup 40}Ar({sup 208}Pb, 2n){sup 246}Fm fusion-evaporation reaction. Improved values of the half-life, T{sub 1/2} = 1.54(4) s, and of the spontaneous fission branching ratio, b{sub SF} = 0.068(6), of {sup 246}Fm were obtained. The {beta}{sup +} /electron capture branching ratio, b{sub EC} = 0.39(3), of {sup 242}Cf was deduced. Possible structures of high-K states in {sup 246}Fm are discussed within the framework of a model calculation based on the Woods-Saxon potential. (orig.)

  1. 48 CFR 246.370 - Material inspection and receiving report. (United States)


    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT QUALITY ASSURANCE Contract Clauses 246.370... deliverable is a scientific or technical report; (5) Research and development contracts not requiring the...

  2. 21 CFR 520.246 - Butorphanol tartrate tablets. (United States)


    ....246 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...) Conditions of use. The drug is used for the treatment of dogs as follows: (1) Amount. 0.25 milligram of... associated with inflammatory conditions of the upper respiratory tract. (3) Limitations. For oral use in dogs...

  3. 48 CFR 52.246-1 - Contractor Inspection Requirements. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor Inspection....246-1 Contractor Inspection Requirements. As prescribed in 46.301, insert the following clause: Contractor Inspection Requirements (APR 1984) The Contractor is responsible for performing or having...

  4. 40 CFR 246.201-6 - Recommended procedures: Transportation to market. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation to market. 246.201-6 Section 246.201-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Procedures § 246.201-6 Recommended procedures: Transportation to market. Transportation to market may be...

  5. 48 CFR 52.246-5 - Inspection of Services-Cost-Reimbursement. (United States)


    ...-Cost-Reimbursement. 52.246-5 Section 52.246-5 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-5 Inspection of Services—Cost-Reimbursement. As prescribed in 46.305, insert... furnishing of services, when a cost-reimbursement contract is contemplated: Inspection of Services—Cost...

  6. 48 CFR 52.246-3 - Inspection of Supplies-Cost-Reimbursement. (United States)


    ...-Cost-Reimbursement. 52.246-3 Section 52.246-3 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-3 Inspection of Supplies—Cost-Reimbursement. As prescribed in 46.303, insert... furnishing of supplies, when a cost-reimbursement contract is contemplated: Inspection of Supplies—Cost...

  7. 48 CFR 52.246-8 - Inspection of Research and Development-Cost-Reimbursement. (United States)


    ... Development-Cost-Reimbursement. 52.246-8 Section 52.246-8 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.246-8 Inspection of Research and Development—Cost-Reimbursement. As prescribed in... (b) a cost-reimbursement contract is contemplated; unless use of the clause is impractical and the...

  8. 48 CFR 52.246-17 - Warranty of Supplies of a Noncomplex Nature. (United States)


    ... Noncomplex Nature. 52.246-17 Section 52.246-17 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-17 Warranty of Supplies of a Noncomplex Nature. As prescribed in 46.710(a)(1), insert a clause substantially as follows: Warranty of Supplies of a Noncomplex Nature (JUN 2003) (a) Definitions...

  9. 48 CFR 52.246-18 - Warranty of Supplies of a Complex Nature. (United States)


    ... Complex Nature. 52.246-18 Section 52.246-18 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.246-18 Warranty of Supplies of a Complex Nature. As prescribed in 46.710(b)(1), insert a clause substantially as follows: Warranty of Supplies of a Complex Nature (MAY 2001) (a) Definitions. As used in this...

  10. 48 CFR 552.246-77 - Additional Contract Warranty Provisions for Supplies of a Noncomplex Nature. (United States)


    ... Warranty Provisions for Supplies of a Noncomplex Nature. 552.246-77 Section 552.246-77 Federal Acquisition... a Noncomplex Nature. As prescribed in 546.710(a), insert the following clause in solicitations and contracts that include FAR 52.246-17, Warranty of Supplies of a Noncomplex Nature. Additional Contract...

  11. In vitro efficacy of ST246 against smallpox and monkeypox. (United States)

    Smith, Scott K; Olson, Victoria A; Karem, Kevin L; Jordan, Robert; Hruby, Dennis E; Damon, Inger K


    Since the eradication of smallpox and the cessation of routine childhood vaccination for smallpox, the proportion of the world's population susceptible to infection with orthopoxviruses, such as variola virus (the causative agent of smallpox) and monkeypox virus, has grown substantially. In the United States, the only vaccines for smallpox licensed by the Food and Drug Administration (FDA) have been live virus vaccines. Unfortunately, a substantial number of people cannot receive live virus vaccines due to contraindications. Furthermore, no antiviral drugs have been fully approved by the FDA for the prevention or treatment of orthopoxvirus infection. Here, we show the inhibitory effect of one new antiviral compound, ST-246, on the in vitro growth properties of six variola virus strains and seven monkeypox virus strains. We performed multiple assays to monitor the cytopathic effect and to evaluate the reduction of viral progeny production and release in the presence of the compound. ST-246 had 50% effective concentrations of 246 inhibits variola and monkeypox viruses similarly by reducing the production and release of enveloped orthopoxvirus and support the development of ST-246 as an antiviral therapeutic compound for the treatment of severe systemic orthopoxvirus infections.

  12. Interaction of 2,4,6-trichlorophenol with high carbon iron filings: Reaction and sorption mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Sinha, Alok [Environmental Engineering and Management Programme, Department of Civil Engineering, Indian Institute of Technology Kanpur, Kanpur 208016 (India); Bose, Purnendu [Environmental Engineering and Management Programme, Department of Civil Engineering, Indian Institute of Technology Kanpur, Kanpur 208016 (India)], E-mail:


    Reductive dehalogenation of 2,4,6-trichlorophenol (2,4,6-TCP) by two types of high carbon iron filings (HCIF), HCIF-1 and HCIF-2 was studied in batch reactors. While the iron, copper, manganese and carbon content of the two types of HCIF was similar, the specific surface area of HCIF-1 and HCIF-2 were 1.944 and 3.418 m{sup 2} g{sup -1}, respectively. During interaction with HCIF-1, 2,4,6-TCP adsorbed on HCIF-1 surface resulting in rapid reduction of aqueous phase 2,4,6-TCP concentration. However, reductive dehalogenation of 2,4,6-TCP was negligible. During interaction between 2,4,6-TCP and HCIF-2, both 2,4,6-TCP adsorption on HCIF-2, and 2,4,6,-TCP dechlorination was observed. 2,4,6-TCP partitioning between solid and aqueous phase could be described by a Freundlich isotherm, while 2,4,6-TCP dechlorination could be described by an appropriate rate expression. A mathematical model was developed for describing the overall interaction of 2,4,6-TCP with HCIF-2, incorporating simultaneous adsorption/desorption and dechlorination reactions of 2,4,6-TCP with the HCIF surface. 2,4-Dichlorophenol (2,4-DCP), 2-chlorophenol (2-CP) and minor amounts of 4-chlorophenol (4-CP) evolved as 2,4,6-TCP dechlorination by-products. The evolved 2,4-DCP partitioned strongly to the HCIF surface. 4-CP and 2-CP accumulated in the aqueous phase. No transformation of 2-CP or 4-CP to phenol was observed.

  13. PNN NGC 246: A Complex Photometric Behaviour That Requires Wet

    Directory of Open Access Journals (Sweden)

    Pérez J. M. González


    Full Text Available We present a study over three single-site campaigns to investigate the photometric behaviour of the PNN NGC 246. We observed this object in 2000 and 2001. The analysis of the light curves indicates complex and variable temporal spectra. Using wavelet analysis we have found evidences for changes on time scales of hours in the 2000 dataset. The temporal spectra obtained during 2001 are quite different from the results of the previous year. The modulations in the light curve are more noticeable and the temporal spectra present a higher number of modulation frequencies. One peculiar characteristic is the presence of a variable harmonic structure related to one of these modulation frequencies. This complex photometric behaviour may be explained by a more complicated unresolved combination of modulation frequencies, but more likely due to a combination of pulsations of the star plus modulations related to interaction with a close companion, maybe indicating a disc. However, these characteristics cannot be confirmed from single site observations. The complex and variable behaviour of NGC 246 needs the WET co-operation in order to completely resolve its light curve.

  14. Computational investigation on 2,4,6-trinitrochlorobenzene crystal

    Energy Technology Data Exchange (ETDEWEB)

    Ju, Xue-Hai; Qiu, Ling; Xiao, He-Ming [Department of Chemistry, Nanjing University of Science and Technology, Nanjing 210094 (China)


    Density functional theory calculations at the B3LYP level were performed on crystalline 2,4,6-trinitrochlorobenzene. The carbon, oxygen, and chlorine atoms make up the narrow lower energy bands, while the nitrogen, carbon, and oxygen atoms make up the higher energy bands. Besides, the contributions of these atomic orbitals to the frontier bands are somewhat well-proportioned. The Mulliken populations obviously demonstrate that the C-N bonds are the weakest, indicating that the C-NO{sub 2} is prone to rupture upon stimuli. An anisotropic impact on the bulk makes the electron transfer from chlorine to its neighbor carbon atom and from nitrogen atoms to oxygen atoms. The crystal lattice energy is predicted to be -50.99 kJ/mol, after being corrected for basis set superposition error. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  15. 12 CFR 24.6 - Examples of qualifying public welfare investments. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Examples of qualifying public welfare investments. 24.6 Section 24.6 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY... finance small businesses or small farms, including minority- and women-owned small businesses or small...

  16. 32 CFR Appendix E to Part 246 - Stars and Stripes (S&S) Board of Directors (United States)


    ... of directors shall monitor planning and execution of the S&S business activities. 2. The S&S board of... DEFENSE (CONTINUED) MISCELLANEOUS STARS AND STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS Pt. 246, App. E Appendix E to Part 246—Stars and Stripes (S&S) Board of Directors A. Organization and Management...



    Tümsek, Fatma; Bayındır, Zekiye; Bodur, Gökçen; Koyuncu, Zelal


    2,4,6-Trichlorophenol is a phenolic compound which is widely used in the production of pesticides, herbicides, wood, leather and glue preservatives. In addition, 2,4,6- trichlorophenol may form during the treatment of phenol containing industrial wastewater with hypochlorite or during the disinfection of drinking-water sources. The removal of 2,4,6-trichlorophenol is significant because of its high toxicity, carcinogenic properties and persistence [1].In this study, the adsorption of 2,4,6-tr...

  18. 33 CFR 148.246 - When is a document considered filed and where should I file it? (United States)


    ... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If a...

  19. Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm

    International Nuclear Information System (INIS)

    Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.


    An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience

  20. Concentrations of Polybrominated Diphenyl Ethers (PBDEs) and 2,4,6-Tribromophenol in Human Placental Tissues (United States)

    Leonetti, Christopher; Butt, Craig M.; Hoffman, Kate; Miranda, Marie Lynn; Stapleton, Heather M.


    Legacy environmental contaminants such as polybrominated diphenyl ethers (PBDEs) are widely detected in human tissues. However, few studies have measured PBDEs in placental tissues, and there are no reported measurements of 2,4,6-tribromophenol (2,4,6-TBP) in placental tissues. Measurements of these contaminants are important for understanding potential fetal exposures, as these compounds have been shown to alter thyroid hormone regulation in vitro and in vivo. In this study, we measured a suite of PBDEs and 2,4,6-TBP in 102 human placental tissues collected between 2010–2011 in Durham County, North Carolina, USA. The most abundant PBDE congener detected was BDE-47, with a mean concentration of 5.09 ng/g lipid (range: 0.12–141 ng/g lipid; detection frequency 91%); however, 2,4,6-TBP was ubiquitously detected and present at higher concentrations with a mean concentration of 15.4 ng/g lipid (range:1.31–316 ng/g lipid; detection frequency 100%). BDE-209 was also detected in more than 50% of the samples, and was significantly associated with 2,4,6-TBP in placental tissues, suggesting they may have a similar source, or that 2,4,6-TBP may be a degradation product of BDE-209. Interestingly, BDE-209 and 2,4,6-TBP were negatively associated with age (rs=−0.16; p=0.10 and rs=−0.17; p=0.08, respectively). The results of this work indicate that PBDEs and 2,4,6-TBP bioaccumulate in human placenta tissue and likely contribute to prenatal exposures to these environmental contaminants. Future studies are needed to determine if these joint exposures are associated with any adverse health measures in infants and children. PMID:26700418

  1. Degradation of 2,4,6-Trichlorophenol and hydrogen production simultaneously by TiO2 nanotubes/graphene composite (United States)

    Slamet, Raudina


    Industrial waters in coal pyrolysis process, synthetic chemicals and oil and gas process contain phenol derivatives that are dangerous to the environment and needs to be removed, one of them is 2,4,6-Trichlorophenol. Degradation of 2,4,6-Trichlorophenol and hydrogen production simultaneously have been investigated using TiNT/Graphene composite at various graphene loading and initial concentration of 2,4,6-Trichlorophenol. Optimal graphene loading of 0.6 wt% was obtained in the simultaneous system with 89% elimination of 2,4,6-Trichlorophenol and 986 µmol of hydrogen production. Test results showed that addition of 2,4,6-Trichlorophenol would subsequently increased 2,4,6-Trichlorophenol conversion and enhanced hydrogen production linearly. 2.7 times greater hydrogen production was found in addition of 50 ppm 2,4,6-Trichlorophenol.

  2. The potential of ion mobility spectrometry (IMS) for detection of 2,4,6-trichloroanisole (2,4,6-TCA) in wine. (United States)

    Karpas, Zeev; Guamán, Ana V; Calvo, Daniel; Pardo, Antonio; Marco, Santiago


    The off-flavor of "tainted wine" is attributed mainly to the presence of 2,4,6-trichloroanisole (2,4,6-TCA) in the wine. In the present study the atmospheric pressure gas-phase ion chemistry, pertaining to ion mobility spectrometry, of 2,4,6-trichloroanisole was investigated. In positive ion mode the dominant species is a monomer ion with a lower intensity dimer species with reduced mobility values (K(0)) of 1.58 and 1.20 cm(2)V(-1) s(-1), respectively. In negative mode the ion with K(0) =1.64 cm(2)V(-1)s(-1) is ascribed to a trichlorophenoxide species while the ions with K(0) =1.48 and 1.13 cm(2)V(-1)s(-1) are attributed to chloride attachment adducts of a TCA monomer and dimer, respectively. The limit of detection of the system for 2,4,6-TCA dissolved in dichloromethane deposited on a filter paper was 2.1 μg and 1.7 ppm in the gas phase. In ethanol and in wine the limit of detection is higher implying that pre-concentration and pre-separation are required before IMS can be used to monitor the level of TCA in wine. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. APR-246/PRIMA-1Met Inhibits and Reverses Squamous Metaplasia in Human Conjunctival Epithelium. (United States)

    Li, Jing; Li, Cheng; Wang, Guoliang; Liu, Zhen; Chen, Pei; Yang, Qichen; Dong, Nuo; Wu, Huping; Liu, Zuguo; Li, Wei


    Squamous metaplasia is a common pathologic condition in ocular surface diseases for which there is no therapeutic medication in clinic. In this study, we investigated the effect of a small molecule, APR-246/PRIMA-1(Met), on squamous metaplasia in human conjunctival epithelium. Human conjunctival explants were cultured for up to 12 days under airlifting conditions. Epithelial cell differentiation and proliferation were assessed by Cytokeratin 10 (K10), K14, K19, Pax6, MUC5AC, and p63 immunostaining patterns. β-catenin and TCF-4 immunofluorescent staining and real-time PCR characterized Wnt signaling pathway involvement. Pterygium clinical samples were cultured under airlifting conditions with or without APR-246 for 4 days. p63, K10, β-catenin, and TCF-4 expression in pterygial epithelium was determined by immunofluorescent staining and real-time PCR. Airlift conjunctival explants resulted in increased stratification and intrastromal epithelial invagination. Such pathology was accompanied by increases in K10, K14, and p63 expression, whereas K19 and Pax6 levels declined when compared to those in freshly isolated tissue. On the other hand, APR-246 reversed all of these declines in K10, K14, and p63 expression. Furthermore, K19 and Pax6 increased along with rises in goblet cell density. These effects of APR-246 were accompanied by near restoration of normal conjunctival epithelial histology. APR-246 also reversed squamous metaplasia in pterygial epithelium that had developed after 4 days in ex vivo culture. Reductions in squamous metaplasia induced by APR-246 suggest it may provide a novel therapeutic approach in different squamous metaplasia-associated ocular surface diseases.

  4. 48 CFR 1852.246-70 - Mission Critical Space System Personnel Reliability Program. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mission Critical Space... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.246-70 Mission Critical Space System Personnel Reliability Program. As prescribed in 1846.370(a), insert the following clause: Mission Critical Space System...


    Serial Analysis of Gene Expression (SAGE) was used to profile transcript levels in Arabidopsis thaliana roots and assess their responses to 2,4,6-trinitrotoluene (TNT) exposure. SAGE libraries representing control and TNT-exposed seedling root transcripts were constructed, and ea...

  6. 8 CFR 246.4 - Immigration judge's authority; withdrawal and substitution. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Immigration judge's authority; withdrawal... IMMIGRATION REGULATIONS RESCISSION OF ADJUSTMENT OF STATUS § 246.4 Immigration judge's authority; withdrawal and substitution. In any proceeding conducted under this part, the immigration judge shall have...

  7. Complete dissipation of 2,4,6-trinitrotoluene by in-vessel composting

    NARCIS (Netherlands)

    Gümüscü, B.; Cekmecelioglu, Deniz; Tekinay, Turgay


    We demonstrate complete removal of 2,4,6-trinitrotoluene (TNT) in 15 days using an in-vessel composting system, which is amended with TNT-degrading bacteria strains. A mixture of TNT, food waste, manure, wood chips, soil and TNT-degrading bacteria consortium are co-composted for 15 days in an

  8. 48 CFR 52.246-9 - Inspection of Research and Development (Short Form). (United States)


    ... Clauses 52.246-9 Inspection of Research and Development (Short Form). As prescribed in 46.309, insert the following clause: Inspection of Research and Development (Short Form) (APR 1984) The Government has the... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Inspection of Research and...

  9. 48 CFR 52.246-7 - Inspection of Research and Development-Fixed-Price. (United States)


    ... Clauses 52.246-7 Inspection of Research and Development—Fixed-Price. As prescribed in 46.307(a), insert the following clause: Inspection of Research and Development—Fixed-Price (AUG 1996) (a) The Contractor... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Inspection of Research and...

  10. Environmental concentrations and toxicology of 2,4,6-tribromophenol (TBP). (United States)

    Koch, Christoph; Sures, Bernd


    2,4,6-Tribromophenol is the most widely produced brominated phenol. In the present review, we summarize studies dealing with this substance from an environmental point of view. We cover concentrations in the abiotic and biotic environment including humans, toxicokinetics as well as toxicodynamics, and show gaps of the current knowledge about this chemical. 2,4,6-Tribomophenol occurs as an intermediate during the synthesis of brominated flame retardants and it similarly represents a degradation product of these substances. Moreover, it is used as a pesticide but also occurs as a natural product of some aquatic organisms. Due to its many sources, 2,4,6-tribromophenol is ubiquitously found in the environment. Nevertheless, not much is known about its toxicokinetics and toxicodynamics. It is also unclear which role the structural isomer 2,4,5-tribromophenol and several degradation products such as 2,4-dibromophenol play in the environment. Due to new flame retardants that enter the market and can degrade to 2,4,6-tribromophenol, this compound will remain relevant in future years - not only in aquatic matrices, but also in house dust and foodstuff, which are an important exposure route for humans. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. 1,3,5-Triazine-2,4,6-triyltrisulfamic acid (TTSA)

    Indian Academy of Sciences (India)

    Melamine reacted with chlorosufonic acid (ClSO3H) to form a new sulfamic-type acid, 1,3,5-triazine-2,4,6-triyltrisulfamic acid (TTSA). Both nitrosation of secondary amines and oxidation of urazoles were accomplished by using TTSA/NaNO2 system under mild and heterogeneous conditions with good to excellent yields.

  12. 25 CFR 1000.246 - Must an AFA that contains a construction project or activity incorporate provisions of Federal... (United States)


    ... as possible in the construction process. If Tribal construction standards are consistent with or... 25 Indians 2 2010-04-01 2010-04-01 false Must an AFA that contains a construction project or activity incorporate provisions of Federal construction standards? 1000.246 Section 1000.246 Indians OFFICE...

  13. Vicarious nucleophilic substitution to prepare 1,3-diamino-2,4,6-trinitrobenzene or 1,3,5-triamino-2,4,6-trinitrobenzene (United States)

    Mitchell, Alexander R.; Pagoria, Philip F.; Schmidt, Robert D.


    The present invention relates to a process to produce 1,3-diamino-2,4,6-trinitrobenzene (DATB) or 1,3,5-triamino-2,4,6,-trinitrobenzene (TATB) by: (a) reacting at ambient pressure and a temperature of between about and C. for between about 0.1 and 24 hr, a trinitroaromatic compound of structure V: ##STR1## wherein X, Y, and Z are each independently selected from --H, or --NH.sub.2, with the proviso that at least 1 or 2 of X, Y, and Z are hydrogen, with an amount effective to produce DATB or TATB of 1,1,1-trialkylhydrazinium halide wherein alkyl is selected from methyl, ethyl, propyl or butyl and halide is selected from chloride, bromide or iodide. in the presence of a strong base selected from sodium butoxide, potassium butoxide, potassium propoxide, sodium propoxide, sodium ethoxide, potassium ethoxide, sodium methoxide, potassium methoxide, and combinations thereof; in a solvent selected from the group consisting of methanol, ethanol, propanol, butanol, dimethylsulphoxide, N-methylpyrrolidone, hexamethylphosphoramide, dimethylformide, dimethylacetamide and mixtures thereof, provided that when alcohols are present primarily DATB and picramide is formed; and (b) isolating the DATB or TATB produced. DATB and TATB are useful specialty explosives. TATB is also used for the preparation of benzenehexamine, a starting material for the synthesis of novel materials (optical imaging devices, liquid crystals, ferromagnetic compounds).

  14. Levan-type fructooligosaccharide production using Bacillus licheniformis RN-01 levansucrase Y246S immobilized on chitosan beads

    Directory of Open Access Journals (Sweden)

    Surawut Sangmanee


    Full Text Available Bacillus licheniformis RN-01 levansucrase Y246S (LsRN-Y246S was immobilized by covalently linking onto chitosan, Sepabead EC-EP, and Sepabead EC-HFA, beads. The stability of immobilized LsRN-Y246S was found to be the highest with chitosan beads, retaining more than 70% activity after 13 weeks storage at 4 oC, and 68% activity after 12 hours incubation at 40°C. LsRN-Y246S immobilized on chitosan beads withstands sucrose concentrations up to 70% (w/v, retaining over 85% of its activity, significantly better than LsRN-Y246S immobilized on others supporting matrices. LsRN-Y246S immobilized on chitosan showed a 2.4 fold increase in activity in the presence of Mn2+, and gave slight protection against deactivation by of Cu2+, Zn2+, Fe3+, SDS and EDTA. A maximum of 8.36 g and an average of 7.35 g LFOS yield at least up to DP 11 can be produced from 25 g of sucrose, during five production cycles. We have demonstrated that LFOS can be effectively produced by chitosan immobilized LsRN-Y246S and purified.

  15. Oral exposure of adult zebrafish (Danio rerio) to 2,4,6-tribromophenol affects reproduction

    DEFF Research Database (Denmark)

    Halden, Anna Norman; Nyholm, Jenny Rattfelt; Andersson, Patrik L


    The bromophenol 2,4,6-tribromophenol (TBP) is widely used as an industrial chemical, formed by degradation of tetrabromobisphenol-A, and it occurs naturally in marine organisms. Concentrations of TBP in fish have been related to intake via feed, but little is known about effects on fish health...... after oral exposure. In this study, we exposed adult male and female zebrafish (Danio rerio) to TBP via feed in nominal concentrations of 33, 330, and 3300 mu g/g feed (or control feed) for 6 weeks to assess the effects of TBP on reproductive output, gonad morphology, circulatory vitellogenin levels......, and early embryo development. The aim was also to investigate the extent to which TBP was metabolised to 2,4,6-tribromoanisole (IBA) in dietary exposed zebrafish, and the amounts of TBP and TBA found in offspring. After 6 weeks of exposure, we found about 3% of the daily dose of TBP in adult fish...

  16. Structural and spectroscopic parameters of 2,4,6-trimethylbenzamide, using DFT method

    International Nuclear Information System (INIS)

    Catikkas, B.; Karakaya, N.


    Conformational analysis of 2,4,6-Trimethylbenzamide was carried out. The geometric parameters (bond length, bond angle and tortion angle) of the most stable conformer were calculated and the Infrared and Raman frequencies of fundamental modes were determined. All calculations have been made by using the B3LYP / 6-311+G(d,p) method. Calculated values were compared with the experimental ones. All calculations were carried out with the Gaussian03 and GaussView3.0 programs.

  17. Spot test for 1,3,5-triamino-2,4,6-trinitrobenzene, TATB (United States)

    Harris, B.W.


    A simple, sensitive and specific spot test for 1,3,5-triamino-2,4,6-trinitrobenzene, TATB, is described. Upon the application of the composition of matter of the subject invention to samples containing in excess of 0.1 mg of this explosive, a bright orange color results. Interfering species such as TNT and Tetryl can be removed by first treating the sample with a solvent which does not dissolve the TATB, but readily dissolves these interfering explosives.

  18. Development of the small-molecule antiviral ST-246® as a smallpox therapeutic (United States)

    Grosenbach, Douglas W; Jordan, Robert; Hruby, Dennis E


    Naturally occurring smallpox has been eradicated, yet it remains as one of the highest priority pathogens due to its potential as a biological weapon. The majority of the US population would be vulnerable in a smallpox outbreak. SIGA Technologies, Inc. has responded to the call of the US government to develop and supply to the Strategic National Stockpile a smallpox antiviral to be deployed in the event of a smallpox outbreak. ST-246® (tecovirimat) was initially identified via a high-throughput screen in 2002, and in the ensuing years, our drug-development activities have spanned in vitro analysis, preclinical safety, pharmacokinetics and efficacy testing (all according to the ‘animal rule’). Additionally, SIGA has conducted Phase I and II clinical trials to evaluate the safety, tolerability and pharmacokinetics of ST-246, bringing us to our current late stage of clinical development. This article reviews the need for a smallpox therapeutic and our experience in developing ST-246, and provides perspective on the role of a smallpox antiviral during a smallpox public health emergency. PMID:21837250

  19. Contribution of filamentous fungi to the musty odorant 2,4,6-trichloroanisole in water supply reservoirs and associated drinking water treatment plants. (United States)

    Bai, Xiuzhi; Zhang, Ting; Qu, Zhipeng; Li, Haipu; Yang, Zhaoguang


    In this study, the distribution of 2,4,6-trichloroanisole (2,4,6-TCA) in two water supply reservoirs and four associated drinking water treatment plants (DWTPs) were investigated. The 2,4,6-TCA concentrations were in the range of 1.53-2.36 ng L -1 in water supply reservoirs and 0.76-6.58 ng L -1 at DWTPs. To determine the contribution of filamentous fungi to 2,4,6-TCA in a full-scale treatment process, the concentrations of 2,4,6-TCA in raw water, settled water, post-filtration water, and finished water were measured. The results showed that 2,4,6-TCA levels continuously increased until chlorination, suggesting that 2,4,6-TCA could form without a chlorination reaction and fungi might be the major contributor to the 2,4,6-TCA formation. Meanwhile, twenty-nine fungal strains were isolated and identified by morphological and molecular biological methods. Of the seventeen isolated fungal species, eleven showed the capability to convert 2,4,6-trichlorophenol (2,4,6-TCP) to 2,4,6-TCA. The highest level of 2,4,6-TCA formation was carried out by Aspergillus versicolor voucher BJ1-3: 40.5% of the original 2,4,6-TCP was converted to 2,4,6-TCA. There was a significant variation in the capability of different species to generate 2,4,6-TCA. The results from the proportions of cell-free, cell-attached, and cell-bound 2,4,6-TCA suggested that 2,4,6-TCA generated by fungi was mainly distributed in their extracellular environment. In addition to 2,4,6-TCA, five putative volatile by-products were also identified by gas chromatography and mass spectrometry. These findings increase our understanding on the mechanisms involved in the formation of 2,4,6-TCA and provide insights into managing and controlling 2,4,6-TCA-related problems in drinking water. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Evaluation of Orally Delivered ST-246 as Postexposure Prophylactic and Antiviral Therapeutic in an Aerosolized Rabbitpox Rabbit Model

    National Research Council Canada - National Science Library

    Nalca, Aysegul; Hatkin, Josh M; Garza, Nicole L; Nichols, Donald K; Norris, Sarah W; Hruby, Dennis E; Jordan, Robert


    ...) to treat smallpox or monkeypox infection. In this study, we showed that administration of the antiviral compound ST-246 to rabbits by oral gavage, once daily for 14 days beginning 1h postexposure (p.e.), resulted in 100...

  1. In vitro susceptibility to ST-246 and Cidofovir corroborates the phylogenetic separation of Brazilian Vaccinia virus into two clades. (United States)

    Pires, Mariana A; Rodrigues, Nathália F S; de Oliveira, Danilo B; de Assis, Felipe L; Costa, Galileu B; Kroon, Erna G; Mota, Bruno E F


    The Orthopoxvirus (OPV) genus of the Poxviridae family contains several human pathogens, including Vaccinia virus (VACV), which have been implicating in outbreaks of a zoonotic disease called Bovine Vaccinia in Brazil. So far, no approved treatment exists for OPV infections, but ST-246 and Cidofovir (CDV) are now in clinical development. Therefore, the objective of this work was to evaluate the susceptibility of five strains of Brazilian VACV (Br-VACV) to ST-246 and Cidofovir. The susceptibility of these strains to both drugs was evaluated by plaque reduction assay, extracellular virus's quantification in the presence of ST-246 and one-step growth curve in cells treated with CDV. Besides that, the ORFs F13L and E9L were sequenced for searching of polymorphisms associated with drug resistance. The effective concentration of 50% (EC 50 ) from both drugs varies significantly for different strains (from 0.0054 to 0.051 μM for ST-246 and from 27.14 to 61.23 μM for CDV). ST-246 strongly inhibits the production of extracellular virus for all isolates in concentrations as low as 0.1 μM and it was observed a relevant decrease of progeny production for all Br-VACV after CDV treatment. Sequencing of the F13L and E9L ORFs showed that Br-VACV do not present the polymorphism(s) associated with resistance to ST-246 and CDV. Taken together, our results showed that ST-246 and CDV are effective against diverse, wild VACV strains and that the susceptibility of Br-VACV to these drugs mirrored the phylogenetic split of these isolates into two groups. Thus, both ST-246 and CDV are of great interest as compounds to treat individuals during Bovine Vaccinia outbreaks in Brazil. Copyright © 2018 Elsevier B.V. All rights reserved.

  2. Impedance spectroscopy of tripolar concentric ring electrodes with Ten20 and TD246 pastes. (United States)

    Nasrollaholhosseini, Seyed Hadi; Herrera, Daniel Salazar; Besio, Walter G


    Electrodes are used to transform ionic currents to electrical currents in biological systems. Modeling the electrode-electrolyte interface could help to optimize the performance of the electrode interface to achieve higher signal to noise ratios. There are previous reports of accurate models for single-element biomedical electrodes. In this paper, we measured the impedance on both tripolar concentric ring electrodes and standard cup electrodes by electrochemical impedance spectroscopy (EIS) using both Ten20 and TD246 electrode paste. Furthermore, we applied the model to prove that the model can predict the performance of the electrode-electrolyte interface for tripolar concentric ring electrodes (TCRE) that are used to record brain signals.

  3. 2,4,6-Triamino-1,3,5-triazine-1,3-diium aquapentafluoridoaluminate

    Directory of Open Access Journals (Sweden)

    V. Maisonneuve


    Full Text Available The title compound, (C3H8N6[AlF5(H2O], was obtained by solvothermal synthesis from the reaction of aluminium hydroxide, 1,3,5-triazine-2,4,6-triamine (melamine, aqueous HF and water at 323 K for 48 h. The structure consists of [AlF5(H2O]2− octahedra and diprotonated melaminium cations. Cohesion is ensured by a three-dimensional network of hydrogen bonds.

  4. Monoklonale Antikörper zum Nachweis von 2,4,6-Trichloranisol in Kork


    Lausterer, Ralph


    Die Verbindung 2,4,6-Trichloranisol (TCA) kann in Kork und Wein vorkommen. TCA entsteht durch mikrobielle Umsetzung von Chlorphenolen. In den betroffenen Industrien führt TCA zu jährlichen Verlusten von mehr als einer Milliarde €. Zur Bestimmung von TCA sollten enzymkoppelte Immunabsorptionstest (ELISAs) mit monoklonalen Antikörpern (mAk) entwickelt werden. Es wurden drei TCA-spezifische mAk-produzierende Zelllinien gewonnen. Mit diesen mAk wurden hochsensitive ELISAs hergstellt, die eine Nac...

  5. Synthesis of 2,4,6-Trisubstituted Pyridines by Oxidative Eosin Y Photoredox Catalysis. (United States)

    Rohokale, Rajendra S; Koenig, Burkhard; Dhavale, Dilip D


    Eosin Y, an organic dye, was activated as a photoredox catalyst in the presence of molecular oxygen using visible light and, when it was used in the reaction of aryl ketones and benzyl amines, afforded good yields (52-87%) of 2,4,6-triarylpyridines (21 examples) at ambient temperature. The aryl groups at the 2- and 6-positions are derived from ketones, while benzyl amine plays the dual role of providing an aryl functionality at the 4-position of pyridine as well as being a nitrogen donor.

  6. Synthesis of 2,4,6-trichlorophenyl hydrazones and their inhibitory potential against glycation of protein. (United States)

    Khan, Khalid Mohammed; Shah, Zarbad; Ahmad, Viqar Uddin; Khan, Momin; Taha, Muhammad; Rahim, Fazal; Jahan, Humera; Perveen, Shahnaz; Choudhary, M Iqbal


    2,4,6-Trichlorophenyl hydrazones 1-35 were synthesized and their in vitro antiglycation potential was evaluated. Compounds 14 (IC50 = 27.2 ± 0.00 μM), and 18 (IC50 = 55.7 ± 0.00 μM) showed an excellent activity against glycation of protein, better than the standard (rutin, IC50 = 70 ± 0.50 μM). This study thus identified a novel series of antiglycation agents. A structure-activity relationship has been studied, and all the compounds were characterized by spectroscopic techniques.

  7. WE-A-18A-01: TG246 On Patient Dose From Diagnostic Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Supanich, M [Rush University Medical Center, Chicago, IL (United States); Dong, F [The Cleveland Clinic, Solon, OH (United States); Andersson, J [Umea University, Umea (Sweden); Pavlicek, W [Mayo Clinic Arizona, Scottsdale, AZ (United States); Bolch, W [University Florida, Gainesville, FL (United States); Fetterly, K [Mayo Clinic, Rochester, MN (United States)


    Radiation dose from diagnostic and interventional radiations continues to be a focus of the regulatory, accreditation and standards organizations in the US and Europe. A Joint AAPM/EFOMP effort has been underway in the past year — having the goal to assist the clinical medical physicist with communicating optional and varied approaches in estimating (and validating) patient dose. In particular, the tools provided by DICOM Radiation Dose Structured Reports, either by themselves or as part of a networked data repository of dose related information are a rich source of actionable information. The tools of the medical physicist have evolved to include using DICOM data in meaningful ways to look at patient dose with respect to imaging practices. In addition to how accurate or reproducible a dose value is (totally necessary and our traditional workspace) it is now being asked how reproducible (patient to patient, device to device) are the delivered doses (new tasking)? Clinical medical physicists are best equipped to assist our radiology and technologist colleagues with this effort. The purpose of this session is to review the efforts of TG246 - bringing forward a summary content of the TG246 Report including specific dose descriptors for CT and Fluoroscopy — particularly in a focus of leveraging the RDSR as a means for monitoring good practices ALARA. Additionally, rapidly evolving technologies for more refined dose estimates are now in use. These will be presented as they look to having highly patient specific dose estimates in automated use.

  8. Concentrations of organochlorine pesticides and 2,4,6-trichloroanisole in cork bark. (United States)

    Olivella, M Àngels; Caixach, Josep; Planas, Carles; Oliveras, Anna; Jové, Patrícia


    Organochlorine pesticides are persistent lipophilic organic pollutants and tend to accumulate in growing plants. During growth, cork is in contact with the open air for long periods (9-12 years). Owing to the previous widespread use of organochlorine pesticides and their high persistence in the environment, there is a risk that residues of such pesticides may be present in cork. In this study, the concentrations of 14 organochlorine pesticides-all of which are indicators of environmental pollution-were analyzed in cork bark samples from three regions in Spain and one in Portugal. In addition, the concentrations of 2,4,6-trichlorophenol (TCP) and 2,4,6-trichloroanisole (TCA) were also analyzed. Our results show only very low concentrations of lindane, γ-HCH (cork sample from Extremadura (0.1 ng g(-1)) and p,p'-DDE was present at a maximum concentration of 2.9 ng g(-1) in a cork sample from Castile-La Mancha. However, all concentrations were well below the legal limit established by Regulation (EC) No. 396/2005 (10 ng g(-1) in foodstuffs). We can conclude, therefore, that the cork samples we studied complied with food safety standards. Copyright © 2011 Elsevier Ltd. All rights reserved.

  9. Brominated dioxins/furans and hydroxylated polybrominated diphenyl ethers: Occurrences in commercial 1,2-bis(2,4,6-tribromophenoxy)ethane (BTBPE) and 2,4,6-tribromophenol, and formation during synthesis of BTBPE. (United States)

    Ren, Man; Zeng, Hao; Peng, Ping-An; Li, Hui-Ru; Tang, Cai-Ming; Hu, Jian-Fang


    Polybrominated dibenzo-p-dioxins (PBDDs) and hydroxylated polybrominated diphenyl ethers (OH-PBDEs) can be formed from bromophenols (BPs) by thermal degradation, biosynthesis or phototransformation. However, it is unknown whether PBDDs and OH-PBDEs can be formed during the chemical production processes that utilize BPs as raw materials. 2,4,6-tribromophenol (2,4,6-TBP) is an important raw material for the synthesis of 1,2-bis(2,4,6-tribromophenoxy)ethane (BTBPE), a novel brominated flame retardant. In this study, PBDDs, polybrominated dibenzofurans (PBDFs) and OH-PBDEs have been identified and quantified in commercially available BTBPE and 2,4,6-TBP. Furthermore, their formation as unintentional by-products during the laboratory synthesis of BTBPE from 2,4,6-TBP and 1,2-dibromoethane in the presence of sodium carbonate has also been investigated. 2,3,7,8-substituted PBDDs and PBDFs (2,3,7,8-PBDD/Fs) were undetectable in commercial samples of BTBPE and present in low levels (nanogram per gram) in 2,4,6-TBP. Two tetrabrominated dibenzo-p-dioxins (TeBDDs), namely 1,3,6,8- and 1,3,7,9-TeBDD, and three hydroxylated pentabrominated diphenyl ethers (OH-pentaBDEs), namely 4'-OH-BDE121, 2'-OH-BDE121, and 6'-OH-BDE100, were identified or tentatively identified, and quantitatively estimated to be at concentrations in the range of undetectable to several thousands of nanograms per gram in commercial BTBPE and 2,4,6-TBP. TeBDDs and OH-pentaBDEs were formed as by-products from 2,4,6-TBP during BTBPE synthesis. Further studies need to be conducted in order to determine whether PBDD/Fs and OH-PBDEs are also formed during the industrial synthesis of other chemical compounds that utilize BPs as raw materials or intermediates. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Reliability of optical fibres and components final report of COST 246

    CERN Document Server

    Griffioen, Willem; Gadonna, Michel; Limberger, Hans; Heens, Bernard; Knuuttila, Hanna; Kurkjian, Charles; Mirza, Shehzad; Opacic, Aleksandar; Regio, Paola; Semjonov, Sergei


    Reliability of Optical Fibres and Components reports the findings of COST 246 (1993-1998) - European research initiative in the field of optical telecommunications. Experts in the materials and reliability field of optical fibres and components have contributed to this unique study programme. The results, conclusions and achievements of their work have been obtained through joint experimentation and discussion with representatives from manufacturing and research groups. Topics covered include: Lifetime estimation; Failure mechanisms; Ageing test methods; Field data and service environments for components. For the first time the reader can explore the reliability of products and examine the results and conclusions in published form. This comprehensive volume is intended to provide a deeper understanding of the reliability of optical fibres and components. The book will be extremely useful to all scientists and practitioners involved in the industry.

  11. Adsorption of 2,4,6-trinitrotoluene on carboxylated porous polystyrene microspheres

    International Nuclear Information System (INIS)

    Ye Zhengfang; Meng Qingqiang; Lu Shengtao


    Large-pore-size (150 nm) polystyrene (PSt) microspheres were carboxylated with phthalic anhydride (PA) through Friedel-Crafts acetylation to study the adsorption of 2,4,6-trinitrotoluene (TNT) on this material from aqueous solution. The scanning electron microscope (SEM) images and mercury porosimetry measurements (MPM) of the microspheres showed that the pore structure was unchanged during the reaction. High adsorption capacity (11.2 mg g -1 of suction-dried adsorbent) and adsorption rate (33.9 mg g -1 h -1 ) for TNT were observed during the study. As shown by the adsorption isotherm, the adsorption of TNT on PA-PSt can be described by the Freundlich adsorption equation, indicating heterogeneous adsorption process. On-column adsorption of TNT on PA-PSt and elution indicated that TNT can be completely removed from aqueous solution and condensed into acetone.

  12. Towards the island of superheavy stability - Prompt spectroscopy of 246Fm and 256Rf nuclei

    International Nuclear Information System (INIS)

    Piot, J.


    The region of trans-fermium nuclei (Z = 100 to 104) is the last region of the nuclides chart to be accessible to spectroscopic measurements. It therefore provides the ultimate anchor points for nuclear models. This region also lies on the path of the alpha-decay chains of the super-heavy elements. This region represents the limit of today's spectroscopic capabilities. It therefore requires technological developments in order to overcome these limits. My thesis focuses on various aspects of the spectroscopy of trans-fermium nuclei. I took part in the development of the TNT2D digital acquisition cards for germanium detectors. I validated their use on the gamma-ray spectrometer JUROGAM during an in-beam experiment and demonstrated the gain compared to an analogue acquisition system. These tests were part of the developments needed to secure a study of the prompt spectroscopy of 256 Rf. The preparation of this experiment also lead me to work on the development of a 50 Ti beam. For that purpose, I studied and tested the use of titanium organo-metallic compounds compatible with the MIVOC technique. In parallel, I studied the use of metallic and oxide titanium pellets with an inductive oven newly developed at the University of Jyvaeskylae. In addition to these developments, I had the opportunity to study the in-beam prompt spectroscopy of 246 Fm at the University of Jyvaeskylae. The measurements yielded a rotational band built on the ground state of 246 Fm. This band has been observed up to the level 16 + and shows a behaviour quite similar to the neighbouring even-even isotopes, except for the top of the band for which a wider statistics is necessary in order to conclude. (author)

  13. A spatio-kinematic study of the interaction of the planetary nebula NGC 246 with the interstellar medium

    NARCIS (Netherlands)

    Muthu, C; Anandarao, BG; Pottasch, [No Value

    Spatio-Kinematic observations were made on NGC 246 in the [OIII] 5007 Angstrom line using an Imaging Fabry-Perot Spectrometer. Evidence for the deceleration effect was found in the leading edge of the nebular shell, possibly due to its interaction with the interstellar medium. Further, we show that

  14. Preparation and characterization of molecularly-imprinted magnetic microspheres for adsorption of 2,4,6-trichlorophenol from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Ping; Pan, Jianming; Yan, Yongsheng [Jiangsu University, Zhenjiang (China); Sun, Qilong; Li, Jianfeng; Tan, Zhenjiang [Jilin Normal University, Siping (China)


    Magnetic molecularly imprinted microspheres (MMIS) were successfully prepared by suspension polymerization, and then as-prepared MMIS were used as adsorbents for selective recognition of 2,4,6-trichlorophenol (2,4,6-TCP) from aqueous solutions. The results composites were characterized by Fourier transform infrared (FT-IR), X-ray diffraction (XRD), thermo gravimetric analysis (TGA), scanning electron microscope (SEM) and vibrating sample magnetometer (VSM). The results demonstrated that MMIS possesses porous spherical morphology, and exhibits good thermal stability and magnetic property (Ms=10.14 emu g{sup -1}). Then batch mode of binding experiments was used to determine the equilibrium, kinetics and selectivity recognition. The Langmuir isotherm model fitted the equilibrium data better than did the Freundlich model, and the maximum adsorption capacity on MMIS was about 1.7 times higher than that of MNIS. Kinetics behaviors of MMIS were well described by the pseudo-second-order model. MMIS possessed outstanding selectivity recognition for 2,4,6-TCP in the presence of other competitive phenols (such as sesamol, 3-CP, thymol, 2,4-DCP). Furthermore, the reusability performance of MMIS showed about 17.53% loss after five repeated cycles. Finally, the MMIS were successfully applied to the selective extraction of 2,4,6-TCP from the vegetable samples.

  15. 40 CFR 721.5356 - Ethanol, 2,2′2″-nitrilotris-, compound with alpha-2,4,6-tris (1-phenylethyl)phenyl]-omega... (United States)


    ...-, compound with alpha-2,4,6-tris (1-phenylethyl)phenyl]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate. 721...]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate. (a) Chemical substance and significant new uses... alpha-[2,4,6-tris(1-phenylethyl)phenyl]-omega-hydroxypoly (oxy-1,2-ethanediyl) phosphate (PMN P-98-185...

  16. Z dependence of the N=152 deformed shell gap: In-beam γ-ray spectroscopy of neutron-rich 245,246Pu

    International Nuclear Information System (INIS)

    Makii, H.; Ishii, T.; Asai, M.; Tsukada, K.; Toyoshima, A.; Ichikawa, S.; Matsuda, M.; Makishima, A.; Kaneko, J.; Toume, H.; Shigematsu, S.; Kohno, T.; Ogawa, M.


    We have measured in-beam γ rays in the neutron-rich 246 Pu 152 and 245 Pu 151 nuclei by means of 244 Pu( 18 O, 16 O) 246 Pu and 244 Pu( 18 O, 17 O) 245 Pu neutron transfer reactions, respectively. The γ rays emitted from 246 Pu ( 245 Pu) were identified by selecting the kinetic energy of scattered 16 O ( 17 O) detected by Si ΔE-E detectors. The ground-state band of 246 Pu was established up to the 12 + state. We have found that the shell gap of N=152 is reduced in energy with decreasing atomic number by extending the systematics of the one-quasiparticle energies in N=151 nuclei into those in 245 Pu. This reduction of the shell gap clearly affects the 2 + energy of the ground-state band of 246 Pu

  17. Visual detection of 2,4,6-trinitrotolune by molecularly imprinted colloidal array photonic crystal

    International Nuclear Information System (INIS)

    Lu, Wei; Asher, Sanford A.; Meng, Zihui; Yan, Zequn; Xue, Min; Qiu, Lili; Yi, Da


    Graphical abstract: Molecularly imprinted colloidal array (MICA) was explored for the selective visual detection of TNT with color changing from green to red. And molecularly imprinted colloidal particles (MICs) were evaluated for the adsorption capacity and the imprinting efficiency. The MICA had excellent flexibility, reversibility and stability. It promised high potential for the visual semi-quantitative detection of other explosives. - Highlights: • Molecularly imprinted colloidal array (MICA) was used to visually detect TNT. • The relationship of particle size, diffracted wavelength and color was discussed. • The adsorption capacity and imprinting efficiency of MICs were calculated. • MICA had short response time, high selectivity, good reversibility and stability. • MICA had high potential to be used in other customed visual explosive detection. - Abstract: We developed a photonic crystal (PhC) sensor for the quantification of 2,4,6-trinitrotoluene (TNT) in solution. Monodisperse (210 nm in diameter) molecularly imprinted colloidal particles (MICs) for TNT were prepared by the emulsion polymerization of methyl methacrylate and acrylamide in the presence of TNT as a template. The MICs were then self-assembled into close-packed opal PhC films. The adsorption capacity of the MICs for TNT was 64 mg TNT/g. The diffraction from the PhC depended on the TNT concentration in a methanol/water (3/2, v/v) potassium dihydrogen phosphate buffer solution (pH = 7.0, 30 mM). The limit of detection (LOD) of the sensor was 1.03 μg. The color of the molecularly imprinted colloidal array (MICA) changed from green to red with an 84 nm diffraction red shift when the TNT concentration increased to 20 mM. The sensor response time was 3 min. The PhC sensor was selective for TNT compared to similar compounds such as 2,4,6-trinitrophenol, 2,4-dinitrotoluene, 2,6-dinitrotoluene, 2-nitromesitylene, 4-nitrotoluene, 2-nitrotoluene, 1,3-dinitrobenzene, methylbenzene, 4-nitrophenol

  18. Visual detection of 2,4,6-trinitrotolune by molecularly imprinted colloidal array photonic crystal

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Wei [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Asher, Sanford A., E-mail: [Department of Chemistry, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Meng, Zihui, E-mail: [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Yan, Zequn [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Xue, Min, E-mail: [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Qiu, Lili, E-mail: [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China); Yi, Da [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing, 100081 (China)


    Graphical abstract: Molecularly imprinted colloidal array (MICA) was explored for the selective visual detection of TNT with color changing from green to red. And molecularly imprinted colloidal particles (MICs) were evaluated for the adsorption capacity and the imprinting efficiency. The MICA had excellent flexibility, reversibility and stability. It promised high potential for the visual semi-quantitative detection of other explosives. - Highlights: • Molecularly imprinted colloidal array (MICA) was used to visually detect TNT. • The relationship of particle size, diffracted wavelength and color was discussed. • The adsorption capacity and imprinting efficiency of MICs were calculated. • MICA had short response time, high selectivity, good reversibility and stability. • MICA had high potential to be used in other customed visual explosive detection. - Abstract: We developed a photonic crystal (PhC) sensor for the quantification of 2,4,6-trinitrotoluene (TNT) in solution. Monodisperse (210 nm in diameter) molecularly imprinted colloidal particles (MICs) for TNT were prepared by the emulsion polymerization of methyl methacrylate and acrylamide in the presence of TNT as a template. The MICs were then self-assembled into close-packed opal PhC films. The adsorption capacity of the MICs for TNT was 64 mg TNT/g. The diffraction from the PhC depended on the TNT concentration in a methanol/water (3/2, v/v) potassium dihydrogen phosphate buffer solution (pH = 7.0, 30 mM). The limit of detection (LOD) of the sensor was 1.03 μg. The color of the molecularly imprinted colloidal array (MICA) changed from green to red with an 84 nm diffraction red shift when the TNT concentration increased to 20 mM. The sensor response time was 3 min. The PhC sensor was selective for TNT compared to similar compounds such as 2,4,6-trinitrophenol, 2,4-dinitrotoluene, 2,6-dinitrotoluene, 2-nitromesitylene, 4-nitrotoluene, 2-nitrotoluene, 1,3-dinitrobenzene, methylbenzene, 4-nitrophenol

  19. Characteristic of metallic state preperties of mendelevium and other actinoids by thermochcomatography

    International Nuclear Information System (INIS)

    Hubener, S.; Zvara, I.


    The adsorption of the heavy actinoids Cf, Es, Fm, and Md on polycrystalline titanium and molybdenum has been studied by thermochromatography in comparison with several well-known metallic elements, in trace amounts. The data lead us to suggest that Es, Fm, and Md are divalent in the metallic state and, moreover, that the position of their f energy levels relativg to the Fermi-energy is lower than in the cases of Cf and Yb. A correlation was found between the experimental enthalpies of adsorption of the heavy actinoids and their predicted enthalpies of sublimation

  20. Evaluation of the cardiovascular system by digital subtraction angiography in 246 patients

    Energy Technology Data Exchange (ETDEWEB)

    Higuma, Kikuhiko; Ohta, Takashi; Hiroto, Seiji


    Usefulness of intravenous digital subtraction angiography (DSA) was examined in 246 patients with cardiovascular disorders. This examination was done by centrally intravenous DSA (CIVDSA) in all patients to reduce the risks and discomforts by peripheral intravenous DSA. 1) CIVDSA could be done safely in patients aged 18 to 81 years. 2) The good diagnostic quality by CIVDSA was obtained in 81.3% of patients. These images were classified into 7 groups according to the cardiovascular system, that is, the jugular arteries, the upper extremity arteries, the thoracic aorta, the left ventricle, the abnominal aorta, the renal arteries, and the lower extremity arteries, whose rate of good diagnostic quality were 100%, 70%, 67.7%, 79.5%, 84.8%, 87%, and 71.4% respectively. 3) The poor diagnostic quality was obtained in 18.7%. 4) The severe complications were not found in any case during this examination. Our results indicate that DSA is the safe, simple and useful method to obtain the diagnostic quality image of the cardiovascular system, especially, of the occulsive arterial disease, the aortic aneurisma, the renovascular stenosis and the cardiac function of postmyocardial infarction, even in aged patients.

  1. Evaluation of the cardiovascular system by digital subtraction angiography in 246 patients

    International Nuclear Information System (INIS)

    Higuma, Kikuhiko; Ohta, Takashi; Hiroto, Seiji


    Usefulness of intravenous digital subtraction angiography (DSA) was examined in 246 patients with cardiovascular disorders. This examination was done by centrally intravenous DSA (CIVDSA) in all patients to reduce the risks and discomforts by peripheral intravenous DSA. 1) CIVDSA could be done safely in patients aged 18 to 81 years. 2) The good diagnostic quality by CIVDSA was obtained in 81.3 % of patients. These images were classified into 7 groups according to the cardiovascular system, that is, the jugular arteries, the upper extremity arteries, the thoracic aorta, the left ventricle, the abnominal aorta, the renal arteries, and the lower extremity arteries, whose rate of good diagnostic quality were 100 %, 70 %, 67.7 %, 79.5 %, 84.8 %, 87 %, and 71.4 % respectively. 3) The poor diagnostic quality was obtained in 18.7 %. 4) The severe complications were not found in any case during this examination. Our results indicate that DSA is the safe, simple and useful method to obtain the diagnostic quality image of the cardiovascular system, especially, of the occulsive arterial disease, the aortic aneurisma, the renovascular stenosis and the cardiac function of postmyocardial infarction, even in aged patients. (author)

  2. Degradation of 2,4,6-trinitrotoluene by P. aeruginosa and characterization of some metabolites

    Directory of Open Access Journals (Sweden)

    Hatice Aysun Mercimek


    Full Text Available Degradation of 2,4,6-trinitrotoluene (TNT, a nitroaromatic explosive found in the soil and ground water, was investigated using Pseudomonas aeruginosa in in vitroexperiments. Biodegradable abilitiy of this bacteria was performed with 50 and 75 mg L−1 TNT concentrations in a defined liquid medium for 96 h time period. Treatment of TNT in supernatant samples taken at 0, 6, 12, 24, 48, 72 and 96 h from agitated vessels was followed by reverse-phase high-performance liquid chromatography (HPLC. In cultures supplemented with 50 and 75 mgL−1 TNT, after 96 h of incubation 46% and 59% reduction were detected respectively. Two metabolites as degradation intermediates with nitrite release into the medium, 2,4-dinitrotoluene (2,4-DNT and 4-aminodinitrotoluene (4-ADNT, were elucidated by thin layer chromatography (TLC and gas chromatography-mass spectrometry (GC-MS. These findings clearly indicate that Pseudomonas aeruginosa can be used in bioremediation of TNT contaminated sites.

  3. Phototransformation of 2,4,6-trinitrotoluene: Sensitized by riboflavin under different irradiation spectral range

    International Nuclear Information System (INIS)

    Yang Xin; Zhao Xueheng; Hwang, H.-M.


    Riboflavin-sensitized phototransformation of 2,4,6-trinitrotoluene (TNT) under natural sunlight was investigated with reverse-phase high performance liquid chromatography/mass spectrometry (HPLC/MS) and gas chromatography/mass spectrometry (GC/MS). The effect of different spectral region of sunlight on TNT phototransformation in the absence or presence of riboflavin was also investigated by using optical filters with cut-off at 400 or 455 nm. The concentration of riboflavin in the phototransformation of TNT was optimized. Concentration of riboflavin and TNT was 1.0 and 50 μM, respectively. The rates of phototransformation of TNT under natural sunlight in the presence or absence of riboflavin were conformed to initial pseudo-first-order rate equation. The photolysis half life of TNT in the presence of riboflavin was 21.87 min, compared to 39 min in the absence of riboflavin under natural sunlight. Two major phototransformation products of TNT, 3,5-dinitroaniline (3,5-DNA) and 1,3,5-trinitrobenzene (1,3,5-TNB), were detected in the samples in the presence of riboflavin receiving irradiation at full wavelength or wavelength >400 nm. The results indicate that riboflavin mediates TNT sensitized-phototransfomation under natural sunlight or near-UV-vis light

  4. Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides

    International Nuclear Information System (INIS)

    Makris, Konstantinos C.; Shakya, Kabindra M.; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand


    The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g -1 ), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media

  5. 2,4,6-Trichlorophenylhydrazine Schiff bases as DPPH radical and super oxide anion scavengers. (United States)

    Khan, Khalid Mohammed; Shah, Zarbad; Ahmad, Viqar Uddin; Khan, Momin; Taha, Muhammad; Rahim, Fazal; Ali, Sajjad; Ambreen, Nida; Perveen, Shahnaz; Choudhary, M Iqbal; Voelter, Wolfgang


    Syntheses of thirty 2,4,6-trichlorophenylhydrazine Schiff bases 1-30 were carried out and evaluated for their in vitro DPPH radical and super oxide anion scavenging activities. Compounds 1-30 have shown a varying degree of DPPH radical scavenging activity and their IC50 values range between 4.05-369.30 µM. The compounds 17, 28, 18, 14, 8, 15, 12, 2, 29, and 7 exhibited IC50 values ranging between 4.05±0.06-24.42±0.86 µM which are superior to standard n-propylgallate (IC50=30.12±0.27 µM). Selected compounds have shown a varying degree of superoxide anion radical scavenger activity and their IC50 values range between 91.23-406.90 µM. The compounds 28, 8, 17, 15, and 14, showed IC50 values between 91.23±1.2-105.31±2.29 µM which are superior to standard n-propylgallate (IC50=106.34±1.6 µM).

  6. High uptake of 2,4,6-trinitrotoluene by vetiver grass - Potential for phytoremediation?

    International Nuclear Information System (INIS)

    Makris, Konstantinos C.; Shakya, Kabindra M.; Datta, Rupali; Sarkar, Dibyendu; Pachanoor, Devanand


    2,4,6-Trinitrotoluene (TNT) is a potent mutagen, and a Group C human carcinogen that has been widely used to produce munitions and explosives. Vast areas that have been previously used as ranges, munition burning, and open detonation sites are heavily contaminated with TNT. Conventional remediation activities in such sites are expensive and damaging to the ecosystem. Phytoremediation offers a cost-effective, environment-friendly solution, utilizing plants to extract TNT from contaminated soil. We investigated the potential use of vetiver grass (Vetiveria zizanioides) to effectively remove TNT from contaminated solutions. Vetiver grass plants were grown in hydroponic systems containing 40 mg TNT L -1 for 8 d. Aqueous concentrations of TNT reached the method detection limit (∼1 μg L -1 ) within the 8-d period, demonstrating high affinity of vetiver for TNT, without any visible toxic effects. Results from this preliminary hydroponic study are encouraging, but in need of verification using TNT-contaminated soils. - Vetiver grass demonstrates ability to absorb TNT in aqueous media

  7. Chemically catalyzed uptake of 2,4,6-trinitrotoluene by Vetiveria zizanioides

    Energy Technology Data Exchange (ETDEWEB)

    Makris, Konstantinos C. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Shakya, Kabindra M. [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Datta, Rupali [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Sarkar, Dibyendu [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)]. E-mail:; Pachanoor, Devanand [Environmental Geochemistry Laboratory, Department of Earth and Environmental Science, College of Sciences, University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States)


    The efficiency of vetiver grass (Vetiveria zizanioides) in removing 2,4,6-trinitrotoluene (TNT) from aqueous media was explored in the presence of a common agrochemical, urea, used as a chaotropic agent. Chaotropic agents disrupt water structure, increasing solubilization of hydrophobic compounds (TNT), thus, enhancing plant TNT uptake. The primary objectives of this study were to: (i) characterize TNT absorption by vetiver in hydroponic media, and (ii) determine the effect of urea on chemically catalyzing TNT uptake by vetiver grass in hydroponic media. Results showed that vetiver exhibited a high TNT uptake capacity (1.026 mg g{sup -1}), but kinetics were slow. Uptake was considerably enhanced in the presence of urea, which significantly (p<0.001) increased the 2nd-order reaction rate constant over that of the untreated (no urea) control. Three major TNT metabolites were detected in the roots, but not in the shoot, namely 1,3,5-trinitrobenzene, 4-amino 2,6-dinitrotoluene, and 2-amino 4,6-dinitrotoluene, indicating TNT degradation by vetiver grass. - A common agrochemical, urea catalyzes TNT removal by vetiver grass in aqueous media.

  8. Hybrid treatment strategies for 2,4,6-trichlorophenol degradation based on combination of hydrodynamic cavitation and AOPs. (United States)

    Barik, Arati J; Gogate, Parag R


    Utilization of hybrid treatment schemes involving advanced oxidation processes and hydrodynamic cavitation in the wastewater treatment forms the prime focus of the present work. The initial phase of the work includes analysis of recent literature relating to the performance of combined approach based on hydrodynamic cavitation (HC) for degradation of different pollutants followed by a detailed investigation into degradation of 2,4,6-trichlorophenol (2,4,6-TCP). The degradation of the priority pollutant, 2,4,6-TCP, using combination of HC based on slit-venturi used as the cavitating device, ozone and H 2 O 2 has been investigated. The effect of operating pressure (2-5bar) and initial pH (3-11) have been investigated for the degradation using only HC. The degradation using only ozone (100-400mg/h) and only H 2 O 2 has also been studied. The efficacy of the combined operation of HC+O 3 at different ozone flow rates (100-400mg/h) and the combined operation of HC+H 2 O 2 at different loadings of H 2 O 2 (2,4,6-TCP:H 2 O 2 as 1:1-1:7) have been subsequently investigated. The degradation efficacy has also been established for the combined treatment strategies of O 3 +H 2 O 2 and HC+O 3 +H 2 O 2 at the optimum conditions of temperature as 30°C, inlet pressure of 4bar and initial pH of 7. Extent of 2,4,6-TCP degradation, TOC and COD removal obtained for HC+O 3 process were 97.1%, 94.4% and 78.5% respectively whereas for O 3 +H 2 O 2 process, the values were 95.5%, 94.8% and 76.2% and for HC+O 3 +H 2 O 2 process the extent of reduction were 100%, 95.6% and 80.9% in the same order. The combined treatment approach as HC+O 3 +H 2 O 2 was established as the most efficient approach for complete removal of 2,4,6-TCP with near complete TOC removal. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Cyclic voltammetry: a tool to quantify 2,4,6-trichloroanisole in aqueous samples from cork planks boiling industrial process. (United States)

    Peres, António M; Freitas, Patrícia; Dias, Luís G; Sousa, Mara E B C; Castro, Luís M; Veloso, Ana C A


    Chloroanisoles, namely 2,4,6-trichloroanisole, are pointed out as the primary responsible of the development of musty off-flavours in bottled wine, due to their migration from cork stoppers, which results in huge economical losses for wine industry. A prevention step is the detection of these compounds in cork planks before stoppers are produced. Mass spectrometry gas chromatography is the reference method used although it is far beyond economical possibilities of the majority of cork stoppers producers. In this work, a portable cyclic voltammetry approach was used to detect 2,4,6-trichloroanisole extracted from natural cork planks to the aqueous phase during the cork boiling industrial treatment process. Analyses were carried out under ambient conditions, in less than 15 min with a low use of solvent and without any sample pre-treatment. The proposed technique had detection (0.31±0.01 ng/L) and quantification (0.95±0.05 ng/L) limits lower than the human threshold detection level. For blank solutions, without 2,4,6-trichloroanisole addition, a concentration in the order of the quantification limit was estimated (1.0±0.2 ng/L), which confirms the satisfactory performance of the proposed methodology. For aqueous samples from the industrial cork planks boiling procedure, intra-day repeatabilities were lower than 3%, respectively. Also, 2,4,6-trichloroanisole contents in the aqueous samples determined by this novel approach were in good agreement with those obtained by GC-MS (correlation coefficient equal to 0.98), confirming the satisfactory accuracy of the proposed methodology. So, since this novel approach is a fast, low-cost, portable and user-friendly method, it can be an alternative and helpful tool for in-situ industrial applications, allowing accurate detection of releasable 2,4,6-trichloroanisole in an earlier phase of cork stoppers production, which may allow implementing more effective cork treatments to reduce or avoid future 2,4,6-trichloroanisole

  10. PBCDD/F formation from radical/radical cross-condensation of 2-Chlorophenoxy with 2-Bromophenoxy, 2,4-Dichlorophenoxy with 2,4-Dibromophenoxy, and 2,4,6-Trichlorophenoxy with 2,4,6-Tribromophenoxy

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Xiangli [Environment Research Institute, Shandong University, Jinan 250100 (China); Yu, Wanni [Environment Research Institute, Shandong University, Jinan 250100 (China); College of Resources and Environment, Linyi University, Linyi 276000 (China); Xu, Fei [Environment Research Institute, Shandong University, Jinan 250100 (China); Zhang, Qingzhu, E-mail: [Environment Research Institute, Shandong University, Jinan 250100 (China); Hu, Jingtian; Wang, Wenxing [Environment Research Institute, Shandong University, Jinan 250100 (China)


    Highlights: • We studied the formation of PBCDD/Fs from the reaction of three CPRs with BPRs. • The substitution pattern of halogenated phenols determines those of PBCDD/Fs. • The substitution of halogenated phenols influence the coupling of phenoxy radicals. • The rate constants of the crucial elementary steps were evaluated. - Abstract: Quantum chemical calculations were carried out to investigate the homogeneous gas-phase formation of mixed polybrominated/chlorinated dibenzo-p-dioxins/benzofurans (PBCDD/Fs) from the cross-condensation of 2-chlorophenoxy radical (2-CPR) with 2-bromophenoxy radical (2-BPR), 2,4-dichlorophenoxy radical (2,4-DCPR) with 2,4-dibromophenoxy radical (2,4-DBPR), and 2,4,6-trichlorophenoxy radical (2,4,6-TCPR) with 2,4,6-tribromophenoxy radical (2,4,6-TBPR). The geometrical parameters and vibrational frequencies were calculated at the MPWB1K/6-31+G(d,p) level, and single-point energy calculations were performed at the MPWB1K/6-311+G(3df,2p) level of theory. The rate constants of the crucial elementary reactions were evaluated by the canonical variational transition-state (CVT) theory with the small curvature tunneling (SCT) correction over a wide temperature range of 600–1200 K. Studies show that the substitution pattern of halogenated phenols not only determines the substitution pattern of the resulting PBCDD/Fs, but also has a significant influence on the formation mechanism of PBCDD/Fs, especially on the coupling of the halogenated phenoxy radicals.

  11. Highly sensitive detection of 2,4,6-trichlorophenol based on HS-β-cyclodextrin/gold nanoparticles composites modified indium tin oxide electrode

    International Nuclear Information System (INIS)

    Zheng, Xiangli; Liu, Shan; Hua, Xiaoxia; Xia, Fangquan; Tian, Dong; Zhou, Changli


    Graphical abstract: Display Omitted -- Highlights: •A novel electrochemical sensing platform by self-assembling of HS-β-cyclodextrin/gold nanoparticles onto indium tin oxide electrode (HS-β-CD/AuNPs/SAM/ITO electrode) surface was constructed. •The proposed electrochemical sensor exhibited high sensitivity for the determination 2,4,6-trichlorophenol which electrochemical activity is very weak. •The newly developed method was successfully applied to quantitatively determine 2,4,6-trichlorophenol in tap water samples. -- ABSTRACT: A new electrochemical sensor for determination of 2,4,6-trichlorophenol (2,4,6-TCP) was fabricated. The characterization of the sensor was studied by scanning electron microscopy, electrochemical impedance spectroscopy and cyclic voltammetry techniques. The electrochemical behavior of 2,4,6-TCP was investigated using cyclic voltammetry and differential pulse voltammetry at the HS-β-cyclodextrin (HS-β-CD)/gold nanoparticles (AuNPs) composite modified indium tin oxide (ITO) electrode. The results showed that the current responses of 2,4,6-TCP greatly enhanced due to the high catalytic activity and enrichment capability of composites. The peak current of 2,4,6-TCP increases linearly with the increase of the 2,4,6-TCP concentration from 3.0 × 10 −9 to 2.8 × 10 −8 M, with the limit of detection of 1.0 × 10 −9 . Further more, the modified electrode was successfully applied to detect the level of 2,4,6-TCP in tap water samples with excellent sensitivity

  12. The statistical model calculation of prompt neutron spectra from spontaneous fission of {sup 244}Cm and {sup 246}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)


    The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)

  13. Solid-state structural properties of 2,4,6-trimethoxybenzene derivatives, determined directly from powder X-ray diffraction data in conjunction with other techniques

    International Nuclear Information System (INIS)

    Pan Zhigang; Xu Mingcan; Cheung, Eugene Y.; Platts, James A.; Harris, Kenneth D.M.; Constable, Edwin C.; Housecroft, Catherine E.


    Structural properties of 2,4,6-trimethoxybenzaldehyde, 2,4,6-trimethoxybenzyl alcohol and 2,4,6-trimethoxyacetophenone have been determined directly from powder X-ray diffraction data, using the direct-space Genetic Algorithm (GA) technique for structure solution followed by Rietveld refinement. Structural similarities and contrasts within this family of materials are elucidated. The work illustrates the value of utilizing information from other sources, including spectroscopic data and computational techniques, as a means of augmenting the structural knowledge established from the powder X-ray diffraction data

  14. The (p→,t) reaction on 58Ni and 56Fe at 24.6 MeV

    International Nuclear Information System (INIS)

    Polane, J.H.; Feix, W.F.; Hall, P.J. van; Klein, S.S.; Nijgh, G.J.; Poppema, O.J.; Wassenaar, S.D.


    The (p, t) reactions on 56 Fe and 58 Ni initiated by 24.6 MeV polarised protons has been investigated. The reaction process is described in terms of simultaneous and sequential neutron transfer. For all five final states studied the sequential process competes strongly with simultaneous transfer of a neutron pair. Theoretical values for the spectroscopic amplitudes were derived from shell-model wavefunctions; these seem to give a reliable description of the reaction process. (author)

  15. (N,N,N′,N′-Tetramethylethylenediamine-κNbis(2,4,6-trimethylphenolato-κOgermanium(II

    Directory of Open Access Journals (Sweden)

    Eduard Rusanov


    Full Text Available In the title compound, [Ge(C9H11O2(C6H16N2], the GeII atom is coordinated in a distorted trigonal–pyramidal geometry by two O atoms belonging to two 2,4,6-trimethylphenolate ligands and one N atom of a tetramethylethylenediamine ligand. Comparing the structure with published data of similar compounds shows that the Ge—O bonds are covalent and the Ge—N bond is coordinated.

  16. Immune responses to the smallpox vaccine given in combination with ST-246, a small-molecule inhibitor of poxvirus dissemination


    Grosenbach, Douglas W.; Jordan, Robert; King, David S.; Berhanu, Aklile; Warren, Travis K.; Kirkwood-Watts, Dana L.; Tyavanagimatt, Shanthakumar; Tan, Ying; Wilson, Rebecca L.; Jones, Kevin F.; Hruby, Dennis E.


    The re-emerging threat of smallpox and the emerging threat of monkeypox highlight the need for effective poxvirus countermeasures. Currently approved smallpox vaccines have unacceptable safety profiles and, consequently, the general populace is no longer vaccinated, leading to an increasingly susceptible population. ST-246, a small-molecule inhibitor of poxvirus dissemination, has been demonstrated in various animal models to be safe and effective in preventing poxviral disease. This suggests...

  17. Removal of 2,4,6-trichlorophenol from a solution by humic acids repeatedly extracted from a peat soil

    International Nuclear Information System (INIS)

    Tzou, Y.-M.; Wang, S.-L.; Liu, J.-C.; Huang, Y.-Y.; Chen, J.-H.


    Humic acid (HA) is one of the major components of soil organic matter. It strongly affects the sorption behavior of organic and inorganic contaminants in soils. To obtain a better understanding of the interactions of contaminants with HA, a repeated extraction technique has been applied to a peat soil to obtain HA fractions with varying aliphaticity and aromaticity, which were subsequently correlated to the sorption properties of 2,4,6-trichlorophenol (TCP). HA fractions were extracted repeatedly using an alkaline solution and each HA fraction was separated into two portions with an air-drying or re-suspending (denoted as RSHAs) process. Solid-state 13 C NMR and elemental analysis demonstrated that the aromaticity and polarity of HAs decreased with extractions. Kinetic results indicated that air-dried HAs exhibited two-step first order sorption behavior with a rapid stage followed by a slower stage. The slower sorption is attributed to the diffusion of 2,4,6-TCP in the condensed aromatic domains of HAs. Conversely, sorption of 2,4,6-TCP on RSHAs was extremely rapid and could not be fitted with any kinetic model. For air-dried HAs the sorption capacity (K oc ) was weakly correlated with the chemical compositions of HAs. However, a positive trend between K oc and aromaticity was observed for RSHAs. Compared with the results of air-dried HAs with their counterparts of RSHAs, it is therefore concluded that air-drying may alter the structure of HAs through artificially creating a more condensed domain in HAs. The structural alternation may result in an incorrect interpretation of the relationship between sorption capacity and chemical composition of HAs and a misjudgment of the transport behavior of 2,4,6-TCP in soils and sediments

  18. Hemin immobilized into metal-organic frameworks as an electrochemical biosensor for 2,4,6-trichlorophenol (United States)

    Zhang, Ting; Wang, Lu; Gao, Congwei; Zhao, Chaoyue; Wang, Yang; Wang, Jianmin


    Hemin immobilized into copper-based metal-organic frameworks was successfully prepared and used as a new electrode material for sensitive electrochemical biosensing. X-ray diffraction patterns, Fourier transform infrared spectra, scanning electron microscopy, UV-vis absorption spectroscopy, and cyclic voltammetry were used to characterize the resultant composites. Due to the interaction between the copper atom groups and hemin, the constrained environment in Cu-MOF-74 acts as a matrix to avoid the dimerization of enzyme molecules and retain its biological activity. The hemin/Cu-MOF composites demonstrated enhanced electrocatalytical activity and high stability towards the oxidation of 2,4,6-trichlorophenol. Under optimum experimental conditions, the sensor showed a wide linear relationship over the range of 0.01-9 μmol L-1 with a detection limit (3σ) of 0.005 μmol L-1. The relative standard deviations were 4.6% and 3.5% for five repeated measurements of 0.5 and 5 μmol L-1 2,4,6-trichlorophenol, respectively. The detection platforms for 2,4,6-trichlorophenol developed here not only indicate that hemin/Cu-MOF-74 possesses intrinsic biological reactivity, but also enable further work to be conducted towards the application of enzyme-containing metal-organic frameworks in electrochemical biosensors.

  19. Enhancement of microbial 2,4,6-trinitrotoluene transformation with increased toxicity by exogenous nutrient amendment. (United States)

    Liang, Shih-Hsiung; Hsu, Duen-Wei; Lin, Chia-Ying; Kao, Chih-Ming; Huang, Da-Ji; Chien, Chih-Ching; Chen, Ssu-Ching; Tsai, Isheng Jason; Chen, Chien-Cheng


    In this study, the bacterial strain Citrobacter youngae strain E4 was isolated from 2,4,6-trinitrotoluene (TNT)-contaminated soil and used to assess the capacity of TNT transformation with/without exogenous nutrient amendments. C. youngae E4 poorly degraded TNT without an exogenous amino nitrogen source, whereas the addition of an amino nitrogen source considerably increased the efficacy of TNT transformation in a dose-dependent manner. The enhanced TNT transformation of C. youngae E4 was mediated by increased cell growth and up-regulation of TNT nitroreductases, including NemA, NfsA and NfsB. This result indicates that the increase in TNT transformation by C. youngae E4 via nitrogen nutrient stimulation is a cometabolism process. Consistently, TNT transformation was effectively enhanced when C. youngae E4 was subjected to a TNT-contaminated soil slurry in the presence of an exogenous amino nitrogen amendment. Thus, effective enhancement of TNT transformation via the coordinated inoculation of the nutrient-responsive C. youngae E4 and an exogenous nitrogen amendment might be applicable for the remediation of TNT-contaminated soil. Although the TNT transformation was significantly enhanced by C. youngae E4 in concert with biostimulation, the 96-h LC50 value of the TNT transformation product mixture on the aquatic invertebrate Tigriopus japonicas was higher than the LC50 value of TNT alone. Our results suggest that exogenous nutrient amendment can enhance microbial TNT transformation; however, additional detoxification processes may be needed due to the increased toxicity after reduced TNT transformation. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. Development of a cellular biosensor for the detection of 2,4,6-trichloroanisole (TCA). (United States)

    Varelas, Vassileios; Sanvicens, Nuria; M-Pilar-Marco; Kintzios, Spiridon


    2,4,6-trichloroanisole (TCA) is a microbial metabolite formed from chlorophenols through the activity of several natural fungal strains present on the cork oak bark. TCA is the primary compound responsible for the mousty/mould off-odour known as "cork taint" present in cork stoppers, wine, water and alcoholic beverages. Chromatographic and electrochemical methods are currently used for the determination of TCA, however its detection at low concentrations remains a technical challenge. The aim of this study was the development of a rapid novel biosensor system based on the Bioelectric Recognition Assay (BERA). The sensor measured the electric response of cultured membrane-engineered fibroblast cells suspended in an alginate gel matrix due to the change of their membrane potential in the presence of the analyte. Membrane-engineered cells were prepared by osmotic insertion of 0.5 μg/l of specific TCA antibodies into the membrane of the cells. The BERA-based sensor was able to detect TCA in a few minutes (3-5 min) at extremely low concentrations (10(-1)ppt), thus demonstrating higher sensitivity than the human sensory threshold. In addition, the assay was quite selective against other haloanisoles and halophenols structurally related to or co-occurring with TCA. Finally the sensor was tested against real white wine samples from cork soaks. At this real test, the BERA sensor was able to detect TCA from cork soaks rapidly (3-5 min) at very low concentrations (1.02-12 ng/l), covering the whole range for the detection threshold for wines (1.4-10 ng/l). Therefore, this novel biosensor offers new perspectives for ultra-rapid, ultra-sensitive and low-cost monitoring of TCA presence in cork and wine and possibly also other food commodities. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Biodegradation of TNT (2,4,6-Trinitrotoluene) by Phanerochaete chrysosporium

    International Nuclear Information System (INIS)

    Fernando, T.; Bumpus, J.A.; Aust, S.D.


    Extensive biodegradation of TNT (2,4,6-trinitrotoluene) by the white rot fungus Phanerochaete chrysosporium was observed. At an initial concentration of 1.3 mg/liter, 35.4 ± 3.6% of the [ 14 C]TNT was degraded to 14 CO 2 in 18 days. The addition of glucose 12 days after the addition of TNT did not stimulate mineralization, and, after 18 days of incubation with TNT only, about 3.3% of the initial TNT could be recovered. Mineralization of [ 14 C]TNT absorbed on soil was also examined. Ground corncobs served as the nutrient for slow but sustained degradation of [ 14 C]TNT to 14 CO 2 such that 6.3 ± 0.6% of the [ 14 C]TNT initially present was converted to 14 CO 2 during the 30-day incubation period. Mass balance analysis of liquid cultures and of soil-corncob cultures revealed that polar [ 14 C]TNT metabolites are formed in both systems, and high-performance liquid chromatography analyses revealed that less then 5% of the radioactivity remained as undegraded [ 14 C]TNT following incubation with the fungus in soil and liquid cultures. When the concentration of TNT in cultures (both liquid and soil) was adjusted to contamination levels that might be found in the environment, i.e., 10,000 mg/kg in soil and 100 mg/liter in water, mineralization studies showed that 18.4 ± 2.9% and 19.6 ± 3.5% of the initial TNT was converted to 14 CO 2 in 90 days in soil and liquid cultures, respectively. In both cases (90 days in water at 100 mg/liter and in soil at 10,000 mg/kg) approximately 85% of the TNT was degraded. These results suggest that this fungus may be useful for the decontamination of sites in the environment contaminated with TNT

  2. Degradation of 2,4,6-trichlorophenol with peroxymonosulfate catalyzed by soluble and supported iron porphyrins

    International Nuclear Information System (INIS)

    Günay, Tuğçe; Çimen, Yasemin


    Degradation of 2,4,6-trichloropenol (TCP) with peroxymonosulfate (PMS) catalyzed by iron porphyrin tetrasulfonate ([FePTS)] was investigated in an 8-to-1 (v/v) CH 3 OH-H 2 O mixture. Typical reaction medium contained a 4.00 mL methanol solution of TCP (0.100 mmol), a 0.50 mL aqueous solution of catalyst (5.0 × 10 −4  mmol), and 0.100 mmol PMS (as 0.031 g of Oxone). The reaction was performed at ambient temperature. The conversion of TCP was 74% in 30 min and 80% in 6 h when the catalyst was [FePTS]. Amberlite IRA-900 supported [FePTS] catalyst was also prepared. In the recycling experiments the homogeneous [FePTS] lost its activity after the first cycle, while [FePTS]-Amberlite IRA 900 maintained its activity for the first 2 cycles. After the second cycle, the conversion of TCP dropped to <10% for Amberlite IRA-900 supported [FePTS] catalyst. The degradation of TCP with PMS was also attempted using cobalt, copper, nickel and palladium porphyrin tetrasulfonate catalysts, however, no catalytic activity was observed with these structures. - Highlights: • The method presents an effective oxidation of TCP. • This research provided persistence, less harmful, self-degradable and more environmental oxidation products. • About seventy percent conversions of TCP in 30 min was achieved at room temperature. - This research provided non-persistent, less harmful, self-degradable and more environmentally friendly oxidation products. About 70% conversions of TCP in 30 min was achieved at room temperature.

  3. Gas phase detection of explosives such as 2,4,6-trinitrotoluene by molecularly imprinted polymers. (United States)

    Bunte, Gudrun; Hürttlen, Jürgen; Pontius, Heike; Hartlieb, Kerstin; Krause, Horst


    Fast, reliable and inexpensive analytical techniques for trace detection of explosive components are in high demand. Our approach is to develop specific sensor coating materials based on molecularly imprinted polymers (MIPs). Despite the known inhibition of radical polymerisations by nitro groups and the known shrinkage of the polymer lattice during/after drying we were able to synthesize particulate MIPs by suspension polymerisation as well as thin MIP coatings by direct surface polymerisation on quartz crystal microbalances (QCM). The best method to purify the porous beads was Soxhlet extraction followed by supercritical carbon dioxide extraction (SFE with sc-CO2) at mild conditions (150 bar, 50 degrees C). At least a removal of >99.7% of the template was achieved. Performance tests of TNT imprinted polymer beads showed that acrylamide (AA) and more pronounced also methacrylic acid (MAA) possessed an enhanced adsorption tendency for gaseous TNT. An adsorption of 2,4-DNT, dinitrotoluene, by these MIPs was not detected. Using 2,4-DNT as template and methacrylamide, MAAM, a positive imprint effect for gaseous 2,4-DNT was achieved with no measurable cross-sensitivity for 2,4,6-TNT. The thin MIP coatings directly synthesized on the QCMs showed thicknesses of 20 to up to 500 nm. Preliminary screening experiments were performed for five different monomers and three different solvents (acetonitrile, chloroform and dimethylformamide). Best adsorption properties for TNT vapour until now showed a PAA-MIP synthesized with chloroform. Direct measurements of the mass attachment, respectively frequency decrease of the coated QCMs during vapour treatment showed a TNT-uptake of about 150 pg per microg MIP per hour. Results look worthy for further studies.

  4. Biodegradation of 2,4,6-trichlorophenol in a packed-bed biofilm reactor equipped with an internal net draft tube riser for aeration and liquid circulation

    Energy Technology Data Exchange (ETDEWEB)

    Gomez-De Jesus, A.; Romano-Baez, F.J.; Leyva-Amezcua, L.; Juarez-Ramirez, C.; Ruiz-Ordaz, N. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico); Galindez-Mayer, J. [Departamento de Ingenieria Bioquimica, Escuela Nacional de Ciencias Biologicas, IPN. Prol. Carpio y Plan de Ayala, Colonia Santo Tomas, s/n. CP 11340, Mexico, D.F. (Mexico)], E-mail:


    For the aerobic biodegradation of the fungicide and defoliant 2,4,6-trichlorophenol (2,4,6-TCP), a bench-scale packed-bed bioreactor equipped with a net draft tube riser for liquid circulation and oxygenation (PB-ALR) was constructed. To obtain a high packed-bed volume relative to the whole bioreactor volume, a high A{sub D}/A{sub R} ratio was used. Reactor's downcomer was packed with a porous support of volcanic stone fragments. PB-ALR hydrodynamics and oxygen mass transfer behavior was evaluated and compared to the observed behavior of the unpacked reactor operating as an internal airlift reactor (ALR). Overall gas holdup values {epsilon}{sub G}, and zonal oxygen mass transfer coefficients determined at various airflow rates in the PB-ALR, were higher than those obtained with the ALR. When comparing mixing time values obtained in both cases, a slight increment in mixing time was observed when reactor was operated as a PB-ALR. By using a mixed microbial community, the biofilm reactor was used to evaluate the aerobic biodegradation of 2,4,6-TCP. Three bacterial strains identified as Burkholderia sp., Burkholderia kururiensis and Stenotrophomonas sp. constituted the microbial consortium able to cometabolically degrade the 2,4,6-TCP, using phenol as primary substrate. This consortium removed 100% of phenol and near 99% of 2,4,6-TCP. Mineralization and dehalogenation of 2,4,6-TCP was evidenced by high COD removal efficiencies ({approx}95%), and by the stoichiometric release of chloride ions from the halogenated compound ({approx}80%). Finally, it was observed that the microbial consortium was also capable to metabolize 2,4,6-TCP without phenol as primary substrate, with high removal efficiencies (near 100% for 2,4,6-TCP, 92% for COD and 88% for chloride ions)

  5. Efficacy of tecovirimat (ST-246) in nonhuman primates infected with variola virus (Smallpox). (United States)

    Mucker, Eric M; Goff, Arthur J; Shamblin, Joshua D; Grosenbach, Douglas W; Damon, Inger K; Mehal, Jason M; Holman, Robert C; Carroll, Darin; Gallardo, Nadia; Olson, Victoria A; Clemmons, Cody J; Hudson, Paul; Hruby, Dennis E


    Naturally occurring smallpox has been eradicated but remains a considerable threat as a biowarfare/bioterrorist weapon (F. Fleck, Bull. World Health Organ. 81:917-918, 2003). While effective, the smallpox vaccine is currently not recommended for routine use in the general public due to safety concerns ( Safe and effective countermeasures, particularly those effective after exposure to smallpox, are needed. Currently, SIGA Technologies is developing the small-molecule oral drug, tecovirimat (previously known as ST-246), as a postexposure therapeutic treatment of orthopoxvirus disease, including smallpox. Tecovirimat has been shown to be efficacious in preventing lethal orthopoxviral disease in numerous animal models (G. Yang, D. C. Pevear, M. H. Davies, M. S. Collett, T. Bailey, et al., J. Virol. 79:13139-13149, 2005; D. C. Quenelle, R. M. Buller, S. Parker, K. A. Keith, D. E. Hruby, et al., Antimicrob. Agents Chemother., 51:689-695, 2007; E. Sbrana, R. Jordan, D. E. Hruby, R. I. Mateo, S. Y. Xiao, et al., Am. J. Trop. Med. Hyg. 76:768-773, 2007). Furthermore, in clinical trials thus far, the drug appears to be safe, with a good pharmacokinetic profile. In this study, the efficacy of tecovirimat was evaluated in both a prelesional and postlesional setting in nonhuman primates challenged intravenously with 1 × 10(8) PFU of Variola virus (VARV; the causative agent of smallpox), a model for smallpox disease in humans. Following challenge, 50% of placebo-treated controls succumbed to infection, while all tecovirimat-treated animals survived regardless of whether treatment was started at 2 or 4 days postinfection. In addition, tecovirimat treatment resulted in dramatic reductions in dermal lesion counts, oropharyngeal virus shedding, and viral DNA circulating in the blood. Although clinical disease was evident in tecovirimat-treated animals, it was generally very mild and appeared to resolve earlier than in placebo

  6. Alternative Flame Retardant, 2,4,6-Tris(2,4,6-tribromophenoxy)-1,3,5-triazine, in an E-waste Recycling Facility and House Dust in North America. (United States)

    Guo, Jiehong; Stubbings, William A; Romanak, Kevin; Nguyen, Linh V; Jantunen, Liisa; Melymuk, Lisa; Arrandale, Victoria; Diamond, Miriam L; Venier, Marta


    A high molecular weight compound, 2,4,6-tris(2,4,6-tribromophenoxy)-1,3,5-triazine (TTBP-TAZ), was detected during the analysis of brominated flame retardants in dust samples collected from an electrical and electronic waste (e-waste) recycling facility in Ontario, Canada. Gas chromatography coupled with both high-resolution and low-resolution mass spectrometry (MS) was used to determine TTBP-TAZ's chemical structure and concentrations. To date, TTBP-TAZ has only been detected in plastic casings of electrical and electronic equipment and house dust from The Netherlands. Here we report on the concentrations of TTBP-TAZ in selected samples from North America: e-waste dust ( n = 7) and air ( n = 4), residential dust ( n = 30), and selected outdoor air ( n = 146), precipitation ( n = 19), sediment ( n = 11) and water ( n = 2) samples from the Great Lakes environment. TTBP-TAZ was detected in all the e-waste dust and air samples, and in 70% of residential dust samples. The median concentrations of TTBP-TAZ in these three types of samples were 5540 ng/g, 5.75 ng/m 3 and 6.76 ng/g, respectively. The flame retardants 2,4,6-tribromophenol, tris(2,3-dibromopropyl) isocyanurate, and 3,3',5,5'-tetrabromobisphenol A bis(2,3-dibromopropyl) ether, BDE-47 and BDE-209 were also measured for comparison. None of these other flame retardants concentrations was significantly correlated with those of TTBP-TAZ in any of the sample types suggesting different sources. TTBP-TAZ was not detected in any of the outdoor environmental samples, which may relate to its application history and physicochemical properties. This is the first report of TTBP-TAZ in North America.

  7. Simultaneous determination of 2,4,6-trichlorophenol and pentachlorophenol based on poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified electrode

    International Nuclear Information System (INIS)

    Zhu, Xiaolin; Zhang, Kexin; Lu, Nan; Yuan, Xing


    Graphical abstract: A poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified glassy carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP) without any pretreatment. - Highlights: • A poly(RhB)/graphene oxide/multiwalled carbon nanotubes composite was synthesized. • The composite film was characterized by SEM, XRD, EIS and Raman spectroscopy. • The simultaneous electrochemical determination of 2,4,6-TCP and PCP was realized. • The electrode showed high sensitivity, excellent reproducibility and good stability. • The electrode was used to determine 2,4,6-TCP and PCP in practical water samples. - Abstract: In the present study, a poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes nanocomposite modified glass carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP). The PRhB/GO/MWCNTs film was extensively characterized by emission scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy and electrochemical impedance spectroscopy (EIS). The electrochemical behaviors of 2,4,6-TCP and PCP were investigated by cyclic voltammetry, linear sweep voltammetry and differential pulse voltammetry. Due to the synergistic effect, the PRhB/GO/MWCNTs/GCE significantly facilitated the simultaneous electro-oxidation of 2,4,6-TCP and PCP with peak potential difference of 160 mV and enhanced oxidation currents. Under optimum conditions, the oxidation current of 2,4,6-TCP was linear to its concentration in the ranges of 4.0 × 10"−"9 to 1.0 × 10"−"7 M and 1.0 × 10"−"7 to 1.0 × 10"−"4 M with the detection limit (S/N = 3) of 8.0 × 10"−"1"0 M. And the linear concentration ranges for PCP were 2.0 × 10"−"9 to 1.0 × 10"−"7 M and 1.0 × 10"−"7 to 9.0 × 10"−"5 M with the detection limit of 5.0 × 10"−"1"0 M

  8. Simultaneous determination of 2,4,6-trichlorophenol and pentachlorophenol based on poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified electrode

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xiaolin; Zhang, Kexin; Lu, Nan; Yuan, Xing, E-mail:


    Graphical abstract: A poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes composite film modified glassy carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP) without any pretreatment. - Highlights: • A poly(RhB)/graphene oxide/multiwalled carbon nanotubes composite was synthesized. • The composite film was characterized by SEM, XRD, EIS and Raman spectroscopy. • The simultaneous electrochemical determination of 2,4,6-TCP and PCP was realized. • The electrode showed high sensitivity, excellent reproducibility and good stability. • The electrode was used to determine 2,4,6-TCP and PCP in practical water samples. - Abstract: In the present study, a poly(Rhodamine B)/graphene oxide/multiwalled carbon nanotubes nanocomposite modified glass carbon electrode (PRhB/GO/MWCNTs/GCE) was developed for the simultaneous determination of 2,4,6-trichlorophenol (2,4,6-TCP) and pentachlorophenol (PCP). The PRhB/GO/MWCNTs film was extensively characterized by emission scanning electron microscopy (SEM), X-ray diffraction (XRD), Raman spectroscopy and electrochemical impedance spectroscopy (EIS). The electrochemical behaviors of 2,4,6-TCP and PCP were investigated by cyclic voltammetry, linear sweep voltammetry and differential pulse voltammetry. Due to the synergistic effect, the PRhB/GO/MWCNTs/GCE significantly facilitated the simultaneous electro-oxidation of 2,4,6-TCP and PCP with peak potential difference of 160 mV and enhanced oxidation currents. Under optimum conditions, the oxidation current of 2,4,6-TCP was linear to its concentration in the ranges of 4.0 × 10{sup −9} to 1.0 × 10{sup −7} M and 1.0 × 10{sup −7} to 1.0 × 10{sup −4} M with the detection limit (S/N = 3) of 8.0 × 10{sup −10} M. And the linear concentration ranges for PCP were 2.0 × 10{sup −9} to 1.0 × 10{sup −7} M and 1.0 × 10{sup −7} to 9.0 × 10{sup −5} M with the

  9. Degradation of 2,4,6-Trinitrophenol (TNP) by Arthrobacter sp. HPC1223 Isolated from Effluent Treatment Plant


    Qureshi, Asifa; Kapley, Atya; Purohit, Hemant J.


    Arthrobacter sp. HPC1223 (Genebank Accession No. AY948280) isolated from activated biomass of effluent treatment plant was capable of utilizing 2,4,6 trinitrophenol (TNP) under aerobic condition at 30 °C and pH 7 as nitrogen source. It was observed that the isolated bacteria utilized TNP up to 70 % (1 mM) in R2A media with nitrite release. The culture growth media changed into orange-red color hydride-meisenheimer complex at 24 h as detected by HPLC. Oxygen uptake of Arthrobacter HPC1223 towa...

  10. Chlorella vulgaris cultivation in sludge extracts from 2,4,6-TCP wastewater treatment for toxicity removal and utilization. (United States)

    Wang, Lu; Chen, Xiurong; Wang, Hualin; Zhang, Yuying; Tang, Qingjie; Li, Jiahui


    Chlorella vulgaris was cultivated in different proportions of activated sludge extracts, which was from the treatment of the synthetic wastewater containing 2,4,6-trichlorophenol (2,4,6-TCP). The nutrients, total nitrogen (TN) and total phosphorus (TP), were removed over 45% and 90%, respectively. The maximum reduction amount of ecotoxicity and total organic carbon (TOC) occurred in the 100% sludge group on the 8th day (68%; 86.2 mg L -1 ). The variations of Excitation-emission matrix spectra (EEMs) and TOC indicated that extracellular organic matters (EOM) produced by algae led to TOC increase in the medium. The cell density was close to each other for groups with sludge extract proportion below 50%; sludge extracts (below 75% addition) had a stimulating effect on the accumulation of chlorophyll-a in per unit algal cell. Superoxide dismutase (SOD) variation demonstrated that C. vulgaris response positively to sludge extracts addition. Lipid content in C. vulgaris was up to its maximum value on the 8th day. Considering the performance on nutrients removal, toxicity reduction and algal growth, the optimal cultivation period for C. vulgaris before harvesting was around 8 days with sludge extracts proportion below 50%. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Preparation of oil palm empty fruit bunch-based activated carbon for removal of 2,4,6-trichlorophenol: Optimization using response surface methodology

    International Nuclear Information System (INIS)

    Hameed, B.H.; Tan, I.A.W.; Ahmad, A.L.


    The effects of three preparation variables: CO 2 activation temperature, CO 2 activation time and KOH:char impregnation ratio (IR) on the 2,4,6-trichlorophenol (2,4,6-TCP) uptake and carbon yield of the activated carbon prepared from oil palm empty fruit bunch (EFB) were investigated. Based on the central composite design, two quadratic models were developed to correlate the three preparation variables to the two responses. The activated carbon preparation conditions were optimized using response surface methodology by maximizing both the 2,4,6-TCP uptake and activated carbon yield within the ranges studied. The optimum conditions for preparing activated carbon from EFB for adsorption of 2,4,6-TCP were found as follows: CO 2 activation temperature of 814 deg. C, CO 2 activation time of 1.9 h and IR of 2.8, which resulted in 168.89 mg/g of 2,4,6-TCP uptake and 17.96% of activated carbon yield. The experimental results obtained agreed satisfactorily with the model predictions. The activated carbon prepared under optimum conditions was mesoporous with BET surface area of 1141 m 2 /g, total pore volume of 0.6 cm 3 /g and average pore diameter of 2.5 nm. The surface morphology and functional groups of the activated carbon were respectively determined from the scanning electron microscopy and Fourier transform infrared analysis.

  12. Synthesis of bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine oxide – a tailor-made photoinitiator for dental adhesives

    Directory of Open Access Journals (Sweden)

    Norbert Moszner


    Full Text Available Because of the poor solubility of the commercially available bisacylphosphine oxides in dental acidic aqueous primer formulations, bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine oxide (WBAPO was synthesized starting from 3-(chloromethyl-2,4,6-trimethylbenzoic acid by the dichlorophosphine route. The substituent was introduced by etherification with 2-(allyloxyethanol. In the second step, 3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoic acid was chlorinated. The formed acid chloride showed an unexpected low thermal stability. Its thermal rearrangement at 180 °C resulted in a fast formation of 3-(chloromethyl-2,4,6-trimethylbenzoic acid 2-(allyloxyethyl ester. In the third step, the acid chloride was reacted with phenylphosphine dilithium with the formation of bis(3-{[2-(allyloxyethoxy]methyl}-2,4,6-trimethylbenzoyl(phenylphosphine, which was oxidized to WBAPO. The structure of WBAPO was confirmed by 1H NMR, 13C NMR, 31P NMR, and IR spectroscopy, as well as elemental analysis. WBAPO, a yellow liquid, possesses improved solubility in polar solvents and shows UV–vis absorption, and a high photoreactivity comparable with the commercially available bisacylphosphine oxides. A sufficient storage stability was found in dental acidic aqueous primer formulations.

  13. Gas-liquid reactive crystallization kinetics of 2,4,6-triamino-1,3,5-trinitrobenzene in the semi-batch procedure (United States)

    Liu, Ruqin; Huang, Ming; Yao, Xiaolu; Chen, Shuang; Wang, Shucun; Suo, Zhirong


    2,4,6-Triamino-1,3,5-trinitrobenzene is the attractive insensitive high energetic material used extensively in the military and civil fields. Combined with the double-films theory, the global gas-liquid chemical reaction kinetics of 2,4,6-triamino-1,3,5-trinitrobenzene was developed by means of the infinitesimal material balance calculation. The raw material concentration and reactive temperature effects on the crystallization of 2,4,6-triamino-1,3,5-trinitrobenzene were investigated by the batch experiments. The reactive crystallization kinetics associated ammonia feeding rate of 2,4,6-triamino-1,3,5-trinitrobenzene, including nucleation as well as crystal growth, was systematically investigated in the heterogonous semi-batch procedure. The nucleation and crystal growth kinetic exponents were estimated by the linear least-squares method. The crystallization kinetic results indicated that nucleation rate strongly increased but liner growth rate decreased with the increasing of ammonia feeding rate. In terms of manufacturing coarse 2,4,6-triamino-1,3,5-trinitrobenzene, it was found that a slow ammonia feeding rate and a low raw material concentration were feasible under the present experimental conditions.

  14. Application of a Homogenous Assay for the Detection of 2,4,6-Trinitrotoluene to Environmental Water Samples

    Directory of Open Access Journals (Sweden)

    Ellen R. Goldman


    Full Text Available A homogeneous assay was used to detect 2,4,6-trinitrotoluene (TNT spiked into environmental water samples. This assay is based on changes in fluorescence emission intensity when TNT competitively displaces a fluorescently labeled, TNT analog bound to an anti-TNT antibody. The effectiveness of the assay was highly dependent on the source of the sample being tested. As no correlation between pH and assay performance was observed, ionic strength was assumed to be the reason for variation in assay results. Addition of 10x phosphate-buffered saline to samples to increase their ionic strength to that of our standard laboratory buffer (about 0.17 M significantly improved the range over which the assay functioned in several river water samples.

  15. Density functional theory investigation of the magnetism of 1,3,5-trithia-2,4,6-triazapentalenyl

    International Nuclear Information System (INIS)

    Zou Weidong; Liu Zuli; Wu Minghu; Yao Kailun


    An accurate full-potential density-functional method is used to study the mechanism of the origin of magnetism and of the magnetic interactions in 1,3,5-trithia-2,4,6-triazapentalenyl (TTTA). The results shown that because of the spin polarization effect and the spin exchange coupling interactions of these atoms, the net spin magnetic moment is formed in the molecule and the spontaneous magnetic moments for the TTTA mainly come from N 1 , S 1 , S 2 atoms and the N 2 , N 3 and S 3 atoms give a little contribution to the magnetism. Our results also revealed that there exists ferromagnetic interaction in the intramolecular of TTTA

  16. Structural studies of the polysaccharides from the lipopolysaccharides of Azospirillum brasilense Sp246 and SpBr14. (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A


    Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Ecotoxicological evaluation of in situ bioremediation of soils contaminated by the explosive 2,4,6-trinitrotoluene (TNT)

    International Nuclear Information System (INIS)

    Frische, Tobias


    The luminescent bacteria assay, using soil leachates, was the most sensitive toxicity indicator. - To evaluate the environmental relevance of in situ bioremediation of contaminated soils, effective and reliable monitoring approaches are of special importance. The presented study was conducted as part of a research project investigating in situ bioremediation of topsoils contaminated by the explosive 2,4,6-trinitrotoluene (TNT). Changes in soil toxicity within different experimental fields at a former ordnance factory were evaluated using a battery of five bioassays (plant growth, Collembola reproduction, soil respiration, luminescent bacteria acute toxicity and mutagenicity test) in combination to chemical contaminant analysis. Resulting data reveal clear differences in sensitivities between methods with the luminescent bacteria assay performed with soil leachates as most sensitive toxicity indicator. Complete test battery results are presented in so-called soil toxicity profiles to visualise and facilitate the interpretation of data. Both biological and chemical monitoring results indicate a reduction of soil toxicity within 17 months of remediation

  18. Oxidation reactivity of 1,2-bis(2,4,6-tribromophenoxy)ethane (BTBPE) by Compound I model of cytochrome P450s

    Institute of Scientific and Technical Information of China (English)

    Zhongyu Wang; Zhiqiang Fu; Qi Yu; Jingwen Chen


    Alternative brominated flame retardants (BFRs) have become prevalent as a consequence of restrictions on the use of polybrominated diphenyl ethers (PBDEs).For risk assessment of these alternatives,knowledge of their metabolism via cytochrome P450 enzymes is needed.We have previously proved that density functional theory (DFT) is able to predict the metabolism of PBDEs by revealing the molecular mechanisms.In the current study,the reactivity of 1,2-bis(2,4,6-tribromophenoxy)ethane and structurally similar chemicals with the Compound I model representing the active site of P450 enzymes was investigated.The DFT calculations delineated reaction pathways which lead to reasonable explanations for products that were detected by wet experiments,meanwhile intermediates which cannot be determined were also proposed.Results showed that alkyl hydrogen abstraction will lead to bis(2,4,6-tribromophenoxy)ethanol,which may undergo hydrolysis yielding 2,4,6-tribromophenol,a neurotoxic compound.In addition,a general pattern of oxidation reactivity regarding the 2,4,6-tribromophenyl moiety was observed among several model compounds.Our study has provided insights for convenient evaluation of the metabolism of other structurally similar BFRs.

  19. 1,1´,1´´-(2,4,6-Trihydroxybenzene-1,3,5-triyl)triethanone tautomerism revisited

    DEFF Research Database (Denmark)

    Hansen, Poul Erik; Kamounah, Fadhil S.; Zhiryakova, Diana


    It has recently been suggested that 1,1′,1′′-(2,4,6-trihydroxybenzene-1,3,5-triyl)triethanone may be tautomeric. Using 13C NMR chemical shifts and deuterium isotope effects on 13C chemical shifts, it is demonstrated that this is not the case. This compound occurs as a strongly hydrogen bonded ben...

  20. Watermelon germplasm lines USVL246-FR2 and USVL252-FR2 tolerant to fusarium oxysporum f. sp. niveum race 2 (United States)

    Two improved germplasm lines of wild watermelon (Citrullus lanatus var. citroides) designated USVL246-FR2 and USVL252-FR2 were released in 2012 by the Agricultural Research Service of the U.S. Department of Agriculture (Wechter et al. 2012). These lines are each highly uniform for growth characteri...

  1. Highly Sensitive Determination of 2,4,6-Trinitrotoluene and Related Byproducts Using a Diol Functionalized Column for High Performance Liquid Chromatography

    NARCIS (Netherlands)

    Gümüscü, B.; Erdogan, Zeynep; Guler, Mustafa O.; Tekinay, Turgay


    In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has

  2. Scaling of light emission from detonating bare Composition B, 2,4,6-trinitrotoluene [C7H5(NO2)3], and PE4 plastic explosive charges

    CSIR Research Space (South Africa)

    Mostert, FJ


    Full Text Available and configuration. In this study, the emission characteristics at wavelengths between 650 and 940 nm were experimentally investigated for cylindrical bare Composition B, 2,4,6-trinitrotoluene [C7H5(NO2)3], and PE4 plastic explosive charges in the mass (M) range of 0...

  3. Three-phase packed bed reactor with an evaporating solvent—I. Experimental: the hydrogenation of 2,4,6-trinitrotoluene in methanol

    NARCIS (Netherlands)

    van Gelder, K.B.; Damhof, J.K.; Kroijenga, P.J.; Westerterp, K.R.


    In this paper we present experimental data on the three-phase hydrogenation of 2,4,6-trinitrotoluene (TNT) to triaminotoluene. The experiments are performed in a cocurrent upflow packed bed reactor. Methanol is used as an evaporating solvent. The influence of the main operating parameters, the

  4. Synthesis of fisetin and 2',4',6'-trihydroxydihyrochalcone 4'-O-β-neohesperidoside based on site-selective deacetylation and deoxygenation. (United States)

    Tsunekawa, Ryuji; Hanaya, Kengo; Higashibayashi, Shuhei; Sugai, Takeshi


    Fisetin and 2',4',6'-trihydroxydihyrochalcone 4'-O-β-neohesperidoside were synthesized from commercially available quercetin and naringin in five steps. The key steps are site-selective deacetylation and subsequent deoxygenation. The target molecules were obtained in 37% and 23% yields from the starting materials, respectively.

  5. Photolysis of 2,4,6-trinitrotoluene in seawater and estuary water: Impact of pH, temperature, salinity, and dissolved organic matter

    International Nuclear Information System (INIS)

    Luning Prak, Dianne J.; Breuer, James E.T.; Rios, Evelyn A.; Jedlicka, Erin E.; O'Sullivan, Daniel W.


    The influence of salinity, pH, temperature, and dissolved organic matter on the photolysis rate of 2,4,6-trinitrotoluene (TNT) in marine, estuary, and laboratory-prepared waters was studied using a Suntest CPS +® solar simulator equipped with optical filters. TNT degradation rates were determined using HPLC analysis, and products were identified using LC/MS. Minimal or no TNT photolysis occurred under a 395-nm long pass filter, but under a 295-nm filter, first-order TNT degradation rate constants and apparent quantum yields increased with increasing salinity in both natural and artificial seawater. TNT rate constants increased slightly with increasing temperature (10 to 32 °C) but did not change significantly with pH (6.4 to 8.1). The addition of dissolved organic matter (up to 5 mg/L) to ultrapure water, artificial seawater, and natural seawater increased the TNT photolysis rate constant. Products formed by TNT photolysis in natural seawater were determined to be 2,4,6-trinitrobenzaldehyde, 1,3,5-trinitrobenzene, 2,4,6-trinitrobenzoic acid, and 2-amino-4,6-dinitrobenzoic acid. - Highlights: • 2,4,6-trinitrotoluene (TNT) was photolyzed in marine, estuary, & laboratory waters. • TNT photolysis rates increased with increasing salinity & dissolved organic matter. • Temperature and pH had minimal impact on TNT photolysis in marine waters. • In seawater, TNT photolysis produced 1,3,5-trinitrobenzene & trinitrobenzaldehyde. • Polar products were 2,4,6-trinobenzoic acid & 2-amino-4,6-dinitrobenzoic acid.

  6. Isolation from estuarine sediments of a Desulfovibrio strain which can grow on lactate coupled to the reductive dehalogenation of 2,4,6-tribromophenol

    Energy Technology Data Exchange (ETDEWEB)

    Boyle, A.W.; Phelps, C.D.; Young, L.Y. [Rutgers-The State Univ. of New Jersey, New Brunswick, NJ (United States). Biotechnology Center for Agriculture and the Environment


    Strain TBP-1, an anaerobic bacterium capable of reductively dehalogenating 2,4,6-tribromophenol to phenol, was isolated from estuarine sediments of the Arthur Kill in the New York/New Jersey harbor. It is a gram-negative, motile, vibrio-shaped, obligate anaerobe which grows on lactate, pyruvate, hydrogen, and fumarate when provided sulfate as an electron acceptor. The organism accumulates acetate when grown on lactate and sulfate, contains desulfoviridin, and will not grow in the absence of NaCl. It will not utilize acetate, succinate, propionate, or butyrate for growth via sulfate reduction. When supplied with lactate as an electron donor, strain TBP-1 will utilize sulfate, sulfite, sulfur, and thiosulfate for growth but not nitrate, fumarate, or acrylate. This organism debrominates 2-, 4-, 2,4-, 2,6-, and 2,4,6-bromophenol but not 3- or 2,3-bromophenol or monobrominated benzoates. It will not dehalogenate monochlorinated, fluorinated, or iodinated phenols or chlorinated benzoates. Together with its physiological characteristics, its 16S rRNA gene sequence places it in the genus Desulfovibrio. The average growth yield of strain TBP-1 grown on a defined medium supplemented with lactate and 2,4,6-bromophenol is 3.71 mg of protein/mmol of phenol produced, and the yield was 1.42 mg of protein/mmol of phenol produced when 40bromophenol was the electron acceptor. Average growth yields for Desulfovibrio sp. strain TBP-1 grown with 2,4,6-bromophenol, 4-bromophenol, or sulfate are 0.62, 0.71, and 1.07, respectively. Growth did not occur when either lactate or 2,4,6-bromophenol was omitted from the growth medium. These results indicate that Desulfovibrio sp. strain TBP-1 is capable of growth via halorespiration.

  7. Oxidation of the odorous compound 2,4,6-trichloroanisole by UV activated persulfate: Kinetics, products, and pathways. (United States)

    Luo, Congwei; Jiang, Jin; Ma, Jun; Pang, Suyan; Liu, Yongze; Song, Yang; Guan, Chaoting; Li, Juan; Jin, Yixin; Wu, Daoji


    The transformation efficiency and products of an odorous compound 2,4,6-trichloroanisole (TCA) at the wavelength of 254 nm in the presence of persulfate were investigated for the first time. The effects of water matrix (i.e., natural organic matter (NOM), pH, carbonate/bicarbonate (HCO3(-)/CO3(2-)), and chloride ions (Cl(-))) were evaluated. The second order rate constant of TCA reacting with sulfate radical (SO4(-)) was determined to be (3.72 ± 0.10) × 10(9) M(-1) s(-1). Increasing dosage of persulfate increased the observed pseudo-first-order rate constant for TCA degradation (kobs), and the contribution of SO4(-) to TCA degradation was much higher than that of HO at each experimental condition. Degradation rate of TCA decreased with pH increasing from 4.0 to 9.0, which could be explained by the lower radical scavenging effect of dihydrogen phosphate than hydrogen phosphate in acidic condition (pH kinetic results could be described by a steady-state kinetic model. Furthermore, liquid chromatography/electrospray ionization-triple quadrupole mass spectrometry at powerful precursor ion scan approach was used to selectively detect oxidation products of TCA. It was found that 2,4,6-trichorophenol (TCP) was the major oxidation product (i.e., the initial yield of TCP was above 90%). The second order rate constant between TCP and SO4(-) was estimated to be (4.16 ± 0.20) × 10(9) M(-1) s(-1). In addition, three products (i.e., 2,6-dichloro-1,4-benzoquinone and two aromatic ring-opening products) were detected in the reaction of TCP with SO4(-), which also appeared in the oxidation of TCA in the UV/persulfate process. A tentative pathway was proposed, where the initial one-electron oxidation of TCA by SO4(-) and further reactions (e.g., ipso-hydroxylation and aromatic ring-cleavage) of the formed cation intermediate TCA were involved. Copyright © 2016. Published by Elsevier Ltd.

  8. Oxidation of 2,4,6,-tri-chlorophenol catalyzed by iron phthalocyanines covalently bound to silica. Oxydation du 2,4,6-trichlorophenol catalyse par des phtalocyanines de fer greffees sur silice par liaisons covalentes

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, M.; Hadasch, A.; Meunier, B. (Centre National de la Recherche Scientifique (CNRS), 31 - Toulouse (France). Laboratoire de Chimie de Coordination); Rabion, A. (Elf-Atochem, 64 - Artix (France). Centre de Recherche)


    The degradation of recalcitrant pollutants remains a high priority in order to preserve our environment. For example, chlorinated aromatic compounds are extremely persistent in the environment because of their slow biodegradation by microorganisms. One of the most notable toxic offenders is 2,4,6-tri-chlorophenol (TCP) which is produced by paper mills and also used as a biocide. Thus TCP is an obvious benchmark for research on the decontamination of waste waters. In this work, the covalent attachment of an iron phthalocyanine with chloro-sulfonyl substituents (FePcSO[sub 2]Cl) onto a functionalized 3-amino-propyl-silica has been achieved. This supported catalyst FePcSO[sub 2]Cl-silica is able to degrade a recalcitrant pollutant like TCP with hydrogen peroxide as oxidant. In order to improve the catalytic efficiency of the grafted iron phthalocyanine complex, modifications of the macrocycle substituents, passivation of the silica surface, variation of the loading of the carrier and addition of an organic co solvent to the reaction mixture were carried out. (authors) 21 refs.

  9. Thermal decomposition and kinetic evaluation of decanted 2,4,6-trinitrotoluene (TNT) for reutilization as composite material (United States)

    Ahmed, M. F.; Hussain, A.; Malik, A. Q.


    Use of energetic materials has long been considered for only military purposes. However, it is very recent that their practical applications in wide range of commercial fields such as mining, road building, under water blasting and rocket propulsion system have been considered. About 5mg of 2,4,6-trinitrotoluene (TNT) in serviceable (Svc) as well as unserviceable (Unsvc) form were used for their thermal decomposition and kinetic parameters investigation. Thermogravimetric/ differential thermal analysis (TG/DTA), X-ray diffraction (XRD) and Scanning electron microscope (SEM) were used to characterize two types of TNT. Arrhenius kinetic parameters like activation energy (E) and enthalpy (AH) of both TNT samples were determined using TG curves with the help of Horowitz and Metzger method. Simultaneously, thermal decomposition range was evaluated from DTA curves. Distinct diffraction peaks showing crystalline nature were obtained from XRD analysis. SEM results indicated that Unsvc TNT contained a variety of defects like cracks and porosity. Similarly, it is observed that thermal as well as kinetic behavior of both TNT samples vary to a great extent. Likewise, a prominent change in the activation energies (E) of both samples is observed. This in-depth study provides a way forward in finding solutions for the safe reutilization of decanted TNT.

  10. Organic pollutants removal from 2,4,6-trinitrotoluene (TNT) red water using low cost activated coke

    Institute of Scientific and Technical Information of China (English)

    Mohe Zhang; Quanlin Zhao; Zhengfang Ye


    We treated 2,4,6-trinitrotoluene (TNT) red water from the Chinese explosive industry with activated coke (AC) from lignite.Since the composition of TNT red water was very complicated,chemical oxygen demand (COD) was used as the index for evaluating treatment efficiency.This study focused on sorption kinetics and equilibrium sorption isotherms of AC for the removal of COD from TNT red water,and the changes of water quality before and after adsorption were evaluated using high performance liquid chromatography,UV-Vis spectra and gas chromatography/mass spectroscopy.The results showed that the sorption kinetics of COD removal from TNT red water onto AC fitted well with the pseudo second-order model.The adsorption process was an exothermic and physical process.The sorption isotherm was in good agreement with Redlich-Peterson isotherm.At the conditions of initial pH =6.28,20°C and 3 hr of agitation,under 160 g/L AC,64.8% of COD was removed.The removal efficiencies of 2,4-dinitrotoluene-3-sulfonate (2,4-DNT-3-SO3-) and 2,4-dinitrotoluene-5-sulfonate (2,4-DNT-5-SO3-) were 80.5% and 84.3%,respectively.After adsorption,the acute toxicity of TNT red water reduced greatly,compared with that of unprocessed TNT red water.

  11. Photodegradation of 2,4,6-trinitrophenol catalyzed by Zn/MgO nanoparticles prepared in aqueous-organic medium

    International Nuclear Information System (INIS)

    Ali, Shaista; Farrukh, Muhammad Akhyar; Khaleeq-ur-Rahman, Muhammad


    Synthesis of Magnesium oxide (MgO) nanoparticles and zinc deposited magnesium oxide (Zn/MgO) nanoparticles was carried out using hydrothermal and deposition-precipitation method with the variation of 1-Propanol (organic solvent) concentration, sodium hydroxide and urea concentration. The nanoparticles were characterized by using FTIR, TGA, SEM-EDX, TEM and XRD. The photocatalytic efficiency of MgO and Zn/MgO nanoparticles was studied by degradation of 2,4,6-trinitrophenol (TNP), which is highly acute and toxic and causes skin and eyes diseases, liver malfunction and tumor formation. Photodegradation of TNP was carried out under UV irradiation and confirmed by using HPLC and GC-MS. MgO and Zn/MgO nanoparticles that were synthesized by using urea showed higher first-order rate constant (k) value and percentage degradation as compared to nanoparticles that were synthesized using NaOH. It was observed that the concentration of solvent has direct relation with the k value of degradation of TNP

  12. Photodegradation of 2,4,6-trinitrophenol catalyzed by Zn/MgO nanoparticles prepared in aqueous-organic medium

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Shaista; Farrukh, Muhammad Akhyar; Khaleeq-ur-Rahman, Muhammad [GC University Lahore, Lahore (Pakistan)


    Synthesis of Magnesium oxide (MgO) nanoparticles and zinc deposited magnesium oxide (Zn/MgO) nanoparticles was carried out using hydrothermal and deposition-precipitation method with the variation of 1-Propanol (organic solvent) concentration, sodium hydroxide and urea concentration. The nanoparticles were characterized by using FTIR, TGA, SEM-EDX, TEM and XRD. The photocatalytic efficiency of MgO and Zn/MgO nanoparticles was studied by degradation of 2,4,6-trinitrophenol (TNP), which is highly acute and toxic and causes skin and eyes diseases, liver malfunction and tumor formation. Photodegradation of TNP was carried out under UV irradiation and confirmed by using HPLC and GC-MS. MgO and Zn/MgO nanoparticles that were synthesized by using urea showed higher first-order rate constant (k) value and percentage degradation as compared to nanoparticles that were synthesized using NaOH. It was observed that the concentration of solvent has direct relation with the k value of degradation of TNP.

  13. 2,4,6-Trinitrotoluene mineralization and bacterial production rates of natural microbial assemblages from coastal sediments

    Energy Technology Data Exchange (ETDEWEB)

    Montgomery, Michael T., E-mail: [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Coffin, Richard B., E-mail: [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Boyd, Thomas J., E-mail: [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Smith, Joseph P., E-mail: [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Walker, Shelby E., E-mail: [Naval Research Laboratory, Marine Biogeochemistry Section, Code 6114, 4555 Overlook Avenue, Washington, DC 20375 (United States); Osburn, Christopher L., E-mail: [Marine, Earth and Atmospheric Sciences, North Carolina State University, Raleigh, NC 27695 (United States)


    The nitrogenous energetic constituent, 2,4,6-Trinitrotoluene (TNT), is widely reported to be resistant to bacterial mineralization (conversion to CO{sub 2}); however, these studies primarily involve bacterial isolates from freshwater where bacterial production is typically limited by phosphorus. This study involved six surveys of coastal waters adjacent to three biome types: temperate broadleaf, northern coniferous, and tropical. Capacity to catabolize and mineralize TNT ring carbon to CO{sub 2} was a common feature of natural sediment assemblages from these coastal environments (ranging to 270+/-38 {mu}g C kg{sup -1} d{sup -1}). More importantly, these mineralization rates comprised a significant proportion of total heterotrophic production. The finding that most natural assemblages surveyed from these ecosystems can mineralize TNT ring carbon to CO{sub 2} is consistent with recent reports that assemblage components can incorporate TNT ring carbon into bacterial biomass. These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - Highlights: > TNT mineralization is a common feature of natural bacterial assemblages in coastal sediments. > TNT mineralization rates comprised a significant proportion of total heterotrophic production. > These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - The capacity to mineralize TNT ring carbon to CO{sub 2} is a common feature of natural bacterial assemblages in coastal sediment.

  14. Effects of additives on 2,4,6-trinitrotoluene (TNT) removal and its mineralization in aqueous solution by gamma irradiation

    International Nuclear Information System (INIS)

    Lee, Byungjin; Jeong, Seung-Woo


    The effects of additives (i.e., methanol, EDTA, mannitol, thiourea, nitrous oxide, oxygen and ozone) on gamma irradiation of 2,4,6-trinitrotoluene (TNT) were investigated to elucidate the initial reaction mechanism of TNT degradation and suggest an practical method for complete by-product removal. All additives, except thiourea, significantly increased the TNT removal efficiency by gamma irradiation. The overall results of the additive experiments implied that the TNT decomposition would be initiated by ·OH, e aq - , and HO 2 ·/O 2 · - , and also implied that ·H did not have any direct effect on the TNT decomposition. Additions of methanol and nitrous oxide were more effective in TNT removal than the other additives, achieving complete removal of TNT at doses below 20 kGy. Total organic carbon (TOC) of the irradiated solution was analyzed to evaluate the degree of TNT mineralization under the additive conditions. TOC under the nitrous oxide addition was removed rapidly, and complete TNT mineralization was thus achieved at 50 kGy. Methanol addition was very effective in the TNT removal, but it was not effective in reduction in TOC. Trinitrobenzene (TNB), oxalic acid and glyoxalic acid were detected as radiolytic organic by-products, while ammonia and nitrate were detected as radiolytic inorganic by-products. The most efficient TNT removal and its mineralization by gamma irradiation would be achieved by supersaturating the solution with nitrous oxide before irradiation.

  15. A study of anti-inflammatory and analgesic activity of new 2,4,6-trisubstituted pyrimidines. (United States)

    Yejella, Rajendra Prasad; Atla, Srinivasa Rao


    Chalcone derivatives (3a-m) were prepared by condensing 4-aminoacetophenone with various substituted aromatic and hetero aromatic aldehydes according to Claisen-Schmidt condensation. These chalcones, on reaction with guanidine hydrochloride under basic alcoholic conditions gave 2,4,6-trisubstituted pyrimidines (5a-m) in quantitative yields. All the newly synthesized pyrimidines were characterized by means of IR, ¹H- and ¹³C-NMR, Electron Ionization (EI)-mass and elemental analyses and screened for anti-inflammatory and analgesic activities by in vivo. 2-amino-4-(4-aminophenyl)-6-(2,4-dichlorophenyl)pyrimidine (5b) and 2-amino-4-(4-aminophenyl)-6-(3-bromophenyl) pyrimidine (5d) were found to be the most potent anti-inflammatory and analgesic activity compared with ibuprofen, reference standard. And also it was found that compound 5b identified as lead structure among all in both the activities. Pyrimidines which showed good anti-inflammatory activity also displayed better analgesic activity.

  16. 2,4,6-Trinitrotoluene mineralization and bacterial production rates of natural microbial assemblages from coastal sediments

    International Nuclear Information System (INIS)

    Montgomery, Michael T.; Coffin, Richard B.; Boyd, Thomas J.; Smith, Joseph P.; Walker, Shelby E.; Osburn, Christopher L.


    The nitrogenous energetic constituent, 2,4,6-Trinitrotoluene (TNT), is widely reported to be resistant to bacterial mineralization (conversion to CO 2 ); however, these studies primarily involve bacterial isolates from freshwater where bacterial production is typically limited by phosphorus. This study involved six surveys of coastal waters adjacent to three biome types: temperate broadleaf, northern coniferous, and tropical. Capacity to catabolize and mineralize TNT ring carbon to CO 2 was a common feature of natural sediment assemblages from these coastal environments (ranging to 270+/-38 μg C kg -1 d -1 ). More importantly, these mineralization rates comprised a significant proportion of total heterotrophic production. The finding that most natural assemblages surveyed from these ecosystems can mineralize TNT ring carbon to CO 2 is consistent with recent reports that assemblage components can incorporate TNT ring carbon into bacterial biomass. These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - Highlights: → TNT mineralization is a common feature of natural bacterial assemblages in coastal sediments. → TNT mineralization rates comprised a significant proportion of total heterotrophic production. → These data counter the widely held contention that TNT is recalcitrant to bacterial catabolism of the ring carbon in natural environments. - The capacity to mineralize TNT ring carbon to CO 2 is a common feature of natural bacterial assemblages in coastal sediment.

  17. Curcumin inhibits epigen and amphiregulin upregulated by 2,4,6-trinitrochlorobenzene associated with attenuation of skin swelling. (United States)

    Sakai, Hiroyasu; Sato, Ken; Sato, Fumiaki; Kai, Yuki; Mandokoro, Kazutaka; Matsumoto, Kenjiro; Kato, Shinichi; Yumoto, Tetsuro; Narita, Minoru; Chiba, Yoshihiko


    Contact dermatitis model involving repeated application of hapten is used as a tool to assess dermatitis, as characterized by thickening. Involvement of cell proliferation, elicited by repeated hapten-stimulation, in this swelling has been unclear. Curcumin is reported to reduce inflammation. We examined involvement of cell proliferation and the role of extracellular regulated kinase (ERK) in 2,4,6-trinitrochlorobenzene (TNCB) challenge-induced ear swelling. We also examined the effects of curcumin in this model. Mice were sensitized with TNCB to the abdominal skin. Then, they were challenged with TNCB to the ear three times. The ERK activation inhibitor U0126 or curcumin was applied 30 min before each TNCB challenge. TNCB challenge-induced increased epidermal cell number and dermal thickening. Gene expressions of epithelial mitogen (EPGN), amphiregulin (AREG) and heparin-binding-epidermal growth factor (HB-EGF) were increased in the ears after the last TNCB challenge. Ki-67 immunoreactivity was increased in the dermis in TNCB-challenged ears. TNCB-induced swelling was inhibited by U0126 and curcumin. Curcumin also attenuated TNCB-induced ERK phosphorylation and expression of EPGN and AREG genes. Ear swelling induced by TNCB challenge might be mediated, in part, by the EPGN- and AREG-ERK proliferation pathway and was inhibited by curcumin.

  18. A Facile Approach to Preparing Molecularly Imprinted Chitosan for Detecting 2,4,6-Tribromophenol with a Widely Linear Range

    Directory of Open Access Journals (Sweden)

    Limei Huang


    Full Text Available The environmental pollution of 2,4,6-tribromophenol (TBP has attracted attention. Based on an urgent need for the better provision of clean water, in situ determination of TBP is of great importance. Here, a facile and effective approach for detecting TBP is developed, based on coupling molecular imprinting technique with electrodeposition of chitosan (CS on the gold electrode. The TBP imprinting CS film was fabricated by using CS as functional material and TBP as template molecule. The experiments show that the morphologies and electrochemical properties of the imprinted film sensor was different from non-imprinted film electrode. The current of the imprinted film was linearly proportional to the TBP concentration, with a wide linear range of 1.0 × 10−7 mol•L−1 to 1.0 × 10−3 mol•L−1. By selecting drop-coating method as a reference for controlled trials with the same functional material, the results illustrated that the electrodeposition enjoyed a widely linear range advantage.

  19. Synthesis and Docking Studies of 2,4,6-Trihydroxy-3-Geranylacetophenone Analogs as Potential Lipoxygenase Inhibitor

    Directory of Open Access Journals (Sweden)

    Chean Hui Ng


    Full Text Available The natural product molecule 2,4,6-trihydroxy-3-geranyl-acetophenone (tHGA isolated from the medicinal plant Melicope ptelefolia was shown to exhibit potent lipoxygenase (LOX inhibitory activity. It is known that LOX plays an important role in inflammatory response as it catalyzes the oxidation of unsaturated fatty acids, such as linoleic acid to form hydroperoxides. The search for selective LOX inhibitors may provide new therapeutic approach for inflammatory diseases. Herein, we report the synthesis of tHGA analogs using simple Friedel-Craft acylation and alkylation reactions with the aim of obtaining a better insight into the structure-activity relationships of the compounds. All the synthesized analogs showed potent soybean 15-LOX inhibitory activity in a dose-dependent manner (IC50 = 10.31–27.61 μM where compound 3e was two-fold more active than tHGA. Molecular docking was then applied to reveal the important binding interactions of compound 3e in soybean 15-LOX binding site. The findings suggest that the presence of longer acyl bearing aliphatic chain (5Cs and aromatic groups could significantly affect the enzymatic activity.

  20. Synthesis, molecular structure, spectroscopic properties and stability of (Z)-N-methyl-C-2,4,6-trimethylphenylnitrone (United States)

    Lasri, Jamal; Ismail, Ali I.; Haukka, Matti; Soliman, Saied M.


    New N-methyl-C-2,4,6-trimethylphenylnitrone 1 has been synthesized starting from N-methylhydroxylamine and mesitaldehyde. The product was fully characterized using different spectroscopic techniques; FTIR, NMR, UV-Vis, high resolution mass spectrometry and X-ray diffraction. The relative stability and percent of population of its two possible isomers (E and Z) were calculated using the B3LYP/6-311++G(d,p) method in gas phase and in solution. In agreement with the X-ray results, it was found that Z-isomer is the most stable one in both gas phase and solution. The molecular geometry, vibrational frequencies, gauge-including atomic orbital (GIAO), and chemical shift values were also calculated using the same level of theory. The TD-DFT results of the studied nitrone predicted a π-π∗ transition band at 285.1 nm (fosc = 0.3543) in the gas phase. The rest of the spectral bands undergo either hyperchromic or hypsochromic shifts in the presence of solvent. Polarizability and HOMO-LUMO gap values were used to predict the nonlinear optical properties (NLO) of the studied compound. NBO analysis has been used to determine the most accurate Lewis structure of the studied molecule.

  1. Extraction-less, rapid assay for the direct detection of 2,4,6-trichloroanisole (TCA) in cork samples. (United States)

    Apostolou, Theofylaktos; Pascual, Nuria; Marco, M-Pilar; Moschos, Anastassios; Petropoulos, Anastassios; Kaltsas, Grigoris; Kintzios, Spyridon


    2,4,6-trichloroanisole (TCA), the cork taint molecule, has been the target of several analytical approaches over the few past years. In spite of the development of highly efficient and sensitive tools for its detection, ranging from advanced chromatography to biosensor-based techniques, a practical breakthrough for routine cork screening purposes has not yet been realized, in part due to the requirement of a lengthy extraction of TCA in organic solvents, mostly 12% ethanol and the high detectability required. In the present report, we present a modification of a previously reported biosensor system based on the measurement of the electric response of cultured fibroblast cells membrane-engineered with the pAb78 TCA-specific antibody. Samples were prepared by macerating cork tissue and mixing it directly with the cellular biorecognition elements, without any intervening extraction process. By using this novel approach, we were able to detect TCA in just five minutes at extremely low concentrations (down to 0.2 ppt). The novel biosensor offers a number of practical benefits, including a very considerable reduction in the total assay time by one day, and a full portability, enabling its direct employment for on-site, high throughput screening of cork in the field and production facilities, without requiring any type of supporting infrastructure. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. 3D Visualization of Developmental Toxicity of 2,4,6-Trinitrotoluene in Zebrafish Embryogenesis Using Light-Sheet Microscopy

    Directory of Open Access Journals (Sweden)

    Juneyong Eum


    Full Text Available Environmental contamination by trinitrotoluene is of global concern due to its widespread use in military ordnance and commercial explosives. Despite known long-term persistence in groundwater and soil, the toxicological profile of trinitrotoluene and other explosive wastes have not been systematically measured using in vivo biological assays. Zebrafish embryos are ideal model vertebrates for high-throughput toxicity screening and live in vivo imaging due to their small size and transparency during embryogenesis. Here, we used Single Plane Illumination Microscopy (SPIM/light sheet microscopy to assess the developmental toxicity of explosive-contaminated water in zebrafish embryos and report 2,4,6-trinitrotoluene-associated developmental abnormalities, including defects in heart formation and circulation, in 3D. Levels of apoptotic cell death were higher in the actively developing tissues of trinitrotoluene-treated embryos than controls. Live 3D imaging of heart tube development at cellular resolution by light-sheet microscopy revealed trinitrotoluene-associated cardiac toxicity, including hypoplastic heart chamber formation and cardiac looping defects, while the real time PCR (polymerase chain reaction quantitatively measured the molecular changes in the heart and blood development supporting the developmental defects at the molecular level. Identification of cellular toxicity in zebrafish using the state-of-the-art 3D imaging system could form the basis of a sensitive biosensor for environmental contaminants and be further valued by combining it with molecular analysis.

  3. Quantitative SERS detection of low-concentration aromatic polychlorinated biphenyl-77 and 2,4,6-trinitrotoluene. (United States)

    Bao, Zhi Yong; Liu, Xin; Chen, Y; Wu, Yucheng; Chan, Helen L W; Dai, Jiyan; Lei, Dang Yuan


    This paper reports a simple label-free high-sensitive method for detecting low-concentration persistent organic pollutants and explosive materials. The proposed method combines surface-enhanced Raman spectroscopy (SERS) and magnetomotive enrichment of the target molecules on the surface of Ag nanoparticles (NPs). This structure can be achieved through self-assembling integration of Ag NPs with ferromagnetic Fe3O4 microspheres, forming a hybrid SERS nanoprobe with both optical and magnetic properties. Moreover, the magnetic response of ferromagnetic Fe3O4 microspheres can be used to dynamically modulate the optical property of Ag NPs through controlling their geometric arrangement on the substrate by applying an external magnetic field. It is also demonstrated from the full-wave numerical simulation results that the maximum electromagnetic field enhancement can be greatly increased by shortening the distance of neighboring Ag NPs and therefore resulting in an improved SERS detecting limit. More importantly, by using the prepared substrate, the SERS signals from organic pollution substances, i.e. aromatic polychlorinated biphenyl-77 and 2,4,6-trinitrotoluene, were quantitatively analyzed. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. A combination of p53-activating APR-246 and phosphatidylserine-targeting antibody potently inhibits tumor development in hormone-dependent mutant p53-expressing breast cancer xenografts

    Directory of Open Access Journals (Sweden)

    Liang Y


    Full Text Available Yayun Liang,1 Benford Mafuvadze,1 Cynthia Besch-Williford,2 Salman M Hyder1 1Deparment of Biomedical Sciences and Dalton Cardiovascular Research Center, Columbia, MO, USA; 2IDEXX BioResearch, Columbia, MO, USA Background: Between 30 and 40% of human breast cancers express a defective tumor suppressor p53 gene. Wild-type p53 tumor suppressor protein promotes cell-cycle arrest and apoptosis and inhibits vascular endothelial growth factor–dependent angiogenesis, whereas mutant p53 protein (mtp53 lacks these functions, resulting in tumor cell survival and metastasis. Restoration of p53 function is therefore a promising drug-targeted strategy for combating mtp53-expressing breast cancer. Methods: In this study, we sought to determine whether administration of APR-246, a small-molecule drug that restores p53 function, in combination with 2aG4, an antibody that targets phosphatidylserine residues on tumor blood vessels and disrupts tumor vasculature, effectively inhibits advanced hormone-dependent breast cancer tumor growth. Results: APR-246 reduced cell viability in mtp53-expressing BT-474 and T47-D human breast cancer cells in vitro, and significantly induced apoptosis in a dose-dependent manner. However, APR-246 did not reduce cell viability in MCF-7 breast cancer cells, which express wild-type p53. We next examined APR-246’s anti-tumor effects in vivo using BT-474 and T47-D tumor xenografts established in female nude mice. Tumor-bearing mice were treated with APR-246 and/or 2aG4 and tumor volume followed over time. Tumor growth was more effectively suppressed by combination treatment than by either agent alone, and combination therapy completely eradicated some tumors. Immunohistochemistry analysis of tumor tissue sections demonstrated that combination therapy more effectively induced apoptosis and reduced cell proliferation in tumor xenografts than either agent alone. Importantly, combination therapy dramatically reduced the density of blood

  5. Microwave assisted facile synthesis of {1/1,3-bis/1,3,5-tris-[(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene]} using bismuth nitrate pentahydrate as an eco-friendly nitrating agent

    International Nuclear Information System (INIS)

    Badgujar, D.M.; Talawar, M.B.; Asthana, S.N.; Venugopalan, S.; Rao, A. Subhananda; Mahulikar, P.P.


    1-(2-Nitroxyethylnitramino)-2,4,6-trinitrobenzene (3a), 1,3-bis(2-nitroxyethyl nitramino)-2,4,6-trinitrobenzene (3b) and 1,3,5-tris(2-nitroxyethylnitramino)-2,4,6-trinitrobenzene (3c) were prepared by the nitration of 1-(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2a) 1,3-bis(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2b) and 1,3,5-tris(2-hydroxyethylamino)-2,4,6-trinitrobenzene (2c) using bismuth nitrate pentahydrate (eco-friendly nitrating agent) in tetrahydrofuran adsorbed on silica gel under microwave irradiation, respectively. Key intermediate compounds viz., 2a, 2b and 2c were synthesized by condensing picryl chloride, styphnyl chloride and 1,3,5-trichloro-2,4,6-trinitrobenzene with ethanol amine, respectively, based on the lines of the reported method. The synthesized compounds were characterized based on their physical constant, infrared (IR) spectroscopy and 1 H nuclear magnetic resonance (NMR) spectroscopy. The spectroscopic data obtained indicated the formation of nitrate esters (3a-3c). The nitration methodology adopted in the present study is of relevance in the context of green chemistry. The target compounds (3a-3c) synthesized using eco-friendly approach are of interest from the point of high energy materials (HEMs)

  6. Tetraphenylphosphonium iodide–1,3,5-trifluoro-2,4,6-triiodobenzene–methanol (3/4/1

    Directory of Open Access Journals (Sweden)

    Gabriella Cavallo


    Full Text Available The crystallization of a 1:1 molar solution of 1,3,5-trifluoro-2,4,6-diiodobenzene (TFTIB and tetraphenylphosponium iodide (TPPI from methanol produced tetragonal needles of pure TPPI and tabular pseudo-hexagonal truncated bipyramids of the title compound, 3C24H20P+·3I−·4C6F3I3·CH4O or (TPPI3(TFTIB4·MeOH. The asymmetric unit is composed of six TPPI molecules, eight TFTIB molecules and two methanol molecules, overall 16 constituents. The formation of the architecture is essentially guided by a number of C—I...I− halogen bonds (XB, whose lengths are in the range 3.276 (1–3.625 (1 Å. Layers of supramolecular polyanions are formed parallel to (10-1 wherein iodide anions function as penta-, tetra- or bidentate XB acceptors. The structure is not far from being P21/n, but the centrosymmetry is lost due to a different conformation of a single couple of cations and the small asymmetry in the formed supramolecular anion. One methanol molecule is hydrogen bonded to an iodide anion, while the second is linked to the first one via an O—H...O contact. This second methanol molecule is more loosely pinned in its position than the first and presents very high anisotropic displacement parameters and a seeming shortening of the C—O bond length. The crystal studied was refined as a perfect inversion twin.


    Directory of Open Access Journals (Sweden)



    Full Text Available INTRODUCTION: Post - operative restlessness is observed commonly among children following Ear Nose Throat surgeries. This post anesthetic problem is also termed as Emergence Agitation (EA which interferes with patient’s recovery, presenting a challenging task to the ane sthetist in terms of assessment and convincing the parents. Many factors play a role singly or in combination in producing EA. EA consist of restlessness, excessive crying and spells of breath holding, head banging and incoherent speech. In this prospectiv e clinical study the incidence of post - operative recovery restlessness EA in children aged between 3 to 12 years, enumeration of the causes, and prediction of EA in Indian population. MATERIALS AND METHODS: 246 Children undergoing elective surgeries of Ear Nose and throat are selected and their demographic data, socio - economic back ground and emotional attachment with parents were elicited. Parents of the children were interviewed prior to surgery using a questionnaire enquiring of their children’s personal ity, and emotional attachment and meekness. Their preoperative clinical data are documented. Their post - operative general condition, behavior, time taken for awakening, period of total recovery and treatment factors are recorded and analyzed. RESULTS: The incidence of EA was found in 23.6% of the children. EA lasted between 21 minutes to 52 minutes with a mean period of 28.4±9.5 minutes. 67% of the children required medication with sedatives, analgesics and anti - emetics. Post - operative stay in the Surgical ICU ranged between Hrs . 3.12±0.36mts to Hrs . 8.39±2.10mts in the children showing restlessness, compared to those not showing agitation. CONCLUSIONS: The factors associated with EA were, age, emotional attachment, meekness, adaptability, previous surgery, analgesics, sedatives, dose of pentothal sodium for induction, time taken for awakening and duration of surgery. Shorter was the time of awakening

  8. Selective fluorescence response and magnetic separation probe for 2,4,6-trinitrotoluene based on iron oxide magnetic nanoparticles. (United States)

    Zou, Wen-Sheng; Wang, Ya-Qin; Wang, Feng; Shao, Qun; Zhang, Jun; Liu, Jin


    Despite the rapid development of nanomaterials and nanotechnology, it is still desirable to develop novel nanoparticle-based techniques which are cost-effective, timesaving, and environment-friendly, and with ease of operation and procedural simplicity, for assay of target analytes. In the work discussed in this paper, the dye fluorescein isothiocyanate (FITC) was conjugated to 1,6-hexanediamine (HDA)-capped iron oxide magnetic nanoparticles (FITC-HDA Fe3O4 MNPs), and the product was characterized. HDA ligands on the surface of Fe3O4 MNPs can bind 2,4,6-trinitrotoluene (TNT) to form TNT anions by acid-base pairing interaction. Formation of TNT anions, and captured TNT substantially affect the emission of FITC on the surface of the Fe3O4 MNPs, resulting in quenching of the fluorescence at 519 nm. A novel FITC-HDA Fe3O4 MNPs-based probe featuring chemosensing and magnetic separation has therefore been constructed. i.e. FITC-HDA Fe3O4 MNPs had a highly selective fluorescence response and enabled magnetic separation of TNT from other nitroaromatic compounds by quenching of the emission of FITC and capture of TNT in aqueous solution. Very good linearity was observed for TNT concentrations in the range 0.05-1.5 μmol L(-1), with a detection limit of 37.2 nmol L(-1) and RSD of 4.7 % (n = 7). Approximately 12 % of the total amount of TNT was captured. The proposed methods are well-suited to trace detection and capture of TNT in aqueous solution.

  9. Transplacental transport and fetal localization of bispehnol A, tetrabromobisphenol A and 2,4,6-tribromophenol in mice

    Energy Technology Data Exchange (ETDEWEB)

    Sundberg, A.; Brunstroem, B.; Brandt, I. [Uppsala Univ. (Sweden). Dept. of Environmental Toxicology; Cantillana, T.; Bergman, Aa. [Stockholm Univ. (Sweden). Dept. of Environmental Chemistry


    Bisphenol A (BPA) is an intermediate in the production of epoxy resins, while its brominated derivative tetrabromobishenol A (TBBPA) and its photolysis degradation product 2,4,6-tribromophenol (TBP) are widely used flame retardants. These brominated compounds have been identified in human blood. TBBPA, TBP and a number of 4-hydroxy-PCBs (e.g. 4-OH-CB107) are high affinity ligands for the thyroxin (T4) transporter transthyretin (TTR) in rodents and other species. Displacement of T4 from the TTR binding site has been proposed as an important mechanism of endocrine disruption by certain halogenated phenolic environmental pollutants. BPA is a fairly potent environmental estrogen receptor agonist that can induce an array of estrogenic effects in several species including mammals, birds and fish. Although the estrogenic activity of TBBPA is less obvious, this brominated BPA analog has been reported to interact with the estrogen receptor and induce estrogenic effects in some in vitro test systems. While the reproductive and developmental toxicity of BPA is well documented, there is evidence that also halogenated phenolic compounds can pass the placental barrier and induce such toxicity. Within the objectives of the COMPARE EU project we study the fetal and maternal kinetics and transplacental transport of phenolic environmental pollutants in pregnant mice. To explore the role of TTR in the placental and blood-brain barrier transport, we employ TTR-deficient mice. For comparative reasons, we also explore the transfer to bird embryos following injection into the yolk or administration to the egg-laying bird. In the present communication, we report on the disposition of BPA, TBBPA and TBP in the fetoplacental unit in pregnant wild-type mice.

  10. Outcomes and prognostic factors in revision hip arthroplasty for severe intra-pelvic cup protrusion: 246 cases. (United States)

    Epinette, J-A; Mertl, P; Combourieu, B; Goncalves, H; Blairon, A; Ehlinger, M; Tabutin, J


    The outcome of revision total hip arthroplasty (THA) for intra-pelvic cup protrusion is unclear. Hence, we conducted a large retrospective study to clarify the surgical strategy (hip lever arm and cup mechanical fixation) and the outcomes of reconstruction for severe intra-pelvic cup protrusion. We hypothesized that restoration of the anatomic hip centre in such acetabular revisions decreased the risk of recurrent loosening. The study included 246 THA procedures (in 220 patients), with a follow-up of 5.2 ± 4.9 years (1-24.2) after the index surgery. Bone loss was estimated using the SOFCOT classification (grade III or IV in 80% of cases) and the Paprosky classification (IIIA or IIIB in 58% of cases). Quality of the reconstruction was assessed on X-rays according to the correction of the protrusion and position of the hip centre of rotation. After a clinical follow-up of at least 5 years, with a mean of 9.9 ± 4.1 years (5-24 years), the mean Postel-Merle d'Aubigné score was 14.2 ± 3.1 and the mean Harris Hip Score was 78.0 ± 18.7. Cup protrusion was partially or completely corrected in every case and cup position was normal in 27 (11%) cases. The centre of rotation was within 10mm of the physiological position in 158 (64.2%) cases, acceptable in 77 (31.3%) cases, ascended in 9 (3.7%) cases, and worsened in 1 (0.4%) case. Revision for cup or cup and femoral failures was required in 24 (9.8%) cases. Cumulative survival rates with cup loosening as the endpoint were 88.5% after 5 years, 79.9% after 10 years, and 63.9% at last follow-up at 13.6 years. Our hypothesis that restoration of anatomic hip centre decreased the risk of recurrent loosening was not verified: success or failure in restoring the normal centre of rotation did not correlate significantly with final cup status. Recurrent aseptic loosening was the cause of failure in 9.8% of cases. Ensuring long-term effective mechanical stability had a greater impact on global outcomes than restoring an ideal

  11. Visceral hypersensitivity is provoked by 2,4,6-trinitrobenzene sulfonic acid-induced ileitis in rats

    Directory of Open Access Journals (Sweden)

    Manoj Kumar Shah


    Full Text Available Background and Aims: Crohn’s Disease (CD, a chronic Inflammatory Bowel Disease, can occur in any part of the gastrointestinal tract, but most frequently in the ileum. Visceral hypersensitivity contributes for development of chronic abdominal pain in this disease. Currently, the understanding of the mechanism underlying hypersensitivity of Crohn’s ileitis has been hindered by a lack of specific animal model. The present study is undertaken to investigate the visceral hypersensitivity provoked by 2,4,6-trinitrobenzene sulfonic (TNBS-induced ileitis rats.Methods: Male Sprague-Dawley rats were anaesthetized and laparotomized for intraileal injection of TNBS (0.6 ml, 80 mg/kg body weight in 30% ethanol, n = 48, an equal volume of 30% Ethanol (n = 24 and Saline (n = 24, respectively. Visceral hypersensitivity was assessed by visceromotor responses (VMR to 20, 40, 60, 80 and 100 mmHg colorectal distension pressure (CRD at day 1, 3, 7, 14, 21 and 28. Immediately after CRD test, the rats were euthanized for collecting the terminal ileal segment for histopathological examinations and ELISA of myleoperoxidase and cytokines (TNF-α, IL-1β, IL-6, and dorsal root ganglia (T11 for determination of calcitonin gene-related peptide by immunohistochemistry, respectively. Results: Among all groups, TNBS-treatment showed transmural inflammation initially at 3 days, reached maximum at 7 days and persisted up to 21 days. The rats with ileitis exhibited (P < 0.05 VMR to CRD at day 7 to day 21. The calcitonin gene-related peptide-immunoreactive positive cells increased (P < 0.05 in dorsal root ganglia at day 7 to 21, which was persistently consistent with visceral hypersensitivity in TNBS-treated rats.Conclusions: TNBS injection into the ileum induced transmural ileitis including granuloma and visceral hypersensitivity. As this model mimics clinical manifestations of CD, it may provide a road map to probe the pathogenesis of gut inflammation and visceral

  12. Uptake of 2,4,6-Trinitrotoluene (TNT) by Vetiver grass (Vetiviera ziznoides L.) -- Preliminary results from a hydroponic study (United States)

    Shakya, K. M.; Sarkar, D.; Datta, R.; Makris, K.; Pachanoor, D.


    2,4,6-Trinitrotoluene(TNT) is a potent mutagen and a Group C human carcinogen that has been widely used to produce munitions and explosives. As a result, vast areas that have been previously used as military ranges, munition burning and open detonation sites have been heavily contaminated with TNT. Conventional remedial activities in such contaminated sites commonly rely on methods such as incineration, land filling and soil composting. Phytoremediation offers a cost-effective solution, utilizing plants to phytoextract TNT from the contaminated soil. We propose the use of vetiver grass (Vetiveria zizanoides) to remove TNT from such contaminated soils. Vetiver is a fast-growing and adaptive grass, enabling its use in TNT-contaminated sites in a wide variety of soil types and climate. We also hypothesized that TNT removal by vetiver grass will be enhanced by utilizing a chaotropic agent (urea) to alter rhizosphere/root hair chemical environment. The objectives of this preliminary hydroponic study were: i) to investigate the effectiveness of vetiver grass in removing TNT from solution, and ii) to evaluate the use of a common agrochemical (urea) in enhancing TNT removal by vetiver grass. Vetiver plants were grown in a hydroponic system with five different TNT concentrations (0, 5, 10, 25, and 50 mg TNT L-1) and three urea concentrations (0, 0.01 and 0.1%). A plant density of 10 g L-1 and three replicate vessels per treatment were used. Aliquots were collected at several time intervals up to 192 hour, and were analyzed for TNT with HPLC. Results showed that vetiver was able to remove TNT from hydroponic solutions. The overall magnitude and kinetics of TNT removal by vetiver grass was enhanced in the presence of urea. TNT removal kinetics depended on TNT and urea initial concentrations, suggestive of second-order kinetic reactions. Preliminary results are encouraging, but in need for verification using more detailed studies involving TNT-contaminated soils. Ongoing

  13. PRIMA-1Met/APR-246 induces apoptosis and tumor growth delay in small cell lung cancer expressing mutant p53

    DEFF Research Database (Denmark)

    Zandi, Roza; Selivanova, Galina; Christensen, Camilla Laulund


    Small cell lung cancer (SCLC) is a highly malignant disease with poor prognosis, necessitating the need to develop new and efficient treatment modalities. PRIMA-1(Met) (p53-dependent reactivation of massive apoptosis), also known as APR-246, is a small molecule, which restores tumor suppressor...... function to mutant p53 and induces cancer cell death in various cancer types. Since p53 is mutated in more than 90% of SCLC, we investigated the ability of PRIMA-1(Met) to induce apoptosis and inhibit tumor growth in SCLC with different p53 mutations....

  14. Template synthesis, characterization and antimicrobial activity of the complex combinations of some transitional metals with isonicotinoylhydrazone -2,4,6- trimethylbenzaldehyde

    International Nuclear Information System (INIS)

    Mitu, L.ITU; Imran, M.


    The complexes of Cu(II), Ni(II), Co(II), Mn(II), and Zn(II) with isonicotinoyl-hydrazone -2,4,6-trimethylbenzaldehyde (INHTB) are reported. The complexes have been characterized by analytical data, IR, UV-Vis, NMR spectra, magnetic susceptibility, thermal analysis and for the Cu(II) complex the ESR spectrum has been recorded. The anti-bacterial activity of these complexes were investigated against Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella enteritidis, Shigella flexneri bacteria. The INHTB ligand is coordinated at the metallic ions by oxygen amide (O=C) and the azomethine nitrogen. (author)


    Directory of Open Access Journals (Sweden)

    Pramuko Ilmu Purboputro


    Full Text Available Ikatan interfacal bonding pada komposit serat alam sangat tergantung dari kekasaran permukaan serat. Permukaan serat dapat ditingkatkan daya ikatan permukaannya dengan cara mencelupkan pada larutan alkali. Pencelupan ini akan mengurangi lapisan lignin yang mengurangi kekuatan ikat pada permukaan serat. Pada penelitian ini proses yang digunakan adalah perlakuan alkali terhadap permukaan serat dengan  cara merendam serat rami selama 2,4,6, dan 8 jam. Larutah alkali yang digunakan adalah larutan NaOH dengan konsentrasi 10% pada pelarut air. Serat rami   Boehmeria nivea (L Goud direndam pada larutan NaOH selama 2,4,6, dan 8 jam perendaman, untuk menghilangkan zat ligninnya agar kekuatan ikatan permukaan bisa diperbaiki.  Pengujian yang dilakukan adalah pengujian tarik dan pengujian impak. Hasil yang didapat adalah kekuatan tarik terbesar didapat pada perendaman 8 jam yaitu sebesar 41,9 MPa. Modulus young terbesar didapat pada perendaman 2 jam, yaitu 2743,15 Mpa, dan kekuatan impak terbesar adalah 0,0725 Joule/mm2 terjadi pada perendaman 4 jam   Kata kunci : komposit serat, kekuatan tarik, kekuatan impak, perendaman alkali

  16. Vanillin Analogues o-Vanillin and 2,4,6-Trihydroxybenzaldehyde Inhibit NFĸB Activation and Suppress Growth of A375 Human Melanoma. (United States)

    Marton, Annamária; Kúsz, Erzsébet; Kolozsi, Csongor; Tubak, Vilmos; Zagotto, Giuseppe; Buzás, Krisztina; Quintieri, Luigi; Vizler, Csaba


    Constitutive activation of nuclear factor kappa-B (NFĸB) is a hallmark of various cancer types, including melanoma. Chemotherapy may further increase tumour NFĸB activity, a phenomenon that, in turn, exacerbates drug resistance. This study aimed at preliminary screening of a panel of aromatic aldehydes, including vanillin, for cytotoxicity and suppression of tumour cell NFĸB activity. The cytotoxic and NFĸB-inhibitory effects of 10 aromatic aldehydes, including vanillin, were investigated in cultured A375 human melanoma cells. Each compound was assayed alone and in combination with the model NFĸB-activating drug doxorubicin. The most promising analogues were then tested alone and in combination with 4-hydroperoxycyclophosphamide in vitro, and with cyclophosphamide in mice bearing A375 xenografts. The vanillin analogues o-vanillin and 2,4,6-trihydroxybenzaldehyde exhibited cytotoxicity against cultured A375 cells, and inhibited doxorubicin- and 4-hydroperoxycyclophosphamide-induced NFĸB activation. They also suppressed A375 cell growth in mice. o-vanillin and 2,4,6-trihydroxybenzaldehyde deserve further evaluation as potential anticancer drugs. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

  17. The first detection of ionized helium in the local ISM - EUVE and IUE spectroscopy of the hot DA white dwarf GD 246 (United States)

    Vennes, Stephane; Dupuis, Jean; Rumph, Todd; Drake, Jeremy; Bowyer, Stuart; Chayer, Pierre; Fontaine, Gilles


    We report observations of the extreme ultraviolet spectrum of the hot degenerate star GD 246 obtained with the EUVE. Our initial attempt at modeling the photospheric emission from the white dwarf reveals a relatively uncontaminated pure H spectrum in the range above 200 A, allowing a study of interstellar continuum absorption features in the line of sight of GD 246. Modeling of the He I autoionization transition discussed by Rumph et al. (1993), and the EUV continuum using the white dwarf as a source of background radiation provides measurements of both neutral and, for the first time, singly ionized He column densities in the local ISM (LISM). We estimate the He ionization fraction He II/(He I + He II) at roughly 25 percent with a total He column of 1.40-1.65 x 10 exp 18/sq cm. We have measured and compared H I column densities from the saturated Ly-alpha ISM absorption in IUE high-dispersion spectroscopy and from EUV continuum absorption: the two measurements are in good agreement with a total H column of 1.2-1.6 x 10 exp 19/sq cm. We discuss some implications for the nature of the LISM, particularly in the context of current models of the EUV radiation field.

  18. Fungal strains isolated from cork stoppers and the formation of 2,4,6-trichloroanisole involved in the cork taint of wine. (United States)

    Prak, Sina; Gunata, Ziya; Guiraud, Joseph-Pierre; Schorr-Galindo, Sabine


    Cork taint is mainly due to 2,4,6-trichloroanisole (TCA) produced through the activity of undesirable fungal strains. We observed that CFU mould number in TCA-containing stoppers was not quantitatively different to that of the stoppers not containing TCA (ca. 10(5)CFU/g). In contrast more fungi diversity was observed in TCA-containing stoppers. Penicillium spp (Penicillium chrysogenum, Penicillium glabrum), Aspergillus spp (Aspergillus niger and Aspergillus oryzae), Chrysonilia sitophila, Mucor racemosus, Paecilomyces sp. and Trichoderma viride were found in TCA-containing stoppers, while C. sitophila and Penicillium sp. were the main fungi in the stoppers devoid of TCA. Conidia were numerous close to the lenticels and present from the lateral surface through to the centre of the stoppers. Strains of Aspergillus, Mucor, Paecilomyces, Penicillium and Trichoderma isolated from TCA-containing stoppers were able to convert 2,4,6-trichlorophenol (TCP) in TCA in resting cell or growing conditions. The best yields of conversion were obtained by green fungi Paecilomyces sp. and P. chrysogenum, 17% and 20%, respectively. Chysonilia sitophila and Penicillium sp. did not produce TCA from TCP in our conditions.

  19. Micelle-Assisted Synthesis of Al2O3·CaO Nanocatalyst: Optical Properties and Their Applications in Photodegradation of 2,4,6-Trinitrophenol

    Directory of Open Access Journals (Sweden)

    Ayesha Imtiaz


    Full Text Available Calcium oxide (CaO nanoparticles are known to exhibit unique property due to their high adsorption capacity and good catalytic activity. In this work the CaO nanocatalysts were prepared by hydrothermal method using anionic surfactant, sodium dodecyl sulphate (SDS, as a templating agent. The as-synthesized nanocatalysts were further used as substrate for the synthesis of alumina doped calcium oxide (Al2O3·CaO nanocatalysts via deposition-precipitation method at the isoelectric point of CaO. The Al2O3·CaO nanocatalysts were characterized by FTIR, XRD, TGA, TEM, and FESEM techniques. The catalytic efficiencies of these nanocatalysts were studied for the photodegradation of 2,4,6-trinitrophenol (2,4,6-TNP, which is an industrial pollutant, spectrophotometrically. The effect of surfactant and temperature on size of nanocatalysts was also studied. The smallest particle size and highest percentage of degradation were observed at critical micelle concentration of the surfactant. The direct optical band gap of the Al2O3·CaO nanocatalyst was found as 3.3 eV.

  20. Thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine – Synthesis, structure and luminescence properties

    International Nuclear Information System (INIS)

    Nawrot, I.; Machura, B.; Kruszynski, R.


    Two new thiocyanate cadmium(II) complexes of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized and characterized. The resulted complexes [Cd(SCN)(NO 3 )(tptz)(H 2 O)] (1) and [Cd(SCN) 2 (tptz)(MeOH)] (2) were studied by IR, UV–vis spectroscopy and single crystal X-ray analysis. The luminescent properties of 1 and 2 were studied in solution and solid state and compared with the free ligand. To get detailed insight into the electronic structure and spectroscopic properties of [Cd(SCN)(NO 3 )(tptz)(H 2 O)] and [Cd(SCN) 2 (tptz)(MeOH)], the density functional theory (DFT) and time-dependent DFT (TD-DFT) calculations were performed. - Highlights: • Two novel thiocyanate cadmium(II) compounds of 2,4,6-tri(2-pyridyl)-1,3,5-triazine were synthesized. • The compounds were identified by IR, UV–vis spectroscopy and X-ray analysis. • The fluorescence properties of the complexes were examined and compared with the free ligand. • The electronic spectra were investigated at the TD-DFT level employing B3LYP/LANL2DZ

  1. Effect of the Mg/Al Ratio on Activated Sol-Gel Hydrotalcites for Photocatalytic Degradation of 2,4,6-Trichlorophenol

    Directory of Open Access Journals (Sweden)

    Esthela Ramos-Ramírez


    Full Text Available Currently, interest has grown in finding effective solutions for the treatment of water pollution by toxic compounds. Some of the latter that have acquired importance are phenols and chlorophenols, due to their employment in the manufacture of pesticides, insecticides, cords of wood, paper industry, among others. The problem is rooted in that these compounds are very persistent in the environment because they are partially biodegradable and cannot be photodegraded directly by sunlight. Chlorophenols are extremely toxic, especially 2,4,6-trichlorophenol, which is potentially carcinogenic. In this work, Mg/Al-mixed oxide catalysts were obtained from the thermal treatment of hydrotalcite-type materials, synthesized by sol-gel method with different Mg/Al ratios. Hydrotalcites and Mg/Al-mixed oxides were physicochemically characterized by X-ray diffraction, thermal analysis (DTA and TGA, and N2 physisorption. The results were obtained on having proven the photocatalytic degradation of 2,4,6-trichlorophenol as a pollutant model by water. The catalysts obtained present the hydrotalcite phase with thermal evolution until achieving Mg/Al-mixed oxides at 500°C. The catalysts are of mesoporous materials and exhibiting large surface areas. The catalysts demonstrated good photocatalytic activity with good efficiency, reaching degradation percentages with Mg/Al = 1, 2, 4, 5, and 7 ratios of 94.2, 92.5, 86.2, 84.2, and 63.9%, respectively, until achieving mineralization.

  2. Hexaaquabis[3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanido-κ2N3,O4]barium tetrahydrate

    Directory of Open Access Journals (Sweden)

    Nguyen Dinh Do


    Full Text Available In the title compound, [Ba(C7H5N2O52(H2O6]·4H2O, the Ba2+ cation lies on a twofold rotation axis and is ten-coordinated by two 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide oxo O atoms [Ba—O = 2.8715 (17 Å], two hydroxyimino N atoms [Ba—N = 3.036 (2 Å], and six water molecules [Ba—O = 2.847 (2, 2.848 (2, and 2.880 (2 Å]. The 3,5-bis(hydroxyimino-1-methyl-2,4,6-trioxocyclohexanide monoanions act in a bidentate chelating manner, coordinating through an N atom of the non-deprotonated hydroxyimino group and an O atom of the neighboring oxo group. Two lattice water molecules are located in the cavities of the framework and are involved in hydrogen bonding to O atoms of one of the coordinating water molecules and the O atom of a keto group of the ligand. As a result, a three-dimensional network is formed.

  3. Synthesis of novel tripodal-benzimidazole from 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine: Structural, electrochemical and antimicrobial studies

    International Nuclear Information System (INIS)

    Koc, Ziya Erdem; Bingol, Haluk; Saf, Ahmet O.; Torlak, Emrah; Coskun, Ahmet


    Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, 1 H NMR, 13 C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu 4 ] [PF 6 ]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO 2 derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.

  4. Graphene-based electrochemical sensor for detection of 2,4,6-trinitrotoluene (TNT) in seawater: the comparison of single-, few-, and multilayer graphene nanoribbons and graphite microparticles. (United States)

    Goh, Madeline Shuhua; Pumera, Martin


    The detection of explosives in seawater is of great interest. We compared response single-, few-, and multilayer graphene nanoribbons and graphite microparticle-based electrodes toward the electrochemical reduction of 2,4,6-trinitrotoluene (TNT). We optimized parameters such as accumulation time, accumulation potential, and pH. We found that few-layer graphene exhibits about 20% enhanced signal for TNT after accumulation when compared to multilayer graphene nanoribbons. However, graphite microparticle-modified electrode provides higher sensitivity, and there was no significant difference in the performance of single-, few-, and multilayer graphene nanoribbons and graphite microparticles for the electrochemical detection of TNT. We established the limit of detection of TNT in untreated seawater at 1 μg/mL.

  5. Crystal structure of 4,4′,4′′-(1,3,5-triazine-2,4,6-triyltripyridinium trichloride 2.5-hydrate

    Directory of Open Access Journals (Sweden)

    Bo-Kai Ling


    Full Text Available The asymmetric unit of the title compound, C18H15N63+·3Cl−·2.5H2O, contains two independent (1,3,5-triazine-2,4,6-triyltripyridinium cations. Both cations are approximately planar, the r.m.s. deviations of fitted non-H atoms being 0.045 and 0.051 Å. In the crystal, extensive O—H...Cl, O—H...O, N—H...Cl and N—H...O hydrogen bonds and weak C—H...Cl and C—H...O interactions link the organic cations, Cl− anions and water molecules into a three-dimensional supramolecular architecture. π–π stacking between the pyridine rings of adjacent cations is also observed, the centroid-to-centroid distance being 3.7578 (8 Å.

  6. Synthesis of novel tripodal-benzimidazole from 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine: Structural, electrochemical and antimicrobial studies

    Energy Technology Data Exchange (ETDEWEB)

    Koc, Ziya Erdem, E-mail: [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Bingol, Haluk; Saf, Ahmet O. [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey); Torlak, Emrah [Provincial Control Laboratory, Konya (Turkey); Coskun, Ahmet [Department of Chemistry, Faculty of Science, Selcuk University, 42031 Konya (Turkey)


    Four new tripodal-benzimidazole derivatives were synthesized by Schiff base reaction between 2,4,6-tris(p-formylphenoxy)-1,3,5-triazine (TRIPOD) and different diamine derivatives. The structures of the obtained compounds were identified by FT-IR, {sup 1}H NMR, {sup 13}C NMR and UV-vis spectral data, thermal analysis and elemental analysis. Electrochemical behaviors of the compounds were studied by cyclic voltammetry in DMF including 0.1 M [NBu{sub 4}] [PF{sub 6}]. The voltammograms showed peaks having similar characteristics except tripodal-benzimidazole including -NO{sub 2} derivative. In addition, their antimicrobial activities were evaluated by using the standard disk diffusion method in dimethylformamide media. The activities were determined against 4 bacteria cultures by comparing to those of gentamycin.

  7. Fabrication of surface plasmon resonance sensor surface with control of the nonspecific adsorption and affinity for the detection of 2,4,6-trinitrotoluene using an antifouling copolymer

    Directory of Open Access Journals (Sweden)

    Rui eYatabe


    Full Text Available We fabricated a surface plasmon resonance (SPR sensor using a hydrophilic polymer for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. The hydrophilic polymer was made from mono-2-(methacryloyloxyethylsuccinate (MES and 2-hydroxyethylmethacrylate (HEMA by surface-initiated atom transfer radical polymerization (SI-ATRP. The detection of TNT was carried out by displacement assay with the SPR measurement. In displacement assay, the affinity between anti-TNT antibody and the sensor surface, affects to the sensitivity. In the SPR measurement, nonspecific adsorption should be controlled because SPR sensor cannot discriminate between specific and nonspecific adsorption. Therefore, the affinity and nonspecific adsorption were controlled by changing the ratio of HEMA to MES. A detection limit of 0.4 ng/ml (ppb for TNT was achieved using a sensor surface with the lowest affinity without nonspecific adsorption.

  8. Growth and characterization of barium complex of 1,3,5-triazinane-2,4,6-trione in gel: a corrosion inhibiting material (United States)

    Divya, R.; Nair, Lekshmi P.; Bijini, B. R.; Nair, C. M. K.; Babu, K. Rajendra


    Good quality prismatic crystals of industrially applicable corrosion inhibiting barium complex of 1,3,5-triazinane-2,4,6-trione have been grown by conventional gel method. The crystal structure, packing, and nature of bonds are revealed in the single crystal X-ray diffraction analysis. The crystal has a three-dimensional polymeric structure having a triclinic crystal system with the space group P-1. The powder X-ray diffraction analysis confirms its crystalline nature. The functional groups present in the crystal are identified by Fourier transform infrared spectroscopy. Elemental analysis confirms the stoichiometry of the elements present in the complex. Thermogravimetric analysis and differential thermal analysis reveal its good thermal stability. The optical properties like band gap, refractive index and extinction coefficient are evaluated from the UV-visible spectral analysis. The singular property of the material, corrosion inhibition efficiency achieved by the adsorption of the sample molecules is determined by the weight loss method.

  9. 2,4,6-Tri-amino-1,3,5-triazin-1-ium 3-(prop-2-eno-yloxy)propano-ate acrylic acid monosolvate monohydrate. (United States)

    Sangeetha, V; Kanagathara, N; Chakkaravarthi, G; Marchewka, M K; Anbalagan, G


    The asymmetric unit of the title salt, C3H7N6 (+)·C6H7O4 (-)·C3H4O2·H2O, contains a 2,4,6-tri-amino-1,3,5-triazin-1-ium cation, a 3-(prop-2-eno-yloxy)propano-ate anion and acrylic acid and water solvent mol-ecules in a 1:1:1:1 ratio and with each species in a general position. In the crystal, the components are linked into a supra-molecular layer in the bc plane via a combination of O-H⋯O, N-H⋯N and N-H⋯O hydrogen bonding. The crystal studied was a non-merohedral twin, the minor component contribution being approximately 26%.

  10. Preparation, crystal structure, vibrational spectral and density functional studies of bis (4-nitrophenol)-2,4,6-triamino-1,3,5-triazine monohydrate (United States)

    Kanagathara, N.; Marchewka, M. K.; Drozd, M.; Renganathan, N. G.; Gunasekaran, S.; Anbalagan, G.


    An organic-organic salt, bis (4-nitrophenol) 2,4,6-triamino 1,3,5-triazine monohydrate (BNPM) has been prepared by slow evaporation technique at room temperature. Single crystal X-ray diffraction analysis reveals that the compound crystallizes in triclinic system with centrosymmetric space group P-1. IR and Raman spectra of BNPM have been recorded and analyzed. The study has been extended to confocal Raman spectral analysis. Band assignments have been made for the melamine and p-nitrophenol molecules. Vibrational spectra have also been discussed on the basis of quantum chemical density functional theory calculations using Firefly (PC GAMESS) Version 7.1 G. Vibrational frequencies are calculated and scaled values are compared with the experimental one. The Mulliken charges, HOMO-LUMO orbital energies are calculated and analyzed. The chemical structure of the compound was established by 1H NMR and 13C NMR spectra.

  11. Near infrared optical biosensor based on peptide functionalized single-walled carbon nanotubes hybrids for 2,4,6-trinitrotoluene (TNT) explosive detection. (United States)

    Wang, Jin


    A near infrared (NIR) optical biosensor based on peptide functionalized single-walled carbon nanotubes (SWCNTs) hybrids for 2,4,6-trinitrotoluene (TNT) explosive detection was developed. The TNT binding peptide was directly anchored on the sidewall of the SWCNTs using the π-π interaction between the aromatic amino acids and SWCNTs, forming the peptide-SWCNTs hybrids for near infrared absorption spectra measurement. The evidence of the morphology of peptide-SWCNTs hybrids was obtained using atomic force microscopy (AFM). The results demonstrated that peptide-SWCNTs hybrids based NIR optical biosensor exhibited sensitive and highly selective for TNT explosive determination, addressing a promising optical biosensor for security application. Copyright © 2018. Published by Elsevier Inc.

  12. Elimination Reactions of (E)-2,4,6-Trinitrobenzaldehyde O-benzoyloximes Promoted by R2NH in MeCN. Change of Reaction Mechanism

    International Nuclear Information System (INIS)

    Cho, Bong Rae; Pyun, Sang Yong


    We have studied the nitrile-forming elimination reactions from 1 promoted by R 2 NH in MeCN. The reaction proceeded by (E1cb) irr mechanism. Change of the β-aryl group from 2,4-dinitrophenyl to a more strongly electron-withdrawing 2,4,6-trinitrophenyl increased the reaction rate by 470-fold, shifted the transition state toward more reactant-like, and changed the reaction mechanism from E2 to (E1cb) irr . To the best of our knowledge, this is the first example of nitrile-forming elimination reaction that proceeds by the (E1cb) irr mechanism in MeCN. Noteworthy is the carbanion stabilizing ability of the 2,4,6-trinitrophenyl group in aprotic solvent. Nitrile-forming elimination reactions of (E)-benzaldoxime derivatives have been extensively investigated under various conditions. The reactions proceeded by the E2 mechanism in MeCN despite the fact that the reactants have syn stereochemistry, poor leaving, and sp 2 hybridized β-carbon atom, all of which favor E1cb- or E1cb-like transition state. Moreover, the transition state structures were relatively insensitive to the variation of the reactant structures. The results have been attributed to the poor anion solvating ability of MeCN, which favors E2 transition state with maximum charge dispersal. For eliminations from strongly activated (E)-2,4-(NO 2 ) 2 C 6 H 3 CH=NOC(O)C 6 H 4 X, a change in the reaction mechanism from E2 to (E1cb) irr was observed as the base-solvent was changed from R 2 NH in MeCN to R 2 NH/R 2 NH 2 + in 70 mol % MeCN(aq). A combination of a strong electron-withdrawing β-aryl group and anion-solvating protic solvent was required for the mechanistic change

  13. Electrochemical determination of 2,4,6-trinitrophenol using a hybrid film composed of a copper-based metal organic framework and electroreduced graphene oxide. (United States)

    Wang, Yong; Cao, Wei; Wang, Luyao; Zhuang, Qianfen; Ni, Yongnian


    A metal organic framework (MOF) of the type copper(II)-1,3,5-benzenetricarboxylic acid (Cu-BTC) was electrodeposited on electroreduced graphene oxide (ERGO) placed on a glassy carbon electrode (GCE). The modified GCE was used for highly sensitive electrochemical determination of 2,4,6-trinitrophenol (TNP). The fabrication process of the modified electrode was characterized by scanning electron microscopy and electrochemical impedance spectroscopy. Differential pulse voltammetry (DPV) demonstrates that the Cu-BTC/ERGO/GCE gives stronger signals for TNP reduction than Cu-BTC/GCE or ERGO/GCE alone. DPV also shows TNP to exhibit three reduction peaks, the first at a potential of -0.42 V (vs. SCE). This potential was selected because the other three similarly-structured compounds (2-nitrophenol, 4-nitrophenol, 2,4-dinitrophenol) do not give a signal at this potential. Response is linear in the 0.2 to 10 μM TNP concentration range, with a 0.1 μM detection limit (at S/N = 3) and a 15.98 μA∙μM -1 ∙cm -2 sensitivity under optimal conditions. The applicability of the sensor was evaluated by detecting TNP in spiked tap water and lake water samples. Recoveries ranged between 95 and 101%. Graphical abstract Schematic presentation of an electrochemical sensor that was fabricated by electrodeposition of the metal-organic framework (MOF) of copper(II)-1,3,5-benzenetricarboxylic acid (Cu-BTC) onto the surface of electroreduced graphene oxide (ERGO) modified glassy carbon electrode (GCE). It was applied to sensitive and selective detection of 2,4,6-trinitrophenol (TNP).

  14. Systems Biology Approach to Bioremediation of Nitroaromatics: Constraint-Based Analysis of 2,4,6-Trinitrotoluene Biotransformation by Escherichia coli

    Directory of Open Access Journals (Sweden)

    Maryam Iman


    Full Text Available Microbial remediation of nitroaromatic compounds (NACs is a promising environmentally friendly and cost-effective approach to the removal of these life-threating agents. Escherichia coli (E. coli has shown remarkable capability for the biotransformation of 2,4,6-trinitro-toluene (TNT. Efforts to develop E. coli as an efficient TNT degrading biocatalyst will benefit from holistic flux-level description of interactions between multiple TNT transforming pathways operating in the strain. To gain such an insight, we extended the genome-scale constraint-based model of E. coli to account for a curated version of major TNT transformation pathways known or evidently hypothesized to be active in E. coli in present of TNT. Using constraint-based analysis (CBA methods, we then performed several series of in silico experiments to elucidate the contribution of these pathways individually or in combination to the E. coli TNT transformation capacity. Results of our analyses were validated by replicating several experimentally observed TNT degradation phenotypes in E. coli cultures. We further used the extended model to explore the influence of process parameters, including aeration regime, TNT concentration, cell density, and carbon source on TNT degradation efficiency. We also conducted an in silico metabolic engineering study to design a series of E. coli mutants capable of degrading TNT at higher yield compared with the wild-type strain. Our study, therefore, extends the application of CBA to bioremediation of nitroaromatics and demonstrates the usefulness of this approach to inform bioremediation research.

  15. Adsorption characteristics of green 5-arylaminomethylene pyrimidine-2,4,6-triones on mild steel surface in acidic medium: Experimental and computational approach (United States)

    Verma, Chandrabhan; Olasunkanmi, Lukman O.; Ebenso, Eno E.; Quraishi, M. A.


    The effect of electron withdrawing nitro (-NO2) and electron releasing hydroxyl (-OH) groups on corrosion inhibition potentials of 5-arylaminomethylenepyrimidine-2,4,6-trione (AMP) had been studied. Four AMPs tagged AMP-1, AMP-2, AMP-3 and AMP-4 were studied for their ability to inhibit mild steel corrosion in 1 M HCl using experimental and theoretical methods. Gravimetric results showed that inhibition efficiency of the studied inhibitors increases with increasing concentration. The results further revealed that that electron withdrawing nitro (-NO2) group decreases the inhibition efficiency of AMP, while electron donating hydroxyl (-OH) group increases the inhibition efficiency of AMP. SEM and AFM studies showed that the studied compounds inhibit mild steel corrosion by adsorbing at the metal/electrolyte interface and their adsorption obeyed the Temkin adsorption isotherm. Potentiodynamic polarization study revealed that studied inhibitors act as mixed type inhibitors with predominant effect on cathodic reaction. The inhibitive strength of the compounds might have direct relationship electron donating ability of the molecules as revealed by quantum chemical parameters. The order of interaction energies derived from Monte Carlo simulations is AMP-4 > AMP-3 > AMP-2 > AMP-1, which is in agreement with the order of inhibition efficiencies obtained from experimental measurements.

  16. Stand-off imaging Raman spectroscopy for forensic analysis of post-blast scenes: trace detection of ammonium nitrate and 2,4,6-trinitrotoluene (United States)

    Ceco, Ema; Önnerud, Hans; Menning, Dennis; Gilljam, John L.; Bââth, Petra; Östmark, Henric


    The following paper presents a realistic forensic capability test of an imaging Raman spectroscopy based demonstrator system, developed at FOI, the Swedish Defence Research Agency. The system uses a 532 nm laser to irradiate a surface of 25×25mm. The backscattered radiation from the surface is collected by an 8" telescope with subsequent optical system, and is finally imaged onto an ICCD camera. We present here an explosives trace analysis study of samples collected from a realistic scenario after a detonation. A left-behind 5 kg IED, based on ammonium nitrate with a TNT (2,4,6-trinitrotoluene) booster, was detonated in a plastic garbage bin. Aluminum sample plates were mounted vertically on a holder approximately 6 m from the point of detonation. Minutes after the detonation, the samples were analyzed with stand-off imaging Raman spectroscopy from a distance of 10 m. Trace amounts could be detected from the secondary explosive (ammonium nitrate with an analysis time of 1 min. Measurement results also indicated detection of residues from the booster (TNT). The sample plates were subsequently swabbed and analyzed with HPLC and GC-MS analyses to confirm the results from the stand-off imaging Raman system. The presented findings indicate that it is possible to determine the type of explosive used in an IED from a distance, within minutes after the attack, and without tampering with physical evidence at the crime scene.

  17. Impaired epithelial differentiation of induced pluripotent stem cells from ectodermal dysplasia-related patients is rescued by the small compound APR-246/PRIMA-1MET. (United States)

    Shalom-Feuerstein, Ruby; Serror, Laura; Aberdam, Edith; Müller, Franz-Josef; van Bokhoven, Hans; Wiman, Klas G; Zhou, Huiqing; Aberdam, Daniel; Petit, Isabelle


    Ectodermal dysplasia is a group of congenital syndromes affecting a variety of ectodermal derivatives. Among them, ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome is caused by single point mutations in the p63 gene, which controls epidermal development and homeostasis. Phenotypic defects of the EEC syndrome include skin defects and limbal stem-cell deficiency. In this study, we designed a unique cellular model that recapitulated major embryonic defects related to EEC. Fibroblasts from healthy donors and EEC patients carrying two different point mutations in the DNA binding domain of p63 were reprogrammed into induced pluripotent stem cell (iPSC) lines. EEC-iPSC from both patients showed early ectodermal commitment into K18(+) cells but failed to further differentiate into K14(+) cells (epidermis/limbus) or K3/K12(+) cells (corneal epithelium). APR-246 (PRIMA-1(MET)), a small compound that restores functionality of mutant p53 in human tumor cells, could revert corneal epithelial lineage commitment and reinstate a normal p63-related signaling pathway. This study illustrates the relevance of iPSC for p63 related disorders and paves the way for future therapy of EEC.

  18. Crystal structure of diaquabis(N,N-diethylnicotinamide-κN1bis(2,4,6-trimethylbenzoato-κO1cobalt(II

    Directory of Open Access Journals (Sweden)

    Gülçin Şefiye Aşkın


    Full Text Available The centrosymmetric molecule in the monomeric title cobalt complex, [Co(C10H11O22(C10H14N2O2(H2O2], contains two water molecules, two 2,4,6-trimethylbenzoate (TMB ligands and two diethylnicotinamide (DENA ligands. All ligands coordinate to the CoII atom in a monodentate fashion. The four O atoms around the CoII atom form a slightly distorted square-planar arrangement, with the distorted octahedral coordination sphere completed by two pyridine N atoms of the DENA ligands. The dihedral angle between the planar carboxylate group and the adjacent benzene ring is 84.2 (4°, while the benzene and pyridine rings are oriented at a dihedral angle of 38.87 (10°. The water molecules exhibit both intramolecular (to the non-coordinating carboxylate O atom and intermolecular (to the amide carbonyl O atom O—H...O hydrogen bonds. The latter lead to the formation of layers parallel to (100, enclosing R44(32 ring motifs. These layers are further linked via weak C—H...O hydrogen bonds, resulting in a three-dimensional network. One of the two ethyl groups of the DENA ligand is disordered over two sets of sites with an occupancy ratio of 0.490 (13:0.510 (13.

  19. Separation, preconcentration and determination of silver ion from water samples using silica gel modified with 2,4,6-trimorpholino-1,3,5-triazin

    International Nuclear Information System (INIS)

    Madrakian, Tayyebeh; Afkhami, Abbas; Zolfigol, Mohammad Ali; Solgi, Mohammad


    A new modified silica gel using 2,4,6-trimorpholino-1,3,5-triazin was used for separation, preconcentration and determination of silver ion in natural water by atomic absorption spectrometry (AAS). This new bonded silica gel was used as an effective sorbent for the solid-phase extraction (SPE) of silver ion from aqueous solutions. Experimental conditions for effective adsorption of trace levels of silver ion were optimized with respect to different experimental parameters in column process. Common coexisting ions did not interfere with the separation and determination of silver at pH 3.5 so that silver ion completely adsorbed on the column. The preconcentration factor is 130 (1 mL elution volume for a 130 mL sample volume). The relative standard deviation (R.S.D.) under optimum conditions is 3.03% (n = 5). The accuracy of the method was estimated by using spring and tap water samples that were spiked with different amounts of silver ion. The adsorption isotherm of silver ion was obtained. The capacity of the sorbent at optimum conditions has been found to be 384 μg of silver per gram of sorbent

  20. Tracing the cycling and fate of the explosive 2,4,6-trinitrotoluene in coastal marine systems with a stable isotopic tracer, 15N-[TNT (United States)

    Smith, Richard W.; Vlahos, Penny; Böhlke, John Karl; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J.; Tobias, Craig


    2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT (15N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ15N analysis of sediments, SPM, and tissues revealed large quantities of 15N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a 15N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments.

  1. Fabrication of an SPR Sensor Surface with Antifouling Properties for Highly Sensitive Detection of 2,4,6-Trinitrotoluene Using Surface-Initiated Atom Transfer Polymerization

    Directory of Open Access Journals (Sweden)

    Kiyoshi Toko


    Full Text Available In this study, we modified a surface plasmon resonance immunosensor chip with a polymer using surface-initiated atom transfer polymerization (SI-ATRP for the highly sensitive detection of 2,4,6-trinitrotoluene (TNT. To immobilize a TNT analogue on the polymer, mono-2-(methacryloyloxyethylsuccinate (MES, which has a carboxyl group, was used in this study. However, the anti-TNT antibody may adsorb non-specifically on the polymer surface by an electrostatic interaction because MES is negatively charged. Therefore, a mixed monomer with MES and diethylaminoethylmethacrylate (DEAEM, which has a tertiary amino group and is positively charged, was prepared to obtain electroneutrality for suppressing the nonspecific adsorption. The detection of TNT was performed by inhibition assay using the polymer surface. To ensure high sensitivity to TNT, the affinity between the surface and the antibody was optimized by controlling the density of the initiator for ATRP by mixing two types of self-assembled monolayer reagents. As a result, a limit of detection of 5.7 pg/mL (ppt for TNT was achieved using the optimized surface.

  2. Spectrophotometric analysis of vitamin E using Cu(I)-Bathocuproine or/and Fe(II)-2,4,6-tris-(2'-pyridyl)-s-triazine complexes

    International Nuclear Information System (INIS)

    Devi, I.; Memon, S. A.; Khuhawar, M.Y.


    Vitamin E (tocopherols and tocotrienols) antioxidants are determined by reducing Cu(II) to Cu(I) or Fe(III) to Fe(II) in presence of vitamin E and subsequent complexation of Cu(I) with bathocuproine and/or Fe(II) with 2,4,6-tris-(2'-pyridyl)-s-triazine (TPTZ). Both the reactions are monitored separately, Cu(I)-bathocuproine at 479 nm where as, Fe(II)-(TPTZ) at 595 nm spectrophotometrically. Linear calibration curves are achieved for both complexes between I to 5mu g ml-1 for vitamin E. The methods were applied for the determination of vitamin E in pharmaceutical preparations and edible oils. Vitamin E, from edible oils, was solvent extracted into n-hexane prior to saponification. Furthermore, a single lined flow was also examined. A larger excess of Cu(II) or Fe =(II) with different concentrations of vitamin E in buffer pH 4 was run on the line and constant amounts of reagent bathocuproine or TPTZ in each case was injected through the injector. The peak height shows a linear relationship for vitamin E between 0.5 to 2.5 mu g ml-1 for both complexes. (author)

  3. Preparation of N-(3-BROMO-2,4,6-trimethylacetanilide) iminodiacetic acid and its 99MTc-complex for hepatobiliary imaging

    International Nuclear Information System (INIS)

    Choi, Ok Ja; Hong, Young Don; Gwon, Hui Jeong; Choi, Sang Mu; Choi, Sun Ju


    N-(3-bromo-2,4,6-trimethylacetanilide) iminodiacetic acid (BrTIDA) was synthesized using nitrilotriacetic anhydride prepared in situ, and lyophilized vials were prepared which contained 20 mg of BrTIDA and 0.4 mg of SnCl 2 . To evaluate the clinical efficacy of the in-house prepared lyophilized kit, a technetium-99m complex of BrTIDA was prepared; its in vivo pharmacokinetic behavior was evaluated via animal studies to assess the hepatocytic function and the functional status of the cystic duct and the gallbladder. Serial static image scans of rabbits and the biodistribution in mice injected with 99m Tc-BrTIDA revealed that none of the tissues except for the hepatobiliary system showed radioactivity concentrations, and a rapid clearance from the organs was observed. In conclusion, a lyophilized kit and its prepared 99m Tc-BrTIDA can be applied as a hepatobiliary imaging agent for the evaluation of the functional status of the hepatocytes and the patency of the biliary duct

  4. Quasi-monoenergetic neutron energy spectra for 246 and 389 MeV (7)Li(p,n) reactions at angles from 0 degrees to 300 degrees

    CERN Document Server

    Iwamoto, Y; Nakamura, T; Nakashima, H; Mares, V; Itoga, T; Matsumoto, T; Nakane, Y; Feldbaumer, E; Jaegerhofer, L; Pioch, C; Tamii, A; Satoh, D; Masuda, A; Sato, T; Iwase, H; Yashima, H; Nishiyama, J; Hagiwara, M; Hatanaka, K; Sakamoto, Y


    The authors measured the neutron energy spectra of a quasi-monoenergetic (7)Li(p,n) neutron source with 246 and 389 MeV protons set at seven angles (0 degrees, 2.5 degrees, 5 degrees, 10 degrees, 15 degrees, 20 degrees and 30 degrees), using a time-of-flight (TOF) method employing organic scintillators NE213 at the Research Center for Nuclear Physics (RCNP) of Osaka University. The energy spectra of the source neutrons were precisely deduced down to 2 MeV at 0 degrees and 10 MeV at other angles. The cross-sections of the peak neutron production reaction at 0 degrees were on the 35-40 mb line of other experimental data, and the peak neutron angular distribution agreed well with the Taddeucci formula. Neutron energy spectra below 100 MeV at all angles were comparable, but the shapes of the continuum above 150 MeV changed considerably with the angle. In order to consider the correction required to derive the response in the peak region from the measured total response for high-energy neutron monitors such as DAR...

  5. Preconcentration of Co, Ni, Cd and Zn on naphthalene–2,4,6-trimorpholino-1,3,5-triazin adsorbent and flame atomic absorption determination

    Directory of Open Access Journals (Sweden)



    Full Text Available A preconcentration method was developed for the determination of trace amounts of Co, Ni, Cd and Zn by atomic absorption spectrometry. The method is based on the retention of the metal cations by naphthalene–2,4,6-trimorpholino-1,3,5-triazin adsorbent in a column. The adsorbed metals were then eluted from the column with hydrochloric acid and the Co, Ni, Cd and Zn were determined by flame atomic absorption spectrometry. The optimal extraction and elution conditions were studied. The effects of diverse ions on the preconcentration were also investigated. A preconcentration factor of 250 for Co(II, Ni(II and Zn(II, and 400 for Cd(II can easily be achieved. Calibration graphs were obtained and the detection limits of the method for Co(II, Ni(II, Cd(II and Zn(II were 0.51, 0.49, 0.17 and 0.10 ng mL-1, respectively. The relative standard deviations (RSD of 0.37–2.31 % for Co, 0.37–3.73 % for Ni, 2.20–2.40 % for Cd and 1.50–2.56 % for Zn were obtained. The method was also used for the simultaneous preconcentration of these elements and the method was successfully applied to their preconcentration and determination. The method was applied to the determination of Co, Ni, Cd and Zn in several real samples.

  6. [Saccharomyces boulardii reduced intestinal inflammation in mice model of 2,4,6-trinitrobencene sulfonic acid induced colitis: based on microarray]. (United States)

    Lee, Sang Kil; Kim, Hyo Jong; Chi, Sung Gil


    Saccharomyces boulardii has been reported to be beneficial in the treatment of inflammatory bowel disease. The aim of this work was to evaluate the effect of S. boulardii in a mice model of 2,4,6-trinitrobencene sulfonic acid (TNBS) induced colitis and analyze the expression of genes in S. boulardii treated mice by microarray. BALB/c mice received TNBS or TNBS and S. boulardii treatment for 4 days. Microarray was performed on total mRNA form colon, and histologic evaluation was also performed. In mice treated with S. boulardii, the histological appearance and mortality rate were significantly restored compared with rats receiving only TNBS. Among 330 genes which were altered by both S. boulardii and TNBS (>2 folds), 193 genes were down-regulated by S. boulardii in microarray. Most of genes which were down-regulated by S. bouardii were functionally classified as inflammatory and immune response related genes. S. boulardii may reduce colonic inflammation along with regulation of inflammatory and immune responsive genes in TNBS-induced colitis.

  7. A New Indirect Spectrofluorimetric Method for Determination of Ascorbic Acid with 2,4,6-Tripyridyl-S-Triazine in Pharmaceutical Samples

    Directory of Open Access Journals (Sweden)

    Lejla Klepo


    Full Text Available Ascorbic acid (AA is a water-soluble vitamin which shows no fluorescence. However, in reaction with iron(III, AA is oxidised to dehydroascorbic acid and iron(III is reduced to iron(II which forms a complex with 2,4,6-tripyridyl-S-triazine (TPTZ in buffered medium. The relative fluorescence intensity of the resulting Fe(TPTZ22+ complex can be measured at excitation and emission wavelengths of 393 and 790 nm, respectively. Based on this data, a new indirect spectrofluorimetric method for the determination of AA in pharmaceutical samples was proposed. Influence of the reaction conditions, such as acidity of acetic buffer, concentration of TPTZ and iron(III, reaction time and instrumental parameters were investigated in detail. The linear range was from 5.4 × 10−4 to 5.4 × 10−6 mol·L−1 (R = 0.9971. The LOD was 7.7 × 10−7 mol·L−1 and LOQ was 2.3 × 10−4 mol·L−1. Fourteen pharmaceutical samples containing various amounts of AA were analysed. Influences of potential interfering substances were also examined. Analysis of commercial pharmaceutical formulations showed good correlation with the nominal values given by the manufacturers and with the results obtained by a titration method. The proposed method can be applied in routine quality control in the pharmaceutical industry due to its sensitivity, simplicity, selectivity and low cost.

  8. Vibrational, DFT, and thermal analysis of 2,4,6-triamino-1,3,5-triazin-1-ium 3-(prop-2-enoyloxy) propanoate acrylic acid monosolvate monohydrate (United States)

    Sangeetha, V.; Govindarajan, M.; Kanagathara, N.; Marchewka, M. K.; Drozd, M.; Anbalagan, G.


    New organic crystals of 2,4,6-triamino-1,3,5-triazin-1-ium 3-(prop-2-enoyloxy) propanoate acrylic acid monosolvate monohydrate (MAC) have been obtained from aqueous solution by the slow solvent evaporation method at room temperature. Single crystal X-ray diffraction analysis reveals that the compound crystallises in the triclinic system with centrosymmetric space group P-1. FT-IR and FT-Raman spectra of MAC have been recorded and analyzed. The molecular geometry and vibrational frequencies and intensity of the vibrational bands are interpreted with the aid of structure optimization based on density functional theory (DFT) B3LYP method with 6-31G(d,p) basis set. The results of the optimized molecular structure are presented and compared with the experimental X-ray diffraction data. The theoretical results show that the optimized geometry can well reproduce the crystal structure, and the calculated vibrational frequency values show good agreement with experimental values. A study of the electronic properties, such as HOMO and LUMO energies and Molecular electrostatic potential (MEP) were performed. Mulliken charges and NBO charges of the title molecule were also calculated and interpreted. Thermogravimetric analysis has been done to study the thermal behaviour of MAC. The 13C and 1H nuclear magnetic resonance (NMR) chemical shifts of the molecule are calculated by the gauge independent atomic orbital (GIAO) method and compared with experimental results.

  9. Experimental and quantum chemical studies of a new organic proton transfer compound, 1H-imidazole-3-ium-3-hydroxy-2,4,6-trinitrophenolate (United States)

    Dhamodharan, P.; Sathya, K.; Dhandapani, M.


    A new proton transfer compound, 1H-imidazole-3-ium-3-hydroxy-2,4,6-trinitrophenolate (IMHTP), was crystallized by slow evaporation-solution growth technique. 1H and 13C NMR spectral studies confirm the molecular structure of the grown crystal. Single crystal X-ray diffraction study confirms that IMHTP crystallizes in monoclinic system with space group P21/c. Thermal curves (TG/DTA) show that the material is thermally stable up to 198 °C. The crystal emits fluorescence at 510 nm, proving its utility in making green light emitting materials in optical applications. The stable molecular structure was optimized by Gaussian 09 program with B3LYP/6-311++G(d,p) level of basis set. The frontier molecular orbital study shows that the charge transfer interaction occurs within the complex. The calculated first-order hyperpolarizability value of IMHTP is 44 times higher than that the reference material, urea. The electrostatic potential map was used to probe into electrophilic and nucleophilic reactive sites present in the molecule.

  10. Adsorption isotherms, kinetics, thermodynamics and desorption studies of 2,4,6-trichlorophenol on oil palm empty fruit bunch-based activated carbon

    International Nuclear Information System (INIS)

    Tan, I.A.W.; Ahmad, A.L.; Hameed, B.H.


    The adsorption characteristics of 2,4,6-trichlorophenol (TCP) on activated carbon prepared from oil palm empty fruit bunch (EFB) were evaluated. The effects of TCP initial concentration, agitation time, solution pH and temperature on TCP adsorption were investigated. TCP adsorption uptake was found to increase with increase in initial concentration, agitation time and solution temperature whereas adsorption of TCP was more favourable at acidic pH. The adsorption equilibrium data were best represented by the Freundlich and Redlich-Peterson isotherms. The adsorption kinetics was found to follow the pseudo-second-order kinetic model. The mechanism of the adsorption process was determined from the intraparticle diffusion model. Boyd plot revealed that the adsorption of TCP on the activated carbon was mainly governed by particle diffusion. Thermodynamic parameters such as standard enthalpy (ΔH o ), standard entropy (ΔS o ), standard free energy (ΔG o ) and activation energy were determined. The regeneration efficiency of the spent activated carbon was high, with TCP desorption of 99.6%.

  11. Human Cell Line Activation Test of the Novel Energetics 2,6-pyrazinediamine 3,5-dinitro 1 -oxide (LLM-105) and 2,4,6-trinitro-3-bromoanisole (TNBA) (United States)


    substances early in the RDT&E process to avoid unnecessary costs, conserve physical resources, and sustain the health of those potentially exposed. The SERDP...pyrazinediamine 3,5-dinitro 1 –oxide (LLM-105) and 2,4,6-trinitro-3-bromoanisole (TNBA) Prepared by: Emily Reinke, Ph.D. Health Effects Division...Toxicology Directorate Army Public Health Center ARIMS designation: 500c Use of trademarked name(s) does not imply endorsement by the U.S

  12. Induction by phenobarbital of aniline-p-hydroxylase in mouse liver under the influence of X-irradiation and 2,4,6-triethyleneimino-1,3,5-triazine

    International Nuclear Information System (INIS)

    Erger, M.; Hollatz, R.; Tempel, K.


    The phenobarbital-induced activity of aniline-p-hydroxylase in livers of mice was enhanced additionally when the animals were X-irradiated 4-16 hours before the administration of the inducer. The same effect could be demonstrated after repeated irradiation with low doses. 2,4,6-triethyleneimino-1,3,5-triazine (tretamine) inhibited the induction of aniline-p-hydroxylase only when administered in extremely high doses. Lower doses resulted in 'superinduciton'. (orig.) [de

  13. Effects of sinomenine on the expression of microRNA-155 in 2,4,6-trinitrobenzenesulfonic acid-induced colitis in mice.

    Directory of Open Access Journals (Sweden)

    Qiao Yu

    Full Text Available Sinomenine, a pure alkaloid isolated in Chinese medicine from the root of Sinomenium acutum, has been demonstrated to have anti-inflammatory and immunosuppressive effects. MicroRNAs (miRNAs are gradually being recognized as critical mediators of disease pathogenesis via coordinated regulation of molecular effector pathways.After colitis was induced in mice by instillation of 5% (w/v 2,4,6-trinitrobenzenesulfonic acid (TNBS, sinomenine at a dose of 100 or 200 mg/kg was orally administered once daily for 7 days. We evaluated body weight, survival rate, diarrhea score, histological score and myeloperoxidase (MPO activity. The mRNA and protein expression levels of miR-155, c-Maf, TNF-α and IFN-γ were determined by quantitative RT-PCR and immunohistochemistry, respectively. Sinomenine (100 or 200 mg/kg-treated mice with TNBS-induced colitis were significantly improved in terms of body weight, survival rate, diarrhea score, histological score and MPO activity compared with untreated mice. Both dosages of sinomenine significantly decreased the mRNA and protein expression levels of c-Maf, TNF-α and IFN-γ, which elevated in TNBS-induced colitis. Furthermore, sinomenine at a dose of 200 mg/kg significantly decreased the level of miR-155 expression by 71% (p = 0.025 compared with untreated TNBS-induced colitis in mice.Our study evaluated the effects and potential mechanisms of sinomenine in the anti-inflammatory response via miRNA-155 in mice with TNBS-induced colitis. Our findings suggest that sinomenine has anti-inflammatory effects on TNBS-induced colitis by down-regulating the levels of miR-155 and several related inflammatory cytokines.

  14. Development of a microwave assisted extraction method for the analysis of 2,4,6-trichloroanisole in cork stoppers by SIDA-SBSE-GC-MS

    International Nuclear Information System (INIS)

    Vestner, Jochen; Fritsch, Stefanie; Rauhut, Doris


    The aim of this research work was focused on the replacement of the time-consuming soaking of cork stoppers which is mainly used as screening method for cork lots in connection with sensory analysis and/or analytical methods to detect releasable 2,4,6-trichloroanisole (TCA) of natural cork stoppers. Releasable TCA from whole cork stoppers was analysed with the application of a microwave assisted extraction method (MAE) in combination with stir bar sorptive extraction (SBSE). The soaking of corks (SOAK) was used as a reference method to optimise MAE parameters. Cork lots of different quality and TCA contamination levels were used to adapt MAE. Pre-tests indicated that an MAE at 40 deg. C for 120 min with 90 min of cooling time are suitable conditions to avoid an over-extraction of TCA of low and medium tainted cork stoppers in comparison to SOAK. These MAE parameters allow the measuring of almost the same amounts of releasable TCA as with the application of the soaking procedure in the relevant range ( -1 releasable TCA from one cork) to evaluate the TCA level of cork stoppers. Stable isotope dilution assay (SIDA) was applied to optimise quantification of the released TCA with deuterium-labelled TCA (TCA-d 5 ) using a time-saving GC-MS technique in single ion monitoring (SIM) mode. The developed MAE method allows the measuring of releasable TCA from the whole cork stopper under improved conditions and in connection with a low use of solvent and a higher sample throughput.

  15. Influence of Halogen Substituents on the Catalytic Oxidation of 2,4,6-Halogenated Phenols by Fe(III-Tetrakis(p-hydroxyphenyl porphyrins and Potassium Monopersulfate

    Directory of Open Access Journals (Sweden)

    Seiya Nagao


    Full Text Available The influence of halogen substituents on the catalytic oxidation of 2,4,6-trihalogenated phenols (TrXPs by iron(III-porphyrin/KHSO5 catalytic systems was investigated. Iron(III-5,10,15,20-tetrakis(p-hydroxyphenylporphyrin (FeTHP and its supported variants were employed, where the supported catalysts were synthesized by introducing FeTHP into hydroquinone-derived humic acids via formaldehyde poly-condensation. F (TrFP, Cl (TrCP, Br (TrBP and I (TrIP were examined as halogen substituents for TrXPs. Although the supported catalysts significantly enhanced the degradation and dehalogenation of TrFP and TrCP, the oxidation of TrBP and TrIP was not enhanced, compared to the FeTHP catalytic system. These results indicate that the degree of oxidation of TrXPs is strongly dependent on the types of halogen substituent. The order of dehalogenation levels for halogen substituents in TrXPs was F > Cl > Br > I, consistent with their order of electronegativity. The electronegativity of a halogen substituent affects the nucleophilicity of the carbon to which it is attached. The levels of oxidation products in the reaction mixtures were analyzed by GC/MS after extraction with n-hexane. The most abundant dimer product from TrFP via 2,6-difluoroquinone is consistent with a scenario where TrXP, with a more electronegative halogen substituent, is readily oxidized, while less electronegative halogen substituents are oxidized less readily by iron(III-porphyrin/KHSO5 catalytic systems.

  16. Highly Sensitive Determination of 2,4,6-Trinitrotoluene and Related Byproducts Using a Diol Functionalized Column for High Performance Liquid Chromatography (United States)

    Gumuscu, Burcu; Erdogan, Zeynep; Guler, Mustafa O.; Tekinay, Turgay


    In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95–98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation. PMID:24905826

  17. A new strategy for 2,4,6-Trinitrotoluene adsorption and electrochemical reduction on poly(melamine)/graphene oxide modified electrode

    International Nuclear Information System (INIS)

    Cotchim, Suparat; Thavarungkul, Panote; Kanatharana, Proespichaya; Limbut, Warakorn


    Highlights: • A new fabrication strategy of a poly(melamine)/graphene oxide (PM/GO) modified glassy carbon electrode (GCE) (PM/GO/GCE) for the detection of ultra-traces of TNT is proposed. • The PM/GO/GCE exhibits excellent adsorption and electrochemical reduction of TNT via the AdCSV technique. • The PM/GO/GCE provides for a high sensitivity, good repeatability and selectivity. • This strategy opens new opportunities for the sensitive detection of TNT aiming at protection of the environmental and homeland securities. - Abstract: A poly(melamine)/graphene oxide (PM/GO) layer modified on a glassy carbon electrode (GCE) was used for the adsorption and electrochemical detection of 2,4,6 trinitrotoluene (TNT). The surface morphology and electrochemical behaviour of the PM/GO/GCE were characterized by scanning electron microscopy (SEM), fourier transform infrared spectroscopy (FT-IR), cyclic voltammetry (CV) and adsorptive cathodic stripping voltammetry (AdCSV). The PM/GO/GCE exhibited excellent adsorption and electrochemical reduction of TNT via the AdCSV technique with two linear ranges, 1–90 μg L −1 and 100–1000 μg L −1 , a detection limit of 0.34 μg L −1 and a quantitation limit of 1.14 μg L −1 . The PM/GO/GCE provided for a high sensitivity, good repeatability and selectivity. This modified electrode was successfully applied to detect TNT in soil samples with good recoveries that ranged from 93 to 99%.

  18. Cuprous oxide created on sepiolite: Preparation, characterization, and photocatalytic activity in treatment of red water from 2,4,6-trinitrotoluene manufacturing

    International Nuclear Information System (INIS)

    Zhu, Qingwei; Zhang, Yihe; Lv, Fengzhu; Chu, Paul K.; Ye, Zhengfan; Zhou, Fengshan


    Highlights: ► Cu 2 O crystals were firstly created on the natural sepiolite fibers. ► The structures of the sepiolite are altered when acidized, benefiting the immobility of cuprous oxide crystals. ► The carrier sepiolite improves efficiently the photocatalytic activity of cuprous oxide crystals. ► Cu 2 O/sepiolite composites show superior photocatalytic activity for the degradation of red water. - Abstract: Cuprous oxide is firstly created on acidized sepiolite (AS) by a simple deposition method for photocatalytic degradation of the red water produced from 2,4,6-trinitrotoluene (TNT) manufacturing. X-ray diffraction (XRD), field-emission scanning electron microscopy (FE-SEM), ultraviolet-visible diffuse reflection absorptive spectroscopy (UV–vis/DRS), and Fourier transform infrared (FT-IR) spectroscopy are used to characterize the photocatalyst composites. Gas chromatography/mass spectrometry (GC/MS) is employed to determine the organic constituents in the red water. The results show that the cuprous oxide particles can be immobilized on the surface of the AS fibers and the structure of the AS is altered when cuprous oxide interacts with AS via chemical reactions besides physical adsorption. The AS improves the optical properties of cuprous oxide and red-shifts the band gap thereby enhancing the utilization of visible light. The Cu 2 O/AS composites demonstrate excellent photocatalytic performance in the degradation of red water. 87.0% of red water can be photocatalytically degraded by Cu 2 O/AS after illumined for 5 h and a majority of organic components of red water except 1,3,5-trinitrobenzene were degraded according to GC–MS analysis.

  19. Total glucosides of peony attenuates 2,4,6-trinitrobenzene sulfonic acid/ethanol-induced colitis in rats through adjustment of TH1/TH2 cytokines polarization. (United States)

    Zhang, Yabing; Zhou, Rui; Zhou, Feng; Cheng, Hong; Xia, Bing


    The present study is to investigate effects of total glucosides of peony (TGP) on 2,4,6-trinitrobenzene sulfonic acid (TNBS)/ethanol-induced colitis in rats and to explore potential clinical use of TGP for treatment of inflammatory bowel disease. Sixty Sprague-Dawley rats were randomly grouped into normal controls, model controls, sulfasalazine (SASP) controls (100 mg/kg/day), and low, medium, and high-dose TGP groups (25, 50, and 100 mg/kg/day, respectively). 24 h following colonic instillation of TNBS, TGP, and SASP were given by gastric gavage three times a day for 7 days. Disease activity index (DAI), colon macroscopic damage index (CMDI), histopathological score (HPS), and myeloperoxidase (MPO) activity were evaluated. Levels of serum TNF-α, IL-1β, and IL-10 were measured by ELISA, and expression of TNF-α, IL-1β, and IL-10 mRNA and protein in colonic tissues was detected by RT-PCR and western blot, respectively. Compared with rats in the model controls, TGP (50 or 100 mg/kg/day)-treated rats with TNBS/ethanol-induced colitis showed significant improvements of DAI, CMDI, HPS, and MPO activity. Moreover, administration of TGP (50 or 100 mg/kg/day) decreased the up-regulated levels of serum TNF-α and IL-1β, and expression of TNF-α and IL-1β mRNA and protein in colonic tissues, and increased the serum IL-10 and colonic IL-10 mRNA and protein level. And there was no significant difference compared with administration of SASP (P > 0.05). TGP attenuates TNBS/ethanol-induced colitis in rats and its efficacy is similar to SASP, the potential mechanism might be related to the adjustment of Th1/Th2 cytokines polarization by decreasing pro-inflammatory cytokine TNF-α and IL-1β, and increasing anti-inflammatory cytokine IL-10.

  20. Highly sensitive determination of 2,4,6-trinitrotoluene and related byproducts using a diol functionalized column for high performance liquid chromatography. (United States)

    Gumuscu, Burcu; Erdogan, Zeynep; Guler, Mustafa O; Tekinay, Turgay


    In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT); 2,4-dinitrotoluene (2,4-DNT); 2,6-dinitrotoluene (2,6-DNT); 2-aminodinitrotoluene (2-ADNT) and 4-aminodinitrotoluene (4-ADNT) molecules in high-performance liquid-chromatography (HPLC) with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95-98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation.

  1. Highly sensitive determination of 2,4,6-trinitrotoluene and related byproducts using a diol functionalized column for high performance liquid chromatography.

    Directory of Open Access Journals (Sweden)

    Burcu Gumuscu

    Full Text Available In this work, a new detection method for complete separation of 2,4,6-trinitrotoluene (TNT; 2,4-dinitrotoluene (2,4-DNT; 2,6-dinitrotoluene (2,6-DNT; 2-aminodinitrotoluene (2-ADNT and 4-aminodinitrotoluene (4-ADNT molecules in high-performance liquid-chromatography (HPLC with UV sensor has been developed using diol column. This approach improves on cost, time, and sensitivity over the existing methods, providing a simple and effective alternative. Total analysis time was less than 13 minutes including column re-equilibration between runs, in which water and acetonitrile were used as gradient elution solvents. Under optimized conditions, the minimum resolution between 2,4-DNT and 2,6-DNT peaks was 2.06. The recovery rates for spiked environmental samples were between 95-98%. The detection limits for diol column ranged from 0.78 to 1.17 µg/L for TNT and its byproducts. While the solvent consumption was 26.4 mL/min for two-phase EPA and 30 mL/min for EPA 8330 methods, it was only 8.8 mL/min for diol column. The resolution was improved up to 49% respect to two-phase EPA and EPA 8330 methods. When compared to C-18 and phenyl-3 columns, solvent usage was reduced up to 64% using diol column and resolution was enhanced approximately two-fold. The sensitivity of diol column was afforded by the hydroxyl groups on polyol layer, joining the formation of charge-transfer complexes with nitroaromatic compounds according to acceptor-donor interactions. Having compliance with current requirements, the proposed method demonstrates sensitive and robust separation.

  2. Ion mobility spectrometry–mass spectrometry studies of ion processes in air at atmospheric pressure and their application to thermal desorption of 2,4,6-trinitrotoluene

    International Nuclear Information System (INIS)

    Sabo, Martin; Malásková, Michaela; Matejčík, Štefan


    In this study we have investigated the negative reactant ion formation in a negative corona discharge (CD) using the corona discharge ion mobility spectrometry orthogonal acceleration time-of-flight (CD-IMS-oaTOF) technique. The reactant ions were formed in the CD operating in the reverse gas flow mode at an elevated temperature of 363.5 K in synthetic and ambient air. Under these conditions mainly O 2 − and their clusters were formed. We have also studied the influence of CCl 4 admixture to air (dopant gas) on the composition of the reactant ions, which resulted in the formation of Cl − and its clusters with a reduced ion mobility of 3.05 cm 2  V −1  s −1 as a major reactant ion peak. Additional IMS peaks with reduced ion mobilities of 2.49, 2.25 and 2.03 cm 2  V −1  s −1 were detected, and Cl −  · (NO 2 ) and Cl −  · (NO) n (n = 2, 3) anions were identified. The negative reactant ions were used to detect 2,4,6 trinitrotoluene (TNT) using the thermal desorption (TD) technique using a CD-IMS instrument. Using TD sampling and a negative CD ion source doped by CCl 4 we have achieved a limit of detection of 350 pg for direct surface analysis of TNT. (paper)

  3. Purifying, cloning and characterizing a novel dehalogenase from Bacillus sp. GZT to enhance the biodegradation of 2,4,6-tribromophenol in water. (United States)

    Liang, Zhishu; Li, Guiying; An, Taicheng


    2,4,6-Tribromophenol (TBP), an intermediate of brominated flame retardants, can easily release to environment and recalcitrant to degradation. Previously, Bacillus sp. GZT, a pure aerobic strain capable of simultaneously debrominating and mineralizing TBP, was successfully isolated by us. To further obtain a practical application and dig up its TBP degradation mechanism, a total of 46.7-fold purification of a novel dehalogenase with a final specific activity of 18.9 U mg -1 and a molecular mass of 63.4 kDa was achieved. Under optimal conditions (35 °C and 200 rpm), up to 80% degradation efficiencies were achieved within 120 min. Adding H 2 O 2 , NADPH, Mn 2+ and Mg 2+ promoted enzyme reaction effectively; while EDTA, methyl viologen, Ni 2+ , Cu 2+ , Ca 2+ and Fe 2+ strongly inhibited reaction activities. The debromination of TBP was catalyzed by the enzyme at a Km of 78 μM and a Vmax of 0.65 min -1  mg protein -1 , which indicated that this dehalogenase could specifically eliminate TBP with a high efficiency and stability. Based on MALDI-TOF/TOF analysis, the dehalogenase shared 98% identity with peptide ABC transporter substrate-binding protein. One open reading frame (ORF) encoding this peptide was found in Strain GZT genome, subjected to clone and expressed in Escherichia coli (E. coli) to characterize the encoding gene. Result showed that this recombinant strain could also remove as similar amount of TBP as Bacillus sp. GZT under the identical condition. Based on these results, we suggest that this newly-isolated TBP dehalogenase highlights a new approach for remediating TBP pollution. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Vibrational, DFT, thermal and dielectric studies on 3-nitrophenol-1,3,5-triazine-2,4,6-triamine (2/1) (United States)

    Sangeetha, V.; Govindarajan, M.; Kanagathara, N.; Marchewka, M. K.; Gunasekaran, S.; Anbalagan, G.


    A new organic-organic salt, 3-nitrophenol-1,3,5-triazine-2,4,6-triamine (2/1) (3-NPM) has been synthesized by slow evaporation technique at room temperature. Single crystal X-ray diffraction analysis reveals that 3-NPM crystallizes in orthorhombic system with centrosymmetric space group Pbca and the lattice parameters are a = 15.5150(6) Å, b = 12.9137(6) Å, c = 17.8323(6) Å, α = β = γ = 90° and V = 3572.8(2) (Å)3. The geometry, fundamental vibrational frequencies are interpreted with the aid of structure optimization and normal coordinate force field calculations based on density functional theory (DFT) B3LYP/6-311G(d,p) method. IR and Raman spectra of 3-NPM have been recorded and analyzed. The complete vibrational assignments are made on the basis of potential energy distribution (PED). The electric dipole moment, polarizability and the first order hyperpolarizability values of the 3-NPM have been calculated. 1H and 13C NMR chemical shifts are calculated by using the gauge independent atomic orbital (GIAO) method with B3LYP method with 6-311G (d,p) basis set. Moreover, molecular electrostatic potential (MEP) and thermodynamic properties are performed. Mulliken and Natural charges of the title molecule are also calculated and interpreted. Thermal decomposition behavior of 3-NPM has been studied by means of thermogravimetric analysis. The dielectric measurements on the powdered sample have been carried out and the variation of dielectric constant and dielectric loss at different frequencies of the applied field has been studied and the results are discussed in detail.

  5. Development of a microwave assisted extraction method for the analysis of 2,4,6-trichloroanisole in cork stoppers by SIDA-SBSE-GC-MS. (United States)

    Vestner, Jochen; Fritsch, Stefanie; Rauhut, Doris


    The aim of this research work was focused on the replacement of the time-consuming soaking of cork stoppers which is mainly used as screening method for cork lots in connection with sensory analysis and/or analytical methods to detect releasable 2,4,6-trichloroanisole (TCA) of natural cork stoppers. Releasable TCA from whole cork stoppers was analysed with the application of a microwave assisted extraction method (MAE) in combination with stir bar sorptive extraction (SBSE). The soaking of corks (SOAK) was used as a reference method to optimise MAE parameters. Cork lots of different quality and TCA contamination levels were used to adapt MAE. Pre-tests indicated that an MAE at 40 degrees C for 120 min with 90 min of cooling time are suitable conditions to avoid an over-extraction of TCA of low and medium tainted cork stoppers in comparison to SOAK. These MAE parameters allow the measuring of almost the same amounts of releasable TCA as with the application of the soaking procedure in the relevant range (cork) to evaluate the TCA level of cork stoppers. Stable isotope dilution assay (SIDA) was applied to optimise quantification of the released TCA with deuterium-labelled TCA (TCA-d(5)) using a time-saving GC-MS technique in single ion monitoring (SIM) mode. The developed MAE method allows the measuring of releasable TCA from the whole cork stopper under improved conditions and in connection with a low use of solvent and a higher sample throughput. Copyright 2009 Elsevier B.V. All rights reserved.

  6. The problem of 2,4,6-trichloroanisole in cork planks studied by attenuated total reflection infrared spectroscopy: proof of concept. (United States)

    Garcia, Ana R; Lopes, Luís F; Brito de Barros, Ricardo; Ilharco, Laura M


    Attenuated total reflection infrared spectroscopy (ATR-IR) proved to be a promising detection technique for 2,4,6-trichloroanisole (TCA), which confers organoleptic defects to bottled alcoholic beverages, allowing the proposal of a criterion for cork plank acceptance when meant for stopper production. By analysis of a significant number of samples, it was proved that the presence of TCA, even in very low concentrations, imparts subtle changes to the cork spectra, namely, the growth of two new bands at ∼1417 (νC═C of TCA ring) and 1314 cm–1 (a shifted νCC of TCA) and an increase in the relative intensities of the bands at ∼1039 cm–1 (δCO of polysaccharides) and ∼813 cm–1 (τCH of suberin), the latter by overlapping with intense bands of TCA. These relative intensities were evaluated in comparison to a fingerprint of suberin (νasC–O–C), at 1161 cm–1. On the basis of those spectral variables, a multivariate statistics linear analysis (LDA) was performed to obtain a discriminant function that allows classifying the samples according to whether they contain or not TCA. The methodology proposed consists of a demanding acceptance criterion for cork planks destined for stopper production (with the guarantee of nonexistence of TCA) that results from combining the quantitative results with the absence of the two TCA correlated bands. ATR infrared spectroscopy is a nondestructive and easy to apply technique, both on cork planks and on stoppers, and has proven more restrictive than other techniques used in the cork industry that analyze the cleaning solutions. At the level of proof of concept, the method here proposed is appealing for high-value stopper applications.

  7. 1,3,5-Triazine-2,4,6-tribenzaldehyde derivative as a new crosslinking agent for synthesis of pH-thermo dual responsive chitosan hydrogels and their nanocomposites: Swelling properties and drug release behavior. (United States)

    Karimi, Ali Reza; Tarighatjoo, Mahsa; Nikravesh, Golara


    In this work, 1,3,5-triazine-2,4,6-tribenzaldehyde was synthesized and chosen as the cross-linking agent for preparation of novel thermo- and pH-responsive hydrogels based on chitosan. The cross-linking proceeds through formation of imine bond by reaction of amino groups of chitosan with aldehyde groups of the cross-linker. The various amounts (6, 10, 14% w/w) of the cross-linker were used with respect to chitosan to produce three 1,3,5-triazine-2,4,6-tribenzaldehyde cross-linked chitosans. Then, their hydrogel nanocomposites were prepared by crosslinking of chitosan with 1,3,5-triazine-2,4,6-tribenzaldehyde in the presence of 0.1% and 0.3% (w/w) multi-walled carbon nanotubes (MWCNTs). The structure and properties of the hydrogels and their nanocomposites were characterized by FT-IR, 1 H NMR and scanning electron microscopy (SEM). The swelling behavior of prepared hydrogels and their nanocomposites at different pHs and temperatures was investigated. The results showed that they exhibit a pH and temperature-responsive swelling ratio. The swelling behavior of the prepared chitosan hydrogels was strongly dependent on the amounts of cross-linker and MWCNTs. In vitro controlled release behavior of metronidazole model drug was studied with prepared hydrogels and nanocomposite hydrogels. The pH, temperature and wt% of MWCNTs were found to strongly influence the drug release behavior of the hydrogels. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Synthesis and the crystal and molecular structures of (H3L . Cl)[CoCl4] and H2L[CuBr4] (L is 2,4,6-Tri(N,N-dimethylamino)methylphenol)

    International Nuclear Information System (INIS)

    Kovalchukova, O. V.; Stash, A. I.; Strashnova, S. B.; Romashkina, E. P.; Zaitsev, B. E.


    The complex compounds (H 3 L . Cl)[CoCl 4 ] (I) and H 2 L[CuBr 4 ] (II), where L is 2,4,6-tri(N,N-dimethylamino)methylphenol, were isolated in the crystalline state and studied by X-ray diffraction. The organic cations were found to be outer-sphere ligands. All three nitrogen atoms of the tertiary amino groups are protonated. In compound I, the H 3 L 3+ cation exists as the cis tautomer. In compound II, the H 2 L 2+ dication exists as the trans isomer. In the crystal structure, the dications are arranged in layers via hydrogen bonds.

  9. (E-N-[2-(9-Fluorenylidene-3a,5,7-trimethyl-3,3a-dihydro-2H-indol-3-ylidene]-2,4,6-trimethylaniline

    Directory of Open Access Journals (Sweden)

    Norihiro Tokitoh


    Full Text Available The title compound, C33H30N2, has an E configuration at the imine double bond. The angle between the least-squares planes of the imine C=N—C group and the benzene ring of the 2,4,6-trimethylphenyl substituent is 85.38 (11°. The crystal structure is sustained mainly by intermolecular π–π interactions (3.510 Å between the two fluorene rings and some C—H...π interactions.

  10. Bis[1,3-bis(2,4,6-trimethylphenyl-2,3-dihydro-1H-imidazol-2-ylidene]dinitrosyl(tetrahydroborato-κ2H,H′tungsten(0

    Directory of Open Access Journals (Sweden)

    Heinz Berke


    Full Text Available In the title paramagnetic 19-electron neutral complex, [W(BH4(C21H24N22(NO2], the W(0 atom is coordinated by two 1,3-bis(2,4,6-trimethylphenylimidazol-2-ylidene (IMes carbene ligands, two NO groups and two H atoms of an η2-tetrahydroborate ligand. Depending on the number of coordination sites (n assigned to the BH4− ligand, the coordination geometry of the W atom may either be described as approximately trigonal–bipyramidal (n = 1 or as very distorted octahedral with the bridging H atoms filling two coordination positions (n = 2. In the latter case, the coplanar NO groups and bridging H atoms (r.m.s. deviation = 0.032 Å form one octahedral plane, with mutually trans-oriented carbene ligands. In the crystal, molecules are connected via C—H...O interactions.

  11. PRIMA-1 and PRIMA-1Met (APR-246: From Mutant/Wild Type p53 Reactivation to Unexpected Mechanisms Underlying Their Potent Anti-Tumor Effect in Combinatorial Therapies

    Directory of Open Access Journals (Sweden)

    Anne Perdrix


    Full Text Available p53 protects cells from genetic assaults by triggering cell-cycle arrest and apoptosis. Inactivation of p53 pathway is found in the vast majority of human cancers often due to somatic missense mutations in TP53 or to an excessive degradation of the protein. Accordingly, reactivation of p53 appears as a quite promising pharmacological approach and, effectively, several attempts have been made in that sense. The most widely investigated compounds for this purpose are PRIMA-1 (p53 reactivation and induction of massive apoptosis and PRIMA-1Met (APR-246, that are at an advanced stage of development, with several clinical trials in progress. Based on publications referenced in PubMed since 2002, here we review the reported effects of these compounds on cancer cells, with a specific focus on their ability of p53 reactivation, an overview of their unexpected anti-cancer effects, and a presentation of the investigated drug combinations.

  12. 2,4,6-Tri­amino-1,3,5-triazin-1-ium 3-(prop-2-eno­yloxy)propano­ate acrylic acid monosolvate monohydrate (United States)

    Sangeetha, V.; Kanagathara, N.; Chakkaravarthi, G.; Marchewka, M. K.; Anbalagan, G.


    The asymmetric unit of the title salt, C3H7N6 +·C6H7O4 −·C3H4O2·H2O, contains a 2,4,6-tri­amino-1,3,5-triazin-1-ium cation, a 3-(prop-2-eno­yloxy)propano­ate anion and acrylic acid and water solvent mol­ecules in a 1:1:1:1 ratio and with each species in a general position. In the crystal, the components are linked into a supra­molecular layer in the bc plane via a combination of O—H⋯O, N—H⋯N and N—H⋯O hydrogen bonding. The crystal studied was a non-merohedral twin, the minor component contribution being approximately 26%. PMID:23723892

  13. Synthesis, crystal structure, antibacterial activity and theoretical studies on a novel mononuclear cobalt(II) complex based on 2,4,6-tris(2-pyridyl)-1,3,5-triazine ligand (United States)

    Maghami, Mahboobeh; Farzaneh, Faezeh; Simpson, Jim; Ghiasi, Mina; Azarkish, Mohammad


    A cobalt complex was prepared from CoCl2·6H2O and 2,4,6-tris(2-pyridyl)-1,3,5-triazine (tptz) in methanol and designated as [Co(tptz)(CH3OH)Cl2]·CH3OH·0.5H2O (1). It was characterized by several techniques including TGA analysis and FT-IR, UV-Vis and 1H NMR spectral studies. The crystal structure of 1 was determined by single-crystal X-ray diffraction. The Co(II) metal center in 1 is six coordinated with a distorted octahedral geometry. The tptz ligand is tridentate and coordinates to the cobalt through coplanar nitrogen atoms from the triazine and two pyridyl rings. Two chloride anions and a methanol molecule complete the inner coordination sphere of the metal ion. The optimized geometrical parameters obtained by DFT calculation are in good agreement with single XRD data. The in vitro antibacterial activity of various tptz complexes of Co(II), Ni(II), Cu(II), Mn(II) and Rh(III) were evaluated against Gram-positive (Bacillus subtilis, Staphylococcus aureus and Gram-negative (Escherichia coli and Pseudomonas aeruginosa) bacteria. Whereas all complexes exhibited good activity in comparison to standard antibacterial drugs, the inhibitory effects of complexes were found to be more than that of the parent ligand. Overall, the obtained results strongly suggest that the cobalt(II) complex is a suitable candidate for counteracting antibiotic resistant microorganisms.

  14. Field-Induced Single-Ion Magnet Behaviour in Two New Cobalt(II Coordination Polymers with 2,4,6-Tris(4-pyridyl-1,3,5-triazine

    Directory of Open Access Journals (Sweden)

    Dong Shao


    Full Text Available We herein reported the syntheses, crystal structures, and magnetic properties of a two-dimensional coordination polymer {[CoII(TPT2/3(H2O4][CH3COO]2·(H2O4}n (1 and a chain compound {[CoII(TPT2(CHOO2(H2O2]}n (2 based on the 2,4,6-Tris(4-pyridyl-1,3,5-triazine (TPT ligand. Structure analyses showed that complex 1 had a cationic hexagonal framework structure, while 2 was a neutral zig-zag chain structure with different distorted octahedral coordination environments. Magnetic measurements revealed that both complexes exhibit large easy-plane magnetic anisotropy with the zero-field splitting parameter D = 47.7 and 62.1 cm−1 for 1 and 2, respectively. This magnetic anisotropy leads to the field-induced slow magnetic relaxation behaviour. However, their magnetic dynamics are quite different; while complex 1 experienced a dominating thermally activated Orbach relaxation at the whole measured temperature region, 2 exhibited multiple relaxation pathways involving direct, Raman, and quantum tunneling (QTM processes at low temperatures and Orbach relaxation at high temperatures. The present complexes enlarge the family of framework-based single-ion magnets (SIMs and highlight the significance of the structural dimensionality to the final magnetic properties.

  15. Solid-phase extraction method for preconcentration of trace amounts of some metal ions in environmental samples using silica gel modified by 2,4,6-trimorpholino-1,3,5-triazin

    International Nuclear Information System (INIS)

    Madrakian, Tayyebeh; Zolfigol, Mohammad Ali; Solgi, Mohammad


    A method was proposed for the preconcentration of some transition elements at trace levels using a column packed with silica gel modified by a synthetic ligand. Metal ions were adsorbed on 2,4,6-trimorpholino-1,3,5-triazin modified silica gel, then analytes retained on the adsorbent were eluted by 1 mol L -1 hydrochloric acid and determined by flame atomic absorption spectrometry (FAAS). The influences of some experimental parameters including pH of the sample solution, weight of adsorbent, type, concentration and volume of eluent, flow rates of the sample solution and eluent, and sample volume on the preconcentration efficiency have been investigated. The influences of some matrix elements were also examined. The method also was used for simultaneous preconcentration of these elements and the method was successfully applied to the preconcentration and determination of them. The detection limits of the method for Ni 2+ , Co 2+ , Cd 2+ and Zn 2+ were 0.29, 0.20, 0.23 and, 0.30 ng mL -1 , respectively. The application of this modified silica gel to preconcentration of investigated cation from tap water, lake water, urine and apple leaves gave high accuracy and precision (relative standard deviation (R.S.D.) <3%)

  16. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides. (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M


    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼ 15, ∼ 90, and ∼ 200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process.

  17. Rhodium(III)-catalyzed regioselective C2-amidation of indoles with N-(2,4,6-trichlorobenzoyloxy)amides and its synthetic application to the development of a novel potential PPARγ modulator. (United States)

    Shi, Jingjing; Zhao, Guanguan; Wang, Xiaowei; Xu, H Eric; Yi, Wei


    A new and efficient method for the direct regioselective C2-amidation of various functionalized indoles with several N-(2,4,6-trichlorobenzoyloxy)amides via Rh(iii)-catalyzed C-H activation/N-O cleavage/C-N formation using the pyrimidyl group as a readily installable and removable directing group has been developed. With this method, a variety of valuable 2-amido indoles can be easily prepared under mild conditions with broad functional group tolerance and excellent region-/site-specificities. Application of this strategy to the synthesis of target compound as a novel PPARγ modulator was also demonstrated. The results from biological evaluation showed that compound had a partial PPARγ agonistic activity and a strong PPARγ binding affinity with an IC50 value of 120.0 nM, along with a less pronounced adipocyte differentiation ability compared to the currently marketed anti-diabetic drug rosiglitazone, suggesting that further development of such a compound might be of great interest.

  18. Physico-chemical characterization, density functional theory (DFT) studies and Hirshfeld surface analysis of a new organic optical material: 1H-benzo[d]imidazol-3-ium-2,4,6-trinitrobenzene-1,3 bis(olate) (United States)

    Dhamodharan, P.; Sathya, K.; Dhandapani, M.


    A novel organic crystal, 1H-benzo[d]imidazol-3-ium-2,4,6-trinitrobenzene-1,3 bis(olate) (BITB), was synthesized. Single crystals of BITB were harvested by solution growth-slow evaporation technique. 1H and 13C NMR spectroscopic techniques were utilized to confirm the presence of various types of carbons and protons in BITB. Single crystal XRD confirms that BITB crystallizes in monoclinic system with a space group of P21/n. The suitability of this material for optical applications was assessed by optical absorption, transmittance, reflectance and refractive index spectroscopic techniques. Gaussian 09 program at B3LYP/6-311++G(d,p) level of basis set as used for the optimization of molecular structure of BITB. Greater first order hyperpolarizability value of BITB is due to intensive hydrogen bond network in the crystal. The value is 15 times greater than that of Urea, a reference standard. Computation of frontier molecular orbitals and electrostatic potential surface helped to understand the electron density and reactive sites in BITB. The material was thermally stable up to 220 °C. Hirshfeld surface analysis was performed to quantify the covalent and non covalent interactions.

  19. Constitutive ω-3 fatty acid production in fat-1 transgenic mice and docosahexaenoic acid administration to wild type mice protect against 2,4,6-trinitrobenzene sulfonic acid-induced colitis. (United States)

    Yum, Hye-Won; Kang, Jing X; Hahm, Ki Baik; Surh, Young-Joon


    Omega-3 (ω-3) polyunsaturated fatty acids (PUFAs) are known to have strong anti-inflammatory effects. In the present study, we investigated the protective effects of ω-3 PUFAs on experimentally induced murine colitis. Intrarectal administration of 2.5% 2,4,6-trinitrobenzene sulfonic acid (TNBS) caused inflammation in the colon of wild type mice, but this was less severe in fat-1 transgenic mice that constitutively produce ω-3 PUFAs from ω-6 PUFAs. The intraperitoneal administration of docosahexaenoic acid (DHA), a representative ω-3 PUFA, was also protective against TNBS-induced murine colitis. In addition, endogenously formed and exogenously introduced ω-3 PUFAs attenuated the production of malondialdehyde and 4-hydroxynonenal in the colon of TNBS-treated mice. The effective protection against inflammatory and oxidative colonic tissue damages in fat-1 and DHA-treated mice was associated with suppression of NF-κB activation and cyclooxygenase-2 expression and with elevated activation of Nrf2 and upregulation of its target gene, heme oxygenase-1. Taken together, these results provide mechanistic basis of protective action of ω-3 fatty PUFAs against experimental colitis. Copyright © 2017. Published by Elsevier Inc.

  20. Solvent-Induced Change of Electronic Spectra and Magnetic Susceptibility of Co(II) Coordination Polymer with 2,4,6-Tris(4-pyridyl)-1,3,5-triazine. (United States)

    Polunin, Ruslan A; Burkovskaya, Nataliya P; Satska, Juliya A; Kolotilov, Sergey V; Kiskin, Mikhail A; Aleksandrov, Grigory G; Cador, Olivier; Ouahab, Lahcène; Eremenko, Igor L; Pavlishchuk, Vitaly V


    One-dimensional coordination polymer [Co(Piv)2(4-ptz)(C2H5OH)2]n (compound 1, Piv(-) = pivalate, 4-ptz = 2,4,6-tris(4-pyridyl)-1,3,5-triazine) was synthesized by interaction of Co(II) pivalate with 4-ptz. Desolvation of 1 led to formation of [Co(Piv)2(4-ptz)]n (compound 2), which adsorbed N2 and H2 at 78 K as a typical microporous sorbent. In contrast, absorption of methanol and ethanol by 2 at 295 K led to structural transformation probably connected with coordination of these alcohols to Co(II). Formation of 2 from 1 was accompanied by change of color of sample from orange to brown and more than 2-fold decrease of molar magnetic susceptibility (χM) in the temperature range from 2 to 300 K. Resolvation of 2 by ethanol or water resulted in restoration of spectral characteristics and χM values almost to the level of that of 1. χMT versus T curves for 1 and samples, obtained by resolvation of 2 by H2O or C2H5OH, were fitted using a model for Co(II) complex with zero-field splitting of this ion.

  1. Studies on synthesis, structural, luminescent and thermal properties of a new non-linear optical crystal: 4-amino-4H-1,2,4-triazol-1-ium-3-hydroxy-2,4,6-trinitrophenolate

    Energy Technology Data Exchange (ETDEWEB)

    Dhamodharan, P.; Sathya, K.; Dhandapani, M., E-mail:


    A new organic proton transfer complex having NLO activity, 4-amino-4H-1,2,4-triazol-1-ium-3-hydroxy-2,4,6-trinitrophenolate (ATHTP), was crystallized to investigate the factors which stabilize the structure of the crystal. The compound crystallizes in triclinic system with space group P-1. Elemental analysis, thermal analysis, UV–Vis–NIR, FT-IR and NMR spectral analyses were carried out to characterize the crystal. Optical, spectral and thermal properties of the title crystal were analyzed to recommend the material for optical applications. Z-scan was used to measure the effective third-order nonlinear optical susceptibility and nonlinear refractive index. The crystal structure was determined using single crystal XRD method and the structure was optimized using Gaussian 09 program at B3LYP/6-311++G(d,p) level of basis set. This hydrogen bond interactions led to the increase in first-order hyperpolarizability of ATHTP and was 30 times greater than that of urea. Hirshfeld analyses surface analysis was carried out to explore intermolecular interactions in the crystalline state. - Highlights: • Single crystals were grown by slow evaporation solution growth technique. • N-H…O, O-H…O and C-H…O type of interactions lead to stable network. • The thermal stability of the compound was investigated by TG/DTA analyses. • The third-order nonlinear optical susceptibility is found to be 2.1×10{sup −7} esu. • Hirshfeld analyses explore covalent and non covalent interactions.

  2. Rapid determination of silver in cultivated Japanese and South Korean oysters and Japanese rock oysters using the 24.6-s neutron activation product 110Ag and estimation of its average daily intake

    International Nuclear Information System (INIS)

    Fukushima, M.; Chatt, A.


    Soft tissues of cultivated Japanese (Miyagi Prefecture) and South Korean (Koje-do and Kosong) oysters and Japanese rock oysters (Honshu Island) were analyzed to measure silver levels. The soft tissues, namely hepatopancreas, gill, muscle, and mantle were separated, freeze-dried, pulverized, and analyzed by an instrumental neutron activation analysis method in conjunction with Compton suppression spectrometry (INAA-CSS). The method consisted of the irradiation of samples in a neutron flux of 5 x 10 11 cm -2 s -1 using the rapid transfer system in an inner pneumatic irradiation site of the Dalhousie University SLOWPOKE-2 reactor (DUSR) facility for 12-15 s, decay for 20 s, and counting for 60 s. The 657.8-keV gamma-ray of the 24.6-s nuclide 110 Ag was used for assaying silver. The method was validated using NIST, NRC and NIES certified reference materials. An absolute detection limit of 0.05 μg silver using NIST SRM 1566b Oyster Tissue was achieved. About 10-50 times higher levels of silver were found in cultivated Japanese oysters compared to the South Korean ones. The silver concentrations in cultivated oysters in Miyagi Prefecture showed the following trend: gill > mantle > hepatopancreas > muscle as well as on the age. Rock oysters generally had higher silver content compared to cultivated oysters. A very preliminary value of about 0.466 μg silver average intake per person per day was estimated from the consumption of oysters by the people living in the Sendai city of Miyagi Prefecture. (author)

  3. Room-temperature phosphorescence chemosensor and Rayleigh scattering chemodosimeter dual-recognition probe for 2,4,6-trinitrotoluene based on manganese-doped ZnS quantum dots. (United States)

    Zou, Wen-Sheng; Sheng, Dong; Ge, Xin; Qiao, Jun-Qin; Lian, Hong-Zhen


    Rayleigh scattering (RS) as an interference factor to detection sensitivity in ordinary fluorescence spectrometry is always avoided in spite of considerable efforts toward the development of RS-based resonance Rayleigh scattering (RRS) and hyper-Rayleigh scattering (HRS) techniques. Here, combining advantages of quantum dots (QDs) including chemical modification of functional groups and the installation of recognition receptors at their surfaces with those of phosphorescence such as the avoidance of autofluorescence and scattering light, l-cys-capped Mn-doped ZnS QDs have been synthesized and used for room-temperature phosphorescence (RTP) to sense and for RS chemodosimetry to image ultratrace 2,4,6-trinitrotoluene (TNT) in water. The l-cys-capped Mn-doped ZnS QDs interdots aggregate with TNT species induced by the formation of Meisenheimer complexes (MHCs) through acid-base pairing interaction between l-cys and TNT, hydrogen bonding, and electrostatic interaction between l-cys intermolecules. Although the resultant MHCs may quench the fluorescence at 430 nm, interdots aggregation can greatly influence the light scattering property of the aqueous QDs system, and therefore, dominant RS enhancement at defect-related emission wavelength was observed under the excitation of violet light of Mn-doped ZnS QDs, which was applied in chemodosimetry to image TNT in water. Meanwhile, Mn-doped ZnS QDs also exhibited a highly selective response to the quenching of the (4)T(1)-(6)A(1) transition emission (RTP) and showed a very good linearity in the range of 0.0025-0.45 μM TNT with detection limit down to 0.8 nM and RSD of 2.3% (n = 5). The proposed methods are well-suited for detecting the ultratrace TNT and distinguishing different nitro compounds.

  4. Effects of 6-methyl-uracil upon the phagocytic activity in mice following whole-body X-irradiation or 2,4,6,-triethyleneimino-s-triazine treatment

    International Nuclear Information System (INIS)

    Raake, W.; Tempel, K.


    1. Phagocytic activity measured by means of the intravasal clearence of a soot dispersion in male NMRI-mice was increased six to ten days after whole-body X-irradiation (640 R) and decreased during the same period after i.v. administration of 2,4,6-triethyleneimino-s-triazine (TEM 2.0 mg/kg). 2. By means of 6-methyl-uracil food admixtures (200 to 400 ppm during 2 or 3 weeks) or by repeated intravenous injections of a N-methyl-D-glucosamine-6-methyluracil complex (62.5 to 250 mg/kg daily during five days), a significant augmentation of the phagocytic index being related to time and dosage was obtained in otherwise untreated mice. Comparable results were seen using cytidine and cytidine-5'-phosphate, whereas guanosine-5'-phosphate remained ineffective. 3. Whilst stimulating effects of 6-methyl-uracil or its N-methyl-D-glucosamine complex on X-irradiated mice were suspended, an increase up to supernormal values of the phagocytic index was produced by the pyrimidine base in animals treated with TEM. In accordance to this the survival rate of lethally X-irradiated mice (960 R) could not be increased; with animals given lethal TEM-doses, however, a significantly increased survival rate was obtained. 4. The present investigations as well as former biochemical analyses confirm the assumption that 6-methyluracil produces its regeneration effects, to some extent at least, by specific pathways influencing the reticuloendothelium. Different results from X-irradiated and TEM-treated mice are referring to the different points of attack of the two noxa. (orig.) [de

  5. Species-specific differences in peroxisome proliferation, catalase, and SOD2 upregulation as well as toxicity in human, mouse, and rat hepatoma cells induced by the explosive and environmental pollutant 2,4,6-trinitrotoluene. (United States)

    Naumenko, Ekaterina Anatolevna; Ahlemeyer, Barbara; Baumgart-Vogt, Eveline


    2,4,6-Trinitrotoluene (TNT) has been widely used as an explosive substance and its toxicity is still of interest as it persisted in polluted areas. TNT is metabolized in hepatocytes which are prone to its toxicity. Since analysis of the human liver or hepatocytes is restricted due to ethical reasons, we investigated the effects of TNT on cell viability, reactive oxygen species (ROS) production, peroxisome proliferation, and antioxidative enzymes in human (HepG2), mouse (Hepa 1-6), and rat (H4IIEC3) hepatoma cell lines. Under control conditions, hepatoma cells of all three species were highly comparable exhibiting identical proliferation rates and distribution of their cell cycle phases. However, we found strong differences in TNT toxicity with the lowest IC 50 values (highest cell death rate) for rat cells, whereas human and mouse cells were three to sevenfold less sensitive. Moreover, a strong decrease in cellular dehydrogenase activity (MTT assay) and increased ROS levels were noted. TNT caused peroxisome proliferation with rat hepatoma cells being most responsive followed by those from mouse and human. Under control conditions, rat cells contained fivefold higher peroxisomal catalase and mitochondrial SOD2 activities and a twofold higher capacity to reduce MTT than human and mouse cells. TNT treatment caused an increase in catalase and SOD2 mRNA and protein levels in human and mouse, but not in rat cells. Similarly, human and mouse cells upregulated SOD2 activity, whereas rat cells failed therein. We conclude that TNT induced oxidative stress, peroxisome proliferation and mitochondrial damage which are highest in rat cells rendering them most susceptible toward TNT. © 2016 Wiley Periodicals, Inc. Environ Toxicol 32: 989-1006, 2017. © 2016 Wiley Periodicals, Inc.

  6. Viscosity of aqueous Ni(NO3)2 solutions at temperatures from (297 to 475) K and at pressures up to 30 MPa and concentration between (0.050 and 2.246) mol . kg-1

    International Nuclear Information System (INIS)

    Abdulagatov, I.M.; Zeinalova, A.B.; Azizov, N.D.


    Viscosity of nine aqueous Ni(NO 3 ) 2 solutions (0.050, 0.153, 0.218, 0.288, 0.608, 0.951, 1.368, 1.824, and 2.246) mol . kg -1 was measured in the temperature range from (297 to 475) K and at pressures (0.1, 10, 20, and 30) MPa. The measurements were carried out with a capillary flow technique. The total experimental uncertainty of viscosity, pressure, temperature, and composition measurements were estimated to be less than 1.6%, 0.05%, 15 mK, and 0.02%, respectively. All experimental and derived results are compared with experimental and calculated values reported in the literature. Extrapolation of the solution viscosity measurements to zero concentration (pure water values) for the given temperature and pressure are in excellent agreement (average absolute deviation, AAD = 0.13%) with the values of pure water viscosity from IAPWS formulation [J. Kestin, J.V. Sengers, B. Kamgar-Parsi, J.M.H. Levelt Sengers, J. Phys. Chem. Ref. Data 13 (1984) 175-189]. The viscosity data for the solutions as a function of concentration have been interpreted in terms of the extended Jones-Dole equation for strong electrolytes. The values of viscosity A-, B-, and D-coefficients of the extended Jones-Dole equation for the relative viscosity (η/η ) of aqueous Ni(NO 3 ) 2 solutions as a function of temperature are studied. The derived values of the viscosity A- and B-coefficients were compared with the results predicted by Falkenhagen-Dole theory (limiting law) of electrolyte solutions and the values calculated with the ionic B-coefficient data. The measured values of viscosity for the solutions were also used to calculate the effective rigid molar volumes in the extended Einstein relation for the relative viscosity (η/η )

  7. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals. (United States)

    Kroonblawd, Matthew P; Sewell, Thomas D; Maillet, Jean-Bernard


    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.

  8. A study comparing the efficacy of antimicrobial agents versus enzyme (P-gp) inducers in the treatment of 2,4,6 trinitrobenzenesulfonic acid-induced colitis in rats. (United States)

    Toklu, H Z; Kabasakal, L; Imeryuz, N; Kan, B; Celikel, C; Cetinel, S; Orun, O; Yuksel, M; Dulger, G A


    The intestinal microflora is an important cofactor in the pathogenesis of intestinal inflammation; and the epithelial cell barrier function is critical in providing protection against the stimulation of mucosal immune system by the microflora. In the present study, therapeutic role of the antibacterial drugs rifampicin and ciprofloxacine were investigated in comparison to spironolactone, an enzyme inducer, in 2,4,6-trinitrobenzenesulfonic acid (TNBS)-induced colitis of the rats. Drugs were administered for 14 days following induction of colitis. All drug treatments ameliorated the clinical hallmarks of colitis as determined by body weight loss and assessment of diarrhea, colon length, and histology. Oxidative damage and neutrophil infiltration as well as nuclear factor κB (NF-κB) and tumor necrosis factor α (TNF-α) expressions that were increased during colitis, were decreased significantly. Rifampicin and ciprofloxacin were probably effective due to their antibacterial and immunomodulating properties. The multidrug resistence gene (MDR1) and its product p-glycoprotein (P-gp) has been implicated in the pathogenesis of inflammatory bowel disease (IBD). In the present study, findings of the P-gp expression were inconclusive but regarding previous studies, it can be suggested that the beneficial effects of rifampicin and spironolactone may be partly due to their action as a P-gp ligand. Spironolactone has been reported to supress the transcription of proinflamatory cytokines that are considered to be of importance in immunoinflammatory diseases. It is also a powerful pregnane X receptor (PXR) inducer; thus, inhibition of the expression of NF-κB and TNF-α, and amelioration of inflammation by spironolactone suggest that this may have been through the activation of PXR. However, our findings regarding PXR expression were inconclusive. Activation of PXR by spironolactone probably also contributed to the induction of P-gp, resulting in extrusion of noxious substances

  9. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals

    International Nuclear Information System (INIS)

    Kroonblawd, Matthew P.; Sewell, Thomas D.; Maillet, Jean-Bernard


    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock

  10. Characteristics of energy exchange between inter- and intramolecular degrees of freedom in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) with implications for coarse-grained simulations of shock waves in polyatomic molecular crystals (United States)

    Kroonblawd, Matthew P.; Sewell, Thomas D.; Maillet, Jean-Bernard


    In this report, we characterize the kinetics and dynamics of energy exchange between intramolecular and intermolecular degrees of freedom (DoF) in crystalline 1,3,5-triamino-2,4,6-trinitrobenzene (TATB). All-atom molecular dynamics (MD) simulations are used to obtain predictions for relaxation from certain limiting initial distributions of energy between the intra- and intermolecular DoF. The results are used to parameterize a coarse-grained Dissipative Particle Dynamics at constant Energy (DPDE) model for TATB. Each TATB molecule in the DPDE model is represented as an all-atom, rigid-molecule mesoparticle, with explicit external (molecular translational and rotational) DoF and coarse-grained implicit internal (vibrational) DoF. In addition to conserving linear and angular momentum, the DPDE equations of motion conserve the total system energy provided that particles can exchange energy between their external and internal DoF. The internal temperature of a TATB molecule is calculated using an internal equation of state, which we develop here, and the temperatures of the external and internal DoF are coupled using a fluctuation-dissipation relation. The DPDE force expression requires specification of the input parameter σ that determines the rate at which energy is exchanged between external and internal DoF. We adjusted σ based on the predictions for relaxation processes obtained from MD simulations. The parameterized DPDE model was employed in large-scale simulations of shock compression of TATB. We show that the rate of energy exchange governed by σ can significantly influence the transient behavior of the system behind the shock.

  11. A dual spectroscopic fluorescence probe based on carbon dots for detection of 2,4,6-trinitrophenol/Fe (III) ion by fluorescence and frequency doubling scattering spectra and its analytical applications. (United States)

    Xu, Jinxia; Bai, Zhangjun; Zu, Fanlin; Yan, Fanyong; Wei, Junfu; Zhang, Saihui; Luo, Yunmei


    A convenient, highly sensitive and reliable assay for 2,4,6‑trinitrophenol (TNP) and Fe (III) ion (Fe 3+ ) in the dual spectroscopic manner is developed based on novel carbon dots (CDs). The CDs with highly blue emitting fluorescent were easily prepared via the one-step potassium hydroxide-assisted reflux method from dextrin. The as-synthesized CDs exhibited the high crystalline quality, the excellent fluorescence characteristics with a high quantum yield of ~13.1%, and the narrow size distribution with an average diameter of 6.3±0.5nm. Fluorescence and frequency doubling scattering (FDS) spectra of CDs show the unique changes in the presence of TNP/Fe 3+ by different mechanism. The fluorescence of CDs decreased apparently in the presence of TNP via electron-transfer. Thus, after the experimental conditions were optimized, the linear range for detection TNP is 0-50μM, the detection limit was 19.1nM. With the addition of Fe 3+ , the FDS of CDs appeared to be highly sensitive with a quick response to Fe 3+ as a result of the change concentration of the scattering particle. The emission peak for FDS at 450nm was enhanced under the excitation wavelength at 900nm. The fluorescence response changes linearly with Fe 3+ concentration in the range of 8-40μM, the detection limits were determined to be 44.1nM. The applications of CDs were extended for the detection of TNP, Fe 3+ in real water samples with a high recovery. The results reported here may become the potential tools for the fast response of TNP and Fe 3+ in the analysis of environmental pollutants. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. 43 CFR 2.46 - Definitions. (United States)


    .... (c) Individual. As used in this subpart, “individual” means a citizen of the United States or an... Department or a bureau thereof, including, but not limited to, education, financial transactions, medical... print, or a photograph. (f) System of records. As used in this subpart, “System of records” means a...

  13. 7 CFR 246.4 - State plan. (United States)


    ... jurisdiction; (ii) Vendor limiting and selection criteria. Vendor limiting criteria, if used by the State agency, and the vendor selection criteria established by the State agency consistent with the... friends; or, (iii) One employee determining eligibility for all certification criteria and issuing food...

  14. 7 CFR 246.8 - Nondiscrimination. (United States)


    ... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... Amendments of 1972, section 504 of the Rehabilitation Act of 1973, the Age Discrimination Act of 1975... discrimination under the Program. Compliance with title VI of the Civil Rights Act of 1964, title IX of the...

  15. 1-Bromo-2,4,6-tricyclohexylbenzene

    Directory of Open Access Journals (Sweden)

    Joel T. Mague


    Full Text Available The title compound, C24H25Br, packs efficiently in the crystal structure with no solvent-accessible voids and several intermolecular H...H contacts approximating the sum of the van der Waals radii. The molecule is quite crowded, with intramolecular Br...H and C...H contacts ca 0.38 and 0.30 Å, respectively, less than the sum of the corresponding van der Waals radii. All cyclohexyl rings adopt chair conformations with the `seat' of the chair inclined at approximately 57–81° to the mean plane of the benzene ring, while those ortho to bromine have their centroids displaced in opposite directions from this plane.

  16. 7 CFR 246.14 - Program costs. (United States)


    ... following: (1) The cost of nutrition education and breastfeeding promotion and support which meets the... documentation of the nutrition education and breastfeeding promotion and support expenditure requirement. Costs... producing nutrition education and breastfeeding promotion and support materials including handouts, flip...

  17. 7 CFR 246.2 - Definitions. (United States)


    ...; (d) Conditions that directly affect the nutritional health of a person, including alcoholism or drug... termination of pregnancy. Poverty income guidelines means the poverty income guidelines prescribed by the...

  18. 7 CFR 246.20 - Audits. (United States)


    ... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... by OIG to be necessary. In performing such audits, OIG will rely to the extent feasible on audit work... implementation and for completion of correction of deficiencies and their causes. (3) FNS will determine whether...

  19. 8 CFR 246.5 - Hearing. (United States)


    ... chapter. (b) Opening. The immigration judge shall advise the respondent of the nature of the proceeding... answer, if any, as exhibits in the record. (c) Pleading by respondent. The immigration judge shall...

  20. 32 CFR 246.5 - Responsibilities. (United States)


    ... APF accounting and reporting procedures required by DoD Instruction 7000.12 5 , in coordination with... unacceptable conflict of interest damaging to the editorial integrity and credibility of the Stars and Stripes... initiatives to ensure support of U.S. Armed Forces during contingency operations and armed conflict. The S&S...

  1. N-(2,4,6-Trimethylphenylformamide

    Directory of Open Access Journals (Sweden)

    David C. Liles


    Full Text Available The title compound, C10H13NO, was obtained as the unexpected, almost exclusive, product in the attempted synthesis of a manganese(I–N-heterocyclic carbene (NHC complex. The dihedral angle between the planes of the formamide moiety and the aryl ring is 68.06 (10°. In the crystal, molecules are linked by N—H...O hydrogen bonds, forming infinite chains along the c axis.

  2. Publications | Page 246 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Governance, Health, Information and Communication, Natural Resources ... Wednesday, 11 May 2011, saw the fifth Information for Change workshop, held in Lagos ... complex institutions, especially health systems and development projects. ... communities have a set of characteristics that makes them very vulnerable to ...

  3. 40 CFR 246.101 - Definitions. (United States)


    ... (or materials which have been separated for the purpose of recycling) from a central storage point. (f... facilities for the purpose of these guidelines. United States Government installations located on foreign... facilities for the purpose of these guidelines. (m) Food waste means the organic residues generated by the...

  4. 7 CFR 246.27 - Program information. (United States)


    ..., New Jersey, Pennsylvania, Puerto Rico, Virginia, Virgin Islands, West Virginia: U.S. Department of Agriculture, FNS, Mid-Atlantic Region, Mercer Corporate Park, 300 Corporate Boulevard, Robbinsville, New...

  5. Publications | Page 246 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transnational migration of Vietnamese women in Asia : experiences, rights and citizenship; final technical report (restricted access). Women who work in South Korea and Taiwan had access to NGOs and government services when facing difficulties while women in the Gulf region have nowhere to turn. Transnational ...

  6. 43 CFR 24.6 - Cooperative agreements. (United States)


    ... Congressional policy (e.g., Fish and Wildlife Coordination Act of 1956) of State-Federal cooperation and coordination in the area of fish and wildlife conservation, State and Federal agencies have implemented...: (1) Protection, maintenance, and development of fish and wildlife habitat; (2) Fish and wildlife...

  7. Sequential addition of H{sub 2} O{sub 2}, pH and solvent effects as key factors in the oxidation of 2,4,6-tri-chloro-phenol catalyzed by iron tetra-sulfo-phthalocyanine; Facteur cles dans l`oxydation du 2,4,6-trichlorophenol catalysee par la tetrasulfophtalocyanine de fer: ajout sequentiel d`eau oxygenee, effets du pH et du solvant

    Energy Technology Data Exchange (ETDEWEB)

    Hadasch, A.; Sorokin, A.; Meunier, B. [Centre National de la Recherche Scientifique (CNRS), 31 - Toulouse (France). Lab. de Chimie de Coordination; Rabion, A. [Centre de Recherche ELF-Atochem, Departement Chimie Organique et Biochimie, 64 - Artix (France)


    Degradation of chlorinated aromatics is an important environmental research field since these compounds are among the most recalcitrant pollutants. With hydrogen peroxide, iron tetra-sulfo-phthalocyanine (FePcS) has been shown to catalyze aromatic ring cleavage of 2,4,6-tri-chloro-phenol (TCP). Here are reported new data on the key factors controlling the catalytic activity of the FePcS-H{sub 2} O{sub 2} system in the oxidation of TCP: the sequential addition of H{sub 2} O{sub 2} and the pH and solvent effects on the monomer/dimer equilibria of the catalyst precursors. The efficiency of the H{sub 2}O{sub 2} oxidation TCP catalyzed by FePcS is highly dependent on the pH value of the reaction mixture, the local hydrogen peroxide concentration and the organisation of FePcS molecules in solution. Among the several forms of FePcS in aqueous solutions (dimer or monomer), monomeric FePcS is proposed to be the catalytically active complex. The key role of the organic co-solvent (acetonitrile, acetone, alcohol,...) is to shift the dimer/monomer equilibrium toward monometric FePcS, the efficient catalyst precursor. A stepwise addition of hydrogen peroxide significantly improves the conversion of TCP and allows a low catalyst loading, below 1% with respect to the pollutant, to improves the conversion of TCP and allows a low catalyst loading, below 1% with respect to the pollutant, to be used. (authors) 23 refs.

  8. Monomer-to-polymer conversion and micro-tensile bond strength to dentine of experimental and commercial adhesives containing diphenyl(2,4,6-trimethylbenzoyl)phosphine oxide or a camphorquinone/amine photo-initiator system. (United States)

    Miletic, Vesna; Pongprueksa, Pong; De Munck, Jan; Brooks, Neil R; Van Meerbeek, Bart


    To compare the degree of conversion (DC) of adhesives initiated by diphenyl(2,4,6-trimethylbenzoyl)phosphine oxide (TPO) or a camphorquinone/tertiary amine system (CQ/Amine) as well as their 'immediate' micro-tensile bond strength (μTBS) to bur-cut dentine. DC of Scotchbond Universal ('SBU'; 3M ESPE), its experimental counterpart containing TPO as photo-initiator system, an experimental G-aenial Bond ('Ga-B'; GC) adhesive formulation, and an experimental LUB-102 adhesive formulation ('LUB', Kuraray Noritake), containing as photo-initiatior system either 2wt% CQ along with 2wt% tertiary amine ('SBU_CQ/Amine'; 'Ga-B_CQ/Amine'; 'LUB_CQ/Amine'), or 2wt% TPO ('SBU_TPO'; 'Ga-B_TPO'; 'LUB_TPO'), was determined using Fourier-transform infrared spectroscopy (FTIR), after being cured with a dual-wavelength light-curing unit (bluephase 20i, Ivoclar Vivadent). The same adhesive formulations were applied to bur-cut mid-coronal dentine of intact human molars, and subjected to a μTBS test after 1-week water storage. Besides being applied following a self-etch (SE) application mode, the adhesive formulations SBU_CQ/Amine and SBU_TPO were also applied following an etch-and-rinse (E&R) mode, this both for DS and μTBS measurement. No significant difference in DC was found for any of the adhesive formulations, except for SBU_CQ/Amine_SE and SBU_TPO_SE. For both SBU formulations, a significantly higher DC was reached for the E&R than the SE approach. Regarding μTBS, no significant differences were recorded, except for the significantly higher μTBS measured for SBU_CQ/Amine_E&R and SBU_TPO_E&R. In self-etch adhesives, the photo-initiator TPO may be used instead of CQ/Amine. The curing and 'immediate' bonding efficiency depended on the application protocol (E&R versus SE), but not on the photo-initiator system. The photo-initiator TPO may be used in self-etch adhesives instead of CQ/Amine with similar curing and 'immediate' bonding efficiency. Copyright © 2013 Elsevier Ltd. All

  9. Biodegradation of Nitro-Substituted Explosives 2,4,6-Trinitrotoluene, Hexahydro-1,3,5-Trinitro-1,3,5-Triazine, and Octahydro-1,3,5,7-Tetranitro-1,3,5-Tetrazocine by a Phytosymbiotic Methylobacterium sp. Associated with Poplar Tissues (Populus deltoides × nigra DN34) (United States)

    Van Aken, Benoit; Yoon, Jong Moon; Schnoor, Jerald L.


    A pink-pigmented symbiotic bacterium was isolated from hybrid poplar tissues (Populus deltoides × nigra DN34). The bacterium was identified by 16S and 16S-23S intergenic spacer ribosomal DNA analysis as a Methylobacterium sp. (strain BJ001). The isolated bacterium was able to use methanol as the sole source of carbon and energy, which is a specific attribute of the genus Methylobacterium. The bacterium in pure culture was shown to degrade the toxic explosives 2,4,6-trinitrotoluene (TNT), hexahydro-1,3,5-trinitro-1,3,5-triazene (RDX), and octahydro-1,3,5,7-tetranitro-1,3,5-tetrazocine (HMX). [U-ring-14C]TNT (25 mg liter−1) was fully transformed in less than 10 days. Metabolites included the reduction derivatives amino-dinitrotoluenes and diamino-nitrotoluenes. No significant release of 14CO2 was recorded from [14C]TNT. In addition, the isolated methylotroph was shown to transform [U-14C]RDX (20 mg liter−1) and [U-14C]HMX (2.5 mg liter−1) in less than 40 days. After 55 days of incubation, 58.0% of initial [14C]RDX and 61.4% of initial [14C]HMX were mineralized into 14CO2. The radioactivity remaining in solution accounted for 12.8 and 12.7% of initial [14C]RDX and [14C]HMX, respectively. Metabolites detected from RDX transformation included a mononitroso RDX derivative and a polar compound tentatively identified as methylenedinitramine. Since members of the genus Methylobacterium are distributed in a wide diversity of natural environments and are very often associated with plants, Methylobacterium sp. strain BJ001 may be involved in natural attenuation or in situ biodegradation (including phytoremediation) of explosive-contaminated sites. PMID:14711682

  10. 32 CFR Appendix D to Part 246 - Editorial Operations (United States)


    ... newspaper to fully inform its readership. b. Freedom of the press. c. Commitment to personal and..., color, religion, sex, national origin, age, marital status, physical handicap, political affiliation or... implements the Freedom of Information Act (FOIA) in the Department of Defense, but it is the responsibility...

  11. An Assessment of surgical outcome amongst 246 cataract ...

    African Journals Online (AJOL)


    existing ocular morbidity as well as prevention or proper management of surgery related complications when they ... Pre-medication with ... They were of modified J loop or C loop ... incision was closed with five 8-0 virgin silk sutures or 9-0.


    African Journals Online (AJOL)

    Fr. Ikenga

    There are various definitions of crime from the perspectives of moralists, ... only precise and administrative applicable definition and that sociologist may strive to .... moralist position on crimes, the libertarians put forward another view that self-.

  13. 40 CFR 421.246 - Pretreatment standards for new sources. (United States)


    ... GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Nickel Subcategory... reclaim leaching belt filter backwash. PSNS for the Secondary Nickel Subcategory Pollutant or pollutant...

  14. 7 CFR 246.12 - Food delivery systems. (United States)


    ...). (3) Vendor selection criteria. The State agency must develop and implement criteria to select stores for authorization. The State agency must apply its selection criteria consistently throughout its... period using the vendor selection criteria in effect at the time of the reassessment and must terminate...

  15. 7 CFR 246.16a - Infant formula cost containment. (United States)


    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS... agencies must use either a single-supplier competitive system as outlined in paragraph (c) of this section... the single-supplier competitive system? Under the single-supplier competitive system, a State agency...

  16. 48 CFR 252.246-7001 - Warranty of data. (United States)


    ... exceed ten percent of the total contract price. (ii) If the breach of the warranty is with respect to the..., DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And... contract entitled, Rights in Technical Data and Computer Software. (b) Warranty. Notwithstanding inspection...


    African Journals Online (AJOL)

    Fr. Ikenga

    Thus, it is the aim of this paper to make a case for the amendment of the Constitution ... 2 Standard International Media Holdings The New International Webster's ..... have a very damaging impact on the judiciary as it would facilitate short-term ... remembered that the pension rights of judicial officers is subject to the number ...

  18. 7 CFR 246.7 - Certification of participants. (United States)


    ... age 5 under the medical assistance program established under Title XIX of the Social Security Act (in... Tribal Organization (including, an Indian tribe, band, or group recognized by the Department of the Interior; or an intertribal council or group which is an authorized representative of Indian tribes, bands...

  19. 32 CFR Appendix A to Part 246 - Mission (United States)


    ... in a Unified Command area of responsibility, or deployed in support of designated joint-Service... readers, the Stars and Stripes shall pay special attention to news of local, host-country conditions... Unified Command designated geographic area. The S&S shall have the same authorities and rights for resale...

  20. Decree number 1.246 of September 16, 1994

    International Nuclear Information System (INIS)


    Promulgates the Treaty for Proscription of Nuclear Weapon in Latin America and Caribbean - Tlatelolco Treaty, held in Mexico City in February 14, 1967 an the Resolutions numbers 267(E-V), of July 3, 1990, 268 (XII), of May 10, 1991 and 290 (VII), of August 26, 1992, all of them adopted by the General Conference of the Organism for the Proscription of Nuclear Weapon in Latin America and Caribbean (OPANAL) in Mexico City

  1. 1935 15' Quad #246 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  2. (E-4-Chloro-N-(2,4,6-trimethylbenzylideneaniline

    Directory of Open Access Journals (Sweden)

    Ying Guo


    Full Text Available In the title compound, C16H16ClN, the dihedral angle between the benzene rings is 24.61 (13°. In the crystal, only van der Waals interactions occur between neighbouring molecules.

  3. 7 CFR 246.16 - Distribution of funds. (United States)


    ... percent of poverty criterion. The Department will determine each State agency's population of persons categorically eligible for WIC which are at or below 185% of poverty, through the best available, nationally... Statistics, for the twelve months ending on March 31 of the fiscal year immediately prior to the adjustment...


    African Journals Online (AJOL)

    Fr. Ikenga

    view of the libertarians, also called the utilitarian view, dominated western jurisprudence while the positivist views pervade modern thinking in both the domestic and international arena. It was finally discovered that the uniqueness of the different views is that crimes must attract punishment for its breach. It is submitted that ...

  5. Dicty_cDB: SSJ246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ifihf*kkkkkkkkkkkkkkkk Translated Amino Acid sequence (All Frames) Frame A: kl*nviqiitinhkc*lnpkesnffnfsrkhtik**cstlrccstccnsrfid...nfsrkhtik**cstlrccstccnsrfidccrccsy lnlqriln*liihilipweifenlivylinn*LYLLIFKKKKKKK...AAAAAAAAAAAAAAAAAAAAAAAA sequence update 1998.12.21 Translated Amino Acid sequence kl*nviqiitinhkc*lnpkesnff

  6. 7 CFR 246.24 - Procurement and property management. (United States)


    ... concerning violation of law are to be referred to such local, State or Federal authority as may have proper jurisdiction. (c) State regulations. The State or local agency may use its own procurement regulations which reflect applicable State and local regulations, provided that procurements made with Program funds adhere...

  7. 48 CFR 252.246-7002 - Warranty of construction (Germany). (United States)


    ... workmanship performed. (d) The Contractor shall restore any work damaged in fulfilling the terms and... damage at the Contractor's expense. (g) With respect to all warranties, express or implied, from... all warranties to be executed in writing, for the benefit of the Government, if directed by the...

  8. 48 CFR 52.246-21 - Warranty of Construction. (United States)


    ... restore any work damaged in fulfilling the terms and conditions of this clause. The Contractor's warranty.... (g) With respect to all warranties, express or implied, from subcontractors, manufacturers, or... executed, in writing, for the benefit of the Government, if directed by the Contracting Officer; and (3...

  9. 40 CFR Appendix to Part 246 - Recommended Bibliography (United States)


    ... Belknap, M. Paper recycling: a business perspective. Subcommittee on Solid Waste, New York Chamber of... Publication SW-155. Washington, U.S. Government Printing Office, 1975. 26 p. Hansen, P. Solid waste recycling projects—a national directory. Environmental Protection Publication SW-45. Washington, U.S. Government...

  10. 29 CFR 1952.246 - Changes to approved plans. (United States)


    ... agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities.) The Employment Standards Administration, U.S... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...

  11. preparation and nucleophilic substitution of the 2,4,6

    African Journals Online (AJOL)


    Three methods for preparation of D-amino acids by nucleophilic substitution on derivatives of ... bioactivity of the peptide (Wenger 1985, ... Acetic acid (0.29 mL, 5 mmol) was added, and the mixture was further stirred for 5 h at rt under ... methanol/dichloromethane) to yield a white ... temperature, diluted with water, extracted.

  12. All projects related to | Page 246 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... America, South America, Argentina, Bolivia, Brazil, Chile, Colombia, Mexico, Peru ... Social sciences in sub-Saharan Africa are severely underresourced. ... SOUTH OF SAHARA, SOCIAL SCIENCES, POLICY MAKING, WEST AFRICA.

  13. 7 CFR 246.9 - Fair hearing procedures for participants. (United States)


    ... representative such as a relative, friend, legal counsel or other spokesperson. Such notification is not required... defined as any clear expression by the individual, the individual's parent, caretaker, or other...

  14. 7 CFR 246.25 - Records and reports. (United States)


    ... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... normal business hours for representatives of the Department and the Comptroller General of the United...) Financial and participation reports—(1) Monthly reports. (i) State agencies must submit financial and...

  15. 7 CFR 246.23 - Claims and penalties. (United States)


    ... through a review of the State agency's reports, program or financial analysis, monitoring, audit, or... cash-value vouchers and taken appropriate follow-up action on all redeemed food instruments and cash... inability to account for the disposition of each redeemed food instrument or cash-value voucher; and (iii...

  16. Degradation of 2,4,6-trinitrotoluene by selected helophytes

    Czech Academy of Sciences Publication Activity Database

    Nepovím, Aleš; Hebner, A.; Soudek, Petr; Gerth, A.; Thomas, H.; Smrček, S.; Vaněk, Tomáš


    Roč. 60, - (2005), s. 1454-1461 ISSN 0045-6535 R&D Projects: GA ČR(CZ) GP206/02/P065; GA MŠk(CZ) 1P05OC042 Institutional research plan: CEZ:AV0Z40550506 Keywords : TNT * biodegradation * emergent plant Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.297, year: 2005

  17. Dicty_cDB: VHD246 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available op1-11B14, complete sequence. 38 0.28 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange ... mRNA sequence. 46 1.4 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Lib

  18. Chemistry of the oxophosphinidene ligand. 2. Reactivity of the anionic complexes [MCp{P(O)R*}(CO)(2)](-) (M = Mo, W; R* = 2,4,6-C(6)H(2)(t)Bu(3)) toward electrophiles based on elements different from carbon. (United States)

    Alonso, María; Alvarez, M Angeles; García, M Esther; Ruiz, Miguel A; Hamidov, Hayrullo; Jeffery, John C


    The anionic oxophosphinidene complexes (H-DBU)[MCp{P(O)R*}(CO)(2)] (M = Mo, W; R* = 2,4,6-C(6)H(2)(t)Bu(3); Cp = η(5)-C(5)H(5), DBU = 1,8-diazabicyclo [5.4.0] undec-7-ene) displayed multisite reactivity when faced with different electrophilic reagents. The reactions with the group 14 organochloride compounds ER(4-x)Cl(x) (E = Si, Ge, Sn, Pb) led to either phosphide-like, oxophosphinidene-bridged derivatives [MCp{P(OE')R*}(CO)(2)] (E' = SiMe(3), SiPh(3), GePh(3), GeMe(2)Cl) or to terminal oxophosphinidene complexes [MCp{P(O)R*}(CO)(2)(E')] (E' = SnPh(3), SnPh(2)Cl, PbPh(3); Mo-Pb = 2.8845(4) Å for the MoPb compound). A particular situation was found in the reaction with SnMe(3)Cl, this giving a product existing in both tautomeric forms, with the phosphide-like complex [MCp{P(OSnMe(3))R*}(CO)(2)] prevailing at room temperature and the tautomer [MCp{P(O)R*}(CO)(2)(SnMe(3))] being the unique species present below 203 K in dichloromethane solution. The title anions also showed a multisite behavior when reacting with transition-metal based electrophiles. Thus, the reactions with the complexes [M'Cp(2)Cl(2)] (M' = Ti, Zr) gave phosphide-like derivatives [MCp{P(OM')R*}(CO)(2)] (M = Mo, M' = TiCp(2)Cl, ZrCp(2)Cl; M = W, M' = ZrCp(2)Cl), displaying a bridging κ(1),κ(1)-P,O- oxophosphinidene ligand connecting MCp(CO)(2) and M'Cp(2)Cl metal fragments (W-P = 2.233(1) Å, O-Zr = 2.016(4) Å for the WZr compound]. In contrast, the reactions with the complex [AuCl{P(p-tol)(3)}] gave the metal-metal bonded derivatives trans-[MCp{P(O)R*}(CO)(2){AuP(p-tol)(3)}] (M = Mo, W; Mo-Au = 2.7071(7) Å). From all the above results it was concluded that the terminal oxophosphinidene complexes are preferentially formed under conditions of orbital control, while charge-controlled reactions tend to give derivatives with the electrophilic fragment bound to the oxygen atom of the oxophosphinidene ligand (phosphide-like, oxophosphinidene-bridged derivatives).

  19. Hypericin from St. John’s Wort (hypericum perforatum) as a novel natural fluorophore for chemiluminescence reaction of bis (2,4,6-trichlorophenyl) oxalate–H2O2–imidazole and quenching effect of some natural lipophilic hydrogen peroxide scavengers

    International Nuclear Information System (INIS)

    Kazemi, Sayed Yahya; Abedirad, Seyed Mohammad; Zali, Seyed Hassan; Amiri, Mohadeseh


    Hypericin (HYP) molecule is a natural photoactive pigment, which plays a role as an effective photoreceptor in some plants of the Hypericum species (the most common of which is Saint John’s Wort) and some insect species. The present work deals with the first attempt to the study of peroxyoxalate chemiluminescence (POCL) system in the presense of HYP as a natural fluorophore. Reaction of bis (2,4,6-trichlorophenyl) oxalate(TCPO)–H 2 O 2 –imidazole can transfer energy to a HYP via formation of dioxetane through the chemically initiated electron exchange luminescence (CIEEL) mechanism and can emits a very intense red light. The effects of HYP, hydrogen peroxide, TCPO and imidazole concentrations on kinetic chemiluminescence parameters were also studied. These parameters including rise and fall rate constant for the chemiluminescence burst, theoretical and experimental maximum intensity, theoretical and experimental time to reach maximum intensity and total light yield emission were evaluated by using a pooled intermediate model for a non-linear least-squares curve fitting program, KINFIT. Moreover, quenching effect of two lipophilic natural antioxidant, Quercetin and β-carotene on it system was also investigated. The measurable concentration range of 7×10 −6 M to 7.5×10 −5 M of antioxidants were evaluated from the proper Stern–Volmer plots with satisfactory RSD% and corresponding detection limits of 2.2×10 −6 and 3.7×10 −6 for β-carotene and quercetin respectively. - Highlights: ► Red fluorophores may therefore chemiluminescence more intensely than other commonly chemiluminophores and emits light in longer wavelengths. ► Hypericin from St. John’s wort (hypericum perforatum) as natural red fluorophore for peroxyoxalate chemiluminescence was introduced. ► Quenching effect of two antioxidant, quercetin and β-carotene on it system was also investigated. ► The non linear least-squares curve fitting program KINFIT was applied to study of CL

  20. The effect of temperature on the stability of compounds used as UV-MALDI-MS matrix: 2,5-dihydroxybenzoic acid, 2,4,6-trihydroxyacetophenone, alpha-cyano-4-hydroxycinnamic acid, 3,5-dimethoxy-4-hydroxycinnamic acid, nor-harmane and harmane. (United States)

    Tarzi, Olga I; Nonami, Hiroshi; Erra-Balsells, Rosa


    The thermal stability of several commonly used crystalline matrix-assisted ultraviolet laser desorption/ionization mass spectrometry (UV-MALDI-MS) matrices, 2,5-dihydroxybenzoic acid (gentisic acid; GA), 2,4,6-trihydroxyacetophenone (THA), alpha-cyano-4-hydroxycinnamic acid (CHC), 3,5-dimethoxy-4-hydroxycinnamic acid (sinapinic acid; SA), 9H-pirido[3,4-b]indole (nor-harmane; nor-Ho), 1-methyl-9H-pirido[3,4-b]indole (harmane; Ho), perchlorate of nor-harmanonium ([nor-Ho+H]+) and perchlorate of harmanonium ([Ho+H]+) was studied by heating them at their melting point and characterizing the remaining material by using different MS techniques [electron ionization mass spectrometry (EI-MS), ultraviolet laserdesorption/ionization-time-of-flight-mass spectrometry (UV-LDI-TOF-MS) and electrospray ionization-time-of-flight-mass spectrometry (ESI-TOF-MS)] as well as by thin layer chromatography analysis (TLC), electronic spectroscopy (UV-absorption, fluorescence emission and excitation spectroscopy) and 1H nuclear magnetic resonance spectroscopy (1H-NMR). In general, all compounds, except for CHC and SA, remained unchanged after fusion. CHC showed loss of CO2, yielding the trans-/cis-4-hydroxyphenylacrilonitrile mixture. This mixture was unambiguously characterized by MS and 1H-NMR spectroscopy, and its sublimation capability was demonstrated. These results explain the well-known cluster formation, fading (vanishing) and further recovering of CHC when used as a matrix in UV-MALDI-MS. Commercial SA (SA 98%; trans-SA/cis-SA 5:1) showed mainly cis- to-trans thermal isomerization and, with very poor yield, loss of CO2, yielding (3',5'-dimethoxy-4'-hydroxyphenyl)-1-ethene as the decarboxilated product. These thermal conversions would not drastically affect its behavior as a UV-MALDI matrix as happens in the case of CHC. Complementary studies of the photochemical stability of these matrices in solid state were also conducted. Copyright (c) 2008 John Wiley & Sons, Ltd.

  1. Carbon cluster formation during thermal decomposition of octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine and 1,3,5-triamino-2,4,6-trinitrobenzene high explosives from ReaxFF reactive molecular dynamics simulations. (United States)

    Zhang, Luzheng; Zybin, Sergey V; van Duin, Adri C T; Dasgupta, Siddharth; Goddard, William A; Kober, Edward M


    We report molecular dynamics (MD) simulations using the first-principles-based ReaxFF reactive force field to study the thermal decomposition of 1,3,5-triamino-2,4,6-trinitrobenzene (TATB) and octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) at various densities and temperatures. TATB is known to produce a large amount (15-30%) of high-molecular-weight carbon clusters, whereas detonation of nitramines such as HMX and RDX (1,3,5-trinitroperhydro-1,3,5-triazine) generate predominantly low-molecular-weight products. In agreement with experimental observation, these simulations predict that TATB decomposition quickly (by 30 ps) initiates the formation of large carbonaceous clusters (more than 4000 amu, or approximately 15-30% of the total system mass), and HMX decomposition leads almost exclusively to small-molecule products. We find that HMX decomposes readily on this time scale at lower temperatures, for which the decomposition rate of TATB is about an order of magnitude slower. Analyzing the ReaxFF MD results leads to the detailed atomistic structure of this carbon-rich phase of TATB and allows characterization of the kinetics and chemistry related to this phase and their dependence on system density and temperature. The carbon-rich phase formed from TATB contains mainly polyaromatic rings with large oxygen content, leading to graphitic regions. We use these results to describe the initial reaction steps of thermal decomposition of HMX and TATB in terms of the rates for forming primary and secondary products, allowing comparison to experimentally derived models. These studies show that MD using the ReaxFF reactive force field provides detailed atomistic information that explains such macroscopic observations as the dramatic difference in carbon cluster formation between TATB and HMX. This shows that ReaxFF MD captures the fundamental differences in the mechanisms of such systems and illustrates how the ReaxFF may be applied to model complex chemical phenomena

  2. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto


    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  3. Rubidium 2,4,6-trioxo-1,3-diazinan-5-ide–1,3-diazinane-2,4,6-trione–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Marlena Gryl


    Full Text Available The asymmetric unit of the title compound, Rb+·C4H3N2O3−·C4H4N2O3·H2O, consists of one rubidium cation, a barbituric acid molecule, a barbiturate anion and one water molecule. The rubidium ion has seven close-contact interactions with O atoms, with Rb...O distances ranging from 2.8594 (16 to 3.2641 (14 Å. These seven O atoms together with an eighth O atom at 3.492 (2 Å away from Rb form a distorted polyhedron with shape intermediate between an antiprism and a dodecahedron. The Rb+ ions connect layers built of organic components and water molecules linked via N—H...O and O—H...O hydrogen bonds.

  4. Crystal structures of 2-[(4,6-diaminopyrimidin-2-ylsulfanyl]-N-(naphthalen-1-ylacetamide and 2-[(4,6-diaminopyrimidin-2-ylsulfanyl]-N-(4-fluorophenylacetamide

    Directory of Open Access Journals (Sweden)

    S. Subasri


    Full Text Available The title compounds, C16H15N5OS, (I, and C12H12FN5OS, (II, are [(diaminopyrimidinesulfanyl]acetamide derivatives. In (I, the pyrimidine ring is inclined to the naphthalene ring system by 55.5 (1°, while in (II, the pyrimidine ring is inclined to the benzene ring by 58.93 (8°. In (II, there is an intramolecular N—H...N hydrogen bond and a short C—H...O contact. In the crystals of (I and (II, molecules are linked by pairs of N—H...N hydrogen bonds, forming inversion dimers with R22(8 ring motifs. In the crystal of (I, the dimers are linked by bifurcated N—H...(O,O and C—H...O hydrogen bonds, forming layers parallel to (100. In the crystal of (II, the dimers are linked by N—H...O hydrogen bonds, also forming layers parallel to (100. The layers are linked by C—H...F hydrogen bonds, forming a three-dimensional architecture.

  5. Crystal structures of N-(4-chlorophenyl-2-[(4,6-diaminopyrimidin-2-ylsulfanyl]acetamide and N-(3-chlorophenyl-2-[(4,6-diaminopyrimidin-2-ylsulfanyl]acetamide

    Directory of Open Access Journals (Sweden)

    S. Subasri


    Full Text Available The title compounds, C12H12ClN5OS, (I, and C12H12ClN5OS, (II, are 2-[(diaminopyrimidin-2-ylsulfanyl]acetamides. Compound (II, crystallizes with two independent molecules (A and B in the asymmetric unit. In each of the molecules, in both (I and (II, an intramolecular N—H...N hydrogen bond forms an S(7 ring motif. The pyrimidine ring is inclined to the benzene ring by 42.25 (14° in (I, and by 59.70 (16 and 62.18 (15° in molecules A and B, respectively, of compound (II. In the crystal of (I, molecules are linked by pairs of N—H...N hydrogen bonds, forming inversion dimers with an R22(8 ring motif. The dimers are linked via bifurcated N—H...O and C—H...O hydrogen bonds, forming corrugated layers parallel to the ac plane. In the crystal of (II, the A molecules are linked through N—H...O and N—H...Cl hydrogen bonds, forming layers parallel to (100. The B molecules are also linked by N—H...O and N—H...Cl hydrogen bonds, also forming layers parallel to (100. The parallel layers of A and B molecules are linked via N—H...N hydrogen bonds, forming a three-dimensional structure.

  6. A meta-analysis of 120 246 individuals identifies 18 new loci for fibrinogen concentration

    NARCIS (Netherlands)

    P.S. de Vries (Paul); D.I. Chasman (Daniel); M. Sabater-Lleal (Maria); M.-H. Chen (Ming-Huei); J.E. Huffman (Jennifer E.); M. Steri (Maristella); W. Tang (Weihong); A. Teumer (Alexander); R.E. Marioni (Riccardo); V. Grossmann (Vera); J.J. Hottenga (Jouke Jan); S. Trompet (Stella); M. Müller-Nurasyid (Martina); J.H. Zhao (Jing Hua); J. Brody (Jennifer); M.E. Kleber (Marcus); X. Guo (Xiuqing); J.J. Wang (Jie Jin); P. Auer (Paul); J. Attia (John); L.R. Yanek (Lisa); T.S. Ahluwalia (Tarunveer Singh); J. Lahti (Jari); C. Venturini (Cristina); T. Tanaka (Toshiko); L.F. Bielak (Lawrence F.); P.K. Joshi (Peter); A. Rocanin-Arjo (Ares); I. Kolcic (Ivana); P. Navarro (Pau); L.M. Rose (Lynda); C. Oldmeadow (Christopher); H. Riess (Helene); J. Mazur (Johanna); S. Basu (Saonli); A. Goel (Anuj); Q. Yang (Qiong); M. Ghanbari (Mohsen); Gonnekewillemsen; A. Rumley (Ann); E. Fiorillo (Edoardo); A.J. de Craen (Anton); A. Grotevendt (Anne); R.A. Scott (Robert); K.D. Taylor (Kent D.); G.E. Delgado (Graciela E.); J. Yao (Jie); A. Kifley (Annette); C. Kooperberg (Charles); Q. Qayyum (Rehan); L. Lopez (Lornam); T.L. Berentzen (Tina L.); K. Räikkönen (Katri); Massimomangino; S. Bandinelli (Stefania); P.A. Peyser (Patricia A.); S. Wild (Sarah); D.-A. Tregouet (David-Alexandre); A.F. Wright (Alan); J. Marten (Jonathan); T. Zemunik (Tatijana); A.C. Morrison (Alanna); B. Sennblad (Bengt); G.H. Tofler (Geoffrey); M.P.M. de Maat (Moniek); E.J.C. de Geus (Eco); G.D. Lowe (Gordon D.); M. Zoledziewska (Magdalena); N. Sattar (Naveed); H. Binder (Harald); U. Völker (Uwe); M. Waldenberger (Melanie); K.-T. Khaw (Kay-Tee); B. McKnight (Barbara); J. Huang (Jian); N.S. Jenny (Nancy); E.G. Holliday (Elizabeth); L. Qi (Lihong); M.G. Mcevoy (Mark G.); D.M. Becker (Diane); J.M. Starr (John); A.-P. Sarin; P.G. Hysi (Pirro); D.G. Hernandez (Dena); M.A. Jhun (Min A.); H. Campbell (Harry); A. Hamsten (Anders); F. Sarin (Fernando); W.L. McArdle (Wendy); P. Eline Slagboom; T. Zeller (Tanja); W. Koenig (Wolfgang); B. Psaty (Brucem); T. Haritunians (Talin); J. Liu (Jingmin); A. Palotie (Aarno); A.G. Uitterlinden (André); D.J. Stott (David J.); A. Hofman (Albert); O.H. Franco (Oscar); O. Polasek (Ozren); I. Rudan (Igor); P.-E. Morange (P.); J.F. Wilson (James F.); S.L. Kardia (Sharon L.r); L. Ferrucci (Luigi); T.D. Spector (Timothy); J.G. Eriksson (Johan G.); T. Hansen (Torben); I.J. Deary (Ian); L.C. Becker (Lewis); R.J. Scott (Rodney); P. Mitchell (Paul); W. März (Winfried); N.J. Wareham (Nick J.); A. Peters (Annette); A. Greinacher (Andreas); P.S. Wild (Philipp S.); J.W. Jukema (Jan Wouter); D.I. Boomsma (Dorret I.); C. Hayward (Caroline); F. Cucca (Francesco); R.P. Tracy (Russell); H. Watkins (Hugh); A.P. Reiner (Alex P.); A.R. Folsom (Aaron); P.M. Ridker (Paul); C.J. O'Donnell (Christopher J.); N.L. Smith (Nicholas L.); D.P. Strachan (David P.); A. Dehghan (Abbas)


    textabstractGenome-wide association studies have previously identified 23 genetic loci associated with circulating fibrinogen concentration. These studies used HapMap imputation and did not examine the X-chromosome. 1000 Genomes imputation provides better coverage of uncommon variants, and includes

  7. 27 CFR 24.246 - Materials authorized for the treatment of wine and juice. (United States)


    ... derived from Aspergillus niger, Aspergillus oryzae, Bacillus subtilis, or barley malt per FDA advisory... shall be derived from Aspergillus niger or Aspergillus oryzae per FDA advisory opinion dated 8/18/83 or... clarify and to stabilize wine The enzyme activity used shall be derived from Aspergillus niger or bovine...

  8. 246 An International Multi-Disciplinary Journal, Ethiopia Vol. 3 (5 ...

    African Journals Online (AJOL)

    Nekky Umera

    enhancing economic, business and operational activities of both private and ... only as a global village, but a neighborhood due to advances in new technologies .... a number of problems such as: geographical fragmentation, inefficient labour.

  9. EKISTICS [OIKIETIKH]: The Problem and Science of Human Settlements, Volume 41, Number 246, May 1976. Education. (United States)

    Bell, Gwen, Ed.

    Articles related to educational planning in developing nations are presented. This issue of the journal of the World Society for Ekistics reviews environmental and settlement education programs which offer a wide variety of new approaches. Topics discussed include becoming a planning society; challenges, dilemmas, and strategies of ekistics…

  10. 1,3,5-Triazine-2,4,6-triyltrisulfamic acid (TTSA)

    Indian Academy of Sciences (India)


    cOrganic Polymer Chemistry Research Laboratory, Department of Chemistry, ... in handling, decreased reactor and plant corrosion ... eral acid in water or mixture of alcohol–water as ... Products were characterized by comparison ... A 250 mL suction flask was used. ... of melamine was completed, the mixture was shaken.

  11. People and things. CERN Courier, Jul-Aug 1984, v. 24(6)

    Energy Technology Data Exchange (ETDEWEB)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Valuable information on collective nuclear matter has come from another GSI / Berkeley team working at the Bevalac, this time using a streamer chamber to measure pion production in heavy ion collisions and infer the properties of the compressed nuclear matter formed in the 10{sup -23} seconds following the collisions. Judged by the bubbling enthusiasm of its 260 users, the LEAR Low Energy Antiproton Ring at CERN continues to be a great success. Electron beams have been taken to 800 MeV in the Aladdin storage ring at the Synchrotron Radiation Center, University of Wisconsin- Madison. The UA 1 'Monojets ' were first past the post in this year's traditional 3.9 km relay race round the CERN site.

  12. 48 CFR 52.246-2 - Inspection of Supplies-Fixed-Price. (United States)


    ... covering supplies under this contract and shall tender to the Government for acceptance only supplies that... mistakes amounting to fraud, or as otherwise provided in the contract. (l) If acceptance is not conclusive... remedies provided by law, or under other provisions of this contract, shall have the right to require the...

  13. 26 CFR 1.246-5 - Reduction of holding periods in certain situations. (United States)


    ... prices, or foreign-currency exchange rates; and (ii) Changes in the fair market value of the stock are... short position on a publicly traded index through a regulated futures contract (RFC) that reflects the...

  14. 48 CFR 552.246-70 - Source Inspection by Quality Approved Manufacturer. (United States)


    ...) Inspection system and inspection of facilities. (1) The inspection system maintained by the Contractor under... Federal Standard 368 or the International Organization for Standardization (ISO) Standard 9001:2000 (Quality Management Systems—Requirements). A documented description of the inspection system shall be made...

  15. SU-F-T-246: Evaluation of Healthcare Failure Mode And Effect Analysis For Risk Assessment

    International Nuclear Information System (INIS)

    Harry, T; Manger, R; Cervino, L; Pawlicki, T


    Purpose: To evaluate the differences between the Veteran Affairs Healthcare Failure Modes and Effect Analysis (HFMEA) and the AAPM Task Group 100 Failure and Effect Analysis (FMEA) risk assessment techniques in the setting of a stereotactic radiosurgery (SRS) procedure were compared respectively. Understanding the differences in the techniques methodologies and outcomes will provide further insight into the applicability and utility of risk assessments exercises in radiation therapy. Methods: HFMEA risk assessment analysis was performed on a stereotactic radiosurgery procedure. A previous study from our institution completed a FMEA of our SRS procedure and the process map generated from this work was used for the HFMEA. The process of performing the HFMEA scoring was analyzed, and the results from both analyses were compared. Results: The key differences between the two risk assessments are the scoring criteria for failure modes and identifying critical failure modes for potential hazards. The general consensus among the team performing the analyses was that scoring for the HFMEA was simpler and more intuitive then the FMEA. The FMEA identified 25 critical failure modes while the HFMEA identified 39. Seven of the FMEA critical failure modes were not identified by the HFMEA and 21 of the HFMEA critical failure modes were not identified by the FMEA. HFMEA as described by the Veteran Affairs provides guidelines on which failure modes to address first. Conclusion: HFMEA is a more efficient model for identifying gross risks in a process than FMEA. Clinics with minimal staff, time and resources can benefit from this type of risk assessment to eliminate or mitigate high risk hazards with nominal effort. FMEA can provide more in depth details but at the cost of elevated effort.

  16. Screening for biosurfactant production by 2,4,6-trinitrotoluene-transforming bacteria. (United States)

    Avila-Arias, H; Avellaneda, H; Garzón, V; Rodríguez, G; Arbeli, Z; Garcia-Bonilla, E; Villegas-Plazas, M; Roldan, F


    To isolate and identify TNT-transforming cultures from explosive-contaminated soils with the ability to produce biosurfactants. Bacteria (pure and mixed cultures) were selected based on their ability to transform TNT in minimum media with TNT as the sole nitrogen source and an additional carbon source. TNT-transforming bacteria were identified by 16S rRNA gene sequencing. TNT transformation rates were significantly lower when no additional carbon or nitrogen sources were added. Surfactant production was enabled by the presence of TNT. Fourteen cultures were able to transform the explosive (>50%); of these, five showed a high transformation capacity (>90%), and six produced surfactants. All explosive-transforming cultures contained Proteobacteria of the genera Achromobacter, Stenotrophomonas, Pseudomonas, Sphingobium, Raoultella, Rhizobium and Methylopila. These cultures transformed TNT when an additional carbon source was added. Remarkably, Achromobacter spanius S17 and Pseudomonas veronii S94 have high TNT transformation rates and are surfactant producers. TNT is a highly toxic, mutagenic and carcinogenic nitroaromatic explosive; therefore, bioremediation to eliminate or mitigate its presence in the environment is essential. TNT-transforming cultures that produce surfactants are a promising method for remediation. To the best of our knowledge, this is the first report that links surfactant production and TNT transformation by bacteria. © 2017 The Society for Applied Microbiology.

  17. : tous les projets | Page 246 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au cours des derniers mois, des centaines de milliers de citoyens en Algérie, au Maroc et en Tunisie se sont mobilisés pour exiger une plus grande responsabilité et légitimité du gouvernement. Date de début : 1 avril 2011. End Date: 30 avril 2014. Sujet: SOCIAL MOVEMENTS, DEMOCRATIZATION. Région: Algeria ...

  18. 2,4,6-tris[bis(1H-tetrazol-5-yl)amino

    Indian Academy of Sciences (India)


    Nitrogen rich compounds; high energy materials; density functional theory. 1. Introduction ... importance due to their numerous applications in gas generators, propel- ..... and Radhakrishnan S 2015 Quantum-chemical design of tetrazolo[1 ...

  19. Rapid restoration of methanogenesis in an acidified UASB reactor treating 2,4,6-trichlorophenol (TCP). (United States)

    Díaz-Báez, María Consuelo; Valderrama-Rincon, Juan Daniel


    Anaerobic bioreactors are often used for removal of xenobiotic and highly toxic pollutants from wastewater. Most of the time, the pollutant is so toxic that the stability of the reactor becomes compromised. It is well known that methanogens are one of the most sensitive organisms in the anaerobic consortia and hence the stability of the reactors is highly dependant on methanogenesis. Unfortunately few studies have focused on recovering the methanogenic activity once it has been inhibited by highly toxic pollutants. Here we establish a quick recovery strategy for neutralization of an acidified UASB reactor after failure by intoxication with an excess of TCP in the influent. Once the reactor returned to pH values compatible with methanogenesis, biogas production was re-started after one day and the system was re-acclimated to TCP. Successful removal of TCP from synthetic wastewater was shown for concentrations up to 70mg/L after restoration. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Symposium on Energy Storage Materials Energy and Fuel Division, 246th ACS National Meeting (United States)


    similar chemical reactivity as Li+ and surface selectivity due to their much larger  ionic  radii than Li+. Chemical and local structure information is...interest in developing organic­inorganic  oligomeric  materials for use as electrolyte in lithium ion batteries. Polyphosphazenes are inorganic...Small functionalized linear oligophosphazenes were also synthesized. All of these viscous  liquids  showed low glass transition temperatures. This

  1. A meta-analysis of 120 246 individuals identifies 18 new loci for fibrinogen concentration

    DEFF Research Database (Denmark)

    de Vries, Paul S; Chasman, Daniel I; Sabater-Lleal, Maria


    Genome-wide association studies have previously identified 23 genetic loci associated with circulating fibrinogen concentration. These studies used HapMap imputation and did not examine the X chromosome. 1000 Genomes imputation provides better coverage of uncommon variants, and includes indels. W...


    The capability of a plant-associated fungus, Fusarium oxyvorum, to transform TNT in liquid cultures was investigated. TNT was transformed into 2-amino-4, 6-dinitrotoluene (2-A-DNT), 4-amino-2, 6-dinitrotoluene (4-A- DNT), and 2, 4-diamino-6-nitrotoluene (2, 4-DAT) via 2- and 4-hy...

  3. 32 CFR Appendix C to Part 246 - Personnel Policies and Procedures (United States)


    ... assignment to the Stars and Stripes editorial staff at the required JMP grade- and experience-level... are fully aware of their obligations as DoD employees. B. Appropriated Fund (APF) Personnel Assignment... provide for education before the S&S assignment. e. The Military Services shall provide highly qualified...

  4. Initial Reductive Reactions in Aerobic Microbial Metabolism of 2,4,6-Trinitrotoluene

    National Research Council Canada - National Science Library

    Vorbeck, Claudia


    .... Thus, two bacterial strains enriched with TNT as a sole source of nitrogen under aerobic conditions, a gram-negative strain called TNT-8 and a gram-positive strain called TNT-32, carried out nitro-group reduction...

  5. Soft rotator model and {sup 246}Cm low-lying level scheme

    Energy Technology Data Exchange (ETDEWEB)

    Porodzinskij, Yu.V.; Sukhovitskij, E.Sh. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)


    Non-axial soft rotator nuclear model is suggested as self-consistent approach for interpretation of level schemes, {gamma}-transition probabilities and neutron interaction with even-even nuclei. (author)

  6. 3-Nitrophenol–1,3,5-triazine-2,4,6-triamine (2/1

    Directory of Open Access Journals (Sweden)

    V. Sangeetha


    Full Text Available The asymmetric unit of the title compound, C3H6N6·2C6H5NO3, contains one melamine and two 3-nitrophenol molecules. The mean planes of the 3-nitrophenol molecules are almost orthogonal to the plane of melamine, making dihedral angles of 82.77 (4 and 88.36 (5°. In the crystal, molecules are linked via O—H...N, N—H...N and N—H...O hydrogen bonds, forming a three-dimensional network. The crystal also features weak C—H...π and π–π interactions [centroid–centroid distance = 3.9823 (9 Å].

  7. 2,4,6-Trimethyl-3,5-bis[(phenylcarbonothioylsulfanylmethyl]benzyl benzenecarbodithioate

    Directory of Open Access Journals (Sweden)

    M. Kannan


    Full Text Available In the title compound C33H30S6, the three pendant methylene benzodithioate groups lie to one side of the central benzene ring in a cis-cis-cis `tripod' arrangement. The dihedral angles between the central benzene ring and the three pendant rings are 72.54 (4, 89.68 (4 and 86.74 (4°. In the crystal structure, one of the benzene rings is disordered over two orientations in a 0.559 (13:0.441 (13 ratio.

  8. 7 CFR 58.246 - Cleaning of dryers, collectors, conveyors, ducts, sifters and storage bins. (United States)


    ... (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG... and the frequency of cleaning shall be based upon observation of actual operating results and...

  9. Economic Growth and Poverty Reduction: Measurement and Policy Issues. OECD Development Centre Working Paper No. 246 (United States)

    Klasen, Stephan


    The aim of this Working Paper is to broaden the debate on "pro-poor growth". An exclusive focus on the income dimension of poverty has neglected the non-income dimensions. After an examination of prominent views on the linkages between economic growth, inequality, and poverty reduction this paper discusses the proper definition and…

  10. 32 CFR Appendix B to Part 246 - Business and Financial Operations (United States)


    ... archive responsibilities in the United States, as designated by the AFIS. Official mail may forward the...” transportation. 5. The S&S shall conduct local “market-penetration” surveys. The S&S shall also operate a...

  11. 40 CFR 246.200-5 - Recommended procedures: Methods of separation and collection. (United States)


    ... individual facility, the ease of collection, and the projected cost effectiveness of using various methods... located in an area the worker frequents in the normal course of business. (3) In locations where computer...

  12. Mineralization of 2,4,6-Trinitrotoleune (TNT) in Coastal Waters and Sediments (United States)


    Tandros et al. 2000) though many of these effects can be reversed if the algae are maintained in flow through systems (Pavlostathis and Jackson 2002...21 Effect of Underwater Demolition Detonation...catalysts, such as TiO2 (Schmelling et al. 1996, Son et al. 2004), or with additions of peroxide and ozone (Rodgers and Bunce 2001), borohydride (Larson et

  13. People and things. CERN Courier, Jul-Aug 1984, v. 24(6)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Valuable information on collective nuclear matter has come from another GSI / Berkeley team working at the Bevalac, this time using a streamer chamber to measure pion production in heavy ion collisions and infer the properties of the compressed nuclear matter formed in the 10 -23 seconds following the collisions. Judged by the bubbling enthusiasm of its 260 users, the LEAR Low Energy Antiproton Ring at CERN continues to be a great success. Electron beams have been taken to 800 MeV in the Aladdin storage ring at the Synchrotron Radiation Center, University of Wisconsin- Madison. The UA 1 'Monojets ' were first past the post in this year's traditional 3.9 km relay race round the CERN site

  14. 40 CFR 52.246 - Control of dry cleaning solvent vapor losses. (United States)


    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Control of dry cleaning solvent vapor... cleaning solvent vapor losses. (a) For the purpose of this section, “dry cleaning operation” means that process by which an organic solvent is used in the commercial cleaning of garments and other fabric...

  15. 24 CFR 246.8 - Materials to be submitted to HUD in support of preemption request. (United States)


    ... Commissioner, audited by an independent public accountant and covering the most recently ended accounting year... by the following: (i) Tax rates or appraisals, (ii) Utility rates, (iii) Contracts for employees or... experienced by the project which have been approved and can be documented as follows: (i) Tax rates or...

  16. SU-F-T-246: Evaluation of Healthcare Failure Mode And Effect Analysis For Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Harry, T [Oregon State University, Corvallis, OR (United States); University of California, San Diego, La Jolla, CA (United States); Manger, R; Cervino, L; Pawlicki, T [University of California, San Diego, La Jolla, CA (United States)


    Purpose: To evaluate the differences between the Veteran Affairs Healthcare Failure Modes and Effect Analysis (HFMEA) and the AAPM Task Group 100 Failure and Effect Analysis (FMEA) risk assessment techniques in the setting of a stereotactic radiosurgery (SRS) procedure were compared respectively. Understanding the differences in the techniques methodologies and outcomes will provide further insight into the applicability and utility of risk assessments exercises in radiation therapy. Methods: HFMEA risk assessment analysis was performed on a stereotactic radiosurgery procedure. A previous study from our institution completed a FMEA of our SRS procedure and the process map generated from this work was used for the HFMEA. The process of performing the HFMEA scoring was analyzed, and the results from both analyses were compared. Results: The key differences between the two risk assessments are the scoring criteria for failure modes and identifying critical failure modes for potential hazards. The general consensus among the team performing the analyses was that scoring for the HFMEA was simpler and more intuitive then the FMEA. The FMEA identified 25 critical failure modes while the HFMEA identified 39. Seven of the FMEA critical failure modes were not identified by the HFMEA and 21 of the HFMEA critical failure modes were not identified by the FMEA. HFMEA as described by the Veteran Affairs provides guidelines on which failure modes to address first. Conclusion: HFMEA is a more efficient model for identifying gross risks in a process than FMEA. Clinics with minimal staff, time and resources can benefit from this type of risk assessment to eliminate or mitigate high risk hazards with nominal effort. FMEA can provide more in depth details but at the cost of elevated effort.

  17. Syntheses of Radioiodinated Pyrimidine-2,4,6-Triones as Potential Agents for Non-Invasive Imaging of Matrix Metalloproteinases

    Directory of Open Access Journals (Sweden)

    Hans-Jörg Breyholz


    Full Text Available Dysregulated expression or activation of matrix metalloproteinases (MMPs is observed in many kinds of live-threatening diseases. Therefore, MMP imaging for example with radiolabelled MMP inhibitors (MMPIs potentially represents a valuable tool for clinical diagnostics using non-invasive single photon emission computed tomography (SPECT or positron emission tomography (PET imaging. This work includes the organic chemical syntheses and in vitro evaluation of five iodinated barbiturate based MMPIs and the selection of derivative 9 for radiosyntheses of isotopologues [123I]9 potentially useful for MMP SPECT imaging and [124I]9 for MMP PET imaging.

  18. Application of Spectra Accuracy for Analysis of Organic Explosive: 2,4,6-trinitrotoluene by AccuTOF-DART

    Directory of Open Access Journals (Sweden)

    Zhanfang Liu


    Full Text Available This paper, through mass spectrometric (MS analysis for nitro compound explosives on a direct analysis in a real-time time-of-flight MS, indicates that even on a high-resolution MS with accurate mass measurement capabilities, there is no guarantee to obtain the unique molecular formula of a compound. By calculating spectra accuracy, highly accurate isotope pattern matching can be conducted to significantly improve performance of compound confirmation or identification.

  19. A DUF-246 family glycosyltransferase-like gene affects male fertility and the biosynthesis of pectic arabinogalactans

    DEFF Research Database (Denmark)

    Stonebloom, Solomon; Ebert, Berit; Xiong, Guangyan


    rates of pollen tube formation in pollen from pagr heterozygotes. To characterize a loss-of-function phenotype for PAGR, the Nicotiana benthamiana orthologs, NbPAGR-A and B, were transiently silenced using Virus Induced Gene Silencing. NbPAGR-silenced plants exhibited reduced internode and petiole...

  20. Detoxification of the explosive 2,4,6-trinitrotoluene in Arabidopsis: discovery of bifunctional O- and C-glucosyltransferases (United States)


    fragment with a mass m/z 254, [M-H]-120 corre- sponded to a fragmentation 0,2X, in agreement with the fragmentation of the C-glucosides of flavonoids ...Trends Plant Sci. 2, 144–151. Cuyckens, F. and Claeys, M. (2004) Mass spectrometry in the structural analysis of flavonoids . J. Mass Spectrom. 39, 1–15

  1. Evaluation of Orally Delivered ST-246 as Postexposure Prophylactic and Antiviral Therapeutic in an Aerosolized Rabbitpox Rabbit Model

    National Research Council Canada - National Science Library

    Nalca, Aysegul; Hatkin, Josh M; Garza, Nicole L; Nichols, Donald K; Norris, Sarah W; Hruby, Dennis E; Jordan, Robert


    Orthopoxviruses, such as variola and monkeypox viruses, can cause severe disease in humans when delivered by the aerosol route, and thus represent significant threats to both military and civilian populations...

  2. 78 FR 19413 - Listing of Color Additives Exempt From Certification; Reactive Blue 246 and Reactive Blue 247... (United States)


    ... certification of these color additives is not necessary for the protection of the public health. IV. Public... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 [Docket Nos. FDA-2011-C-0344 and FDA-2011-C-0463] Listing of Color Additives Exempt From Certification; Reactive...

  3. 48 CFR 52.246-19 - Warranty of Systems and Equipment under Performance Specifications or Design Criteria. (United States)


    ... or refusal of the Contractor to— (A) Present a detailed recommendation for corrective action as... the Contractor must remedy the failure or refusal specified in the notice. (6) If the Contractor does... entitled to reimbursement from the Contractor, or from the proceeds, for the reasonable expenses of care...

  4. Pathogenicity of the bioherbicide fungus chondrostereum purpureum to some trees and shrubs of southern Vancouver Island. FRDA report No. 246

    Energy Technology Data Exchange (ETDEWEB)

    Wall, R.E.


    Chondrostereum purpureum is a common stem-invading fungus of trees and shrubs. The fungus has attracted interest as a bioherbicide, but a better understanding of its biology is required. This study was undertaken to determine the range of virulence of isolates of C. purpureum from a given region on major hardwood species in British Columbia. The investigators inoculated wounds of stems of standing red alder (Alnus rubra) and bigleaf maple (Acer macrophyllum) saplings with 11 isolates of the fungus and measured the resulting stem cankers as an index of virulence. They also inoculated eight hardwood and shrub species with two isolates to demonstrate the range of susceptibility of species to the fungus, as well as the intraspecific variation.

  5. 4-Nitrophenol–2,4,6-triamino-1,3,5-triazine–water (2/1/1

    Directory of Open Access Journals (Sweden)

    N. Kanagathara


    Full Text Available In the title adduct, 2C6H5NO3·C3H6N6·H2O, the melamine and the two independent nitrophenol molecules are essentially planar, with maximum deviations of 0.0294 (10, 0.0706 (12 and 0.0742 (12 Å, respectively. In the crystal, N—H...N, O—H...N, N—H...O and O—H...O hydrogen bonds link the components into a three-dimensional network. In addition, weak π–π interactions [centroid–centroid distances = 3.728 (3 and 3.749 (3 Å] are observed.

  6. 3-Nitro-phenol-1,3,5-triazine-2,4,6-tri-amine (2/1). (United States)

    Sangeetha, V; Kanagathara, N; Chakkaravarthi, G; Marchewka, M K; Anbalagan, G


    The asymmetric unit of the title compound, C3H6N6·2C6H5NO3, contains one melamine and two 3-nitro-phenol mol-ecules. The mean planes of the 3-nitro-phenol mol-ecules are almost orthogonal to the plane of melamine, making dihedral angles of 82.77 (4) and 88.36 (5)°. In the crystal, mol-ecules are linked via O-H⋯N, N-H⋯N and N-H⋯O hydrogen bonds, forming a three-dimensional network. The crystal also features weak C-H⋯π and π-π inter-actions [centroid-centroid distance = 3.9823 (9) Å].

  7. Justiça Transicional e a ONU 10.5102/uri.v4i1.246

    Directory of Open Access Journals (Sweden)

    Tarciso Dal Maso Jardim


    Full Text Available The aim of this article is to emphasize the transitional justice, as well as the historical moments inflicted by violent aggressions to human dignity during the authoritarian and totalitarian regimes in the XX century. Those violation experiences which resulted upon crimes of war speed up the creation of the international courts of justice, the elaboration of new legal patterns, new legal norms, which became very important for the development of the international law. In this way, the United Nations placed a key role in legalizing the international system, punishing the criminals and paying for the damages suffered by the war victims.

  8. Toxicity and Metabolites of 2,4,6- Trinitrotoluene (TNT) in Plants and Worms from Exposure to Aged Soil

    National Research Council Canada - National Science Library

    Best, Elly


    .... Short-term exposure tests were conducted to explore the acute toxicity for the test organisms of TNT-spiked artificial soils and of the aged TNT-contaminated soil to be included in the subsequent...

  9. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.


    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  10. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.


    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  11. Evaluation of the endocrine activity of 2,4,6-tribromophenol, benzanthrone and benzophenone-2 based on Appendix 7.8-5 of REACH guidance document

    DEFF Research Database (Denmark)

    Duis, Karen; Holbech, Henrik; Velasco-Santamaría, Yohana M.

    Within a project funded by the German Federal Environment Agency, the practicability of Appendix 7.8-5 of REACH guidance document R.7b was evaluated using three case study substances. Shortcomings in the guidance were identified. An assessment of potential endocrine activity in aquatic vertebrates...

  12. 1-(4,5-Dinitro-10-azatricyclo[,7]dodeca-2,4,6-trien-10-yl-2,2,2-trifluoroethanone

    Directory of Open Access Journals (Sweden)

    Jin-Tang Wang


    Full Text Available In the title compound, C13H10F3N3O5, a derivative of andrographolide, the five-membered ring adopts an envelope conformation, while the non-planar six-membered ring has a chair conformation. An intramolecular C—H...F hydrogen bond results in the formation of a non-planar six-membered ring adopting a twisted conformation. In the crystal structure, intermolecular C—H...O hydrogen bonds link the molecules into centrosymmetric dimers.

  13. Alterations of cholinergic markers in transgenic APPSWE/PS1DE9 and APPSWE/PS1A246E mouse models of Alzheimer´s disease

    Czech Academy of Sciences Publication Activity Database

    Machová, Eva; Jakubík, Jan; Michal, Pavel; Oksman, M.; Iivonen, H.; Tanila, H.; Doležal, Vladimír


    Roč. 102, Suppl.1 (2007), s. 133-133 ISSN 0022-3042. [Biennial meeting of the International Society for Neurochemistry /21./ and Annual meeting of the American Society for Neurochemistry /38./. 19.08.2007-24.08.2007, Cancun] R&D Projects: GA MŠk(CZ) LC554; GA AV ČR IAA500110703 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * cholinergic markers * transgenic mouse model * Alzheimer ´s disease Subject RIV: FH - Neurology

  14. α7 Nicotinic Agonist AR-R17779 Protects Mice against 2,4,6-Trinitrobenzene Sulfonic Acid-Induced Colitis in a Spleen-Dependent Way

    Directory of Open Access Journals (Sweden)

    Andrea Grandi


    Full Text Available The existence of a cholinergic anti-inflammatory pathway negatively modulating the inflammatory and immune responses in various clinical conditions and experimental models has long been postulated. In particular, the protective involvement of the vagus nerve and of nicotinic Ach receptors (nAChRs has been proposed in intestinal inflammation and repeatedly investigated in DSS- and TNBS-induced colitis. However, the role of α7 nAChRs stimulation is still controversial and the potential contribution of α4β2 nAChRs has never been explored in this experimental condition. Our aims were therefore to pharmacologically investigate the role played by both α7 and α4β2 nAChRs in the modulation of the local and systemic inflammatory responses activated in TNBS-induced colitis in mice and to assess the involvement of the spleen in nicotinic responses. To this end, TNBS-exposed mice were sub-acutely treated with various subcutaneous doses of highly selective agonists (AR-R17779 and TC-2403 and antagonists (methyllycaconitine and dihydro-β-erythroidine of α7 and α4β2 nAChRs, respectively, or with sulfasalazine 50 mg/kg per os and clinical and inflammatory responses were evaluated by means of biochemical, histological and flow cytometry assays. α4β2 ligands evoked weak and contradictory effects, while α7 nAChR agonist AR-R17779 emerged as the most beneficial treatment, able to attenuate several local markers of colitis severity and to revert the rise in splenic T-cells and in colonic inflammatory cytokines levels induced by haptenization. After splenectomy, AR-R17779 lost its protective effects, demonstrating for the first time that, in TNBS-model of experimental colitis, the anti-inflammatory effect of exogenous α7 nAChR stimulation is strictly spleen-dependent. Our findings showed that the selective α7 nAChRs agonist AR-R17779 exerted beneficial effects in a model of intestinal inflammation characterized by activation of the adaptive immune system and that the spleen is essential to mediate this cholinergic protection.

  15. Assessing the acid properties of desilicated ZSM-5 by FTIR using CO and 2,4,6-trimethylpyridine (collidine) as molecular probes

    DEFF Research Database (Denmark)

    Holm, Martin Spangsberg; Svelle, S.; Joensen, F.


    Lewis acid sites were generated, presumably from dislodged framework aluminium. Collidine, which is too bulky to enter the micropore system of ZSM-5, could access Lewis acidity, suggesting that these sites were predominantly generated on the external surface or in the newly created mesopores....... Additionally, by first saturating the zeolite surface with collidine and subsequently adsorbing CO, we show that barely any Lewis acidity was uncoordinated post-collidine saturation while the Bronsted acidity continuously was protected behind the micropore system. It is hypothesized from the present study...

  16. CCDC 1477674: Experimental Crystal Structure Determination : (1,3-bis(2,4,6-trimethylphenyl)imidazol-2-ylidene)-trimethyl-gallium

    KAUST Repository

    Wu, Melissa M.; Gill, Arran M.; Yunpeng, Lu; Yongxin, Li; Ganguly, Rakesh; Falivene, Laura; Garcí a, Felipe


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  17. Impaired epithelial differentiation of induced pluripotent stem cells from ectodermal dysplasia-related patients is rescued by the small compound APR-246/PRIMA-1MET

    NARCIS (Netherlands)

    Shalom-Feuerstein, R.; Serror, L.; Aberdam, E.; Muller, F.J.; Bokhoven, H. van; Wiman, K.G.; Zhou, Huiqing; Aberdam, D.; Petit, I.


    Ectodermal dysplasia is a group of congenital syndromes affecting a variety of ectodermal derivatives. Among them, ectrodactyly, ectodermal dysplasia, and cleft lip/palate (EEC) syndrome is caused by single point mutations in the p63 gene, which controls epidermal development and homeostasis.

  18. Comments on Li et al. Effects of in Utero Exposure to Dicyclohexyl Phthalate on Rat Fetal Leydig Cells. Int. J. Environ. Res. Public Health 2016, 13, 246

    DEFF Research Database (Denmark)

    Svingen, Terje


    Profiling the expression levels of genes or proteins in tissues comprising two or more cell types is commonplace in biological sciences. Such analyses present particular challenges, however, for example a potential shift in cellular composition, or ‘cellularity’, between specimens. That is, does...... an observed change in expression level represent what occurs within individual cells, or does it represent a shift in the ratio of different cell types within the tissue? This commentary attempts to highlight the importance of considering cellularity when interpreting quantitative expression data, using...

  19. Transformation and fate of 2,4,6-trinitrotoluene (TNT) in anaerobic bioslurry reactors under various aeration schemes: implications for the decontamination of soils. (United States)

    Newcombe, David A; Crawford, Ronald L


    Energetic compounds have been used in a variety of industrial and military applications worldwide leading to widespread environmental contamination. Many of these compounds are toxic and resist degradation by oxidative enzymes resulting in a need for alternative remediation methods. It has been shown that trinitrotoluene (TNT)-contaminated soil subjected to treatment in strictly anaerobic bioreactors results in tight binding of TNT transformation products to soil organic matter. The research presented here examined the fate of TNT and its metabolites in bioreactors under three different aeration regimes. In all treatment regimes, the typical metabolites of aminodinitrotoluenes and diaminonitrotoluenes were observed prior to irreversible binding into the soil fraction of the slurry. Significant transformation of TNT into organic acids or simple diols, as others report in prior work, was not observed in any of the treatments and is an unlikely fate of TNT in anaerobic soil slurries. These results indicate that aeration does not dramatically affect transformation or fate of TNT in reactor systems that receive a rich carbon source but does affect the rate at which metabolites become tightly bound to the soil. The most rapid transformations and lowest redox potentials were observed in reactors in which an aerobic headspace was maintained suggesting that aerobes play a role in establishing conditions that are most conducive to TNT reduction.

  20. Fluorescence-based Sensing of 2,4,6-Trinitrotoluene (TNT) Using a Multi-channeled Poly(methyl methacrylate) (PMMA) Microimmunosensor (United States)


    monoclonalframesethtm) for NRL. 3-Mercaptopropyltrimethoxysilane, tetraethylorthosilicate (TEOS) and dimethylsulfoxide ( DMSO ) were obtained from Sigma...prepared via hot-embossing and tri- solvent annealing (see Experimental section). Microchannels were coated with a sol-gel film using a previously...PMMA substrate that was tri- solvent bonded to a 1.0 mm thick PMMA coverslip. The footprint of the microfluidic device is 76 × 25 × 25 mm. The

  1. A Literature Review - Problem Definition Studies on Selected Toxic Chemicals. Volume 3. Occupational Health and Safety Aspects of 2,4,6-Trinitrotoluene (TNT) (United States)


    crude liver extract, yellow bone marrow extract, a high vitamin (C and B complex) and high caloric diet . However, in spite of intensive treatment, the...protein-rich diet . . . . . 40 B. Effect of Other Food Additives . . . . . . . . . . . 40Si. Vitamin C . . . . . . ... . . . . . . . .. .. 40 ii...uncommon. Hassman (86) in 1971, in a review article about TNT reported that both hypo - and hyper-menorrhea occur in women exposed to TNT. f

  2. CCDC 1477675: Experimental Crystal Structure Determination : (1,3-bis(2,4,6-trimethylphenyl)imidazol-2-ylidene)-trimethyl-indium

    KAUST Repository

    Wu, Melissa M.


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  3. Synergy of aggregation pheromone with methyl (E,E,Z)-2,4,6-decatrienoate in attraction of brown marmorated stink bug, Halyomorpha halys (United States)

    The male-produced aggregation pheromone of the brown marmorated stink bug ((BMSB), Halyomorpha halys (Stål) (Hemiptera: Pentatomidae)), recently identified as a mixture of (3S,6S,7R,10S)-10,11-epoxy-1-bisabolen-3-ol and (3S,6S,7R,10R)-10,11-epoxy-1-bisabolen-3-ol, offers new opportunities for manage...

  4. Inhibitory effect of a formulated extract from multiple citrus peels on LPS-induced inflammation in RAW 246.7 macrophages

    Directory of Open Access Journals (Sweden)

    Tadahiro Etoh


    Full Text Available ABSTRACTBackground: Formulated Citrus Peel Extract (GL made from the peels of six citrus fruits available in Japan, namely navel oranges, citrus hassaku, citrus limon, citrus natsudaidai, citrus miyauchi and satsuma, was initially developed as a cosmetic product to protect skin from UV irradiation. Anecdotal evidences of anti-cancer property of GL have been reported by consumers based on the cases such as topical application for melanoma, and oral ingestion for prostate, lung and liver cancers.Those anecdotal reports stimulated us to investigate anti-tumorigenesis activity of GL. In the previous study, we reported that the topical application of GL inhibited DMBA/TPA-induced skin tumor formation by decreasing inflammatory gene parameters.Objective: In this study, we mainly investigated the effect of GL on translocation of NF-kB together with production of nitric-oxide and TNF-α induced by LPS in RAW 264.7 cells.Results: This investigation showed that GL decreased the release of TNF-α and nitric oxide from macrophage RAW264.7 cells stimulated by LPS in a dose-dependent manner. In addition, GL suppressed the expression of iNOS and nuclear translocation of NF-kB in RAW264.7 cells, inhibited the degradation of IκB-α, and scavenged hydroxyl radicals (DMPO/OH adduct in vitro.Conclusions: Our findings suggest that GL suppresses the inflammation in vitro, and exerts chemopreventive activity through the inhibition of production of TNF-α and iNOS proteins due to the inhibition of nuclear translocation of NF-kB and oxidative stress. GL appears to be a novel functional natural product capable of preventing inflammation and inflammation-associated tumorigenesis.Keywords: GL, Citrus peel extract, anti-inflammation, Nitric oxide, iNOS, NF-kB, TNF-α

  5. 2,4,6-tris[bis(1H-tetrazol-5-yl)amino]-1,3,5-triazine as a nitrogen-rich ...

    Indian Academy of Sciences (India)


    mmol) (in 15 mL of deionized water) was added dropwise to the slurry of cyanuric chloride (0.18 g, 1 mmol) in ace- ... ture was filtered and washed with water to obtain a white solid product of N,N',N”-(1,3,5-triazine-2,4 .... getic materials emerging for military and space appli- cations J. Hazard. Mater. 112 1; (b) Wang R, Xu H,.

  6. Guillen Fabienne P. et Trabelsi Salah (dir., Les esclavages en Méditerranée. Espaces et dynamiques économiques, Madrid, Casa de Velazquez, 2012, 246 p.

    Directory of Open Access Journals (Sweden)

    Alessandro Stella


    Full Text Available Les études réunies par Fabienne Plazolles Guillen et Salah Trabelsi trouvent leur place dans le courant historiographique qui depuis trente ans tente de contrebalancer la prépondérance des études sur l’esclavage aux Amériques, au point d’assimiler l’esclavage aux Noirs dans les plantations du Nouveau Monde. Le succès de cette entreprise intellectuelle est loin d’être assuré, du fait que la littérature anglophone dominante refuse obstinément d’intégrer dans sa bibliographie les ouvrages publié...

  7. Synthesis and Low Temperature Spectroscopic Observation of 1,3,5-Trioxane-2,4,6-Trione: The Cyclic Trimer of Carbon Dioxide (United States)


    Dewar flask with a viewing window feature. A 5% O3/O2 mixture from the ozone generator (10 V coronal discharge ) was delivered to the cold solution...orthocarbonate extended covalent structure of interconnected six-membered rings was predicted by model calculation with the finding of a stabilization energy...stability. The approach is that of a model compound synthesis where the trioxane ring is first generated from substituted aldehydes and then the

  8. Machine Learning Intermolecular Potentials for 1,3,5-Triamino-2,4,6-trinitrobenzene (TATB) Using Symmetry-Adapted Perturbation Theory (United States)


    Information Operations and Reports (0704-0188), 1215 Jefferson Davis Highway, Suite 1204, Arlington, VA 22202-4302. Respondents should be aware that...speech recognition,3 fraud prevention,4 spam email filtering,5 unmanned vehicle operation ,6 finance,7 and even drunk driver detection,8 ML has now...Ridge Regression KRR can be derived from Eq. 2 by ignoring the bias term b, setting ε = 0, and squaring the “ slack variables” ξ. This yields the

  9. Dicarbonyl[2-hydroxy-3,5,7-tris(morpholinomethylcyclohepta-2,4,6-trienonato(1–-κ2O1,O2]rhodium(I

    Directory of Open Access Journals (Sweden)

    G. Steyl


    Full Text Available In the title compound, [Rh(C22H32N3O5(CO2], the RhI atom is coordinated by two carbonyl ligands and two tropolonate O atoms in a distorted square-planar geometry. It is an example of a new type of tropolone derivative that has not been characterized via solid-state methods. Weak intramolecular C—H...N and intermolecular C—H...O hydrogen bonds, and π–π stacking interactions between the tropolone rings [centroid–centroid distance = 3.590 (8 Å] are observed in the crystal structure.

  10. CCDC 933141: Experimental Crystal Structure Determination : (2-(bis(2,4,6-Trimethoxyphenyl)phosphino)benzenesulfonato)-(2,6-dimethylpyridine)-methyl-palladium dichloromethane solvate

    KAUST Repository

    Neuwald, B.; Falivene, L.; Caporaso, L.; Cavallo, Luigi; Mecking, S.


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  11. Compression behavior and spectroscopic properties of insensitive explosive 1,3,5-triamino-2,4,6-trinitrobenzene from dispersion-corrected density functional theory (United States)

    Su, Yan; Fan, Junyu; Zheng, Zhaoyang; Zhao, Jijun; Song, Huajie


    Not Available Project supported by the Science Challenge Project of China (Grant No. TZ2016001), the National Natural Science Foundation of China (Grant Nos. 11674046 and 11372053), the Fundamental Research Funds for the Central Universities of China (Grant No. DUT17GF203), the Opening Project of State Key Laboratory of Explosion Science and Technology, Beijing Institute of Technology, China (Grant No. KFJJ16-01M), and the Supercomputing Center of Dalian University of Technology, China.

  12. Migrating hydrogen in 2,4,6-triaminopyrimidinium(1+).sub.x./sub. hydrogen trioxofluorophosphate(1-).sub.x./sub. monohydrate/2,4,6-triaminopyrimidinium(2+).sub.1–x./sub.trioxofluorophosphate(2–).sub.1–x./sub. monohydrate(0.0 < x < 0.73) with changing temperature

    Czech Academy of Sciences Publication Activity Database

    Matulková, I.; Fábry, Jan; Němec, I.; Císařová, I.; Vaněk, Přemysl


    Roč. 73, Jun (2017), s. 1114-1124 ISSN 2052-5206 Institutional support: RVO:68378271 Keywords : X-ray single-structure determination * hydrogen bonding * pi-pi-electron ring interactions * crystallographic databases * fluorine Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.032, year: 2016

  13. Crystal structures of 2-[(4,6-di-amino-pyrimidin-2-yl)sulfan-yl]-N-(naphthalen-1-yl)acetamide and 2-[(4,6-di-amino-pyrimidin-2-yl)sulfan-yl]-N-(4-fluoro-phen-yl)acetamide. (United States)

    Subasri, S; Kumar, Timiri Ajay; Sinha, Barij Nayan; Jayaprakash, Venkatesan; Viswanathan, Vijayan; Velmurugan, Devadasan


    The title compounds, C 16 H 15 N 5 OS, (I), and C 12 H 12 FN 5 OS, (II), are [(di-amino-pyrimidine)-sulfan-yl]acetamide derivatives. In (I), the pyrimidine ring is inclined to the naphthalene ring system by 55.5 (1)°, while in (II), the pyrimidine ring is inclined to the benzene ring by 58.93 (8)°. In (II), there is an intra-molecular N-H⋯N hydrogen bond and a short C-H⋯O contact. In the crystals of (I) and (II), mol-ecules are linked by pairs of N-H⋯N hydrogen bonds, forming inversion dimers with R 2 2 (8) ring motifs. In the crystal of (I), the dimers are linked by bifurcated N-H⋯(O,O) and C-H⋯O hydrogen bonds, forming layers parallel to (100). In the crystal of (II), the dimers are linked by N-H⋯O hydrogen bonds, also forming layers parallel to (100). The layers are linked by C-H⋯F hydrogen bonds, forming a three-dimensional architecture.

  14. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.


    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  15. ORF Alignment: NC_002950 [GENIUS II[Archive

    Lifescience Database Archive (English)


  16. CCDC 972836: Experimental Crystal Structure Determination : (2-(1-(1,3-bis(2,4,6-trimethylphenyl)-1H-imidazol-3-ium-2-yl)propan-2-ylidene)-1,3-oxazolidin-3-yl)-tris(pentafluorophenyl)-aluminium

    KAUST Repository



    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  17. Multivariate soil fertility relationships for predicting the environmental persistence of 2,4,6-trinitrotoluene (TNT) and 1,3,5-trinitro-1,3,5-tricyclohexane (RDX) among taxonomically distinct soils. (United States)

    Katseanes, Chelsea K; Chappell, Mark A; Hopkins, Bryan G; Durham, Brian D; Price, Cynthia L; Porter, Beth E; Miller, Lesley F


    After nearly a century of use in numerous munition platforms, TNT and RDX contamination has turned up largely in the environment due to ammunition manufacturing or as part of releases from low-order detonations during training activities. Although the basic knowledge governing the environmental fate of TNT and RDX are known, accurate predictions of TNT and RDX persistence in soil remain elusive, particularly given the universal heterogeneity of pedomorphic soil types. In this work, we proposed overcoming this problem by considering the environmental persistence of these munition constituents (MC) as multivariate mathematical functions over a variety of taxonomically distinct soil types, instead of a single constant or parameter of a specific absolute value. To test this idea, we conducted experiments where the disappearance kinetics of TNT and RDX were measured over a >300 h period in taxonomically distinct soils. Classical fertility-based soil measurements were log-transformed, statistically decomposed, and correlated to TNT and RDX disappearance rates (k -TNT and k -RDX ) using multivariate dimension-reduction and correlation techniques. From these efforts, we generated multivariate linear functions for k parameters across different soil types based on a statistically reduced set of their chemical and physical properties: Calculations showed that the soil properties exhibited strong covariance, with a prominent latent structure emerging as the basis for relative comparisons of the samples in reduced space. Loadings describing TNT degradation were largely driven by properties associated with alkaline/calcareous soil characteristics, while the degradation of RDX was attributed to the soil organic matter content - reflective of an important soil fertility characteristic. In spite of the differing responses to the munitions, batch data suggested that the overall nutrient dynamics were consistent for each soil type, as well as readily distinguishable from the other soil types used in this study. Thus, we hypothesized that the latent structure arising from the strong covariance of full multivariate geochemical matrix describing taxonomically distinguished "soil types" may provide the means for potentially predicting complex phenomena in soils. Published by Elsevier Ltd.

  18. Surface effects on the crystallization of cyclo-1,3,5-trimethylene-2,4,6-trinitramine (RDX) and the consequences for its N K X-ray emission spectrum. (United States)

    Goldberg, Ilana G; Vila, Fernando D; Jach, Terrence


    Recent studies of the crystallization of cyclotrimethylene-trinitramine (RDX) have shown that the presence of the α- and β-phases of the compound is sensitive to the substrate when using drop cast crystallization methods. The specific phase has potential consequences for measurements of the nitrogen K X-ray emission spectrum (XES) that were recently reported for this compound using samples crystallized on In metal substrates. We have determined that the crystallization of RDX on a clean In metal substrate starts out completely as the β-phase but progressively incorporates the α-phase as the film thickens. In addition, we have carried out additional molecular orbital calculations of the N 1s X-ray fluorescence from the valence band, comparing the results expected from the α-and β- phases. The differences due to the presence of the β-phase instead of, or in addition to, the α-phase appear to be minimal.

  19. Crystal structure of (1S,3R,8R,9R,10S-2,4,6-tris(2,2-dichloro-3,7,7,10-tetramethyltricyclo[,3]dodec-9-ylcyclotriboroxane

    Directory of Open Access Journals (Sweden)

    Ahmed Benharref


    Full Text Available The title compound, C48H75B3Cl6O3, was synthesized in two steps from β-himachalene (3,5,5,9-tetramethyl-2,4a,5,6,7,8-hexahydro-1H-benzocycloheptene, which was isolated from the essential oil of the Atlas cedar (Cedrus Atlantica. The molecule consists of an almost planar cyclotriboroxane ring [maximum deviation = 0.036 (2 Å] linked to three identical fused ring systems with different conformations. Each of the three attached ring systems is built up from a seven-membered ring to which a six- and a three-membered ring are fused. The three six-membered rings have a twist-boat conformation, whereas the seven-membered rings display boat, chair and twist-boat conformations. The dihedral angles between the central boroxane ring and the mean planes of the attached six-membered rings are 63.67 (18, 54.89 (2 and 56.57 (19°. The crystal packing is governed only by van der Waals interactions.

  20. Synthesis and spectroscopic and structural characterization of the monomeric diborylphosphine and diphosphinoborane compounds PhP(BMes2)2 and MesB(PPh2)2 (Mes = 2,4,6-Me3C6H2)

    International Nuclear Information System (INIS)

    Bartlett, R.A.; Dias, H.V.R.; Power, P.P.


    The synthesis and spectroscopic and first x-ray structural characterization of a diborylphosphine, PhP(BMes 2 ) 2 (1), and a diphosphinoborane, MesB(PPh 2 ) 2 (2), are described. The structure of 1 has a planar core that involves the phosphorus and two boron atoms and also the five substituent carbons. In addition, the B-P bond lengths are shortened, which suggests a close structural analogy between 1 and the allyl cation. In the case of 2, although the boron remains planar, both phosphorus centers are pyramidal with slightly longer B-P bonds than in 1. Both 1 and 2 are the first examples of their respective classes of compound to be well characterized. Crystal data with Mo Kα radiation (λ = 0.71069 /angstrom/) at 130 K are as follows. 1: a = 14.302 (4) /angstrom/, b = 15.701 (3) /angstrom/, c = 16.601 (6) /angstrom/, β = 109.61 (2)/degrees/; monoclinic, space group C2/c, Z = 4, R = 0.059. 2: a = 7.815 (2) /angstrom/, b = 8.723 (2) /angstrom/, c = 40.147 (10) /angstrom/, β = 94.90 (2)/degrees/; monoclinic, space group P2 1 /n, Z = 4, R = 0.041. A listing of available 11 B and 31 P NMR data on compounds involving triply connected boron and phosphorus centers is also provided and discussed in the context of the data for 1 and 2. 25 references, 2 figures, 4 tables

  1. Anti-allergic activity of 2,4,6-trihydroxy-3-geranylacetophenone (tHGA) via attenuation of IgE-mediated mast cell activation and inhibition of passive systemic anaphylaxis

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Ji Wei; Israf, Daud Ahmad; Harith, Hanis Hazeera; Md Hashim, Nur Fariesha [Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, Serdang 43400 (Malaysia); Ng, Chean Hui; Shaari, Khozirah [Faculty of Science, Universiti Putra Malaysia, Serdang 43300 (Malaysia); Tham, Chau Ling, E-mail: [Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, Serdang 43400 (Malaysia)


    tHGA, a geranyl acetophenone compound originally isolated from a local shrub called Melicope ptelefolia, has been previously reported to prevent ovalbumin-induced allergic airway inflammation in a murine model of allergic asthma by targeting cysteinyl leukotriene synthesis. Mast cells are immune effector cells involved in the pathogenesis of allergic diseases including asthma by releasing cysteinyl leukotrienes. The anti-asthmatic properties of tHGA could be attributed to its inhibitory effect on mast cell degranulation. As mast cell degranulation is an important event in allergic responses, this study aimed to investigate the anti-allergic effects of tHGA in cellular and animal models of IgE-mediated mast cell degranulation. For in vitro model of IgE-mediated mast cell degranulation, DNP-IgE-sensitized RBL-2H3 cells were pre-treated with tHGA before challenged with DNP-BSA to induce degranulation. For IgE-mediated passive systemic anaphylaxis, Sprague Dawley rats were sensitized by intraperitoneal injection of DNP-IgE before challenged with DNP-BSA. Both in vitro and in vivo models showed that tHGA significantly inhibited the release of preformed mediators (β-hexosaminidase and histamine) as well as de novo mediators (interleukin-4, tumour necrosis factor-α, prostaglandin D{sub 2} and leukotriene C{sub 4}). Pre-treatment of tHGA also prevented IgE-challenged RBL-2H3 cells and peritoneal mast cells from undergoing morphological changes associated with mast cell degranulation. These findings indicate that tHGA possesses potent anti-allergic activity via attenuation of IgE-mediated mast cell degranulation and inhibition of IgE-mediated passive systemic anaphylaxis. Thus, tHGA may have the potential to be developed as a mast cell stabilizer for the treatment of allergic diseases in the future. - Highlights: • The in vitro and in vivo mast cell stabilizing effects of tHGA were examined. • tHGA counteracts the plasma membrane deformation in degranulating mast cells. • tHGA attenuates preformed and de novo mediators released by degranulating mast cells. • tHGA prevents in vivo mast cell activation and passive systemic anaphylaxis in rats. • tHGA could be a potential mast cell stabilizer for the treatment of allergic diseases.

  2. 4,4′,4′′-Tris(2-pyridyl-2,2′,2′′-[(2,4,6-trimethylbenzene-1,3,5-triyltris(methylenetris(sulfanediyl]tripyrimidine

    Directory of Open Access Journals (Sweden)

    Ya-Wen Zhang


    Full Text Available The title compound, C39H33N9S3, features a mesitylene unit substituted with three thioether arms. The distances from the center of mesitylene unit to the N atoms of the three pyridine rings in the arms are 10.05 (1, 9.94 (3 and 8.79 (3 Å. The crystal structure shows weak intramolecular C—H...N hydrogen bonds.

  3. Synthesis and anti-mitotic activity of 2,4- or 2,6-disubstituted- and 2,4,6-trisubstituted-2H-pyrazolo[4,3-c]pyridines

    Czech Academy of Sciences Publication Activity Database

    Milišiunaitė, V.; Arbačiauskienė, E.; Řezníčková, Eva; Jorda, Radek; Malínková, V.; Žukauskaitė, Asta; Holzer, W.; Šačkus, A.; Kryštof, Vladimír


    Roč. 150, APR 25 (2018), s. 908-919 ISSN 0223-5234 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Apoptosis * G2/M cell cycle arrest * Pyrazole * Structure-activity relationships Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.519, year: 2016

  4. Influence of a macromolecule on the bleaching process of photochromic 1-methyl-2,4,6-tetraphenyl-1,4-dihydropyridine: Approach based on the analysis of a chaotic signal

    Czech Academy of Sciences Publication Activity Database

    Nešpůrek, Stanislav; Pecen, Ladislav; Zmeškal, O.


    Roč. 1, č. 1 (2008), s. 179-203 ISSN 0973-7405 R&D Projects: GA AV ČR KAN401770651; GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10300504 Keywords : photochromism * photobleaching * chaotic signal Subject RIV: CF - Physical ; Theoretical Chemistry

  5. What Should Be the Future Direction of the Foreign Policy of the United States?: National Debate Topic for High Schools, 1979-1980, Pursuant to Public Law 88-246. (United States)

    Library of Congress, Washington, DC. Congressional Research Service.

    This book provides information on the 1979-80 national high school debate topic (United States foreign policy). The volume begins with a group of articles selected to provide an overview of foreign policy considerations and a general context for discussions of the three propositions within the designated topic. The book also contains sections with…

  6. A Review of the Literature on Social and Emotional Learning for Students Ages 3-8: Implementation Strategies and State and District Support Policies (Part 2 of 4). REL 2017-246 (United States)

    O'Conner, Rosemarie; De Feyter, Jessica; Carr, Alyssa; Luo, Jia Lisa; Romm, Helen


    Social and emotional learning (SEL) is the process by which children and adults learn to understand and manage emotions, maintain positive relationships, and make responsible decisions. This is the second in a series of four related reports about what is known about SEL programs for students ages 3-8. The report series addresses four issues raised…

  7. The Origin of Continents and Oceans : A. Wegener (translated by J. Biram from the 4th revised German edition, 1929) Dover, New York N.Y., 1966, 246 pp., 63 illus., paperbound U.S.$2.00

    NARCIS (Netherlands)

    Bemmelen, R.W. van

    In the old controversy between fixism and mobilism a new scientific tool, palaeomagnetism, has recently brought forward independent diagnostic facts. In the discussions about drift many authors quote Wegener's classic work. It is fortunate that it has now appeared in an excellent English translation

  8. CCDC 1005758: Experimental Crystal Structure Determination : (mu2-eta5,eta5-Bi-(2,4,6-triethylcyclohexa-2,4-dien-1-yl))-bis(eta5-pentamethyl-cyclopentadienyl)-di-ruthenium

    KAUST Repository

    Mohapatra, Swagat K.; Fonari, Alexandr; Risko, Chad; Yesudas, Kada; Moudgil, Karttikay; Delcamp, Jared H.; Timofeeva, Tatiana V.; Bredas, Jean-Luc; Marder, Seth R.; Barlow, Stephen


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  9. Anti-allergic activity of 2,4,6-trihydroxy-3-geranylacetophenone (tHGA) via attenuation of IgE-mediated mast cell activation and inhibition of passive systemic anaphylaxis

    International Nuclear Information System (INIS)

    Tan, Ji Wei; Israf, Daud Ahmad; Harith, Hanis Hazeera; Md Hashim, Nur Fariesha; Ng, Chean Hui; Shaari, Khozirah; Tham, Chau Ling


    tHGA, a geranyl acetophenone compound originally isolated from a local shrub called Melicope ptelefolia, has been previously reported to prevent ovalbumin-induced allergic airway inflammation in a murine model of allergic asthma by targeting cysteinyl leukotriene synthesis. Mast cells are immune effector cells involved in the pathogenesis of allergic diseases including asthma by releasing cysteinyl leukotrienes. The anti-asthmatic properties of tHGA could be attributed to its inhibitory effect on mast cell degranulation. As mast cell degranulation is an important event in allergic responses, this study aimed to investigate the anti-allergic effects of tHGA in cellular and animal models of IgE-mediated mast cell degranulation. For in vitro model of IgE-mediated mast cell degranulation, DNP-IgE-sensitized RBL-2H3 cells were pre-treated with tHGA before challenged with DNP-BSA to induce degranulation. For IgE-mediated passive systemic anaphylaxis, Sprague Dawley rats were sensitized by intraperitoneal injection of DNP-IgE before challenged with DNP-BSA. Both in vitro and in vivo models showed that tHGA significantly inhibited the release of preformed mediators (β-hexosaminidase and histamine) as well as de novo mediators (interleukin-4, tumour necrosis factor-α, prostaglandin D 2 and leukotriene C 4 ). Pre-treatment of tHGA also prevented IgE-challenged RBL-2H3 cells and peritoneal mast cells from undergoing morphological changes associated with mast cell degranulation. These findings indicate that tHGA possesses potent anti-allergic activity via attenuation of IgE-mediated mast cell degranulation and inhibition of IgE-mediated passive systemic anaphylaxis. Thus, tHGA may have the potential to be developed as a mast cell stabilizer for the treatment of allergic diseases in the future. - Highlights: • The in vitro and in vivo mast cell stabilizing effects of tHGA were examined. • tHGA counteracts the plasma membrane deformation in degranulating mast cells. • tHGA attenuates preformed and de novo mediators released by degranulating mast cells. • tHGA prevents in vivo mast cell activation and passive systemic anaphylaxis in rats. • tHGA could be a potential mast cell stabilizer for the treatment of allergic diseases.

  10. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)


  13. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien


    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  15. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.


    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  16. Protein (Cyanobacteria): 281806 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEE...YP_007117793.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  17. Protein (Cyanobacteria): 281805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MYLILPDLYANMTYQIDERLNTSPCGFLSFADDGTIVMVN...YP_007118829.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  18. Protein (Cyanobacteria): 281754 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MLYNNEILPTLTVESSPRSMNILLYKLLSLRRIEYIAVDR...YP_007115817.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  19. 48 CFR 46.705 - Limitations. (United States)


    ... QUALITY ASSURANCE Warranties 46.705 Limitations. (a) Except for the warranties in the clauses at 52.246-3, Inspection of Supplies—Cost-Reimbursement, and 52.246-8, Inspection of Research and Development—Cost...

  20. A trace of anger is enough: on the enforcement of social norms

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub

    -, č. 246 (2005), s. 1-10 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : punishment * public good * reciprocity Subject RIV: AH - Economics

  1. Ayllón, Bruno. La cooperación Sur-Sur y triangular en América Latina. Políticas afirmativas y prácticas transformadoras. Madrid, 2013. Editora Catarata / Universidad Complutense de Madrid (IUDC-UCM), 2013, 246p. ISBN: 978–84–8319–441–6


    Dolcetti, Michele; Universidad Complutense de Madrid


    Três anos após a publicação de “La Cooperación Sur-Sur en Latinoamérica. Utopía y realidad”, a equipe de pesquisa do IUDC-UCM editou “La Cooperación Sur-Sur en América Latina. Políticas afirmativas y práticas transformadoras”, texto imprescindível para o estudo da Cooperação Sul-Sul (CSS) no espaço ibero-americano. Em 2010 a análise da CSS era incipiente e suas definições pouco consolidadas; falava-se de “estado embrionário da CSS” e de “doadores emergentes”: definições que expressavam plenam...

  2. Crystal structures and conformations of two Diels–Alder adduct derivatives: 1,8-bis(thiophen-2-yl-14-oxatetracyclo[,7.09,13]tetradeca-2(7,3,5-trien-10-one and 1,8-diphenyl-14-oxatetracyclo[,7.09,13] tetradeca-2,4,6-trien-10-one

    Directory of Open Access Journals (Sweden)

    S. Gopinath


    Full Text Available The title compounds, C21H16O2S2 (I and C25H20O2 (II, are products of a tandem `pincer' Diels–Alder reaction consisting of [2 + 2] cycloadditions between benzo[c]furan and cyclopentanone. Each comprises a fused tetracyclic ring system containing two five-membered rings (in envelope conformations with the O atom as the flap and six-membered rings (in boat conformations. In addition, two thiophene rings in (I and two phenyl rings in (II are attached to the tetracyclic ring system. The cyclopentanone ring adopts a twisted conformation in (I and an envelope conformation in (II. In (I, the thiophene rings are positionally disordered over two sets of sites, with occupancy ratios of 0.901 (2:0.099 (2 and 0.666 (2:0.334 (2. In (II, the oxygen atom of the cyclopentanone ring is rotationally disordered over two sites with an occupancy ratio of 0.579 (4:0.421 (4. The molecular structure of (I is stabilized by an intramolecular C—H...O hydrogen bond, which generates an S(7 ring motif. In the crystal, the molecules are linked via weak C—H...O hydrogen bonds, which generate R22(16 ring motifs in (I and C(8 chains in (II. In both structures, the crystal packing also features C—H...π interactions. The crystal studied of compound (I was twinned by non-merohedry. The twin component is related by the twin law [−1 0 0 −0.101 1 −0.484 0 0 −1] operated by a twofold rotation axis parallel to the b axis. The structure of (I was refined with a twin scale factor of 0.275 (2.

  3. [KDy(Hptc3(H3ptc]n·2n(Hbipy·5n(H2O, a Layered Coordination Polymer Containing DyO6N3 Tri-Capped Trigonal Prisms (H3ptc = Pyridine 2,4,6-Tricarboxylic Acid, C8H5NO6; Bipy = 2,2'-Bipyridine, C10H8N2

    Directory of Open Access Journals (Sweden)

    Shoaib Anwar


    Full Text Available The synthesis, structure and properties of the bimetallic layered coordination polymer, [KDy(C8H3NO63(C8H5NO6]n·2n(C10H9N2·5n(H2O = [KDy(Hptc3(H3ptc]n·2n(Hbipy·5n(H2O, are described. The Dy3+ ion is coordinated by three O,N,O-tridentate doubly-deprotonated pyridine tri-carboxylate (Hptc ligands to generate a fairly regular DyO6N3 tri-capped trigonal prism, with the N atoms acting as the caps. The potassium ion is coordinated by an O,N,O-tridentate H3ptc molecule as well as monodentate and bidentate Hptc ligands to result in an irregular KNO9 coordination geometry. The ligands bridge the metal-atom nodes into a bimetallic, layered, coordination polymer, which extends as corrugated layers in the (010 plane, with the mono-protonated bipyridine cations and water molecules occupying the inter-layer regions: Unlike related structures, there are no dysprosium–water bonds. Many O–HLO and N–HLO hydrogen bonds consolidate the structure. Characterization and bioactivity data are described. Crystal data: C52H42DyKN8O29, Mr = 1444.54, triclinic,  (No. 2, Z = 2, a = 9.188(2 Å, b = 15.7332(17 Å, c = 19.1664(19 Å, α = 92.797(6°, β = 92.319(7°, γ = 91.273(9°, V = 2764.3(7 Å3, R(F = 0.029, wR(F2 = 0.084.

  4. DOI: 10.4025/actascibiolsci.v33i3.8011 Acta Scientiarum. Biological Sciences Maringá, v. 33, n. 3, p. 239-246, 2011 Acute inflammatory response in Nile tilapia fed probiotic Lactobacillus plantarum in the diet = Resposta inflamatória aguda em tilápia do Nilo alimentada com probiótico, Lactobacillus plantarum na dieta

    Directory of Open Access Journals (Sweden)

    Geovana Dotta


    Full Text Available The present study evaluated the acute inflammatory response induced bycarrageenin (500 £gg injected in the swim bladder of Nile tilapia, after fed or not probiotic supplemented diet. Fifty four fish were distributed in six treatments and three replicates: Group A: Fish fed unsupplemented diet: 0.5 mL saline-injected fish; fish injected with 500 £gg carrageenin diluted in 0.5 mL saline; Non-injected. Group B: Fish fed probiotic supplemented diet: saline-injected fish; carrageenin-injected fish; Non-injected. Fifteen days after feeding the fish were injected with carrageenin or saline. After six hours, inflammatory exudate was collected, as well as the blood for hematocrit, red blood cell (RBC and white blood cell (WBC counts, differential count of leucocytes and phagocytic activity in the blood. Supplementation with probiotic did not influence the RBC, hematocrit and the numbers of lymphocytes and basophils in the blood. The number of neutrophils was significantly higher in supplemented fish injected with carrageenin. Glucose concentration in supplemented and non-injected fish was higher than that observed in the saline injected ones. Probiotic potentialized the migration of cells to the inflammatory focus in the animals injected with the carrageenin irritant. In fish injected with saline and carrageenin occurred the greatest phagocytic activity in the blood in relation to those treatments.Este trabalho avaliou a resposta inflamatoria aguda induzida por injecao de carragenina (500 ƒÝg na bexiga natatoria de tilapia do Nilo suplementada ou nao com probiotico na racao. Cinquenta e quatro animais foram distribuidos em seis tratamentos com tres repeticoes: Grupo A: peixes alimentados com racao naosuplementada: Controle (injecao de 0,5 mL de solucao salina esteril; Carragenina (injecao de500 £gg de carragenina; Nao-injetada. Grupo B: peixes alimentados com racao suplementada com probiotico: Controle; Carragenina; Nao-injetada. Apos 15 dias de alimentacao foi injetado carragenina ou salina. Apos 6h, realizou-se a coleta de exsudato e sangue para determinacao do hematocrito, contagens totais de eritrocitos, leucocitos, contagem diferencial de leucocitos e atividade fagocitaria no sangue. A suplementacao com probiotico na racao nao influenciou o numero total de eritrocitos, o hematocrito e os numeros de linfocitos e basofilos no sangue dos animais. O numero de neutrofilos foi maior nos peixes suplementados com probiotico einjetados com carragenina. A glicose nos peixes suplementados com probiotico nao-injetados foi maior do que nos injetados com salina. A suplementacao com probiotico potencializou a migracao de celulas para o foco inflamatorio nos injetados com o flogogeno carragenina. Empeixes injetados com salina e carragenina, ocorreu maior atividade fagocitaria no sangue em relacao aos demais tratamentos.

  5. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.


    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  6. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.


    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  7. Characterization of Coconut cadang-cadang viroid variants from oil palm affected by orange spotting disease in Malaysia. (United States)

    Wu, Y H; Cheong, L C; Meon, S; Lau, W H; Kong, L L; Joseph, H; Vadamalai, G


    A 246-nt variant of Coconut cadang-cadang viroid (CCCVd) has been identified and described from oil palms with orange spotting symptoms in Malaysia. Compared with the 246-nt form of CCCVd from coconut, the oil palm variant substituted C(31)→U in the pathogenicity domain and G(70)→C in the central conserved domain. This is the first sequence reported for a 246-nt variant of CCCVd in oil palms expressing orange spotting symptoms.

  8. A POC Clinical Trial for PTSD with a First-In-Class Vasopressin 1a Receptor Antagonist (United States)


    clinical benefit of SRX246 for the treatment of anger, irritability, and aggression; major depression ; disturbed sleep; and quality of life and tolerability of SRX246 (160 mg PO BID) and ii) clinical benefit of SRX246 for the treatment of major depression , anger, irritability, and...colleagues. Changes that had a significant impact on expenditures Nothing to Report Significant changes in use or care of human subjects, vertebrate

  9. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)


  12. Preparation, characterization, and sensitivity data of some azidomethyl nitramines

    Energy Technology Data Exchange (ETDEWEB)

    Klapoetke, Thomas M.; Krumm, Burkhard; Steemann, F.X. [Department of Chemistry and Biochemistry, Ludwig-Maximilian University of Munich (Germany)


    1,3-Diazido-2-nitro-2-azapropane (DANP) and 1,7-diazido-2,4,6-trinitro-2,4,6-triazaheptane (DATH) were synthesized, thoroughly analyzed, and their explosive properties and sensitivities toward friction and impact were measured. The precursors 1,3-diacetoxy-2-nitro-2-azapropane (1), 1,3-dichloro-2-nitro-2-azapropane (3), and 1,7-dichloro-2,4,6-trinitro-2,4,6-triazaheptane (4) - as well as DATH - were furthermore characterized by X-ray diffraction. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

  13. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)


  15. CCDC 972511: Experimental Crystal Structure Determination : 10,11,21,22-tetra-(2,4,6-trimethylphenyl)-2,13-bis(3,5-di-t-butylphenyl)-2,14,16a,19b,21,22b-hexahydrodiphenanthro[1,10,9,8-cdefg:1,10,9,8-c'd'e'f'g']s-indaceno[2,1-a:6,5-a']dicarbazole

    KAUST Repository

    Das, Soumyajit; Lee, Sangsu; Son, Minjung; Zhu, Xiaojian; Zhang, Wenhua; Zheng, Bin; Hu, Pan; Zeng, Zebing; Sun, Zhe; Zeng, Wangdong; Li, Run-Wei; Huang, Kuo-Wei; Ding, Jun; Kim, Dongho; Wu, Jishan


    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  16. Experimental studies on removal of airborne haloanisoles by non-thermal plasma air purifiers

    DEFF Research Database (Denmark)

    Fang, Lei; Hallam, David; Bermúdez, Raúl


    A laboratory study was conducted to test the performance of non-thermal plasma air purifiers on its removal effectiveness of two haloanisoles – 2,4,6-trichloroanisole (TCA) and 2,4,6-Tribromoanisole (TBA). TCA and TBA are the two major compounds found in wine cellars that can contaminate wine to ...

  17. NCBI nr-aa BLAST: CBRC-DSIM-01-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-01-0041 ref|ZP_00141975.1| phosphatidate cytidylyltransferase [Rickettsia sibi...rica 246] gb|EAA25384.1| phosphatidate cytidylyltransferase [Rickettsia sibirica 246] ZP_00141975.1 0.009 26% ...

  18. NCBI nr-aa BLAST: CBRC-TTRU-01-0188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0188 ref|ZP_00142186.1| heme exporter protein B [Rickettsia sibirica 2...46] gb|EAA25595.1| heme exporter protein B [Rickettsia sibirica 246] ZP_00142186.1 0.055 25% ...

  19. NCBI nr-aa BLAST: CBRC-TTRU-01-0560 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0560 ref|ZP_00142186.1| heme exporter protein B [Rickettsia sibirica 2...46] gb|EAA25595.1| heme exporter protein B [Rickettsia sibirica 246] ZP_00142186.1 0.14 23% ...


    The objective of this study was to evaluate the aquatic chronic lethal and sublethal toxicity effects from the phytoremediation of water contaminated with 2,4,6-trinitrotoluene (2,4,6-TNT) by the wetland plant species Myriophyllum aquaticum (parrot feather). Rotifers (Brachionus...

  1. A Novel Brominated Triazine-based Flame Retardant (TTBP-TAZ) in Plastic Consumer Products and Indoor Dust

    NARCIS (Netherlands)

    Ballesteros Gomez, A.M.; de Boer, J.; Leonards, P.E.G.


    The presence of a novel brominated flame retardant named 2,4,6-tris(2,4,6-tribromophenoxy)-1,3,5-triazine (TTBP-TAZ) is reported for the first time in plastic parts of consumer products and indoor dust samples. TTBP-TAZ was identified by untargeted screening and can be a replacement of the banned

  2. Prevalence of intestinal helminth parasites in stray dogs in urban ...

    African Journals Online (AJOL)

    A total of 246 faecal samples were collected between October 2015 to February 2016, 154 from stray dogs in Harare and 92 from rural dogs in Arcturas, Goromonzi and Christon Bank. The samples were examined by flotation and sedimentation methods and helminth eggs identified and EPG counted. Of the 246 samples, ...

  3. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    High Altitude Plant Physiology Research Centre, Srinagar, Pauri Garhwal 246 174 Uttarakhand, India; Department of Forestry & Natural Resources, School of Agriculture & Allied Sciences, HNB Garhwal University, Srinagar, Pauri Garhwal 246 174, Uttarakhand, India; Department of Horticulture, Aromatic & Medicinal Plant, ...

  4. 76 FR 13231 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance (United States)


    .... Corporation, West Plains Division, Regal Beloit Corporation. 75,201 Abbott Laboratories, Irving, TX February 9... Jeanerette Distribution Center; Fruit of the Loom; Leased Workers Spherion. 74,902 Abbott Diabetes Care, Inc... Subject firm Location Impact date 75,246 Deluxe Laboratories......... Hollywood, CA 75,246A Deluxe...

  5. Structural analysis within the Rožná and Olší uranium deposits (Strážek Moldanubicum) for the estimation of deformation and stress conditions of underground gas storage

    Czech Academy of Sciences Publication Activity Database

    Ptáček, Jiří; Melichar, R.; Hájek, Antonín; Koníček, Petr; Souček, Kamil; Staš, Lubomír; Kříž, P.; Lazárek, J.


    Roč. 10, č. 2 (2013), s. 237-246 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : structural analysis * deformation * stress * underground gas storage Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013

  6. 40 CFR 437.44 - Effluent limitations attainable by the application of the best available technology economically... (United States)


    ... Lead Mercury Nickel Silver Tin Titanium Vanadium Zinc (2) The in-plant limitations that apply to metal... Pyridine 2,4,6-trichlorophenol Metal parameters Arsenic Cadmium Chromium Cobalt Copper Lead Mercury Tin...-Cresol p-Cresol n-Decane Fluoranthene n-Octadecane Phenol Pyridine 2,4,6-trichlorophenol Metal parameters...

  7. Relationship between Indian summer monsoon rainfall and position of Pacific Ocean warm pool

    Digital Repository Service at National Institute of Oceanography (India)

    Gopinathan, C.K.; Sastry, J

    stream_size 5 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_246.pdf.txt stream_source_info Indian_J_Mar_Sci_19_246.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  8. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.


    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  9. Use of Low-cost Adsorbents to Chlorophenols and Organic Matter Removal of Petrochemical Wastewater

    Directory of Open Access Journals (Sweden)

    Aretha Moreira de Oliveira


    Full Text Available The removal of 2,4 diclorophenol (2,4-DCF and 2,4,6 trichlorophenol (2,4,6 TCF present in  petrochemical wastewater was evaluated using low-cost adsorbents, such as chitin, chitosan and coconut shells. Batch studies showed that the absorption efficiency for 2,4 DCF and 2,4,6 TCF follow the order: chitosan > chitin > coconut shells. Langmuir and Freundlich models have been applied to experimental isotherms data, to better understand the adsorption mechanisms. Petrochemical wastewater treatment with fixed bed column system using chitinous adsorbents showed a removal of COD (75% , TOG (90% and turbidity (74-89%.

  10. The Ratio of Blood Products Transfused Affects Mortality in Patients Receiving Massive Transfusions at a Combat Support Hospital

    National Research Council Canada - National Science Library

    Borgman, Matthew A; Spinella, Philip C; Perkins, Jeremy G; Grathwohl, Kurt W; Repine, Thomas; Beekley, Alec C; Sebesta, James; Jenkins, Donald; Wade, Charles E; Holcomb, John B


    ...:1 ratio of plasma to red blood cell (RBC) units. Methods: We performed a retrospective chart review of 246 patients at a US Army combat support hospital, each of who received a massive transfusion...

  11. nvj 36 2 new.cdr

    African Journals Online (AJOL)


    ABSTRACT. A survey on gastrointestinal parasites of intensively managed rodents was conducted between December2012 and November 2013 at two tertiary institutions in Ibadan, Nigeria. Samples werecollected from 246 rodents comprising 100 brown field rats (Rattusnorvegicus), 100 grasscutters( ...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 246 ... ... for combating current and future diseases of global health importance, Abstract ... and evaluation of a tripartite novel excipient for direct compression of ... Vol 1, No 1 (2004), Diffuse Transcranial Electrical Stimulation ...

  13. Euroopa Inimõiguste Kohtu inimesepilt / Lauri Mälksoo

    Index Scriptorium Estoniae

    Mälksoo, Lauri, 1975-


    Raamatuarvustus: Katri Lõhmus. Caring Autonomy. European Human Rights Law and the Challenge of Individualism. Cambridge University Press 2015, 246 lk. Euroopa inimõiguste ja põhivabaduste kaitse konventsiooni artikli 8 sisustamisest

  14. First aid to aid Helmand / Ella Karapetyan

    Index Scriptorium Estoniae

    Karapetyan, Ella


    Välisministeeriumi rahastatud projekti raames saatsid MTÜ Mondo ja Eesti Kaitsevägi Afganistani 1500 esmaabipakki, mis on mõeldud Helmandi provintsis toimunud esmaabikoolituse läbinutele. Koolitusprojekti kogumaksumus on 2 246 580 krooni

  15. A Study of Triple Negative Breast Cancer at a Tertiary Cancer Care ...

    African Journals Online (AJOL)

    cause of cancer deaths worldwide. It is the ... Background: Triple negative breast cancers (TNBCs) are a diverse and heterogeneous group .... nonHispanic black patients with breast cancer, at 24.6%. ... chance of breast conservation rates.

  16. Harvesting solar light with crystalline carbon nitrides for efficient photocatalytic hydrogen evolution

    KAUST Repository

    Bhunia, Manas Kumar; Yamauchi, Kazuo; Takanabe, Kazuhiro


    Described herein is the photocatalytic hydrogen evolution using crystalline carbon nitrides (CNs) obtained by supramolecular aggregation followed by ionic melt polycondensation (IMP) using melamine and 2,4,6-triaminopyrimidine as a dopant. The solid

  17. aging hypotension and intra-operative cardiac arres

    African Journals Online (AJOL)

    anaesthesiologists. Results: Medical officers scored an average of 252 and 246 points, whereas interns scored an average of 216 and 215 points ... performance, and then to assess the validity and reliability of the .... Surgeon: “cutting skin”.

  18. ORF Alignment: NT_033777 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ophila melanogaster] gb|AAF54897.1| CG7996-PA ... [Drosophila melanogaster] sp|P05049|SNAK_DROME ... protease snake precursor ... Length = 246 ... Query: 186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKW

  19. An Assessment of Changes in the Magnesium Level During ...

    African Journals Online (AJOL)


    acid synthesis.[2,4-6] It is also ... stimulate sodium-potassium ATPase at low concentrations ... and muscle activity after major abdominal surgeries. .... respiratory rate, and temperature) was assessed by Pearson .... and protein reduction.

  20. Simultaneous quantitative determination of zidovudine and ...

    African Journals Online (AJOL)

    Methods: Standard stock solutions for HPLC analysis were prepared by ... In the HPLC measurement, sample detection was carried out at 246 nm using an ... Human plasma, Reverse phase high- performance liquid chromatography. Tropical ...

  1. Polymorphism of Candidate Genes for Hypertension and their Relation to Blood Pressure and Intermediate Phenotypes in Normotensive Offspring of Hypertensives

    Czech Academy of Sciences Publication Activity Database

    Peleška, Jan; Jindra, A.; Jáchymová, M.; Horký, K.; Kolář, J.; Heller, S.; Marečková, Z.; Tomečková, Marie; Umnerová, V.; Reissigová, Jindra; Zvárová, Jana

    19 Suppl. 2, - (2001), s. 245-246 ISSN 0263-6352. [European Meeting on Hypertension /11./. 15.06.2001-19.06.2001, Milano] Institutional research plan: AV0Z1030915 Subject RIV: BA - General Mathematics

  2. Jibril Attahiru Alhassan FACTORS PROMOTING AGRICULTURAL ...

    African Journals Online (AJOL)

    at national level. Information and Communication Technology (ICT) is a merger of computing ... agricultural research in Ghana while Private-sector involvement in agricultural .... Recent investment trends Outlook on Agriculture, 33(4) 239-246.

  3. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Fellowship; Associateship. Associate Profile. Period: 2010–2013. Ray, P S . Date of birth: 27 November 1976. Address during Associateship: IISER, Mohanpur Campus, Nadia 741 246. Contact: Email: YouTube; Twitter ...

  4. Depth-of-anaesthesia monitoring

    African Journals Online (AJOL)

    Correspondence to: John Sneyd, e-mail: Abstract. All anaesthetists .... 2000;55(3):242-246. 5. Thornton C, Barrowcliffe MP, Konieczko KM, et al. ... Sandin RH, Enlund G, Samuelsson P, Lennmarken C. Awareness.

  5. 77 FR 12877 - Record of Decision for the General Management Plan/Abbreviated Final Environmental Impact... (United States)


    ... may be obtained by contacting Superintendent Don Striker, New River Gorge National River, P.O. Box 246..., provides an income stream for their long-term maintenance. Emphasizes primitive recreational experiences...

  6. Personal neutron dosemeter of the Czech Republic: Review of basic properties, results of recent tests

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Spurný, František; Plichta, J.


    Roč. 14, 7/8 (2006), s. 246-253 ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality

  7. MUK ja maksujärelevalve = TAFIC and tax supervision

    Index Scriptorium Estoniae


    Maksuameti Maksupettuste Uurimise Keskus (MUK) viis 2003. aastal lõpule eeluurimise 42 maksukuritegusid ja rahapesu puudutavas kriminaalasjas ning saatis kohtu ette 76 süüdistatavat 246 kuriteoepisoodis

  8. Effects of various levels of rosemary and oregano volatile oil mixture ...

    African Journals Online (AJOL)



    Jan 24, 2012 ... INTRODUCTION. During leukocytes and mitochondrial respiration chain, ... radicals are singlet oxygen, superoxide radicals, hydroxyl radicals ... 246.9 g/kg crude protein; 12.26 MJ/kg metabolisable energy (ME)], formulated to ...

  9. Method of reduction of nitroaromatics by enzymatic reaction with redox enzymes (United States)

    Shah, Manish M.


    A method for the controlled reduction of nitroaromatic compounds such as nitrobenzene and 2,4,6-trinitrotoluene by enzymatic reaction with redox enzymes, such as Oxyrase (Trademark of Oxyrase, Inc., Mansfield, Ohio).

  10. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel


    Roč. 58, č. 9 (2013), s. 243-246 ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  11. Terrestrial adaptation of green algae Klebsormidium and Zygnema (Charophyta) involves diversity in photosynthetic traits but not in CO2 acquisition

    Czech Academy of Sciences Publication Activity Database

    Pierangelini, M.; Ryšánek, David; Lang, I.; Adlassnig, W.; Holzinger, A.


    Roč. 246, č. 5 (2017), s. 971-986 ISSN 0032-0935 Institutional support: RVO:61388971 Keywords : Desiccation * Green algae * Photosynthesis Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.361, year: 2016

  12. U.S. Collaborative-Engagement with China: Using Strategic Technological Collaborative Leadership (STCL) (United States)


    Red Rock Tech., Seagate, Sony Storage Devices Lantronix, SBE Terminal Server Technologies Table 1. COTS Suppliers and Components in the Aegis...million Singapore $711 China $622 Australia $471 Taiwan $363 Malaysia $301 South Korea $246 74

  13. Od krize Západu k jeho katastrofě: Ke strukturalistické koncepci filosofie dějin J. L. Fischera

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav


    Roč. 64, č. 2 (2016), s. 229-246 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : crisis * peripetia * catastrophe * 'primitivism' * legitimisation * democracy Subject RIV: AA - Philosophy ; Religion

  14. On the nature of γ′ phase cutting and its effect on high temperature and low stress creep anisotropy of Ni-base single crystal superalloys

    Czech Academy of Sciences Publication Activity Database

    Jácome, L. A.; Nörtershäuser, P.; Somsen, C.; Dlouhý, Antonín; Eggeler, G.


    Roč. 69, MAY (2014), s. 246-264 ISSN 1359-6454 Institutional support: RVO:68081723 Keywords : Ni-base single crystal superalloys * Creep * Anisotropy * Dislocation * Rafting Subject RIV: JG - Metallurgy Impact factor: 4.465, year: 2014

  15. Assessment of undiscovered oil and gas resources in the Lower Indus Basin, Pakistan, 2017 (United States)

    Schenk, Christopher J.; Tennyson, Marilyn E.; Klett, Timothy R.; Finn, Thomas M.; Mercier, Tracey J.; Gaswirth, Stephanie B.; Marra, Kristen R.; Le, Phuong A.; Hawkins, Sarah J.; Leathers-Miller, Heidi M.


    Using a geology-based assessment methodology, the U.S. Geological Survey estimated mean undiscovered, technically recoverable resources of 164 million barrels of oil and 24.6 trillion cubic feet of gas in the Lower Indus Basin, Pakistan.


    Institute of Scientific and Technical Information of China (English)

    Mingshun Liu; Haixiang Gao; Xiaomei Fu; Po Ma


    Objectives: To explore applied value on CT and BA in diagnosis of patients with atherothrombotic brain infarction. Methods:CT and BA were examined in 246 patients with atherothrombotic brain infarction. Results:The different change of CT and BA were showed in 246 patients with atherothrombotic brain infarction. Conclusions: There were separately different advantage and shortcoming in CT and BA in diagnosis of atherothrombotic brain infarction. The value of clinical application of BA was important in diagnosis of atherothrombotic brain infarction.

  17. 3,5-bis(acylamino) benzamides

    International Nuclear Information System (INIS)


    Certain 3,5-disubstituted, 2,4,6-triiodoanilides of polyhydroxymonobasic acids have recently been found useful as non-ionic x-ray contrast agents. The 3-(lower acylamino)-5-amino-2,4,6-triiodobenzamides are prepared by hydrogenation of a 3,5-dinitrobenzamide, acylation of the resulting diamino compound to the bis-(acylamino) level and iodination of the acylamino compound

  18. Degradation of chlorophenol mixtures in a fed-batch system by two ...

    African Journals Online (AJOL)

    This work was undertaken to investigate the effect of variations of the feed rate on a fed-batch set-up used to degrade xenobiotics. The mixture of substrates was composed of PCP, 2,4,6 TCP and 2,3,5,6 TeCP (pentachlorophenol, 2,4,6 trichlorophenol and 2,3,5,6 tetrachlorophenol respectively). Two acclimated bacteria ...

  19. Cryptosporidium parvum and Cryptosporidium andersoni infection in naturally infected cattle of northwest Iran

    Directory of Open Access Journals (Sweden)

    Yousef Mirzai


    Full Text Available The protozoan intestinal parasite Cryptosporidium commonly infects cattle throughout the world and Iran. The present study was undertaken to determine the abundance and associated risk factors of Cryptosporidium infection in cattle herds of northwestern Iran. A total number of 246 fecal samples from 138 (56.1% diarrheic (D and 108 (43.9% non-diarrheic (ND cattle were randomly collected and examined by fecal smears stained with Ziehl-Neelsen. For molecular specification, DNA was extracted from collected Cryptosporidium oocysts and a fragment of 1325 bp in size from 18S rRNA gene was amplified. The overall prevalence of Cryptosporidium infection was 22.3% (55/246. The prevalence of Cryptosporidium infection in examined calves less than 6 month-old was significantly higher than adult cattle. C. parvum and C. andersoni were identified in 20.3% (50/246 and 2.03% (5/246 of examined cattle, respectively. The highest prevalence of C. parvum infection was found in D calves < 6 month-old (13.4%, 33/246, while C. andersoni was only detected in ND cattle (8.9%, 22/246. There was significant difference in the prevalence between male than female cattle. There was no significant difference between prevalence and seasons of investigation. It was concluded that C. parvum was the prevalent species in younger animals compared to older ones as a potentially zoonotic agent in the region.

  20. Bioactive Formylated Flavonoids from Eugenia rigida: Isolation, Synthesis, and X-ray Crystallography. (United States)

    Zaki, Mohamed A; Nanayakkara, N P Dhammika; Hetta, Mona H; Jacob, Melissa R; Khan, Shabana I; Mohammed, Rabab; Ibrahim, Mohamed A; Samoylenko, Volodymyr; Coleman, Christina; Fronczek, Frank R; Ferreira, Daneel; Muhammad, Ilias


    Two new flavonoids, rac-6-formyl-5,7-dihydroxyflavanone (1) and 2',6'-dihydroxy-4'-methoxy-3'-methylchalcone (2), together with five known derivatives, rac-8-formyl-5,7-dihydroxyflavanone (3), 4',6'-dihydroxy-2'-methoxy-3'-methyldihydrochalcone (4), rac-7-hydroxy-5-methoxy-6-methylflavanone (5), 3'-formyl-2',4',6'-trihydroxy-5'-methyldihydrochalcone (6), and 3'-formyl-2',4',6'-trihydroxydihydrochalcone (7), were isolated from the leaves of Eugenia rigida. The individual (S)- and (R)-enantiomers of 1 and 3, together with the corresponding formylated flavones 8 (6-formyl-5,7-dihydroxyflavone) and 9 (8-formyl-5,7-dihydroxyflavone), as well as 2',4',6'-trihydroxychalcone (10), 3'-formyl-2',4',6'-trihydroxychalcone (11), and the corresponding 3'-formyl-2',4',6'-trihydroxydihydrochalcone (7) and 2',4',6'-trihydroxydihydrochalcone (12), were synthesized. The structures of the isolated and synthetic compounds were established via NMR, HRESIMS, and electronic circular dichroism data. In addition, the structures of 3, 5, and 8 were confirmed by single-crystal X-ray diffraction crystallography. The isolated and synthetic flavonoids were evaluated for their antimicrobial and cytotoxic activities against a panel of microorganisms and solid tumor cell lines.

  1. A New Alkali-Stable Phosphonium Cation Based on Fundamental Understanding of Degradation Mechanisms. (United States)

    Zhang, Bingzi; Kaspar, Robert B; Gu, Shuang; Wang, Junhua; Zhuang, Zhongbin; Yan, Yushan


    Highly alkali-stable cationic groups are a critical component of hydroxide exchange membranes (HEMs). To search for such cations, we studied the degradation kinetics and mechanisms of a series of quaternary phosphonium (QP) cations. Benzyl tris(2,4,6-trimethoxyphenyl)phosphonium [BTPP-(2,4,6-MeO)] was determined to have higher alkaline stability than the benchmark cation, benzyl trimethylammonium (BTMA). A multi-step methoxy-triggered degradation mechanism for BTPP-(2,4,6-MeO) was proposed and verified. By replacing methoxy substituents with methyl groups, a superior QP cation, methyl tris(2,4,6-trimethylphenyl)phosphonium [MTPP-(2,4,6-Me)] was developed. MTPP-(2,4,6-Me) is one of the most stable cations reported to date, with <20 % degradation after 5000 h at 80 °C in a 1 m KOD in CD3 OD/D2 O (5:1 v/v) solution. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Organobromine compound profiling in human adipose: Assessment of sources of bromophenol

    International Nuclear Information System (INIS)

    Gao, Shixiong; Wan, Yi; Zheng, Guomao; Luo, Kai; Kannan, Kurunthachalam; Giesy, John P.; Lam, Michael H.W.; Hu, Jianying


    Bromophenols (BRPs) have been widely detected in human tissues, however, relative proportions from natural products and/or anthropogenic flame retardants are not clear. 21 polybrominated diphenyl ethers (PBDEs), 15 MeO/OH-PBDEs, and 10 BRPs were simultaneously quantified in adipose collected from people from New York City, USA. An in vitro assay utilizing human liver microsomes was performed for detected predominant organobromine. High concentrations of 2,4,6-triBRP and PBDEs were observed, and extremely low concentrations of naturally occurring MeO/OH-PBDEs were detected. Similar biotransformatioin rates of BRPs and MeO/OH-PBDEs indicated that the relative high concentration of 2,4,6-triBRP in humans was not of natural origin. Significant correlation observed between concentrations of 2,4,6-triBRP and BDE-209 suggested that the two chemicals may share a common source. Both 2,4,6-triBRP and BDE-209 were detected in commercial ABS resins, suggesting that plastic products made from ABS resins could be potential sources of co-exposure of the two compounds for humans. - Highlights: • 2,4,6-triBRP detected with high concentrations in human was not of natural origin. • Co-exposure of 2,4,6-triBRP and BDE-209 was observed in human samples. • Products made from ABS resins were potential exposure sources of 2,4,6-triBRP. - The profile of organobromine compounds in human together with biotransformation behaviors indicate that anthropogenic sources mainly contribute to high levels of bromophenols in humans

  3. Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force

    Energy Technology Data Exchange (ETDEWEB)

    Girod, M.; Delaroche, J.P.; Romain, P. [CEA/DIF, DPTA/SPN, Boite Postale 12, 91680 Bruyeres-le-Chatel (France); Libert, J. [Institut de Physique Nucleaire Centre National de la Recherche Scientifique-IN2P3, F-91406 Orsay (France)


    The structure properties of the even-even nuclei {sup 226,} {sup 228,} {sup 230,} {sup 232,} {sup 234}Th, {sup 230,} {sup 232,} {sup 234,} {sup 236,} {sup 238,} {sup 240}U, {sup 240,} {sup 242,} {sup 244,} {sup 246}Pu, and {sup 242,} {sup 244,} {sup 246,} {sup 248}Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)

  4. Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force

    International Nuclear Information System (INIS)

    Girod, M.; Delaroche, J.P.; Romain, P.; Libert, J.


    The structure properties of the even-even nuclei 226, 228, 230, 232, 234 Th, 230, 232, 234, 236, 238, 240 U, 240, 242, 244, 246 Pu, and 242, 244, 246, 248 Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)

  5. 溶媒に依存したスタンナンチオンの安定性<ミニノート>


    斎藤, 雅一; 時任, 宣博; 岡崎, 廉治


    Stannanethione, Tbt(mes)Sn=S (Tbt = 2,4,6-tris[bis(trimethylsilyl)methyl]phenyl; Mes = mesityl) was aynthesized by the reaction of the corresponding kinetically stabilized diarylstannylene, Tbt(Mes)Sn:, with styrene episulfide. In THF-Et2O, Tbt(mes)Sn=S reacted with styrene oxide to give the corresponding [3+2]cycloadducts even at room temperature as in the case of more hindered stable stannanethione, Tbt(Tip)Sn=S (Tip = 2,4,6-triisopropylphenyl). On the contrary, Tbt(Mes)Sn=S dimerized in ...

  6. Applications of deuterium labeling in studies of drug metabolism: metabolism of trideuteroaniline mustard

    International Nuclear Information System (INIS)

    Cox, P.J.; Farmer, P.B.; Foster, A.B.; Jarman, M.


    In a continuation of a study of aniline mustard, the metabolism of 2,4,6-trideuteroaniline mustard [N-N-di-(2-chloroethyl)-2,4,6-trideuteroaniline] was investigated. Measurements of the ratios of deuterated to nondeuterated species in p-hydroxyaniline mustard and N-(2-chloroethyl)-4-hydroxyaniline isolated following in vitro metabolism of a mixture of aniline mustard and aniline mustard-d 3 enabled a determination both of the kinetic isotope effect and of the extents of NIH shifts and indicated the probable metabolite sequence

  7. Statement of work for services provided by the Waste Sampling and Characterization Facility for Effluent Monitoring during Calendar Year 1996

    International Nuclear Information System (INIS)

    Gleckler, B.P.


    This report documents radionuclide air emissions from the Hanford Site and the resulting effective dose equivalent to any member of the public from those emissions. This report complies with the reporting requirements of the Code of Federal Regulations, Title 40, ''Protection of the Environment,'' Part 61, ''National Emissions Standards for Hazardous Air Pollutants,'' Subpart H, ''National Emission Standards for Emissions of Radionuclides Other Than Radon From Department of Energy Facilities'' (40 CFR 61 Subpart H) and Chapter 246-247 of the Washington Administrative Code (WAC 246-247)

  8. Low cycle fatigue life of two nickel-base casting alloys in a hydrogen environment

    International Nuclear Information System (INIS)

    Cooper, R.A.


    Results of low cycle fatigue tests on alloy Mar-M-246 and Inconel 713 are presented. Based on the limited data, it was concluded that the Mar-M-246 material had a cyclic life in hydrogen that averaged three times higher than the alloy 713LC material for similar strain ranges. The hydrogen environment reduced life for both materials. The life reduction was more than an order of magnitude for the 713LC material. Porosity content of the cast specimens was as expected and was an important factor governing low cycle fatigue life

  9. Description of All Solutions of a Linear Complementarity Problem

    Czech Academy of Sciences Publication Activity Database

    Rohn, Jiří


    Roč. 18, - (2009), s. 246-252 E-ISSN 1081-3810 R&D Projects: GA ČR GA201/09/1957; GA ČR GC201/08/J020 Institutional research plan: CEZ:AV0Z10300504 Keywords : linear complementarity problem * Moore-Penrose inverse * verified solution * absolute value equation Subject RIV: BA - General Mathematics Impact factor: 0.892, year: 2009 ela / ela -articles/articles/vol18_pp246-252.pdf

  10. Summary of research results 2012. Foundation 'Natuur en Milieu'. Factsheet; Samenvatting onderzoeksresultaten 2012. Stichting Natuur en Milieu. Factsheet

    Energy Technology Data Exchange (ETDEWEB)

    Vegter, F.; Van der Lelij, B.


    A summary is given of a survey among 1.246 Dutch people between 16 and 70 years old on their attitude towards the environment. The following subjects were investigated: attitude towards nature and environment, ways to solve problems, tasks of environmental organizations, sustainable solutions, green reputation of politicians, well-known Dutch people and businesses [Dutch] Een samenvatting is gegeven van een enquete onder 1.246 Nederlanders tussen 16 en 70 jaar inzake hun houding tegenover natuur en milieu. De volgende onderwerpen komen aan de orde: Houding tegenover het thema natuur en milieu; Oplossingsrichtingen; Taken van milieuorganisaties; Oplossingen op het gebied van duurzaamheid; Groen imago politici, bekende Nederlanders en bedrijven.

  11. Religious Fanaticism, a Threat to National Security: The Case of ...

    African Journals Online (AJOL)

    ... other means should be employed to extinct this group and similar ones in Nigeria and beyond. This is because, until Jesus returns (Dan. 9:26; Matt. 24:6), there are some people so deeply committed to doing evil that they can be restrained, not by dialogue, argument, reason and persuasion, but only by superior force.

  12. Cyclopentadienyl molybdenum(II/VI) N-heterocyclic carbene complexes: Synthesis, structure, and reactivity under oxidative conditions

    KAUST Repository

    Li, Shenyu; Kee, Choonwee; Huang, Kuo-Wei; Hor, Andy Sum Andy; Zhao, Jin


    A series of N-heterocyclic carbene (NHC) complexes CpMo(CO) 2(NHC)X (NHC = IMe = 1,3-dimethylimidazol-2-ylidene, X = Br, 1; NHC = 1,3-dipropylimidazol-2-ylidene, X = Br, 2; NHC = IMes = 1,3-bis(2,4,6- trimethylphenyl)imidazol-2-ylidene, X = Br, 3

  13. 28. Zvenigorod conference on the plasma physics and controlled thermonuclear synthesis. Theses of reports

    International Nuclear Information System (INIS)


    Theses of reports, presented at the 28th Conference on the plasma physics and controlled thermonuclear synthesis (Zvenigorod, 19-23 February 2001) are published. 246 reports were heard at the following sections: magnetic confinement, theory and experiments; inertial thermonuclear synthesis; plasma processes and physics of gas-discharge plasma; physical bases of plasma technologies. 17 reports had the summarizing character [ru

  14. Labor market flexibility, international competitiveness and patterns of trade

    Czech Academy of Sciences Publication Activity Database

    Uzagalieva, Ainura; Cukrowski, J.


    Roč. 59, č. 2 (2006), s. 225-246 ISSN 0012-981X R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : labor market regulations * competitiveness * international trade Subject RIV: AH - Economics

  15. 77 FR 53214 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year... (United States)


    ...,104 Center, Inc. Center. AZ Casa Sierra Vista, Casa Sierra Vista.... 600-A E 25th St...... Yuma 30 190........... 246 176,271 Senior Citizens Avenue. Housing, LTD. NM New Mexico-American La Resolana 1025 Chelwood... Corporation. OH CRS, Ltd (Stern Hendy Clifton Place........ 900 Rue De La Paix... Cincinnati 183 375,387...

  16. Laténské pohřebiště v pískovnách u Vliněvsi, okr. Mělník

    Czech Academy of Sciences Publication Activity Database

    Limburský, Petr; Sankot, P.; Březinová, Helena; Likovský, Jakub


    Roč. 106, prosinec (2015), s. 181-246 ISSN 0031-0506 Grant - others:GA UK(CZ) 564512 Institutional support: RVO:67985912 Keywords : Central Bohemia * Mělník region * cemetery * La Tène period * chronology * social structure * interregional ties to western Europe and the Danube region Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Influence of positions of the incidence and severity of maxillofacial ...

    African Journals Online (AJOL)

    The most common vehicle involved in RTA was the mini bus, 34.3% followed by motorcycle, 26.5%. Middle seat passengers, drivers and motorcycle passengers and riders sustained more and severe injuries during crashes. The mandible was more frequently fractured at the symphysis (24.6%) than at any other site while ...

  18. Induced production of brominated aromatic compounds in the alga Ceramium tenuicorne. (United States)

    Dahlgren, Elin; Enhus, Carolina; Lindqvist, Dennis; Eklund, Britta; Asplund, Lillemor


    In the Baltic Sea, high concentrations of toxic brominated aromatic compounds have been detected in all compartments of the marine food web. A growing body of evidence points towards filamentous algae as a natural producer of these chemicals. However, little is known about the effects of environmental factors and life history on algal production of brominated compounds. In this study, several congeners of methoxylated polybrominated diphenyl ethers (MeO-PBDEs), hydroxylated polybrominated diphenyl ethers (OH-PBDEs) and brominated phenols (BPs) were identified in a naturally growing filamentous red algal species (Ceramium tenuicorne) in the Baltic Sea. The identified substances displayed large seasonal variations in the alga with a concentration peak in July. Production of MeO-/OH-PBDEs and BPs by C. tenuicorne was also established in isolated clonal material grown in a controlled laboratory setting. Based on three replicates, herbivory, as well as elevated levels of light and salinity in the culture medium, significantly increased the production of 2,4,6-tribromophenol (2,4,6-TBP). Investigation of differences in production between the isomorphic female, male and diploid clonal life stages of the alga grown in the laboratory revealed a significantly higher production of 2,4,6-TBP in the brackish water female gametophytes, compared to the corresponding marine gametophytes. Even higher concentrations of 2,4,6-TBP were produced by marine male gametophytes and sporophytes.

  19. Microsporidiosis and Cryptosporidiosis in HIV/AIDS Patients in St. Petersburg, Russia: Serological Identification of Microsporidia and Cryptosporidium parvum in Sera Samples from HIV/AIDS Patients

    Czech Academy of Sciences Publication Activity Database

    Kučerová, Z.; Sokolova, O.I.; Demyanov, A.; Kváč, Martin; Sak, Bohumil; Květoňová, Dana; Secor, W. E.


    Roč. 27, č. 1 (2011), s. 13-15 ISSN 0889-2229 R&D Projects: GA AV ČR KJB500960701 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium * HIV * AIDS Subject RIV: EC - Immunology Impact factor: 2.246, year: 2011

  20. Metallogels derived from silver coordination polymers of C3-symmetric tris(pyridylamide) tripodal ligands: synthesis of Ag nanoparticles and catalysis. (United States)

    Paul, Mithun; Sarkar, Koushik; Dastidar, Parthasarathi


    By applying a recently developed crystal engineering rationale, four C3 symmetric tris(pyridylamide) ligands namely 1,3,5-tris(nicotinamidomethyl)-2,4,6-triethylbenzene, 1,3,5-tris(isonicotinamidomethyl)-2,4,6-triethylbenzene, 1,3,5-tris(nicotinamidomethyl)-2,4,6-trimethylbenzene, and 1,3,5-tris(isonicotinamidomethyl)-2,4,6-trimethylbenzene, which contain potential hydrogen-bonding sites, were designed and synthesized for generating Ag(I) coordination polymers and coordination-polymer-based gels. The coordination polymers thus obtained were characterized by single-crystal X-ray diffraction. The silver metallogels were characterized by transmission electron microscopy (TEM) and dynamic rheology. Upon exposure to visible light, these silver metallogels produced silver nanoparticles (AgNPs), which were characterized by TEM, powder X-ray diffraction, energy dispersive X-ray and X-ray photoelectron spectroscopy. These NPs were found to be effectively catalyzed the reduction of 4-nitrophenolate to 4-aminophenolate without the use of any exogenous reducing agent. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. African Journal of Marine Science - Vol 30, No 2 (2008)

    African Journals Online (AJOL)

    Records of Fraser\\'s dolphin Lagenodelphis hosei Fraser 1956 from the Gulf of Guinea and Angola · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CR Weir, J Debrah, PK Ofori-Danson, C Pierpoint, K Van Waerebeek, 241-246 ...

  2. Consumer demand system estimation and value added tax reforms in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Janský, Petr


    Roč. 64, č. 3 (2014), s. 246-273 ISSN 0015-1920 R&D Projects: GA TA ČR(CZ) TD010033 Institutional support: RVO:67985998 Keywords : consumer behavior * Quadratic Almost Ideal Demand System * tax reforms Subject RIV: AH - Economics Impact factor: 0.420, year: 2014

  3. Comparison of CERES, WOFOST and SWAP models in simulating soil water content during growing season under different soil conditions

    Czech Academy of Sciences Publication Activity Database

    Eitzinger, J.; Trnka, M.; Hosch, J.; Žalud, Z.; Dubrovský, Martin


    Roč. 171, č. 3 (2004), s. 223-246 ISSN 0304-3800 R&D Projects: GA ČR GA521/02/0827 Institutional research plan: CEZ:AV0Z3042911 Keywords : Winter wheat * Spring barley * Soil water balance * Model evaluation * Ecological modeling Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.652, year: 2004

  4. Training, Degrees, and Credentials in the Hiring of School Psychologists (United States)

    O'donnell, Patrick S.; Dunlap, Linda L.


    A national sample of 246 Directors of Pupil Personnel Services and Directors of Special Education were surveyed to assess the importance they place on training, degrees, and credentials in the hiring of school psychologists. High, but varying, levels of importance were found for the content knowledge and skill areas in the National Association of…

  5. Perceived Parenting Styles, Personality Traits and Sleep Patterns in Adolescents (United States)

    Brand, Serge; Hatzinger, Martin; Beck, Johannes; Holsboer-Trachsler, Edith


    The present study examined the role of parenting styles with respect to adolescents' sleep patterns and symptoms of depression and anxiety. A total of 246 adolescents (age: 17.58 [plus or minus] 1.62) took part in the study. They completed several questionnaires with regard to parenting styles and to symptoms of anxiety and depression;…

  6. Novel high band gap pendant-borylated carbazole polymers with deep HOMO levels through direct +N=B- interaction for organic photovoltaics

    DEFF Research Database (Denmark)

    Brandt, Rasmus G.; Sveegaard, Steffen G.; Xiao, Manjun


    In this communication, we investigate the direct and still conjugated intramolecular +N=B- interactions in novel high band gap borylated carbazole containing polymers, namely, poly(3,6-(N-di(2,4,6-trimethyl)-phenylboryl-carbazole)-alt- 4,8-di(5-(2-ethylhexyl)thiophene-2-yl)benzo[1,2-b: 4,5-b...

  7. Discrepancies between Parents' and Children's Attitudes toward TV Advertising (United States)

    Baiocco, Roberto; D'Alessio, Maria; Laghi, Fiorenzo


    The authors conducted a study with 500 parent-child dyads. The sample comprised 254 boys and 246 girls. The children were grouped into 5 age groups (1 group for each age from 7 to 11 years), with each group comprising 100 children. The survey regards discrepancies between children and their parents on attitudes toward TV advertising to determine…

  8. Psychosocial Factors Influencing Attitudes Towards Internet Piracy ...

    African Journals Online (AJOL)

    In all a total of two hundred and fifty participants were drawn through accidental sampling technique for this study. Their age ranged between 19-48 ... In the same view, consumers ethnic group was not found to significantly influence attitude towards Internet piracy (F(3,246) = .404, P> .05). Reasons were given why the ...

  9. Defense Department funds advanced military wireless networks research


    Crumbley, Liz


    The U.S. Department of Defense has awarded a $246,000 Defense University Research Instrumentation Program (DURIP) grant to researchers in Virginia Tech's Bradley Department of Electrical and Computer Engineering for advanced research on wireless communications networks that are critical during military maneuvers.

  10. Estimation of NH3 emissions from a naturally ventilated livestock farm using local-scale atmospheric dispersion modelling

    Czech Academy of Sciences Publication Activity Database

    Hensen, A.; Loubet, B.; Mosquera, J.; van den Bulk, W. C. M.; Erisman, J. W.; Daemmgen, U.; Milford, C.; Loepmeier, F. J.; Cellier, P.; Mikuška, Pavel; Sutton, M. A.


    Roč. 6, č. 12 (2009), s. 2847-2860 ISSN 1726-4170 Institutional research plan: CEZ:AV0Z40310501 Keywords : NH3 livestock farm emissions * concentration measurement * atmospheric dispersion Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.246, year: 2009

  11. Adiabatic temperature change from non-adiabatic measurements

    Czech Academy of Sciences Publication Activity Database

    Carvalho, A.M.G.; Mejía, C.S.; Ponte, C.A.; Silva, L.E.L.; Kaštil, Jiří; Kamarád, Jiří; Gomes, A.M.


    Roč. 122, č. 3 (2016), s. 1-5, č. článku 246. ISSN 0947-8396 Institutional support: RVO:68378271 Keywords : magnetocaloric effect * adiabatic temperature change * calorimetric device * gadolinium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  12. 77 FR 2278 - Intent To Grant an Exclusive License for a U.S. Army Owned Invention to Triumph Actuation Systems... (United States)


    ....S. patent 7,228,779, issued June 12, 2007, ``Automatic Primer Feed Mechanism''; U.S. patent 7,246,549, issued July 24, 2007, ``Automatic Primer Feed Mechanism; U.S. patent 7,318,369, issued January 15, 2008, ``Out-of- Battery Lock for the Automatic Primer Feed Mechanism''; U.S. patent 7,845,264, issued...

  13. U.S. Army Reserve 88th Readiness Division Finds Big Savings

    Energy Technology Data Exchange (ETDEWEB)



    Fact sheet features lighting work done for the U.S. Army Reserve 88th Readiness Division, which was recognized in two 2017 Interior Lighting Campaign exemplary recognition categories. The troffer lighting upgrade projects at the two recognized sites are expected to save more than 246,000 kWh annually or roughly enough electricity to run 23 homes for a year.

  14. Nikkaji Dictionary: メトキシレゾルフィン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term メトキシレゾルフィン 名詞 一般 * * * * メトキシレゾルフィン ... Nikkaji J246.013K 200906078819947312 C CA06 UNKNOWN_1 メトキシレゾルフィン

  15. Nikkaji Dictionary: エトキシレゾルフィン [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term エトキシレゾルフィン 名詞 一般 * * * * エトキシレゾルフィン ... Nikkaji J246.012B 200906083802266749 C CA06 UNKNOWN_1 エトキシレゾルフィン

  16. Child Labour Remains "Massive Problem." (United States)

    World of Work, 2002


    Despite significant progress in efforts to abolish child labor, an alarming number of children are engaged in its worst forms. Although 106 million are engaged in acceptable labor (light work for those above the minimum age for employment), 246 million are involved in child labor that should be abolished (under minimum age, hazardous work). (JOW)

  17. Evaluation of nucleoside phosphonates and their analogs and prodrugs for inhibition of orthopoxvirus replication

    Czech Academy of Sciences Publication Activity Database

    Keith, K. A.; Hitchcock, M. J. M.; Lee, W. A.; Holý, Antonín; Kern, E. R.


    Roč. 47, č. 7 (2003), s. 2193-2198 ISSN 0066-4804 R&D Projects: GA AV ČR IBS4055109 Grant - others:Public Health Service(US) NO1-AI-85347 Institutional research plan: CEZ:AV0Z4055905 Keywords : adefovir * cidofovir * tenofovir Subject RIV: CC - Organic Chemistry Impact factor: 4.246, year: 2003

  18. Relations of Shyness-Sensitivity and Unsociability with Adjustment in Middle Childhood and Early Adolescence in Suburban Chinese Children (United States)

    Liu, Junsheng; Chen, Xinyin; Zhou, Ying; Li, Dan; Fu, Rui; Coplan, Robert J.


    This study examined how shyness-sensitivity and unsociability were associated with social, school, and psychological adjustment in Chinese children and adolescents. Participants included 564 children (272 boys, M[subscript age] = 9 years) and 462 adolescents (246 boys, M[subscript age] = 13 years) in a suburban region in China. Data were obtained…

  19. Felipe B. Pedraza y Oana Andreia Sambrian Toma (eds. Hispania Felix I. Revista Hispano Rumana de Cultura y Civilización de los Siglos de Oro. Lope de Vega en su Siglo de Oro

    Directory of Open Access Journals (Sweden)

    Jésica Castro


    Full Text Available Felipe B. Pedraza y Oana Andreia Sambrian Toma (eds. Hispania Felix I. Revista Hispano Rumana de Cultura y Civilización de los Siglos de Oro. Lope de Vega en su Siglo de Oro. Vigo: Editorial Academia del Hispanismo, 2010. 246 pp.

  20. Coping Styles of Failing Brunei Vocational Students (United States)

    Mundia, Lawrence; Salleh, Sallimah


    Purpose: The purpose of this paper is to determine the prevalence of two types of underachieving students (n = 246) (active failing (AF) and passive failing (PF)) in Brunei vocational and technical education (VTE) institutions and their patterns of coping. Design/methodology/approach: The field survey method was used to directly reach many…

  1. 48 CFR 46.314 - Transportation contracts. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Transportation contracts... MANAGEMENT QUALITY ASSURANCE Contract Clauses 46.314 Transportation contracts. The contracting officer shall insert the clause at 52.246-14, Inspection of Transportation, in solicitations and contracts for freight...

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 246 ... Vol 8, No 1 (2011), Evaluation of physical stability of oleogels containing diclofenac diethylamine, Abstract. DC Goupale, B ... Vol 2, No 1 (2005), High performance liquid chromatographic determination of ciprofloxacin in human plasma and urine and its application to pharmacokinetic studies, Abstract.

  3. 48 CFR 846.302-72 - Frozen processed foods. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Frozen processed foods... CONTRACT MANAGEMENT QUALITY ASSURANCE Contract Clauses 846.302-72 Frozen processed foods. The contracting officer shall insert the clause at 852.246-72, Frozen processed foods, in solicitations and contracts for...

  4. New insights into mitral valve dystrophy : A Filamin-A genotype-phenotype and outcome study

    NARCIS (Netherlands)

    Le Tourneau, Thierry; Le Scouarnec, Solena; Cueff, Caroline; Bernstein, Daniel; Aalberts, Jan J J; Lecointe, Simon; Mérot, Jean; Bernstein, Jonathan A; Oomen, Toon; Dina, Christian; Karakachoff, Matilde; Desal, Hubert; Al Habash, Ousama; Delling, Francesca N; Capoulade, Romain; Suurmeijer, Albert J H; Milan, David; Norris, Russell A; Markwald, Roger; Aikawa, Elena; Slaugenhaupt, Susan A; Jeunemaitre, Xavier; Hagège, Albert; Roussel, Jean-Christian; Trochu, Jean-Noël; Levine, Robert A; Kyndt, Florence; Probst, Vincent; Le Marec, Hervé; Schott, Jean-Jacques


    Aims: Filamin-A (FLNA) was identified as the first gene of non-syndromic mitral valve dystrophy (FLNA-MVD). We aimed to assess the phenotype of FLNA-MVD and its impact on prognosis. Methods and results: We investigated the disease in 246 subjects (72 mutated) from four FLNA-MVD families harbouring

  5. Evolution of Hutti-Maski greenstone belt of the Eastern Dharwar ...

    Indian Academy of Sciences (India)


    the Hutti-Maski greenstone belt have been studied by several workers (Iyer and Vasudev. 32. 1979 ..... In the present case it is clear that there is overgrowth of garnet on a. 246 core grain. ...... Mg) phase relations; Am. Jour. Science, 276 ...

  6. System to Repair Deformations in Elastomeric Hoses (United States)


    February 2017 The below identified patent application is available for licensing. Requests for information should be addressed to...thereon or therefore. CROSS REFERENCE TO OTHER PATENT APPLICATIONS [0002] This application claims priority to United States Patent Application No. 13...The following patents discuss different background art related to the subject matter discussed above: [0008] United State Patent No. 3,175,246

  7. Holt Oram syndrome: a registry-based study in Europe

    DEFF Research Database (Denmark)

    Barisic, Ingeborg; Boban, Ljubica; Greenlees, Ruth


    were reported in all cases. Agenesis/hypoplasia of radius was present in 49.2% (30/61), ulnar aplasia/hypoplasia in 24.6% (15/61) and humerus hypoplasia/phocomelia in 42.6% (26/61) of patients. Congenital heart defects (CHD) were recorded in 78.7% (48/61) of patients. Isolated septal defects were...

  8. First-principles calculations of structural, elastic and electronic properties of Ni(2)MnZ (Z = Al, Ga and In) Heusler alloys

    Czech Academy of Sciences Publication Activity Database

    Rached, H.; Rached, D.; Khenata, R.; Reshak, Ali H; Rabah, M.


    Roč. 246, č. 7 (2009), s. 1580-1586 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z60870520 Keywords : spin injection * magnetic order * temperature Subject RIV: BO - Biophysics Impact factor: 1.150, year: 2009

  9. 75 FR 40771 - Agency Information Collection Activities: Proposed Collection; Comment Request-Supplemental... (United States)


    ...) of Public Law 110-246, Food, Conservation, and Energy Act of 2008 (FCEA), renamed the Food Stamp... that participants no longer receive stamps or coupons to make food purchases and emphasizes the... Estimated Section of regulation Title Number (if Number of Report filed responses/ of man- total man- any...

  10. Structural Analysis of a Polysaccharide from Chlorella kessleri by Means of Gas Chromatography-Mass Spectrometry of Its Saccharide Alditols

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Sigler, Karel


    Roč. 52, č. 3 (2007), s. 246-252 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : gas chromatographic * chlorella kessleri * oligosaccharide Subject RIV: EE - Microbiology, Virology Impact factor: 0.989, year: 2007

  11. Encyklopedie těšínských učenců Leopolda Jana Šeršníka

    Czech Academy of Sciences Publication Activity Database

    Podavka, Ondřej


    Roč. 16, č. 2 (2015), s. 228-246 ISSN 1805-790X R&D Projects: GA ČR(CZ) GAP406/12/2254 Institutional support: RVO:67985955 Keywords : Leopold Jan Šeršník * historia litteraria * encyclopedias * Cieszyn Silesia * scholars Subject RIV: AB - History

  12. Learning Styles and Their Relationship to Stress and Coping in College Women (United States)

    Vaughn, L. M.; Hensley, B.; Baker, R. C.; Dearman, L.


    The authors examined the relationship between specific learning styles and stress and coping in a sample of female college students (N = 246). Participants in the study were assessed on the three variables by completing several self-report instruments measuring learning styles, life stress level, and coping skills. There were significant…

  13. A Comparison of Evidential Networks and Compositional Models

    Czech Academy of Sciences Publication Activity Database

    Vejnarová, Jiřina


    Roč. 50, č. 2 (2014), s. 246-267 ISSN 0023-5954 R&D Projects: GA ČR GA13-20012S Institutional support: RVO:67985556 Keywords : evidence theory * graphical models * conditional independence Subject RIV: BA - General Mathematics Impact factor: 0.541, year: 2014

  14. Nuclear magnetic resonance studies of the binding of nitroaromatic electron acceptors to lecithin

    International Nuclear Information System (INIS)

    Sidorowicz, A.


    It was found from the chemical shifts measurements of carbon-13 and proton resonances, that the phosphate group of lecithin forms charge-transfer complex with 2,4,6-trinitrophenol, but not with s-trinitrobenzene. The conclusion is, that hydrogen bond formed between phenolic OH proton and phosphate group of lecithin facilitates electron transfer process. (orig.)

  15. Characterization of plasma metabolites at late gestation and lactation in early parity sows on production and post-weaning reproductive performance (United States)

    Lactation is a very energy demanding period for sows. The current study provides a better understanding of the biochemical response of first- (n = 246) or second-parity (n = 127) sows during late gestation through lactation and assesses relationships with piglet production and dam reproductive perfo...

  16. Demographic Characteristics of Ghanaian Optometry Students and Factors Influencing Their Career Choice and Institution of Learning (United States)

    Boadi-Kusi, Samuel Bert; Kyei, Samuel; Mashige, Khathutshelo Percy; Abu, Emmanuel Kwasi; Antwi-Boasiako, Daniel; Halladay, Abraham Carl


    Optometry is only provided at tertiary level in two institutions in Ghana, with an average of 50 students graduating each year for a population of approximately 24.6 million. No information on the demography of optometry students and factors that influence their choice of optometry as a career and institution of learning is available. This…

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. Volume 17 Issue 3 March 2012 pp 236-246 General Article. Ancient Indian Mathematics - A Conspectus · S G Dani · More Details Fulltext PDF. Volume 17 Issue 9 September 2012 pp 824-846 General Article. India's Arrival on the Modern Mathematical Scene · S G Dani · More Details Fulltext PDF ...

  18. Investigating a Drop-on-Demand Microdispenser for Standardized Sample Preparation (United States)


    potassium chlorate were obtained from Sigma-Aldrich. 1,3,5-trinitro-1,3,5-triazine (RDX), octahydro-1,3,5,7- tetranitro-tetrazocine (HMX), 2,4,6... potassium chlorate , HMX, TNT, RDX, PETN, urea, and sugar. The analyte of interest was dissolved in the appropriate solvent and then diluted to various

  19. Antagonism of Taxol Cytotoxicity by Prolactin: Implication for Patient Resistance to Chemotherapy (United States)


    often occurs during adolescence . When both estrogen and PRL are elevated, men can have galactorrhea, or inap- propriate milk production (246, 275...Women treated with oral contraceptives or postmenopausal hormone replacement therapy do not have a higher inci- dence of prolactinomas. Statements on

  20. Biodegradation of 2,4-dichlorophenol originating from ...

    African Journals Online (AJOL)



    Jun 3, 2009 ... of high concentration of chlorophenols. Appl. Microbiol. Biotechnol. 59: 599-604. Louie TM, Webster CM, Xun L (2002). Genetic and biochemical characterization of a 2,4,6- trichlorophenol degradation pathway in. Ralstonia eutropha JMP 134. J. Bacteriol. 184: 3492-3500. Lysetska M, Knoll A, Boehringer D ...