WorldWideScience

Sample records for mendelevium 245

  1. Symposium commemorating the 25th anniversary of the discovery of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T. (ed.)

    1980-01-01

    The Symposium honoring the 25th Anniversary of the discovery of mendelevium was held at the Lawrence Berkeley Laboratory on March 28, 1980. The following three papers were presented: Chemical Properties of Mendelevium; Nuclear Properties of Mendelevium; and Radioactive Decay of Md Isotopes. Besides these papers there were introductory remarks, reminiscences, and concluding remarks.

  2. Studies on some physico-chemical properties of the monovalent mendelevium

    International Nuclear Information System (INIS)

    Kamenskaya, A.N.; Mikheev, N.B.; Novichenko, V.L.

    1979-01-01

    It was established that Md 3+ reduced by Yb 2+ or Eu 2+ co-crystallizes with NaCl in water-ethanol solutions. The co-crystallization coefficient is independent of the relative quantities of the solid and liquid phase, of the concentration of the reducing agent in the concentration range from 1 to 8 mg/ml, and of the concentration of the chloride ion in the solution. Basing on the knowledge of anomalous mixed crystals and on the thermodynamical analysis of the formation of truly isomorphical solid solutions and anomalous mixed crystals, it was shown that mendelevium co-crystallizing with NaCl is in its monovalent state. Besides, it was concluded that up to 1.5 M chloride concentration the monovalent mendelevium does not form stable chloride complexes in water-ethanol solutions. (author)

  3. 245 Zoopharmacognosy

    Indian Academy of Sciences (India)

    Sulochana Gadgil. GENERAL ARTICLES. 236 Wallace and Natural Selection, 1858. Sahotra Sarkar. 245 Zoopharmacognosy. Self-Medication in Wild Animals. Rajasekar Raman and Sripathi Kandula. FEATURE ARTICLE. 254 Molecule Matters. The Quinine Story: A 100-Year Saga. Vijay Nair and Sreekumar Vellalath. 245.

  4. Chemical properties of mendelevium

    Energy Technology Data Exchange (ETDEWEB)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10/sup 6/ atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md/sup 3 +/ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md/sup 2 +/ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md/sup 3 +/ with sodium bismuthate failed to show any evidence for Md/sup 4 +/; reduction potential of Md/sup 3 +/ was found to be close to -0.1 volt; Md/sup 3 +/ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md/sup 2 +/ + 2e/sup -/ = Md(Hg) and E/sup 0/ = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm/sup 2 +/.

  5. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-01-01

    The isotope 256 Md is nearly always employed for chemical studies of this element. This nuclide can be made by bombardment of fractions of a microgram of 254 Es with intense alpha-particle beams which will produce about 10 6 atoms of 256 Md with a half-life of 77 minutes. Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severly restricted the gathering and broadening of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with element found in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md wih sodium bismuthate failed to show any evidence of Md 4+ ; standard reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg), and E 0 = 1.5 V

  6. Chemical properties of mendelevium

    International Nuclear Information System (INIS)

    Hulet, E.K.

    1980-11-01

    Even with the most intense ion beams and the largest available quantities of target isotope, about 10 6 atoms at a time is all the Md that can be produced for chemical studies. This lack of sufficient sample size coupled with the very short lifetimes of the few atoms produced has severely restricted the gathering and the broadness of our knowledge concerning the properties of Md and the heavier elements. To illustrate, the literature contains a mere eleven references to the chemical studies of Md, and none of these deal with bulk properties associated with the element bound in solid phases. Some of these findings are: Md was found to be more volatile than other actinide metals which lead to the belief that it is divalent in the metallic state; separation of Md from the other actinides can be accomplished either by reduction of Md 3+ to the divalent state or by chromatographic separations with Md remaining in the tripositive state; extraction of Md 2+ with bis(2-ethylhexyl)phosphoric acid is much poorer than the extraction of the neighboring tripositive actinides; attempts to oxidize Md 3+ with sodium bismuthate failed to show any evidence for Md 4+ ; reduction potential of Md 3+ was found to be close to -0.1 volt; Md 3+ can be reduced to Md(Hg) by sodium amalgams and by electrolysis; the electrochemical behavior of Md is very similar to that of Fm and can be summarized in the equation, Md 2+ + 2e - = Md(Hg) and E 0 = -1.50 V.; and Md cannot be reduced to a monovalent ion with Sm 2+

  7. 8 CFR 245.6 - Interview.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interview. 245.6 Section 245.6 Aliens and... ADMITTED FOR PERMANENT RESIDENCE § 245.6 Interview. Each applicant for adjustment of status under this part shall be interviewed by an immigration officer. This interview may be waived in the case of a child...

  8. 8 CFR 245a.32 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 245a.32 Section 245a.32 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.32 Ineligible aliens. The...

  9. 43 CFR 24.5 - International agreements.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false International agreements. 24.5 Section 24.5 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.5 International agreements. (a) International conventions...

  10. 33 CFR 117.245 - Smyrna River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smyrna River. 117.245 Section 117.245 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.245 Smyrna River. The draw of the Delaware...

  11. 20 CFR 627.245 - Work experience.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Work experience. 627.245 Section 627.245... PROGRAMS UNDER TITLES I, II, AND III OF THE ACT Program Requirements § 627.245 Work experience. (a) Definition. Work experience means a short-term or part-time training assignment with a public or private...

  12. 24 CFR 245.120 - Meeting space.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of the...

  13. 48 CFR 245.7306 - Sales services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Sales services. 245.7306 Section 245.7306 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7306...

  14. 48 CFR 245.7302 - Competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Competitive sales. 245.7302 Section 245.7302 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7302...

  15. 32 CFR 245.27 - Data entry.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Data entry. 245.27 Section 245.27 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Under ESCAT § 245.27 Data entry. Aircraft will file IFR or VFR flight plans, assigned a discrete...

  16. 31 CFR 245.9 - Procedural instructions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Procedural instructions. 245.9... § 245.9 Procedural instructions. The Commissioner of the Financial Management Service may issue procedural instructions, implementing these regulations, in Volume I, Part 4 of the Treasury Financial Manual. ...

  17. 40 CFR 1033.245 - Deterioration factors.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Deterioration factors. 1033.245... CONTROLS CONTROL OF EMISSIONS FROM LOCOMOTIVES Certifying Engine Families § 1033.245 Deterioration factors. Establish deterioration factors for each pollutant to determine, as described in § 1033.240, whether your...

  18. 40 CFR 1042.245 - Deterioration factors.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Deterioration factors. 1042.245... Certifying Engine Families § 1042.245 Deterioration factors. This section describes how to determine deterioration factors for Category 1 and Category 2 engines, either with an engineering analysis, with pre...

  19. 8 CFR 245a.19 - Interviews.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interviews. 245a.19 Section 245a.19 Aliens... Interviews. (a) All aliens filing applications for adjustment of status with the Service under this section must be personally interviewed, except that the adjudicative interview may be waived for a child under...

  20. 48 CFR 245.7309-7 - Default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Default. 245.7309-7 Section 245.7309-7 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Default. If the successful Bidder fails to make full payment, remove property by the specified date, or...

  1. 40 CFR 86.245-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.245-94 Section 86.245-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  2. 48 CFR 245.7307-2 - Justification.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307-2... terminated research and development contracts with educational institutions; (2) No acceptable bids received.../agency will provide the contract administration office the sales justification and any special sales...

  3. 48 CFR 53.245 - Government property.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Government property. 53...) CLAUSES AND FORMS FORMS Prescription of Forms 53.245 Government property. The following forms are prescribed, as specified in this section, for use in reporting, reutilization, and disposal of Government...

  4. 49 CFR 199.245 - Contractor employees.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse Prevention Program § 199.245 Contractor employees. (a) With respect to those covered employees who are contractors or employed by a contractor, an operator may provide by contract that the alcohol testing...

  5. 24 CFR 245.115 - Protected activities.

    Science.gov (United States)

    2010-04-01

    ... tenants and tenant organizers to conduct the following activities related to the establishment or... offer information about tenant organizations; (6) Posting information on bulletin boards; (7) Assisting... housing projects covered under § 245.10, and their agents, must allow tenants and tenant organizers to...

  6. 48 CFR 245.7307-1 - General.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307-1 General. (a) Non-competitive sales include purchases or retention at less than cost by the contractor. (b) Non-competitive sales may be made when— (1) The contracting department/agency or the plant clearance...

  7. 24 CFR 245.5 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... IN MULTIFAMILY HOUSING PROJECTS General Provisions § 245.5 Purpose. The purpose of this part is to recognize the importance and benefits of cooperation and participation of tenants in creating a suitable living environment in multifamily housing projects and in contributing to the successful operation of...

  8. 7 CFR 245.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 245.1 Section 245.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... SCHOOLS § 245.1 General purpose and scope. (a) This part established the responsibilities of State...

  9. 32 CFR 245.6 - Abbreviations and acronyms.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Abbreviations and acronyms. 245.6 Section 245.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED... Abbreviations § 245.6 Abbreviations and acronyms. AADC—Area Air Defense Commander ADE—Air Defense Emergency ADIZ...

  10. 7 CFR 58.245 - Method of sample analysis.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Method of sample analysis. 58.245 Section 58.245... Procedures § 58.245 Method of sample analysis. Samples shall be tested according to the applicable methods of... Service, Dairy Programs, or Official Methods of Analysis of the Association of Analytical Chemists or...

  11. 48 CFR 245.608 - Screening of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Screening of contractor inventory. 245.608 Section 245.608 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Disposal of Contractor Inventory 245.608 Screening of contractor inventory. ...

  12. 48 CFR 245.7307 - Non-competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Non-competitive sales. 245.7307 Section 245.7307 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307...

  13. 49 CFR 192.245 - Repair or removal of defects.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Repair or removal of defects. 192.245 Section 192.245 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF...

  14. 7 CFR 245.10 - Action by local educational agencies.

    Science.gov (United States)

    2010-01-01

    ... by the school and of the proposed letter or notice to parents. (c) Each local educational agency... 7 Agriculture 4 2010-01-01 2010-01-01 false Action by local educational agencies. 245.10 Section... AND FREE MILK IN SCHOOLS § 245.10 Action by local educational agencies. (a) Each local educational...

  15. EPA Method 245.2: Mercury (Automated Cold Vapor Technique)

    Science.gov (United States)

    Method 245.2 describes procedures for preparation and analysis of drinking water samples for analysis of mercury using acid digestion and cold vapor atomic absorption. Samples are prepared using an acid digestion technique.

  16. 48 CFR 52.245-9 - Use and Charges.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Use and Charges. 52.245-9... Charges. As prescribed in 45.107(c), insert the following clause: Use and Charges (AUG 2010) (a... property. The Contractor may use the Government property without charge in the performance of— (1...

  17. 19 CFR 24.5 - Filing identification number.

    Science.gov (United States)

    2010-04-01

    ... TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.5 Filing identification number. (a) Generally..., the Social Security number. (2) If neither an Internal Revenue Service employer identification number nor a Social Security number has been assigned, the word “None” shall be written on the line provided...

  18. 32 CFR 245.18 - Transportation security operations center (TSOC).

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Transportation security operations center (TSOC... DEFENSE (CONTINUED) MISCELLANEOUS PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) Procedures for Implementation of ESCAT § 245.18 Transportation security operations center (TSOC). TSOC will...

  19. 48 CFR 245.7310-8 - Antitrust clearance.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-8... acceptance of its bid. Award shall be made only upon advice from the Department of Justice that the proposed sale would not create or maintain a situation inconsistent with the antitrust laws. ...

  20. 40 CFR 180.245 - Streptomycin; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Streptomycin; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.245 Streptomycin; tolerances for residues. (a) General. (1) Tolerances are established for...

  1. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... the major training exercises for reporting (MTERs), which include the Southeastern ASW Integrated... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Requirements for monitoring and reporting... Training (AFAST) § 216.245 Requirements for monitoring and reporting. (a) As outlined in the AFAST...

  2. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    Science.gov (United States)

    Fondi, Marco

    2014-01-01

    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmids encoded proteins; in this context a computational pipeline specifically devoted to the analysis and the visualization of the network-like evolutionary relationships among different plasmids molecules was developed. This information was supplemented with a detailed (in silico) functional characterization of both the connected (i.e., sharing homology with other sequences in the dataset) and the unconnected (i.e., not sharing homology) components of the network. Furthermore, the most likely source organism for each of the genes encoded by A. brasilense plasmids was checked, allowing the identification of possible trends of gene loss/gain in this microorganism. Data obtained provided a detailed description of the evolutionary landscape of the plasmids of A. brasilense Sp245, suggesting some of the molecular mechanisms responsible for the present-day structure of these molecules. PMID:25610702

  3. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    Directory of Open Access Journals (Sweden)

    Valerio Orlandini

    2014-01-01

    Full Text Available Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmids encoded proteins; in this context a computational pipeline specifically devoted to the analysis and the visualization of the network-like evolutionary relationships among different plasmids molecules was developed. This information was supplemented with a detailed (in silico functional characterization of both the connected (i.e., sharing homology with other sequences in the dataset and the unconnected (i.e., not sharing homology components of the network. Furthermore, the most likely source organism for each of the genes encoded by A. brasilense plasmids was checked, allowing the identification of possible trends of gene loss/gain in this microorganism. Data obtained provided a detailed description of the evolutionary landscape of the plasmids of A. brasilense Sp245, suggesting some of the molecular mechanisms responsible for the present-day structure of these molecules.

  4. 27 CFR 28.245 - Shipment to foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to foreign-trade zone. 28.245 Section 28.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Consignment § 28.245 Shipment to foreign-trade zone. Where distilled spirits (including specially denatured...

  5. 48 CFR 245.7311-2 - Safety, security, and fire regulations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Safety, security, and fire regulations. 245.7311-2 Section 245.7311-2 Federal Acquisition Regulations System DEFENSE ACQUISITION... Inventory 245.7311-2 Safety, security, and fire regulations. ...

  6. 48 CFR 252.245-7000 - Government-furnished mapping, charting, and geodesy property.

    Science.gov (United States)

    2010-10-01

    ... mapping, charting, and geodesy property. 252.245-7000 Section 252.245-7000 Federal Acquisition Regulations..., charting, and geodesy property. As prescribed in 245.107-70, use the following clause: Government-Furnished Mapping, Charting, and Geodesy Property (DEC 1991) (a) Definition—Mapping, charting, and geodesy (MC&G...

  7. 17 CFR 245.101 - Prohibition of insider trading during pension fund blackout periods.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Prohibition of insider trading during pension fund blackout periods. 245.101 Section 245.101 Commodity and Securities Exchanges...-Blackout Trading Restriction) § 245.101 Prohibition of insider trading during pension fund blackout periods...

  8. 48 CFR 245.610-4 - Contractor inventory in foreign countries.

    Science.gov (United States)

    2010-10-01

    ... equivalent in other currency at the official exchange rate, the Purchaser agrees to obtain the approval of... foreign countries. 245.610-4 Section 245.610-4 Federal Acquisition Regulations System DEFENSE ACQUISITION..., and Disposal of Contractor Inventory 245.610-4 Contractor inventory in foreign countries. (1) Normally...

  9. 48 CFR 1852.245-79 - Use of Government-owned property.

    Science.gov (United States)

    2010-10-01

    ...-owned facilities (real property or plant equipment), special test equipment, or special tooling... property. 1852.245-79 Section 1852.245-79 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.245-79 Use of Government-owned property. As prescribed in 1845.106-70(i), insert the...

  10. 48 CFR 245.7206 - Transmitting DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... Instructions 245.7206 Transmitting DD Form 1342, DoD Property Record. As a minimum, the plant clearance officer... contractor acquired the equipment; (g) Location of the industrial plant equipment; (h) Total acquisition cost..., DoD Property Record. 245.7206 Section 245.7206 Federal Acquisition Regulations System DEFENSE...

  11. 42 CFR 456.245 - Number of studies required to be performed.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Number of studies required to be performed. 456.245 Section 456.245 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.245 Number of studies required to be performed. The...

  12. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability.

  13. 27 CFR 24.245 - Use of carbon dioxide in still wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of carbon dioxide in still wine. 24.245 Section 24.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.245 Use of carbon dioxide in still wine. The...

  14. Comparing R1233zd And R245fa For Low Temperature ORC Applications

    OpenAIRE

    Datla, Bala V.; Brasz, Joost J.

    2014-01-01

    The majority of recently introduced ORC systems use R245fa as working fluid. The lower saturation pressures of R245fa versus R134a allowed the use of existing HVAC electric motors, compressors, evaporators and condensers after minor modifications as ORC electric generators, turbines/expanders, boilers and condensers. At elevated saturation temperatures R245fa turbine/expander equipment matches the power density of R134a HVAC compressors equipment. Refrigerants with still lower saturation pres...

  15. 20 CFR 411.245 - What are a PM's responsibilities under the Ticket to Work program?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What are a PM's responsibilities under the Ticket to Work program? 411.245 Section 411.245 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Use of One or More Program Managers To Assist in Administration of the Ticket to Work Program § 411.245...

  16. Simultaneous recovery of metals and degradation of organic species: copper and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T).

    Science.gov (United States)

    Chaudhary, Abdul J; Hassan, Mukhtar-ul; Grimes, Susan M

    2009-06-15

    In mixed wastewater streams, the presence of metal ions can retard the destruction of organic contaminants and the efficiency of recovery of the metal is reduced by the presence of organic species. The reduction in the efficiency of these methods is due to the formation of complexes between the organic species and the metal ions in solution. Results are presented for copper-2,4,5-T system in which both effects occur. A photolytic cell alone can achieve the complete degradation of 2,4,5-T, in the presence of TiO(2) or H(2)O(2), at pH 3.5. The addition of Cu(II) ions, however, retard the degradation of 2,4,5-T and complete mineralisation of 2,4,5-T was not achieved and the system also leaves Cu(II) ions in solution. An electrolytic cell alone can be used to recover copper in pH range 1.5-4.5 but is not capable of achieving complete disappearance of 2,4,5-T by anodic oxidation. A combined photolytic-electrolytic system is capable of achieving simultaneous destruction of 2,4,5-T and recovery of copper from mixed wastewater streams at pH 3.5. The percentage destruction of 2,4,5-T and the recovery of copper can be increased further by using a combined photolytic and an activated carbon concentrator cell system. This system can achieve the simultaneous recovery of copper and the degradation of 2,4,5-T without the use of an additional oxidants or catalysts.

  17. 8 CFR 245.11 - Adjustment of aliens in S nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in S nonimmigrant classification. 245.11 Section 245.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in S nonimmigrant classification. (a) Eligibility. An application on Form I-854, requesting that...

  18. 7 CFR 245.5 - Public announcement of the eligibility criteria.

    Science.gov (United States)

    2010-01-01

    ... educational agencywith respect to the application under the hearing procedure set forth in § 245.7. The letter... the State agency, or FNSRO where applicable, notifies the local educational agency (as defined in... and for free milk have been approved, the local educational agency (as defined in § 245.2) shall...

  19. 48 CFR 245.7311-1 - Sales and use tax liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Sales and use tax liability. 245.7311-1 Section 245.7311-1 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor...

  20. 48 CFR 1852.245-70 - Contractor requests for Government-owned equipment.

    Science.gov (United States)

    2010-10-01

    ... the equipment and the reasons why contractor-owned property cannot be used, citing the applicable FAR... 1419, DOD Industrial Plant Equipment Requisition, or equivalent format, for each item requested and (ii... Government-owned equipment. 1852.245-70 Section 1852.245-70 Federal Acquisition Regulations System NATIONAL...

  1. 8 CFR 245a.5 - Temporary disqualification of certain newly legalized aliens from receiving benefits from...

    Science.gov (United States)

    2010-01-01

    ... of the Act only, assistance furnished under the Legal Services Corporation Act (42 U.S.C. 2996, et... SECTION 245A OF THE IMMIGRATION AND NATIONALITY ACT Immigration Reform and Control Act of 1986 (IRCA... pursuant to section 245A of the Act (Adjustment of Status of Certain Entrants Before January 1, 1982, to...

  2. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... classification. 245.23 Section 245.23 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... waiver; (iii) The biometric services fee prescribed by 8 CFR 103.7(b)(1) or an application for a fee... child, or multiple drug-related crimes, or where there are security- or terrorism-related concerns. (f...

  3. 8 CFR 245.24 - Adjustment of aliens in U nonimmigrant status.

    Science.gov (United States)

    2010-01-01

    ... status. 245.24 Section 245.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... instructions; (2) The fee prescribed in 8 CFR 103.7(b)(1) or an application for a fee waiver; (3) The biometric... where there are security- or terrorism-related concerns. (e) Continued assistance in the investigation...

  4. CLONING AND CHARACTERIZATION OF A CHROMOSOMAL DNA REGION REQUIRED FOR GROWTH ON 2,4,5-T BY PSEUDOMONAS CEPACIA AC1100

    Science.gov (United States)

    A series of spontaneous 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) nonmetabolizing mutants of Pseudomonas cepacia AC1100 were characterized to be defective in either 2,4,5-T uptake or conversion of this compound to 2,4,5-trichlorophenol (2,4,5-TCP). Two of these mutants, RHC22 a...

  5. FTIR spectroscopic study of biofilms formed by the rhizobacterium Azospirillum brasilense Sp245 and its mutant Azospirillum brasilense Sp245.1610

    Science.gov (United States)

    Tugarova, Anna V.; Scheludko, Andrei V.; Dyatlova, Yulia A.; Filip'echeva, Yulia A.; Kamnev, Alexander A.

    2017-07-01

    Biofilms are spatially and metabolically structured communities of microorganisms, representing a mode of their existence which is ubiquitous in nature, with cells localised within an extracellular biopolymeric matrix, attached to each other, at an interface. For plant-growth-promoting rhizobacteria (PGPR), the formation of biofilms is of special importance due to their primary localisation at the surface of plant root systems. In this work, FTIR spectroscopy was used, for the first time for bacteria of the genus Azospirillum, to comparatively study 6-day-mature biofilms formed on the surface of ZnSe discs by the rhizobacterium Azospirillum brasilense Sp245 and its mutant A. brasilense Sp245.1610. The mutant strain, having an Omegon Km insertion in the gene of lipid metabolism fabG1 on the plasmid AZOBR_p1, as compared to the wild-type strain Sp245 (see http://dx.doi.org/10.1134/S1022795413110112)

  6. 8 CFR 245.21 - Adjustment of status of certain nationals of Vietnam, Cambodia, and Laos (section 586 of Public...

    Science.gov (United States)

    2010-01-01

    ... of Vietnam, Cambodia, and Laos (section 586 of Public Law 106-429). 245.21 Section 245.21 Aliens and... ADMITTED FOR PERMANENT RESIDENCE § 245.21 Adjustment of status of certain nationals of Vietnam, Cambodia... that of a lawful permanent resident, a native or citizen of Vietnam, Cambodia, or Laos who: (1) Was...

  7. 48 CFR 245.606-70 - Instructions for completing DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... PROPERTY Reporting, Redistribution, and Disposal of Contractor Inventory 245.606-70 Instructions for completing DD Form 1342, DoD Property Record. (a) The contractor shall list excess industrial plant equipment... completing DD Form 1342, DoD Property Record. 245.606-70 Section 245.606-70 Federal Acquisition Regulations...

  8. First results of the 2.45 GHz Oshima electron cyclotron resonance ion source

    Energy Technology Data Exchange (ETDEWEB)

    Asaji, T., E-mail: asaji@nc-toyama.ac.jp [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan); Nakamura, T.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Hitobo, T. [Tateyama Machine Co., Ltd., 30 Shimonoban, Toyama 930-1305 (Japan); Uchida, T. [Graduate School of Engineering, Toyo University, 2100 Kujirai, Kawagoe, Saitama 350-8585 (Japan); Muramatsu, M. [National Institute of Radiological Sciences (NIRS), 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Kato, Y. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka 565-0871 (Japan)

    2016-02-15

    A new electron cyclotron resonance ion source has been constructed at Oshima College with a 2.45 GHz magnetron microwave source and permanent magnets employed as the main components. In addition, a solid-state power amplifier with a frequency range of 2.5–6.0 GHz was installed to study two-frequency plasma heating. Three solenoid coils were set up for adjusting the axial magnetic fields. Argon plasma generation and ion beam production have been conducted during the first year of operation. Ion current densities in the ECR plasma were measured using a biased disk. For 2.45 and 4.65 GHz two-frequency plasma heating, the ion density was approximately 1.5 times higher than that of 2.45 GHz single-frequency heating.

  9. 48 CFR 1852.245-73 - Financial reporting of NASA property in the custody of contractors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Financial reporting of NASA... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.245-73 Financial reporting of NASA property in the custody of contractors. As prescribed in 1845.106-70(d), insert the following clause: Financial Reporting...

  10. 26 CFR 1.245-1 - Dividends received from certain foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Special Deductions for Corporations § 1.245-1 Dividends... gross income of the foreign corporation from all sources is effectively connected for that year with the... section, the principles of paragraph (a) of § 1.316-2 shall apply. A dividend shall be considered to be...

  11. 2,4,5-trihydroxy-3-methylacetophenone: A cellulosic chromophore as a case study of aromaticity

    Science.gov (United States)

    Nele Sophie Zwirchmayr; Thomas Elder; Markus Bacher; Andreas Hofinger-Horvath; Paul Kosma; Thomas. Rosenau

    2017-01-01

    The title compound (2,4,5-trihydroxy-3-methylacetophenone, 1) was isolated as chromophore from aged cellulosic pulps. The peculiar feature of the compound is its weak aromatic system that can be converted into nonaromatic (quinoid or cyclic aliphatic) tautomers, depending on the conditions and reaction partners. In alkaline media, the participation of quinoid canonic...

  12. 40 CFR 1045.245 - How do I determine deterioration factors from exhaust durability testing?

    Science.gov (United States)

    2010-07-01

    ... PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM SPARK-IGNITION PROPULSION MARINE ENGINES AND VESSELS Certifying Engine Families § 1045.245 How do I determine deterioration factors... measure emissions from the emission-data engine at a low-hour test point and the end of the useful life...

  13. Effects of 2.45 GHz Radiofrequency Radiation Exposures on Normal ...

    African Journals Online (AJOL)

    sickle cell patients. Blood samples were collected for analysis before and after being irradiated with a 2.45 GHz radiofrequency source. The osmotic fragility of the red blood cells, the packed cell volume and percentage haemolysis for irreversibly ...

  14. A novel polymeric catalyst for the one-pot synthesis of 2,4,5-triaryl ...

    Indian Academy of Sciences (India)

    Abstract. An efficient synthesis of 2,4,5-trisubstituted imidazoles is achieved by three component cyclo- condensation of benzil or benzoin, aldehyde and ammonium acetate by using novel polymeric catalyst. [poly(AMPS-co-AA)] under solvent-free conditions. The key advantages of this process are high yields, shorter.

  15. 48 CFR 752.245-70 - Government property-USAID reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government property-USAID... Clauses 752.245-70 Government property—USAID reporting requirements. In response to a GAO audit recommendation, USAID contracts, except for those for commercial items, must contain the following preface and...

  16. 46 CFR 199.245 - Survival craft embarkation and launching arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft embarkation and launching arrangements... Passenger Vessels § 199.245 Survival craft embarkation and launching arrangements. (a) Each davit-launched liferaft must be arranged to be rapidly boarded by its full complement of persons. (b) All survival craft...

  17. 7 CFR 245.4 - Exceptions for Puerto Rico and the Virgin Islands.

    Science.gov (United States)

    2010-01-01

    ... criteria. Instead, such State agencies may use a statistical survey to determine the number of children....4 Section 245.4 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS DETERMINING ELIGIBILITY FOR FREE AND...

  18. 48 CFR 245.7101-2 - DD Form 1149, Requisition and Invoice Shipping Document.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Plant Clearance Forms 245.7101-2 DD Form 1149, Requisition and Invoice Shipping Document. Use for transfer and donation of contractor inventory. Donations of industrial plant equipment may be shipped via...

  19. short communication one-pot synthesis of 2,4,5-trisubstituted

    African Journals Online (AJOL)

    L-Proline: An efficient catalyst for the one-pot synthesis of 2,4,5-trisubstituted and 1,2,4,5- tetrasubstituted imidazoles. Tetrahedron 2009, 65, 10155-10161. 9. (a) Balalaei, S.; Arabanian, A. One-pot synthesis of tetrasubstituted imidazoles catalyzed by zeolite HY and silica gel under microwave irradiation. Green Chem. 2000 ...

  20. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    ... disorganization in the testis of exposed group with increasing SARs. These results suggest that MW radiation has the potential to affect both male and female fertility adversely. Keywords: 2.45 GHz microwave radiation, histopathology, DNA single strand break, ovary, testis. African Journal of Biotechnology Vol. 12(2), pp.

  1. 5 CFR 531.245 - Computing locality rates and special rates for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Computing locality rates and special... Gm Employees § 531.245 Computing locality rates and special rates for GM employees. Locality rates and special rates are computed for GM employees in the same manner as locality rates and special rates...

  2. Electrochemical oxidation of 2,4,5-trichlorophenoxyacetic acid by metal-oxide-coated Ti electrodes.

    Science.gov (United States)

    Maharana, Dusmant; Xu, Zesheng; Niu, Junfeng; Rao, Neti Nageswara

    2015-10-01

    Electrochemical oxidation of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) over metal-oxide-coated Ti anodes, i.e., Ti/SnO2-Sb/Ce-PbO2, Ti/SnO2-Sb and Ti/RuO2, was examined. The degradation efficiency of over 90% was attained at 20 min at different initial concentrations (0.5-20 mg L(-1)) and initial pH values (3.1-11.2). The degradation efficiencies of 2,4,5-T on Ti/SnO2-Sb/Ce-PbO2, Ti/SnO2-Sb and Ti/RuO2 anodes were higher than 99.9%, 97.2% and 91.5% at 30 min, respectively, and the respective total organic carbon removal ratios were 65.7%, 54.6% and 37.2%. The electrochemical degradation of 2,4,5-T in aqueous solution followed pseudo-first-order kinetics. The compounds, i.e., 2,5-dichlorohydroquinone and 2,5-dihydroxy-p-benzoquinone, have been identified as the main aromatic intermediates by liquid chromatography-mass spectrometry. The results showed that the energy efficiencies of 2,4,5-T (20 mg L(-1)) degradation with Ti/SnO2-Sb/Ce-PbO2 anode at the optimal current densities from 2 to 16 mA cm(-2) ranged from 8.21 to 18.73 kWh m(-3). Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. High-Frequency Wireless Communications System: 2.45-GHz Front-End Circuit and System Integration

    Science.gov (United States)

    Chen, M.-H.; Huang, M.-C.; Ting, Y.-C.; Chen, H.-H.; Li, T.-L.

    2010-01-01

    In this article, a course on high-frequency wireless communications systems is presented. With the 145-MHz baseband subsystem available from a prerequisite course, the present course emphasizes the design and implementation of the 2.45-GHz front-end subsystem as well as system integration issues. In this curriculum, the 2.45-GHz front-end…

  4. Evaluation of various tests for the diagnosis of soil contamination by 2,4,5-trichlorophenol (2,4,5-TCP)

    International Nuclear Information System (INIS)

    Bello, D.; Trasar-Cepeda, C.; Leiros, M.C.; Gil-Sotres, F.

    2008-01-01

    Soil response to contamination with 2,4,5-triclorophenol was studied to test the validity of the concept of Generic Reference Levels (GRL), the main criterion used to define soil contamination. Soil samples were artificially contaminated with doses between 0 and 5000 mg kg -1 of 2,4,5-triclorophenol, and analysed by various tests. Where possible, the response of soils to the contaminant was modelled by a sigmoidal dose-response curve in order to estimate the ED 50 values. The tests provided different responses, but only microbial biomass-C and dehydrogenase and urease activities demonstrated soil deterioration in response to contamination. The results suggest that the diagnosis of soil contamination has been greatly simplified in the legislation by the provision of a single figure for each compound, and that the GRL concept could perhaps be substituted by measurement of ED 50 values, which better reflect the alteration of a soil due to the presence of a xenobiotic substance. - The concentration of a toxic substance present in a soil cannot be considered as the only criteria to classify such soil as contaminated

  5. Preparation of miniantibodies to Azospirillum brasilense Sp245 surface antigens and their use for bacterial detection.

    Science.gov (United States)

    Dykman, Lev A; Staroverov, Sergei A; Guliy, Olga I; Ignatov, Oleg V; Fomin, Alexander S; Vidyasheva, Irina V; Karavaeva, Olga A; Bunin, Viktor D; Burygin, Gennady L

    2012-01-01

    This article reports the first preparation of miniantibodies to Azospirillum brasilense Sp245 surface antigens by using a combinatorial phage library of sheep antibodies. The prepared phage antibodies were used for the first time for lipopolysaccharide and flagellin detection by dot assay, electro-optical analysis of cell suspensions, and transmission electron microscopy. Interaction of A. brasilense Sp245 with antilipopolysaccharide and antiflagellin phage-displayed miniantibodies caused the magnitude of the electro-optical signal to change considerably. The electro-optical results were in good agreement with the electron microscopic data. This is the first reported possibility of employing phage-displayed miniantibodies in bacterial detection aided by electro-optical analysis of cell suspensions.

  6. Indoor Propagation Measurement for WLAN Systems Operating in 2.45 GHz ISM Band

    Directory of Open Access Journals (Sweden)

    P. Pechac

    2002-12-01

    Full Text Available For a planning of indoor Wireless LAN systems working in the ISMband, the signal propagation prediction is needed. In this article, themeasurement campaign based on two types of measurements at 2.45 GHz isintroduced. The first type of the measurement was a classicalnarrowband signal level measurement within indoor scenario withoutpresence of people. The aim of this measurement was to find empiricalparameters for COST231 Multi-Wall and One-Slope models. In order tostatistically describe the time varying nature of the received envelopeof the signal, at WLAN 2.45 GHz band, the second part of measurementcampaign was accomplished. In this case, the signal level was measuredusing commercial WLAN PCMCIA cards in two notebooks. Probabilitydensity functions and corresponding cumulative distribution functionswere set and discussed based on the specific locations and orientationof one of the notebooks. Results from both measurement campaigns werecompared and conclusions are drawn for the needs of practical planningof indoor WLAN systems coverage.

  7. Effects of lindane, paraquat, toxaphene, and 2,4,5-trichlorophenoxyacetic acid on mallard embryo development

    Science.gov (United States)

    Hoffman, D.J.; Eastin, W.C.

    1982-01-01

    The effects were determined of externally treating mallard (Anas platyrhynchos) eggs with two insecticides (lindane and toxaphene) and two herbicides (paraquat and 2,4,5-T) with formulations and concentrations similar to field applications. Paraquat was the most embryotoxic of the four compounds regardless of the type of vehicle. The LC50 for paraquat was 1.5 lb of active ingredient/ acre in aqueous emulsion and 0.1 lb/acre in the oil vehicle. The other compounds had LC50's that were several orders of magnitude higher. Both paraquat and toxaphene caused some mortality at 1/2 of the field level of application. Paraquat impaired growth and was slightly teratogenic at 1/2 of the field level of application, but required higher concentrations (1.5 to 3 times the field level) to produce brain and visceral defects. Lindane was teratogenic, resulting in multiple defects but only at doses that were greater than five times the field level of application. Toxaphene resulted in defects of the joints at doses close to or exceeding the LC50. The herbicide 2,4,5-T resulted in few toxic effects and relatively few abnormal survivors with gross defects. The overall embryotoxicity with either vehicle was paraquat > lindane > toxaphene > 2,4,5-T on a lb per acre basis. However the potential hazard at exposures of up to five times the field level of application was paraquat > toxaphene; neither lindane nor 2,4,5-T constituted much of a hazard. Both paraquat and lindane were more toxic on a lb-peracre basis when administered in oil vehicle but only paraquat represented a potential hazard at five times the field level of application.

  8. Structure, magnetic order and excitations in the 245 family of Fe-based superconductors

    OpenAIRE

    Bao, Wei

    2014-01-01

    Elastic neutron scattering simultaneously probes both the crystal structure and magnetic order in a material. Inelastic neutron scattering measures phonons and magnetic excitations. Here, we review the average composition, crystal structure and magnetic order in the 245 family of Fe-based superconductors and in related insulating compounds from neutron diffraction works. A three-dimensional phase-diagram summarizes various structural, magnetic and electronic properties as a function of the sa...

  9. Photometric anomalies in the metal-deficient red giants, BD -18 deg 5550 and CD -38 deg 245

    Energy Technology Data Exchange (ETDEWEB)

    Twarog, B.A.; Anthony-Twarog, B.J. (Kansas Univ., Lawrence (USA) Obsevatorio Interamericano de Cerro Tololo, La Serena (Chile))

    1991-01-01

    Three distinct anomalies affecting the red giants CD -38 deg 245 and BD -18 deg 5550 are examined with reference to new uvby photometry data for metal-deficient red giants. In particular, it is demonstrated that shortward of 4200 A, CD -38 deg 245 exhibits an ultraviolet deficiency for a star of its temperature when compared with stars of higher metallicity. In contrast, BD -18 deg 5550 may contain an ultraviolet excess. Another problem is that CD -38 deg 245 is a variable star in the ultraviolet. Possible explanations for these anomalies are considered. 62 refs.

  10. 49 CFR 40.245 - What is the procedure for an alcohol screening test using a saliva ASD or a breath tube ASD?

    Science.gov (United States)

    2010-10-01

    ... Alcohol Screening Tests § 40.245 What is the procedure for an alcohol screening test using a saliva ASD or... 49 Transportation 1 2010-10-01 2010-10-01 false What is the procedure for an alcohol screening test using a saliva ASD or a breath tube ASD? 40.245 Section 40.245 Transportation Office of the...

  11. CHARACTERIZATION AND NUCLEOTIDE SEQUENCE DETERMINATION OF A REPEAT ELEMENT ISOLATED FROM A 2,4,5,-T DEGRADING STRAIN OF PSEUDOMONAS CEPACIA

    Science.gov (United States)

    Pseudomonas cepacia strain AC1100, capable of growth on 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), was mutated to the 2,4,5-T− strain PT88 by a ColE1 :: Tn5 chromosomal insertion. Using cloned DNA from the region flanking the insertion, a 1477-bp sequence (designated RS1100) wa...

  12. BIODEGRATION OF 2,4,5-TRICHLOROPHENOXYACETIC ACID IN LIQUID CULTURE AND IN SOIL BY THE WHITE ROT FUNGUS PHANEROCHAETE CHRYSOSPORIUM

    Science.gov (United States)

    Extensive biodegradation of [14C]-2,4,5-trichlorophenoxyacetic acid ([[14C]-2,4,5-T) by the white rot fungus Phanerochaete chrysosporium was demonstrated in nutrient nitrogen-limited aqueous cultures and in [14C]-2,4,5-T-contaminated soil inoculat...

  13. Characterization of 2,4-dichlorophenoxyacetic acid and 2,4,5-trichlorophenoxyacetic acid-degrading fungi in Vietnamese soils.

    Science.gov (United States)

    Itoh, Kazuhito; Kinoshita, Masahiro; Morishita, Shigeyuki; Chida, Masateru; Suyama, Kousuke

    2013-04-01

    Sixty-nine fungal strains were isolated countrywide from 10 Vietnamese soils, in areas both with and without a history of exposure to Agent Orange, and their degrading activities on the phenoxy acid herbicides 2,4-dichlorophenoxyacetic acid (2,4-D) and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), as well as related compounds, were examined. Among taxonomically various fungi, 45, 12 and 4% of the isolates degraded phenoxyacetic acid (PA), 2,4-D and 2,4,5-T, respectively. While the PA-degrading fungi were distributed to all sites and among many genera, the 2,4-D-degraders were found only in order Eurotiales in class Eurotiomycetes. All of the 2,4,5-T-degrading fungal strains were phylogenetically close to Eupenicillium spp. and were isolated from southern Vietnam. As a degradation intermediate, the corresponding phenol compounds were detected in some strains. The degradation substrate spectrum for 26 compounds of Eupenicillium spp. strains including 2,4,5-T-degraders and -non-degraders seemed to be related to phylogenetic similarity and soil sampling location of the isolates. These results suggest that the heavily contaminated environments enhanced the adaptation of the phylogenetic group of Eupenicillium spp. toward to obtain the ability to degrade 2,4,5-T. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  14. The Influence of Irganox 245 on Crystallinity and Mechanics Stability of Polypropylene-Natural Rubber Poly blends

    International Nuclear Information System (INIS)

    Mashuri; Kristiawan Setia; Darminto; Aloma KK; Sudirman

    2008-01-01

    The influence of irganox 245 on crystallinity and mechanics stability of polyethylene (PP)- Natural Rubber (NR) poly blends exposure by sunlight for 12 weeks has been studied. For optimalization of antioxidant function to reduce oxidation in PP-NR (4:1) poly blends irganox 245 with variation concentration of 4 %, 6 %, 8 % and 10 % vol were added. Poly blends was made by blending method at 170 o C for 10 minutes with form an 30 rpm. The result showed that irganox 245 could not increasing adhesion at the interface between PP-NR, so PP-NR still immiscible blends. The optimal concentrations of irganox 245 as antioxidant on PP-NR poly blends is 8 % vol. PP-NR-irganox 245 8 % vol have decreasing tensile strength up to 6 % and increasing elongation at break up to 50 % in exposure by sunlight at long time 8 weeks but for 12 weeks tensile strength and elongation at break very weaks. Crystallinity and mechanics stability of PP-NR-irganox 245 8 % vol better than PP-NR poly blends, it is showed by slowly defects and decreasing crystallinity up to 9 % for exposure 12 weeks. (author)

  15. [Isolation and purification of Mn-peroxidase from Azospirillum brasilense Sp245].

    Science.gov (United States)

    Kupriashina, M A; Selivanov, N Iu; Nikitina, V E

    2012-01-01

    Homogenous Mn-peroxidase of a 26-fold purity grade was isolated from a culture of Azospirillum brasilense Sp245 cultivated on a medium containing 0.1 mM pyrocatechol. The molecular weight of the enzyme is 43 kD as revealed by electrophoresis in SDS-PAAG. It was shown that the use of pyrocatechol and 2,2'-azino-bis(3-ethylbenzotiazoline-6-sulfonate) at concentrations of 0.1 and I mM as inductors increased the Mn-peroxidase activity by a factor of 3.

  16. Development of a 2.45GHz compact higher order mode ECR ion source

    International Nuclear Information System (INIS)

    Tojyo, E.; Ohshiro, Y.; Oyaizu, M.; Shirakabe, Y.

    1991-10-01

    A new type of a compact ECR ion source has been designed and is being manufactured. It uses 2.45 GHz microwave frequency and has enough field strength to be operated at second harmonic mode in addition to the fundamental one. The most remarkable feature of this source is that it is made of permanent magnets only ; The required axial field had been realized by use of 'mirror-field forming flanges' which are constructed by many rectangular magnets. We report this feature, the design parameters and the field configurations of the source. (author)

  17. Structure, magnetic order and excitations in the 245 family of Fe-based superconductors

    Science.gov (United States)

    Bao, Wei

    2015-01-01

    Elastic neutron scattering simultaneously probes both the crystal structure and magnetic order in a material. Inelastic neutron scattering measures phonons and magnetic excitations. Here, we review the average composition, crystal structure and magnetic order in the 245 family of Fe-based superconductors and in related insulating compounds from neutron diffraction works. A three-dimensional phase-diagram summarizes various structural, magnetic and electronic properties as a function of the sample composition. A high pressure phase diagram for the superconductor is also provided. Magnetic excitations and the theoretic Heisenberg Hamiltonian are provided for the superconductor. Issues for future works are discussed.

  18. Structure, magnetic order and excitations in the 245 family of Fe-based superconductors.

    Science.gov (United States)

    Bao, Wei

    2015-01-21

    Elastic neutron scattering simultaneously probes both the crystal structure and magnetic order in a material. Inelastic neutron scattering measures phonons and magnetic excitations. Here, we review the average composition, crystal structure and magnetic order in the 245 family of Fe-based superconductors and in related insulating compounds from neutron diffraction works. A three-dimensional phase-diagram summarizes various structural, magnetic and electronic properties as a function of the sample composition. A high pressure phase diagram for the superconductor is also provided. Magnetic excitations and the theoretic Heisenberg Hamiltonian are provided for the superconductor. Issues for future works are discussed.

  19. Resolved 24.5 micron emission from massive young stellar objects

    Science.gov (United States)

    de Wit, W. J.; Hoare, M. G.; Fujiyoshi, T.; Oudmaijer, R. D.; Honda, M.; Kataza, H.; Miyata, T.; Okamoto, Y. K.; Onaka, T.; Sako, S.; Yamashita, T.

    2009-01-01

    Context: Massive young stellar objects (MYSO) are surrounded by massive dusty envelopes, whose physical structure and geometry are determined by the star formation process. Aims: Our principal aim is to establish the density structure of MYSO envelopes on scales of ~1000 AU. This constitutes an increase of a factor ~10 in angular resolution compared to similar studies performed in the (sub)mm. Methods: We have obtained diffraction-limited (0.6´´) 24.5 μm images (field of view of 40 arcsec×30 arcsec) of 14 well-known massive star formation regions with the COMICS instrument mounted on the 8.2 m Subaru telescope. We construct azimuthally averaged intensity profiles of the resolved MYSO envelopes and build spectral energy distributions (SEDs) from archival data and the COMICS 24.5 μm flux density. The SEDs range from near-infrared to millimeter wavelengths. Self-consistent 1-D radiative transfer models described by a density dependence of the form n(r) ∝ r-p are used to simultaneously compare the intensity profiles and SEDs to model predictions. Results: The images reveal the presence of discrete MYSO sources which are resolved on arcsecond scales, and, to first-order, the observed emission is circular on the sky. For many sources, the spherical models are capable of satisfactorily reproducing the 24.5 μm intensity profile, the 24.5 μm flux density, the 9.7 μm silicate absorption feature, and the submm emission. They are described by density distributions with p =1.0±0.25. Such distributions are shallower than those found on larger scales probed with single-dish (sub)mm studies. Other sources have density laws that are shallower/steeper than p=1.0 and there is evidence that these are viewed near edge-on or near face-on respectively. In these cases spherical models fail to provide good fits to the data. The images also reveal a diffuse component tracing somewhat larger scale structures, particularly visible in the regions S 140, AFGL 2136, IRAS 20126

  20. The Effect of 2.45 GHz Microwave Radiation on Brain Cell Apoptosis in Sprague Dawley Rats

    International Nuclear Information System (INIS)

    Wan Saffiey Wan Abdullah; Rozaimah Abdul Rahim; Zulkifli Yusof

    2016-01-01

    Microwave radiation is a part of non-ionizing electromagnetic radiations present in the environment and is now being perceived as health risks. The study was performed to investigate the effect of 2.45 GHz microwave radiation on brain cell apoptosis in Sprague Dawley rat. In the research done, 32 Sprague Dawley rat were used and divided into four groups; control group, G1 (1 month exposure), G2 (2 months exposure) and G3 (3 months exposure). The presence of apoptotic activity in control group was compared molecularly with exposed group through DNA ladder test. Each exposed group were irradiated in GTEM cell at frequency of 2.45 GHz located at RF/ MW laboratory. There was presence of necrotic instead of apoptotic activity in brain cell and increase in weight of Sprague Dawley rat. Therefore the effect of 2.45GHz microwave radiation shown no presence of apoptosis and increase in weight of Sprague Dawley rat. (author)

  1. A Alexander von Humboldt, el Ciudadano Universal, en su natalicio 245

    Directory of Open Access Journals (Sweden)

    José Leonardo De Sousa

    2018-04-01

    Full Text Available Hace 245 años, en la escala del tiempo del planeta, Alexander von Humboldt vislumbró la luz de la vida el día 14 de septiembre de 1769. A nuestro entender fue el máximo y, quizás, uno de los últimos exponentes de ese movimiento del Enciclopedismo Europeo conocido como la Ilustración . Tal fue su contribución al conocimiento integral del territorio americano que fue calificado por el Libertador Simón Bolívar como el “ descubridor científico del Nuevo Mundo ” y declarado como Ciudadano Mexicano, en 1827, por Guadalupe Victoria (primer presidente de México y luego, como Benemérito de la Patria por el presidente mexicano Benito Juárez.

  2. Generation and heating of toroidally confined overdense plasmas with 2.45 GHz microwaves

    Energy Technology Data Exchange (ETDEWEB)

    Koehn, A; Birkenmeier, G; Holzhauer, E; Ramisch, M; Stroth, U, E-mail: koehn@ipf.uni-stuttgart.d [Institut fuer Plasmaforschung, Universitaet Stuttgart, 70569 Stuttgart (Germany)

    2010-03-15

    In the stellarator TJ-K, overdense low-temperature plasmas are created by means of microwaves at 2.45 GHz. Extensive studies have been carried out to understand the heating process. The plasma breakdown at the cyclotron resonance layer has been directly observed with a multiple Langmuir probe array. Profile measurements indicate power deposition at the plasma boundary, where the upper hybrid resonance (UHR) is located. This result is confirmed by full-wave simulations which emphasize the importance of the vacuum vessel to increase the absorbed microwave power due to multiple reflections. Further indications for heating at the UHR layer are found by measurements of the wave electric field of the incident microwave and by power-modulation experiments. In contrast to similar experiments, no indication for heating by electron Bernstein waves was found.

  3. Distribution of luminous stars at (1,b) = (245/sup 0/,0/sup 0/) in Puppis

    Energy Technology Data Exchange (ETDEWEB)

    Reed, B.C.; Fitzgerald, M.P. (Waterloo Univ., Ontario (Canada). Dept. of Physics)

    1984-11-01

    Spectroscopic and photometric parallaxes are presented for 108 O-B5 stars (V=<12.5) in the vicinity of (l,b)=(245/sup 0/,0/sup 0/). The galactic plane as defined by these stars is found to be essentially flat to R>=15 kpc (galactocentric; R/sub 0/=10 kpc), in agreement with the distribution of neutral hydrogen. The stellar density distribution of O-BO stars is found to consist of an inter-arm region for r<=2.8 kpc, followed by a rise to a peak density of approx. 100 stars kpc/sup -3/ at r=3 kpc (R=11.7 kpc), declining exponentially thereafter with a scale length in R of 1.6 +- 0.1 kpc, or greater. There is no evidence for the existence of Puppis OB1 or OB2.

  4. On-body and off-body 2.45 GHz MIMO communications for hearing instrument applications

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Medina, Pablo F.; Thaysen, Jesper

    2013-01-01

    MIMO diversity antennas have been investigated for 2.45 GHz on-body and off-body hearing instrument communication links in an indoor environment. The 2 × 2 antenna setup consists of crossed, linearly polarized antennas. The measured results were treated as a four-branch diversity system. Diversit...... for line-of-sight and non-line-of-sight, respectively....

  5. On-Body and Off-Body 2.45 GHz MIMO Communications for Hearing Instrument Applications

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Medina, Pablo F.; Thaysen, Jesper

    2013-01-01

    MIMO diversity antennas have been investigated for 2:45 GHz on-body and off-body hearing instrument communication links in an indoor environment. The 2 2 antenna setup consists of crossed, linearly polarized antennas. The measured results were treated as a four-branch diversity system. Diversity ...... for lineof-sight and non-line-of-sight, respectively....

  6. Comparative study of electrochemical oxidation of herbicide 2,4,5-T: Kinetics, parametric optimization and mineralization pathway

    Directory of Open Access Journals (Sweden)

    Hicham Zazou

    2017-01-01

    Full Text Available Oxidative degradation of herbicide 2,4,5-T was studied by electrochemical advanced oxidation processes anodic oxidation and electro-Fenton (EF using Pt/carbon felt and BDD/carbon felt cells. The effect of main operating parameters on oxidation of 2,4,5-T and mineralization of its aqueous solution were investigated. The rate constant for oxidation of 2,4,5-T by ·≡OH was determined as (3.7 ± 0.2 × 109 M−1 s−1 using competition kinetics method. The EF process with BDD anode was shown to be very efficient reaching 94% mineralization in 3 h treatment. Based on identified aromatic intermediates, short-chain carboxylic acids, released inorganic ions and total organic carbon removal measurements, a plausible oxidation pathway for mineralization of 2,4,5-T by hydroxyl radical was proposed. In addition, the evolution of solution toxicity during treatment was monitored by Microtox method showing the formation of toxic aromatic/cyclic intermediates. The results showed also that EF process was able to remove efficiently toxic intermediates and consequently solution toxicity.

  7. Frill treatment with 2,4,5-T and 2,4-D effective for killing northern hardwoods

    Science.gov (United States)

    W. E. McQuilken

    1957-01-01

    In 1951, Chaiken reported successful use of a 1 percent water emulsion of 2,4,5-T, applied in ax frills, for killing unwanted hardwoods in the southeastern Coastal Plain. Chaiken's work was an important and, in large part, original contribution; it aroused a good deal of interest among foresters concerned with stand improvement, and it spurred further...

  8. USP2-45 Is a Circadian Clock Output Effector Regulating Calcium Absorption at the Post-Translational Level.

    Directory of Open Access Journals (Sweden)

    Daniel Pouly

    Full Text Available The mammalian circadian clock influences most aspects of physiology and behavior through the transcriptional control of a wide variety of genes, mostly in a tissue-specific manner. About 20 clock-controlled genes (CCGs oscillate in virtually all mammalian tissues and are generally considered as core clock components. One of them is Ubiquitin-Specific Protease 2 (Usp2, whose status remains controversial, as it may be a cogwheel regulating the stability or activity of core cogwheels or an output effector. We report here that Usp2 is a clock output effector related to bodily Ca2+ homeostasis, a feature that is conserved across evolution. Drosophila with a whole-body knockdown of the orthologue of Usp2, CG14619 (dUsp2-kd, predominantly die during pupation but are rescued by dietary Ca2+ supplementation. Usp2-KO mice show hyperabsorption of dietary Ca2+ in small intestine, likely due to strong overexpression of the membrane scaffold protein NHERF4, a regulator of the Ca2+ channel TRPV6 mediating dietary Ca2+ uptake. In this tissue, USP2-45 is found in membrane fractions and negatively regulates NHERF4 protein abundance in a rhythmic manner at the protein level. In clock mutant animals (Cry1/Cry2-dKO, rhythmic USP2-45 expression is lost, as well as the one of NHERF4, confirming the inverse relationship between USP2-45 and NHERF4 protein levels. Finally, USP2-45 interacts in vitro with NHERF4 and endogenous Clathrin Heavy Chain. Taken together these data prompt us to define USP2-45 as the first clock output effector acting at the post-translational level at cell membranes and possibly regulating membrane permeability of Ca2+.

  9. 8 CFR 245.9 - Adjustment of status of certain nationals of the People's Republic of China under Public Law 102...

    Science.gov (United States)

    2010-01-01

    ... of the People's Republic of China under Public Law 102-404. 245.9 Section 245.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON... of China under Public Law 102-404. (a) Principal applicant status. All nationals of the People's...

  10. Residues in blackcurrants, fodder peas, spinach and potatoes treated with sublethal doses of 2,4,5-T to simulate wind drift damage

    DEFF Research Database (Denmark)

    Løkke, Hans; Odgaard, Peder

    1981-01-01

    Blackcurrants, treated with 0.1 kg of 2,4,5-T ha-1 (as esters of mixed C4-C6 alcohols; Tormona 80), contained 0.1 mg of 2,4,5-T residues kg-1 in the berries at ripeness 29 days after treatment. Total residues in the berries were not reduced during growth and ripening, although the residue...

  11. 8 CFR 245a.15 - Continuous residence in an unlawful status since prior to January 1, 1982, through May 4, 1988.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continuous residence in an unlawful status... Legal Immigration Family Equity (LIFE) Act Legalization Provisions § 245a.15 Continuous residence in an... residence in the United States can be found at § 245a.2(d)(3). (2) The following evidence may establish an...

  12. Flexible indium-gallium-zinc-oxide Schottky diode operating beyond 2.45 GHz

    Science.gov (United States)

    Zhang, Jiawei; Li, Yunpeng; Zhang, Binglei; Wang, Hanbin; Xin, Qian; Song, Aimin

    2015-07-01

    Mechanically flexible mobile phones have been long anticipated due to the rapid development of thin-film electronics in the last couple of decades. However, to date, no such phone has been developed, largely due to a lack of flexible electronic components that are fast enough for the required wireless communications, in particular the speed-demanding front-end rectifiers. Here Schottky diodes based on amorphous indium-gallium-zinc-oxide (IGZO) are fabricated on flexible plastic substrates. Using suitable radio-frequency mesa structures, a range of IGZO thicknesses and diode sizes have been studied. The results have revealed an unexpected dependence of the diode speed on the IGZO thickness. The findings enable the best optimized flexible diodes to reach 6.3 GHz at zero bias, which is beyond the critical benchmark speed of 2.45 GHz to satisfy the principal frequency bands of smart phones such as those for cellular communication, Bluetooth, Wi-Fi and global satellite positioning.

  13. R245fa Flow Boiling inside a 4.2 mm ID Microfin Tube

    Science.gov (United States)

    Longo, G. A.; Mancin, S.; Righetti, G.; Zilio, C.

    2017-11-01

    This paper presents the R245fa flow boiling heat transfer and pressure drop measurements inside a mini microfin tube with internal diameter at the fin tip of 4.2 mm, having 40 fins, 0.15 mm high with a helix angle of 18°. The tube was brazed inside a copper plate and electrically heated from the bottom. Sixteen T-type thermocouples are located in the copper plate to monitor the wall temperature. The experimental measurements were carried out at constant mean saturation temperature of 30 °C, by varying the refrigerant mass velocity between 100 kg m-2 s-1 and 300 kg m-2 s-1, the vapour quality from 0.15 to 0.95, at two different heat fluxes: 30 and 60 kW m-2. The experimental results are presented in terms of two-phase heat transfer coefficient, onset dryout vapour quality, and frictional pressure drop. Moreover, the experimental measurements are compared against the most updated models for boiling heat transfer coefficient and frictional pressure drop estimations available in the open literature for microfin tubes.

  14. Two approaches for $H^{-}$ ion production with 245 GHz ion sources

    CERN Document Server

    Gobin, R; Bacal, M; Breton, J; Delferrière, O; Harrault, F; Ivanov, A A; Svarnas, P; Tuske, O

    2006-01-01

    Over the last few years, the accelerator community requested the development of improved negative hydrogen ion sources. For spallation sources, like SNS or ESS, pulsed high intensity H/sup negative ion beams of a few tens of milliamperes, with a duty cycle close to 10%, are required. New facilities like CERN also ask for high performance negative ion beams. Since CEA undertook an electron cyclotron resonance (ECR)-based ion source programme, a European network devoted to high performance negative ion source development has been created. In this group, several laboratories developing 2.45 GHz ECR sources follow different approaches to increase the extracted ion current. At Saclay, with a solenoidal magnetic structure based on coils, close to 3 mA H/sup negative ion beam is now extracted in pulsed mode (2 ms/100 ms). A metallic biased grid separates the plasma bulk from the H/sup negative ion production zone and significantly improves the H/sup negative extracted current. At Ecole Polytechnique, the source Came...

  15. Purification and characterization of β-Fructosidase with inulinase activity from Aspergillus niger - 245

    Directory of Open Access Journals (Sweden)

    Vinícius D'Arcadia Cruz

    1998-01-01

    Full Text Available Aspergillus niger - 245, a strain isolated from soil samples showed good β-fructosidase activity when inoculated in medium formulated with dahlia extract tubers. The enzyme was purified by precipitation in ammonium sulphate and percolated in DEAE-Sephadex A-50 and CM-cellulose columns, witch showed a single peack in all the purification steps, maintaining the I/S ratio between 0.32 to, 0.39. Optimum pH for inulinase activity (I was between 4.0 - 4.5 and for invertase activity (S between 2.5 and 5.0. The optimum temperature was 60O.C for both activities and no loss in activity was observed when it was maintained at this temperature for 30 min. The Km value was 1.44 and 5.0, respectively, for I and S and Vm value 10.48 and 30.55, respectively. The I activity was strongly inhibited by Hg2+ and Ag+ and 2 x 10-3 M of glucose, but not by fructose at the same concentration. The enzyme showed an exo-action mechanism, acting on the inulin of different origins. In assay conditions total hydrolysis of all the frutans was obtained, although it has shown larger activity on the chicory inulin than that one from artichoke Jerusalem and dahlia, in the first 30 min. The obtained results suggested that the enzyme presented good potential for industrial application in the preparing the fructose syrupsAspergillus niger - 245, isolado do solo mostrou boa atividade de b-frutosidase meio formulado com extrato de tubérculos de dahlia. A enzima foi purificada por precipitação em sulfato de amônia e percolada em colunas de DEAE-Sephadex A-50 e CM-celulose, produzindo um único pico em todas as fases de purificação e mantendo a relação I/S entre 0,32 a 0,39. O pH ótimo para a atividade de inulinase (I foi encontrado entre 4,0 - 4.5 e para a atividade de invertase (S em 2,5 e 5,0. A temperatura ótima foi de 60O.C para ambas as atividades e nenhuma perda foi observada quando mantida nesta temperatura por 30 min. Os valores de Km foram de 1,44 e 5

  16. The reticulin algorithm for adrenocortical tumor diagnosis: a multicentric validation study on 245 unpublished cases.

    Science.gov (United States)

    Duregon, Eleonora; Fassina, Ambrogio; Volante, Marco; Nesi, Gabriella; Santi, Raffaella; Gatti, Gaia; Cappellesso, Rocco; Dalino Ciaramella, Paolo; Ventura, Laura; Gambacorta, Marcello; Dei Tos, Angelo Paolo; Loli, Paola; Mannelli, Massimo; Mantero, Franco; Berruti, Alfredo; Terzolo, Massimo; Papotti, Mauro

    2013-09-01

    The pathologic diagnosis of adrenocortical carcinoma (ACC) still needs to be improved, because the renowned Weiss Score (WS) system has a poor reproducibility of some parameters and is difficult to apply in borderline cases and in ACC variants. The "reticulin algorithm" (RA) defines malignancy through an altered reticulin framework associated with 1 of the 3 following parameter: necrosis, high mitotic rate, and vascular invasion. This study aimed at validating the interobserver reproducibility of reticulin stain evaluation in an unpublished series of 245 adrenocortical tumors (61 adenomas and 184 carcinomas) from 5 Italian centers, classified according to the WS. Eight pathologists reviewed all reticulin-stained slides. After training, a second round of evaluation on discordant cases was performed 10 weeks later. The RA reclassified 67 cases (27%) as adenomas, including 44 with no reticulin alterations and 23 with an altered reticulin framework but lacking the subsequent parameters of the triad. The other 178 cases (73%) were carcinomas according to the above-mentioned criteria. A complete (8/8 pathologists) interobserver agreement was reached in 75% of cases (κ=0.702), irrespective of case derivation, pathologists' experience, and histologic variants, and was further improved when only those cases with high WS and clinically malignant behavior were considered. After the training, the overall agreement increased to 86%. We conclude that reticulin staining is a reliable technique and an easy-to-interpret system in adrenocortical tumors; moreover, it has a high interobserver reproducibility, which supports the notion of using such a method in the proposed 2-step RA approach for ACC diagnosis.

  17. Distribution of blood types in a sample of 245 New Zealand non-purebred cats.

    Science.gov (United States)

    Cattin, R P

    2016-05-01

    To determine the distribution of feline blood types in a sample of non-pedigree, domestic cats in New Zealand, whether a difference exists in this distribution between domestic short haired and domestic long haired cats, and between the North and South Islands of New Zealand; and to calculate the risk of a random blood transfusion causing a severe transfusion reaction, and the risk of a random mating producing kittens susceptible to neonatal isoerythrolysis. The results of 245 blood typing tests in non-pedigree cats performed at the New Zealand Veterinary Pathology (NZVP) and Gribbles Veterinary Pathology laboratories between the beginning of 2009 and the end of 2014 were retrospectively collated and analysed. Cats that were identified as domestic short or long haired were included. For the cats tested at Gribbles Veterinary Pathology 62 were from the North Island, and 27 from the South Island. The blood type distribution differed between samples from the two laboratories (p=0.029), but not between domestic short and long haired cats (p=0.50), or between the North and South Islands (p=0.76). Of the 89 cats tested at Gribbles Veterinary Pathology, 70 (79%) were type A, 18 (20%) type B, and 1 (1%) type AB; for NZVP 139/156 (89.1%) cats were type A, 16 (10.3%) type B, and 1 (0.6%) type AB. It was estimated that 18.3-31.9% of random blood transfusions would be at risk of a transfusion reaction, and neonatal isoerythrolysis would be a risk in 9.2-16.1% of random matings between non-pedigree cats. The results from this study suggest that there is a high risk of complications for a random blood transfusion between non-purebred cats in New Zealand. Neonatal isoerythrolysis should be considered an important differential diagnosis in illness or mortality in kittens during the first days of life.

  18. Síntese de 1,3-imidazois-2,4,5-trissubstituídos derivados de calcogenofenos

    OpenAIRE

    Mariele Borkowski Rodrigues

    2014-01-01

    No presente trabalho, uma série inédita de 1,3-imidazois-2,4,5-trissubstituídos 11/12 foi sintetizada, a partir de diferentes 1,2-dicetonas derivadas de calcogenofenos, com o objetivo de associar duas classes de heterocíclos interessantes, os 1,3-imidazois e os calcogenofenos. Para a síntese dos 1,3-imidazois-2,4,5-trissubstituídos 11 e 12 foi utilizada a reação multicomponente de Radziszewski modificada, em que reagiram-se as 1,2-dicetonas derivadas de calcogenofenos 8a-c e 9a-c com aldeídos...

  19. Effect of paraquat and 2,4,5-T on biosynthesis of epicuticular wax in some semiarid shrubs

    International Nuclear Information System (INIS)

    Rao, J.V.S.; Reddy, K.R.; Devi, M.S.

    1987-01-01

    The formation of epicuticular wax and cuticle of some semiarid scrub leaves was reduced by foliar application of either paraquat (1, 1', 4', 4,-bipyridilium ion) at 100 mgl -1 or 2,4,5-T(2,4,5-trichlorophenoxy acetic acid) at 2000 mg 1 -1 . Studies on the biosynthesis of epicuticular wax using acetate-1- 14 C revealed that the two classes of herbicides significantly decreased the synthesis of alcohols, aldehydes and mixture of hydrocarbons, esters and ketone fractions, while increasing the synthesis of fatty acid components. The substantial increase observed in cuticular transpiration with these herbicide treatments may be attributed to the altered pattern of biosynthesis of different wax components. (author). 15 refs., 2 figs

  20. Experimental evidence of E × B plasma rotation in a 2.45 GHz hydrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Cortázar, O. D., E-mail: daniel.cortazar@uclm.es [Institute for Energy Research-INEI, University of Castilla-La Mancha, C.J. Cela s/n, 13170 Ciudad Real (Spain); Megía-Macías, A. [CERN, BE-ABP-HSL Department, CH1211 Geneva (Switzerland); E.S.S. Bilbao, Polígono Ugaldeguren III, A-7B, 48170 Zamudio (Spain); Tarvainen, O.; Koivisto, H. [Department of Physics, Accelerator Laboratory, University of Jyväskylä, PO Box 35 (YFL), 40500 Jyväskylä (Finland)

    2015-12-15

    An experimental observation of a rotating plasma structure in a 2.45 GHz microwave-driven hydrogen discharge is reported. The rotation is presumably produced by E × B drift. The formation of the rotating plasma structure is sensitive to the strength of the off-resonance static magnetic field. The rotation frequency is on the order of 10 kHz and is affected by the neutral gas pressure and applied microwave power.

  1. 48 CFR 245.7101-3 - DD Form 1348-1, DoD Single Line Item Release/Receipt Document.

    Science.gov (United States)

    2010-10-01

    ... PROPERTY Plant Clearance Forms 245.7101-3 DD Form 1348-1, DoD Single Line Item Release/Receipt Document. Use for shipments of excess industrial plant equipment and contractor inventory redistribution system...

  2. Extraction and quantification of chlorophenolate molecules in soils spiked with 2,4-dichlorophenol and 2,4,5-trichlorophenol.

    Science.gov (United States)

    Bello, Diana; Trasar-Cepeda, Carmen

    2018-03-01

    The compounds 2,4-dichlorophenol (2,4-DCP) and 2,4,5-trichlorophenol (2,4,5-TCP) are classified as priority pollutants, with potentially hazardous impacts on the environment. In soil, dissociation of the phenol group occurs, resulting in the simultaneous presence of neutral phenol and anionic phenolate. Although the toxicity of 2,4-DCP and 2,4,5-TCP to soil microbiota has been suggested to be mainly due to the phenolate anion, this hypothesis cannot be tested due to the lack of appropriate methods of extracting and quantifying the anionic form of these compounds (unlike the neutral form, which can be easily quantified). In this study, we developed a method that enables extraction and quantification of phenolate ions. The method could therefore be used to elucidate the processes that regulate the behaviour of chlorophenolic molecules in soil and to clarify the distribution and toxicity of these compounds in the edaphic environment. The proposed method uses saline solutions (CaCl 2 , KCl and K 2 SO 4 ) of low ionic strength to extract the chlorophenolate anion from soil, followed by sequential transformation of the anion from the aqueous solution to an organic solvent that enables subsequent identification and quantification of the molecule by gas chromatography. Two soils of contrasting pH were used to test whether the proposed method was practicable. The method enabled analysis of the distribution of the neutral and anionic forms of the chlorophenols in both types of soil considered and revealed the influence of soil pH in this distribution. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Mutagenicity of 1-Ethyl-2,4,5-triphenyl-1H-imidazole and Six Derivatives in Salmonella typhimurium

    OpenAIRE

    KORKMAZ, Ferhan; Korkmaz, Ferhan; MERCANGOZ, Ayse

    2010-01-01

     Newly synthesized 1-Ethyl-2,4,5-triphenyl-1H-imidazole and its six derivatives were tested by Ames assay. In order to reveal the mutagenic activities of the compounds, two different mutant strains of Salmonella typhimurium (TA98 and TA100) were used in an Ames assay with/without S9 microsomal fraction from rat liver. It was found that the compounds have no mutagenic activities.          &nb...

  4. Extension of Sphingobium sp. BHC-A to a 2,4,5-trichlorophenoxyacetic acid mineralizing strain by metabolic engineering.

    Science.gov (United States)

    Ge, Feng; Chen, Xu; Wang, Xin; Liao, Xuewei; Jiao, Yiying; Hong, Qing; Zhang, Longjiang; Wu, Jun

    2013-07-20

    The gene cassette encoding for TftAB and TftCD proteins was integrated into the 16srDNA gene of the γ-hexachlorocyclohexane (γ-HCH) mineralizing strain Sphingobium sp. BHC-A by homologous recombination. The recombinant γ-HCH mineralizing strain may degrade 2,4,5-trichlorophenoxyacetic acid at a rate of 250nmol mg [protein](-1)h(-1), and the generated intermediate 2,5-dichlorohydroquinone may be further mineralized through γ-HCH downstream degradation pathway. Copyright © 2013 Elsevier B.V. All rights reserved.

  5. A RF-MEMS Based Tunable Matching Network for 2.45-GHz Discrete-Resizing CMOS Power Amplifiers

    Directory of Open Access Journals (Sweden)

    F. Alimenti

    2014-04-01

    Full Text Available This paper deals with the design and experimental validation of a tunable matching network for discrete-resizing CMOS power amplifiers operating at 2.45 GHz (i.e. in the WiFi frequency band. The network is based on a two stages ladder configuration and exploits high-Q MEMS capacitors to achieve the impedance tuning. Furthermore, since these capacitors can be programmed through a 3-wires serial interface, a fully digital control of the transformed impedance is achieved.

  6. The strontium isotopic composition of interstitial waters from sites 245 and 336 of the deep sea drilling project

    International Nuclear Information System (INIS)

    Hawkesworth, C.J.; Elderfield, H.

    1978-01-01

    Measurements of 87 Sr/ 86 Sr ratios of interstitial waters from leg 25, site 245 and leg 38, site 336 of the Deep Sea Drilling Project show that the enrichment of Sr 2+ with depth is caused both by the alteration of volcanic material and by the introduction of strontium derived from calcium carbonate. 87 Sr/ 86 Sr ratios range from 0.70913 to 0.70794 at site 245 and from 0.70916 to 0.70694 at site 336. The low ratios compared with contemporaneous seawater reflect the release of Sr from a volcanic source having, according to material-balance calculations, a 87 Se/ 86 Sr ratio of about 0.7034 at site 336. At this site the source appears to be volcanic ash and not basaltic basement which acts as a sink for Sr 2+ during in situ low-temperature weathering. The volcanic contribution to the strontium enrichment in the basal interstitial waters varies from 50% at site 336. The remaining Sr 2+ is derived from Sr-rich biogenic carbonate during diagenetic recrystallization to form Sr-poor calcite. (Auth.)

  7. Microwave radiation (2.45 GHz)-induced oxidative stress: Whole-body exposure effect on histopathology of Wistar rats.

    Science.gov (United States)

    Chauhan, Parul; Verma, H N; Sisodia, Rashmi; Kesari, Kavindra Kumar

    2017-01-01

    Man-made microwave and radiofrequency (RF) radiation technologies have been steadily increasing with the growing demand of electronic appliances such as microwave oven and cell phones. These appliances affect biological systems by increasing free radicals, thus leading to oxidative damage. The aim of this study was to explore the effect of 2.45 GHz microwave radiation on histology and the level of lipid peroxide (LPO) in Wistar rats. Sixty-day-old male Wistar rats with 180 ± 10 g body weight were used for this study. Animals were divided into two groups: sham exposed (control) and microwave exposed. These animals were exposed for 2 h a day for 35 d to 2.45 GHz microwave radiation (power density, 0.2 mW/cm 2 ). The whole-body specific absorption rate (SAR) was estimated to be 0.14 W/kg. After completion of the exposure period, rats were sacrificed, and brain, liver, kidney, testis and spleen were stored/preserved for determination of LPO and histological parameters. Significantly high level of LPO was observed in the liver (p microwave radiation. Also histological changes were observed in the brain, liver, testis, kidney and spleen after whole-body microwave exposure, compared to the control group. Based on the results obtained in this study, we conclude that exposure to microwave radiation 2 h a day for 35 d can potentially cause histopathology and oxidative changes in Wistar rats. These results indicate possible implications of such exposure on human health.

  8. Protection of tomato seed germination from the inhibitory effect of 2,4,5-trichlorophenoxyacetic acid by inoculation of soil with Burkholderia cepacia AC1100.

    Science.gov (United States)

    Gangadhara, K P; Kunhi, A A

    2000-09-01

    The effect of 2,4,5-trichlorophenoxy acetic acid (2,4,5-T) on the germination and seedling vigor of different crop seeds was tested. Seeds of rice, maize, sorghum, finger millet, and horse gram were comparatively more tolerant to the chemical with no marked effect up to a concentration of 200 mg 2,4,5-T L(-)(1) as tested by the filter paper method. Tomato and brinjal (egg plant) were highly susceptible. Even at 5 and 10 mg 2,4,5-T L(-)(1), marked reduction in the germination and seedling vigor of tomato and egg plant, respectively, was observed. At 20 and 30 mg L(-)(1), the germination of tomato and egg plant seeds, respectively, were completely inhibited on filter paper, whereas the inhibitory concentrations in soil was 40 mg 2,4,5-T kg(-)(1) soil. Several abnormalities were observed in the chemically affected seedlings. Protease activity of the seeds germinating in the presence of the chemical was drastically reduced. Bioremediation of the chemically contaminated soil with Burkholderia cepacia AC1100, by inoculation of the soil 7 days before sowing the seeds, completely protected the seeds, resulting in normal germination and an improved seedling vigor.

  9. Similarity Theory Based Radial Turbine Performance and Loss Mechanism Comparison between R245fa and Air for Heavy-Duty Diesel Engine Organic Rankine Cycles

    Directory of Open Access Journals (Sweden)

    Lei Zhang

    2017-01-01

    Full Text Available Organic Rankine Cycles using radial turbines as expanders are considered as one of the most efficient technologies to convert heavy-duty diesel engine waste heat into useful work. Turbine similarity design based on the existing air turbine profiles is time saving. Due to totally different thermodynamic properties between organic fluids and air, its influence on turbine performance and loss mechanisms need to be analyzed. This paper numerically simulated a radial turbine under similar conditions between R245fa and air, and compared the differences of the turbine performance and loss mechanisms. Larger specific heat ratio of air leads to air turbine operating at higher pressure ratios. As R245fa gas constant is only about one-fifth of air gas constant, reduced rotating speeds of R245fa turbine are only 0.4-fold of those of air turbine, and reduced mass flow rates are about twice of those of air turbine. When using R245fa as working fluid, the nozzle shock wave losses decrease but rotor suction surface separation vortex losses increase, and eventually leads that isentropic efficiencies of R245fa turbine in the commonly used velocity ratio range from 0.5 to 0.9 are 3%–4% lower than those of air turbine.

  10. 2,4-Dichlorophenoxyacetic acid (2,4-D)- and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)-degrading gene cluster in the soybean root-nodulating bacterium Bradyrhizobium elkanii USDA94.

    Science.gov (United States)

    Hayashi, Shohei; Sano, Tomoki; Suyama, Kousuke; Itoh, Kazuhito

    2016-01-01

    Herbicides 2,4-dichlorophenoxyacetic acid (2,4-D)- and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)-degrading Bradyrhizobium strains possess tfdAα and/or cadABC as degrading genes. It has been reported that root-nodulating bacteria belonging to Bradyrhizobium elkanii also have tfdAα and cadA like genes but lack the ability to degrade these herbicides and that the cadA genes in 2,4-D-degrading and non-degrading Bradyrhizobium are phylogenetically different. In this study, we identified cadRABCK in the genome of a type strain of soybean root-nodulating B. elkanii USDA94 and demonstrated that the strain could degrade the herbicides when cadABCK was forcibly expressed. cadABCK-cloned Escherichia coli also showed the degrading ability. Because co-spiked phenoxyacetic acid (PAA) could induce the degradation of 2,4-D in B. elkanii USDA94, the lack of degrading ability in this strain was supposed to be due to the low inducing potential of the herbicides for the degrading gene cluster. On the other hand, tfdAα from B. elkanii USDA94 showed little potential to degrade the herbicides, but it did for 4-chlorophenoxyacetic acid and PAA. The 2,4-D-degrading ability of the cad cluster and the inducing ability of PAA were confirmed by preparing cadA deletion mutant. This is the first study to demonstrate that the cad cluster in the typical root-nodulating bacterium indeed have the potential to degrade the herbicides, suggesting that degrading genes for anthropogenic compounds could be found in ordinary non-degrading bacteria. Copyright © 2016 Elsevier GmbH. All rights reserved.

  11. Photosynthetic 14C fixation in leaves and isolated chloroplasts of some scrub species under the influence of paraquat and 2,4,5-T

    International Nuclear Information System (INIS)

    Madhusudana Rao, I.; Swamy, P.M.; Rama Das, V.S.

    1980-01-01

    The diurnal course of carbon dioxide uptake in the leaves of six nonsucculent semiarid scrub species was investigated. Five nonsucculent scrub species, Carissa spinarum, Maba buxifolia, Flacourtia sepiaria, Gymnosporia emerginata and Dodonaea viscosa exhibited nocturnal carbon assimilation while day time CO 2 uptake was predominant in Chomelia asiatica. Foliar application of paraquat (100 mg 1sup(-1)) or 2,4,5-T (2000 mg 1sup(-1)) caused a marked inhibition in the dark uptake of CO 2 . On the other hand, carbon uptake during day was slightly reduced. Studies on the carbon assimilation of isolated chloroplasts under the influence of paraquat or 2,4,5-T revealed that paraquat is more effective than 2,4,5-T in the suppression of carbon assimilation of in vivo and in vitro chloroplasts. The data suggested that the process of nocturnal carbon assimilation is far more sensitive to paraquat than the light dependent carbon fixation during day. (author)

  12. Design of a 2.45 GHz ECR Ion Source for Production of Medium Charge States Ions

    International Nuclear Information System (INIS)

    Gough, R.; Hoff, M.; Leitner, M.; Leung, K.N.; Wutte, D.

    1997-01-01

    At Lawrence Berkeley National Laboratory we are constructing an ECR ion source test facility for nuclear science experiments. For this purpose a single-stage 2.45 GHz electron cyclotron resonance ion source has been designed and fabricated. It features an axial magnetic field with a mirror ratio of up to 5.5 and a hexapole field produced by a novel Nd-Fe-B permanent magnet assembly. In order to enhance the ion confinement time the source plasma volume has been enlarged as much as possible while still maintaining a high mirror ratio. This paper describes the design of the source. Ion optics simulation of the extraction system currently under design will also be presented

  13. Mössbauer spectroscopic study of 57Fe metabolic transformations in the rhizobacterium Azospirillum brasilense Sp245

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Kovács, Krisztina; Biró, Borbála; Homonnay, Zoltán; Kuzmann, Ernő

    2014-04-01

    Preliminary 57Fe transmission Mössbauer spectroscopic data were obtained for the first time for live cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp245) grown aerobically with 57FeIII-nitrilotriacetate (NTA) complex as a sole source of iron. The results obtained have shown that live cells actively reduce part of the assimilated iron(III) to iron(II), the latter amounting up to 33 % of total cellular iron after 18 h of growth, and 48 % after additional 3 days of storage of the dense wet cell suspension in nutrient-free saline solution in air at room temperature (measured at 80 K). The cellular iron(II) was found to be represented by two quadrupole doublets of different high-spin forms, while the parameters of the cellular iron(III) were close to those typical for bacterioferritins.

  14. Chromosomal flhB1 gene of the alphaproteobacterium Azospirillum brasilense Sp245 is essential for correct assembly of both constitutive polar flagellum and inducible lateral flagella.

    Science.gov (United States)

    Filip'echeva, Yulia; Shelud'ko, Andrei; Prilipov, Alexei; Telesheva, Elizaveta; Mokeev, Dmitry; Burov, Andrei; Petrova, Lilia; Katsy, Elena

    2018-03-01

    Azospirillum brasilense has the ability of swimming and swarming motility owing to the work of a constitutive polar flagellum and inducible lateral flagella, respectively. The interplay between these flagellar systems is poorly understood. One of the key elements of the flagellar export apparatus is the protein FlhB. Two predicted flhB genes are present in the genome of A. brasilense Sp245 (accession nos. HE577327-HE577333). Experimental evidence obtained here indicates that the chromosomal coding sequence (CDS) AZOBR_150177 (flhB1) of Sp245 is essential for the production of both types of flagella. In an flhB1:: Omegon-Km mutant, Sp245.1063, defects in polar and lateral flagellar assembly and motility were complemented by expressing the wild-type flhB1 gene from plasmid pRK415. It was found that Sp245.1063 lost the capacity for slight but statistically significant decrease in mean cell length in response to transfer from solid to liquid media, and vice versa; in the complemented mutant, this capacity was restored. It was also shown that after the acquisition of the pRK415-harbored downstream CDS AZOBR_150176, cells of Sp245 and Sp245.1063 ceased to elongate on solid media. These initial data suggest that the AZOBR_150176-encoded putative multisensory hybrid sensor histidine kinase-response regulator, in concert with FlhB1, plays a role in morphological response of azospirilla to changes in the hardness of a milieu.

  15. Composites of surface imprinting polymer capped Mn-doped ZnS quantum dots for room-temperature phosphorescence probing of 2,4,5-trichlorophenol

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Xiao [School of Material Science and Engineering, Jiangsu University, Zhenjiang 212013 (China); School of Chemistry and Chemical Engineering, Jiangsu University, Zhenjiang 212013 (China); Zhou, Zhiping, E-mail: weixiaokeyan@163.com [School of Material Science and Engineering, Jiangsu University, Zhenjiang 212013 (China); Dai, Jiangdong [School of Material Science and Engineering, Jiangsu University, Zhenjiang 212013 (China); Hao, Tongfan [School of Computer Science, Jilin Normal University, Siping 136000 (China); Li, Hongji; Xu, Yeqing; Gao, Lin; Pan, Jianming; Li, Chunxiang; Yan, Yongsheng [School of Chemistry and Chemical Engineering, Jiangsu University, Zhenjiang 212013 (China)

    2014-11-15

    In this paper, a simple procedure for the determination of 2,4,5-trichlorophenol (2,4,5-TCP) is reported. Mn-doped ZnS quantum dots (QDs) capped by molecularly imprinted polymers (MIPs) were prepared. MIPs were characterized by spectrofluorometer, UV–vis spectrophotometer, X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), transmission electron microscope (TEM) and scanning electron microscope (SEM). Meanwhile, spectrofluorometer was used to the evaluation of optical stability, the effect of pH, and the selective and sensitive determination of 2,4,5-TCP. Under optical conditions, MIPs-capped Mn-doped ZnS QDs were successfully applied to the detection of 2,4,5-TCP in water selectively and sensitively, and a linear relationship was obtained to cover the concentration range of 5.0–50 μmol L{sup −1} with a correlation coefficient of 0.9913. Moreover, 2,4,5-TCP could quench the room temperature phosphorescence of MIPs-capped Mn-doped ZnS QDs in a concentration-dependent manner, which was best described by a Stern–Volmer-type equation. - Highlights: • Molecularly imprinted polymers (MIPs)-capped Mn-doped ZnS quantum dots (QDs) were prepared. • The composite materials integrated the advantages of the high selectivity of the molecular imprinting and strong RTP property of the QDs. • The composite materials was successfully applied to selectively and sensitively detect 2,4,5-TCP in water.

  16. Electrochemical decontamination of waters by advanced oxidation processes (aops: Case of the mineralization of 2,4,5-t on bdd electrode

    Directory of Open Access Journals (Sweden)

    Birame Boye

    2004-12-01

    Full Text Available In the present work, herbicide 2,4,5-trichlorophenoxyacetic acid, more commonly known as 2,4,5-T herbicide, has been completely mineralized (i.e. transformed into CO2 and H2O in saturated aqueous solutions using a semi-industrial electrochemical cell that contains a boron doped diamond anode and a zirconium cathode. We have performed cyclic voltammetry, chronoamperometry and bulk electrolysis to give the optimization characteristics of the degradation of such a compound and its by-products. Bulk electrolysis in the potential region of electrolyte decomposition leads to the complete destruction of 2,4,5-T and its degradation intermediates by means of the electrogeneration of the highly reactive hydroxyl radicals. The evolution of the chemical oxygen demand (COD and the instant current efficiency (ICE during the degradation process is perfectly predicted by a theoretical mathematical model. HPLC and GC-MS have also been performed to highlight the evolution of the mother product and its degradation intermediates. Kinetic analysis of the obtained results has shown a fast destruction of the mother herbicide asserting a diffusion-controlled process. 2,4,5-trichlorophenol and quinone-based organic compounds have been depicted as aromatic intermediates, all of them transformed into short chains carboxylic acids before complete mineralization happens.

  17. [Mutants of bacterium Azospirillum brasilense Sp245 with Omegon insertion in mmsB or fabG genes of lipid metabolism are defective in motility and flagellation].

    Science.gov (United States)

    Kovtunov, E A; Shelud'ko, A V; Chernyshova, M P; Petrova, L P; Katsy, E I

    2013-11-01

    Bacteria Azospirillum brasilense have mixed flagellation: in addition to the polar flagellum, numerous lateral flagella are formed in their cells on medium with increased density. Flagella determine the active swimming and swarming capacities of azospirilla. Using A. brasilense Sp245 as an example, we showed that the Omegon-Km artificial transposon insertion into the chromosomal gene for 3-hydroxyisobutyrate dehydrogenase (mmsB) was concurrent with the appearance of significant defects in the formation of polar flagella and with the paralysis of lateral flagella. The Sp245 mutant with the Omegon insertion into the plasmid AZOBR_p1-borne gene for 3-oxoacyl-[acyl-carrier protein]-reductase (fabG) showed the complete loss of flagella and the swarming capacity, as well as significant defects in polar flagellar assembly (though some cells are still motile in liquid medium). The viability of the A. brasilense Sp245 mutants with the Omegon insertion into the mmsB or fabG gene was not reduced. No considerable differences in the fatty acid composition of whole cell lipid extracts were found for the A. brasilense Sp245 strain and its mmsB and fabG mutants.

  18. Residues in blackcurrants, fodder peas, spinach and potatoes treated with sublethal doses of 2,4,5-T to simulate wind drift damage

    DEFF Research Database (Denmark)

    Løkke, Hans; Odgaard, Peder

    1981-01-01

    Blackcurrants, treated with 0.1 kg of 2,4,5-T ha-1 (as esters of mixed C4-C6 alcohols; Tormona 80), contained 0.1 mg of 2,4,5-T residues kg-1 in the berries at ripeness 29 days after treatment. Total residues in the berries were not reduced during growth and ripening, although the residue...... concentrations declined in the same period due to growth dilution. In spinach leaves from old plants, treated with 0.1 kg ha-1, 0.05 mg of 2,4,5-T kg-1 was found 14 days after treatment. Fodder peas showed no residues (....1 kg ha-1 on potato plants, the disappearance of 2,4,5-T was rapid during the first month, but residues were translocated into the tubers and reached a constant level of 0.02 mg kg-1 after 1 month until harvest at 108 days after treatment. In all crops, visible effects were observed after treatment...

  19. 8 CFR 245.18 - How can physicians (with approved Forms I-140) that are serving in medically underserved areas or...

    Science.gov (United States)

    2010-01-01

    ... when the Service approves a Form I-140 petition with a national interest job offer waiver, the... the Form I-140 and of the national interest waiver. (j) Will a Service officer interview the physician... adjustment interview with a Service officer, unless the Service waives the interview as provided in § 245.6...

  20. Effect of exposure to 2.45 GHz microwave on DNA repair genes transcription in cultured cells

    Energy Technology Data Exchange (ETDEWEB)

    Perrin, A.; Bachelet, C. [Molecular and Cellular Biophysics Unit of the Health Service Research Center for Defense (CRSSA), 38 - Grenoble (France); Fournier, C.; Peinnequin, A. [Radiobiology and Inflamation Unit of the Health Service Research Center for Defense (CRSSA), 38 - Grenoble (France); Leveque, P.; Collin, A. [Research Institut on Microwave and Optical Communications (IRCOM), CNRS UMR 6615, 87 - Limoges (France)

    2006-07-01

    The aim of the study was to investigate, in vitro, the effect of 2.45 GHz continuous (C.W.) and pulsed (P.W.) electromagnetic field exposure combined with a known mutagen on the induction of enzymes implicated in the DNA repair pathway. Microwaves do not create bonds breaks within molecules and there is no clear hypothesis for a possible mechanism supporting a biological action. Nevertheless, an indirect influence of microwaves during an intermediary step of the complex sequence of events involved in mutagenesis cannot yet be excluded. Highly sensitive real-time R.T.q.P.C.R. was used to monitor transcriptional variations of DNA repair genes. The experiments were carried out using the monocyte human cell line T.H.P.1 with the genotoxic compound 4- nitro-quinoline-N-oxide (4-N.Q.O.). The carrier frequency was 2.45 GHz C.W. and P.W. (1 khz repetition time, 10 % duty cycle) with the same power density corresponding to an average specific absorption rate (S.A.R.) value of 0.19 W/kg in the biological samples. Non exposed (sham) and exposed (P.W. and C.W.) cell culture plates were incubated simultaneously in three identical incubators in the presence of 4-N.Q.O., under shaking, at 37 Celsius degrees. Specially designed incubators were integrated in three identical anechoic chambers equipped with waveguide antennas. Care was taken to increase the reproducibility of the experiments and to avoid false positive or misinterpretation of the results. The presence or the absence of the electromagnetic field was the only difference between the sham and exposed assays. The different exposure conditions were applied alternatively in the three anechoic chambers in order to avoid cage effects. The temperature inside the cell plates was measured with an optic fiber probe (Luxtron). Numerical dosimetry was calculated using the Finite Difference Time Domain method. A time-scaled form of the heat transfer equation allowed to calculate the temperature distribution inside the petri dishes

  1. Crystal structure of triaqua(1,10-phenanthroline-κ2N,N′(2,4,5-trifluoro-3-methoxybenzoato-κO1cobalt(II 2,4,5-trifluoro-3-methoxybenzoate

    Directory of Open Access Journals (Sweden)

    Junshan Sun

    2014-11-01

    Full Text Available The title salt, [Co(C8H4F3O3(C12H8N2(H2O3](C8H4F3O3, was obtained under solvothermal conditions by the reaction of 2,4,5-trifluoro-3-methoxybenzoic acid with CoCl2 in the presence of 1,10-phenanthroline (phen. The CoII ion is octahedrally coordinated by two N atoms [Co—N = 2.165 (2 and 2.129 (2 Å] from the phen ligand, by one carboxylate O atom [Co—O = 2.107 (1 Å] and by three O atoms from water molecules [Co—O = 2.093 (1, 2.102 (1 and 2.114 (1 Å]. The equatorial positions of the slightly distorted octahedron are occupied by the N atoms, the carboxylate O and one water O atom. An intra- and intermolecular O—H...O hydrogen-bonding network between the water-containing complex cation and the organic anion leads to the formation of ribbons parallel to [010].

  2. Spectroscopic (FT-IR, FT-Raman, UV and NMR) investigation and NLO, HOMO-LUMO, NBO analysis of organic 2,4,5-trichloroaniline.

    Science.gov (United States)

    Govindarajan, M; Karabacak, M; Periandy, S; Tanuja, D

    2012-11-01

    In this work, the experimental and theoretical study on the molecular structure and vibrational spectra of 2,4,5-trichloroaniline (C(6)H(4)NCl(3), abbreviated as 2,4,5-TClA) were studied. The FT-IR and FT-Raman spectra were recorded. The molecular geometry and vibrational frequencies in the ground state were calculated by using the Hartree-Fock (HF) and density functional theory (DFT) methods (B3LYP) with 6-311++G(d,p) basis set. Comparison of the observed fundamental vibrational frequencies of 2,4,5-TClA with calculated results by HF and DFT indicates that B3LYP is superior to HF method for molecular vibrational problems. The difference between the observed and scaled wavenumber values of most of the fundamentals is very small. The theoretically predicted FT-IR and FT-Raman spectra of the title molecule have been constructed. A study on the electronic properties, such as HOMO and LUMO energies, were performed by time-dependent DFT (TD-DFT) approach. Besides, molecular electrostatic potential (MEP) and thermodynamic properties were performed. The electric dipole moment (μ) and the first hyperpolarizability (β) values of the investigated molecule were computed using ab initio quantum mechanical calculations. The calculated results also show that the 2,4,5-TClA molecule may have microscopic nonlinear optical (NLO) behavior with non-zero values. Mulliken atomic charges of 2,4,5-TClA was calculated and compared with aniline and chlorobenzene molecules. The (13)C nuclear magnetic resonance (NMR) chemical shifts of the molecule were calculated by the gauge independent atomic orbital (GIAO) method and compared with experimental results. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. Calcifications of Vertebrobasilar Arteries on CT: Detailed Distribution and Relation to Risk Factors in 245 Ischemic Stroke Patients

    Directory of Open Access Journals (Sweden)

    Slaven Pikija

    2013-01-01

    Full Text Available Introduction. Intracranial atherosclerosis is responsible for a substantial proportion of strokes worldwide but its detailed morphology in the vertebrobasilar arteries (VBA is unknown. Subject and Methods. Cases with ischemic strokes were retrospectively sought from the hospital database. Native CT scans were assessed for vessel area and intracranial artery calcifications (ICACs in VBA. The calcifications were classified as focal (FCs, crescent, and circular. Results. 245 patients (mean age: years, 57.6% females had visible ICACs. Calcifications were found in 75.9%, 63.3%, and 17.1% in the left vertebral artery (LVA, the right vertebral artery (RVA, and the basilar artery (BA, respectively. FCs were present in 91.0%, 90.3%, and 100.0%; crescents in 30.3%, 29.0%, and 7.1%, and circulars in 6.4%, 4.8%, and 0.0% of the RVA, LVA, and BA, respectively. FCs in dorsolateral quadrant were least prevalent in both vertebral arteries (VAs: 46 (29.8% and 46 (27.4% for RVA and LVA, respectively. Risk factors associated with vertical dispersion of ICACs were male gender (OR : 2.69, 1.38–5.28 and diabetes (OR : 2.28, 1.04–4.99. Conclusions. FCs in VAs are least prevalent in dorsolateral quadrants. The vertical dispersion of ICACs seems to be associated with the male gender and diabetes.

  4. Electromagnetic optimisation of a 2.45 GHz microwave plasma source operated at atmospheric pressure and designed for hydrogen production

    Science.gov (United States)

    Miotk, R.; Jasiński, M.; Mizeraczyk, J.

    2018-03-01

    This paper presents the partial electromagnetic optimisation of a 2.45 GHz cylindrical-type microwave plasma source (MPS) operated at atmospheric pressure. The presented device is designed for hydrogen production from liquid fuels, e.g. hydrocarbons and alcohols. Due to industrial requirements regarding low costs for hydrogen produced in this way, previous testing indicated that improvements were required to the electromagnetic performance of the MPS. The MPS has a duct discontinuity region, which is a result of the cylindrical structure located within the device. The microwave plasma is generated in this discontinuity region. Rigorous analysis of the region requires solving a set of Maxwell equations, which is burdensome for complicated structures. Furthermore, the presence of the microwave plasma increases the complexity of this task. To avoid calculating the complex Maxwell equations, we suggest the use of the equivalent circuit method. This work is based upon the idea of using a Weissfloch circuit to characterize the area of the duct discontinuity and the plasma. The resulting MPS equivalent circuit allowed the calculation of a capacitive metallic diaphragm, through which an improvement in the electromagnetic performance of the plasma source was obtained.

  5. Molecular structure and protonation trends in 6-methoxy- and 8-methoxy-2,4,5-tris(dimethylamino)quinolines

    Science.gov (United States)

    Dyablo, O. V.; Pozharskii, A. F.; Shmoilova, E. A.; Ozeryanskii, V. A.; Fedik, N. S.; Suponitsky, K. Yu.

    2016-03-01

    Molecular structure and protonation trends of 6-methoxy- 7 and 8-methoxy- 8 derivatives of 2,4,5-tris(dimethylamino)quinoline were studied using X-ray measurements, NMR spectra and theoretical calculations. It has been found that while 8 in the solid state forms protic salts of a quinolinium type, its isomer 7 behaves as a typical proton sponge giving the anilinium cation with a proton chelated by peri-NMe2 groups. In solution, both compounds are simultaneously monoprotonated at two possible centers but again a tendency of 7 to form anilinium cation is much higher if compared to 8. It has been also shown that basicity of 7 is the largest among all known derivatives of 4,5-bis(dimethylamino)quinoline and even slightly exceeds that of 1,8-bis(dimethylamino)naphthalene (parent proton sponge). This was attributed to the ;buttressing effect; exhibited by the 6-MeO group. Stable double salts of 7 with picrate and perchlorate anions unprecedented for azines with conjugated aza and NMe2 groups were obtained and thoroughly studied.

  6. Recoil-range studies of heavy products of multinucleon transfer from 18O to 245Cm and 249Cf

    International Nuclear Information System (INIS)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of 245 Cm and 249 Cf with 18 O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation

  7. Abatement of fluorinated compounds using a 2.45GHz microwave plasma torch with a reverse vortex plasma reactor.

    Science.gov (United States)

    Kim, J H; Cho, C H; Shin, D H; Hong, Y C; Shin, Y W

    2015-08-30

    Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF6, NF3 by varying plasma power and N2 flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF3 and SF6 in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF3 was achieved without an additive gas at the N2 flow rate of 150 liter per minute (L/min) by applying a microwave power of 6kW with RVR. Also, a DRE of SF6 was 99.99% at the N2 flow rate of 60 L/min using an applied microwave power of 6kW. The performance of reverse vortex reactor increased about 43% of NF3 and 29% of SF6 abatements results definition by decomposition energy per liter more than conventional vortex reactor. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Plasma parameter diagnosis using hydrogen emission spectra of a quartz-chamber 2.45 GHz ECRIS at Peking University

    Science.gov (United States)

    Wu, WenBin; Ren, HaiTao; Peng, ShiXiang; Xu, Yuan; Wen, JiaMei; Zhang, Tao; Zhang, JingFeng; Zhang, AiLin; Sun, Jiang; Guo, ZhiYu; Chen, JiaEr

    2018-04-01

    A quartz-chamber 2.45 GHz electron cyclotron resonance ion source (ECRIS) was designed for diagnostic purposes at Peking University [Patent Number: ZL 201110026605.4]. This ion source can produce a maximum 84 mA hydrogen ion beam at 50 kV with a duty factor of 10%. The root-mean-square (RMS) emittance of this beam is less than 0.12π mm mrad. In our initial work, the electron temperature and electron density inside the plasma chamber had been measured with the line intensity ratio of noble gases. Based on these results, the atomic and molecular emission spectra of hydrogen were applied to determine the dissociation degree of hydrogen and the vibrational temperature of hydrogen molecules in the ground state, respectively. Measurements were performed at gas pressures from 4×10-4 to 1×10-3 Pa and at input peak RF power ranging from 1000 to 1800 W. The dissociation degree of hydrogen in the range of 0.5%-10% and the vibrational temperature of hydrogen molecules in the ground state in the range of 3500-8500 K were obtained. The plasma processes inside this ECRIS chamber were discussed based on these results.

  9. Effects of acute exposure to WIFI signals (2.45GHz) on heart variability and blood pressure in Albinos rabbit.

    Science.gov (United States)

    Saili, Linda; Hanini, Amel; Smirani, Chiraz; Azzouz, Ines; Azzouz, Amina; Sakly, Mohsen; Abdelmelek, Hafedh; Bouslama, Zihad

    2015-09-01

    Electrocardiogram and arterial pressure measurements were studied under acute exposures to WIFI (2.45GHz) during one hour in adult male rabbits. Antennas of WIFI were placed at 25cm at the right side near the heart. Acute exposure of rabbits to WIFI increased heart frequency (+22%) and arterial blood pressure (+14%). Moreover, analysis of ECG revealed that WIFI induced a combined increase of PR and QT intervals. By contrast, the same exposure failed to alter maximum amplitude and P waves. After intravenously injection of dopamine (0.50ml/kg) and epinephrine (0.50ml/kg) under acute exposure to RF we found that, WIFI alter catecholamines (dopamine, epinephrine) action on heart variability and blood pressure compared to control. These results suggest for the first time, as far as we know, that exposure to WIFI affect heart rhythm, blood pressure, and catecholamines efficacy on cardiovascular system; indicating that radiofrequency can act directly and/or indirectly on cardiovascular system. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Effects of olive leave extract on metabolic disorders and oxidative stress induced by 2.45 GHz WIFI signals.

    Science.gov (United States)

    Salah, Myriam Ben; Abdelmelek, Hafedh; Abderraba, Manef

    2013-11-01

    We investigated the effect of olive leaves extract administration on glucose metabolism and oxidative response in liver and kidneys of rats exposed to radio frequency (RF). The exposure of rats to RF (2.45 GHz, 1h/day during 21 consecutive days) induced a diabetes-like status. Moreover, RF decreased the activities of glutathione peroxidase (GPx, -33.33% and -49.40%) catalase (CAT, -43.39% and -39.62%) and the superoxide dismutase (SOD, -59.29% and -68.53%) and groups thiol amount (-62.68% and -34.85%), respectively in liver and kidneys. Indeed, exposure to RF increased the malondialdehyde (MDA, 29.69% and 51.35%) concentration respectively in liver and kidneys. Olive leaves extract administration (100 mg/kg, ip) in RF-exposed rats prevented glucose metabolism disruption and restored the activities of GPx, CAT and SOD and thiol group amount in liver and kidneys. Moreover, olive leave extract administration was able to bring down the elevated levels of MDA in liver but not in kidneys. Our investigations suggested that RF exposure induced a diabetes-like status through alteration of oxidative response. Olive leaves extract was able to correct glucose metabolism disorder by minimizing oxidative stress induced by RF in rat tissues. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Effects of Wi-Fi (2.45 GHz) Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study.

    Science.gov (United States)

    Shokri, Saeed; Soltani, Aiob; Kazemi, Mahsa; Sardari, Dariush; Mofrad, Farshid Babapoor

    2015-01-01

    In today's world, 2.45-GHz radio-frequency radiation (RFR) from industrial, scientific, medical, military and domestic applications is the main part of indoor-outdoor electromagnetic field exposure. Long-term effects of 2.45-GHz Wi-Fi radiation on male reproductive system was not known completely. Therefore, this study aimed to investigate the major cause of male infertility during short- and long-term exposure of Wi-Fi radiation. This is an animal experimental study, which was conducted in the Department of Anatomical Sciences, Faculty of Medicine, Zanjan University of Medical Sciences, Zanjan, IRAN, from June to August 2014. Three-month-old male Wistar rats (n=27) were exposed to the 2.45 GHz radiation in a chamber with two Wi-Fi antennas on opposite walls. Animals were divided into the three following groups: I. control group (n=9) including healthy animals without any exposure to the antenna, II. 1-hour group (n=9) exposed to the 2.45 GHz Wi-Fi radiation for 1 hour per day during two months and III.7-hour group (n=9) exposed to the 2.45 GHz Wi-Fi radiation for 7 hours per day during 2 months. Sperm parameters, caspase-3 concentrations, histomorphometric changes of testis in addition to the apoptotic indexes were evaluated in the exposed and control animals. Both 1-hour and 7-hour groups showed a decrease in sperm parameters in a time dependent pattern. In parallel, the number of apoptosis-positive cells and caspase-3 activity increased in the seminiferous tubules of exposed rats. The seminal vesicle weight reduced significantly in both1-hour or 7-hour groups in comparison to the control group. Regarding to the progressive privilege of 2.45 GHz wireless networks in our environment, we concluded that there should be a major concern regarding the timedependent exposure of whole-body to the higher frequencies of Wi-Fi networks existing in the vicinity of our living places.

  12. Income Differences in Smoking Prevalences in 245 Districts of South Korea: Patterns by Area Deprivation and Urbanity, 2008-2014

    Directory of Open Access Journals (Sweden)

    Ikhan Kim

    2017-03-01

    Full Text Available Objectives The aim of this study was to measure income differences in smoking prevalence at the district level and to investigate correlations among area deprivation, smoking prevalence, and income differences in smoking prevalence, stratified by urbanity. Methods Data were pooled from the Community Health Survey data of South Korea between 2008 and 2014. The age-standardized prevalence of smoking and its interquintile income differences were calculated. We conducted correlation analyses to investigate the association of the deprivation index with smoking prevalence and interquintile differences in smoking prevalence. Results Across 245 districts, the median prevalence of smoking in men was 45.9% (95% confidence interval [CI], 43.4 to 48.5%, with an interquartile range (IQR of 4.6% points. In women, the median prevalence was 3.0% (95% CI, 2.4 to 3.6% and IQR was 1.6% points. The median interquintile difference in smoking prevalence was 7.4% points (95% CI, 1.6 to 13.2% points in men and 2.7% points (95% CI, 0.5 to 4.9% points in women. The correlation coefficients for the association between the deprivation index and smoking prevalence was 0.58, 0.15, -0.22 in metropolitan, urban, and rural areas, respectively, among men, and 0.54, -0.33, -0.43 among women. No meaningful correlation was found between area deprivation and interquintile difference in smoking prevalence. The correlation between smoking prevalence and interquintile difference in smoking prevalence was more evident in women than in men. Conclusions This study provides evidence of geographical variations in smoking prevalence and interquintile difference in smoking prevalence. Neither smoking prevalence nor the deprivation index was closely correlated with interquintile income difference in smoking prevalence. Measuring inequalities in smoking prevalence is crucial to developing policies aimed at reducing inequalities in smoking.

  13. Income Differences in Smoking Prevalences in 245 Districts of South Korea: Patterns by Area Deprivation and Urbanity, 2008-2014.

    Science.gov (United States)

    Kim, Ikhan; Bahk, Jinwook; Yoon, Tae-Ho; Yun, Sung-Cheol; Khang, Young-Ho

    2017-03-01

    The aim of this study was to measure income differences in smoking prevalence at the district level and to investigate correlations among area deprivation, smoking prevalence, and income differences in smoking prevalence, stratified by urbanity. Data were pooled from the Community Health Survey data of South Korea between 2008 and 2014. The age-standardized prevalence of smoking and its interquintile income differences were calculated. We conducted correlation analyses to investigate the association of the deprivation index with smoking prevalence and interquintile differences in smoking prevalence. Across 245 districts, the median prevalence of smoking in men was 45.9% (95% confidence interval [CI], 43.4 to 48.5%), with an interquartile range (IQR) of 4.6% points. In women, the median prevalence was 3.0% (95% CI, 2.4 to 3.6%) and IQR was 1.6% points. The median interquintile difference in smoking prevalence was 7.4% points (95% CI, 1.6 to 13.2% points) in men and 2.7% points (95% CI, 0.5 to 4.9% points) in women. The correlation coefficients for the association between the deprivation index and smoking prevalence was 0.58, 0.15, -0.22 in metropolitan, urban, and rural areas, respectively, among men, and 0.54, -0.33, -0.43 among women. No meaningful correlation was found between area deprivation and interquintile difference in smoking prevalence. The correlation between smoking prevalence and interquintile difference in smoking prevalence was more evident in women than in men. This study provides evidence of geographical variations in smoking prevalence and interquintile difference in smoking prevalence. Neither smoking prevalence nor the deprivation index was closely correlated with interquintile income difference in smoking prevalence. Measuring inequalities in smoking prevalence is crucial to developing policies aimed at reducing inequalities in smoking.

  14. Design, synthesis and evaluation of unique 2,4,5-triaryl imidazole derivatives as novel potent aspartic protease inhibitors.

    Science.gov (United States)

    Khan, Mohd Sajid; Akhtar, Salman; Siddiqui, S A; Siddiqui, M S; Srinivasan, K V; Arif, J M

    2012-05-01

    The 2,4,5-triaryl imidazole derivatives (API) were designed, screened and characterized kinetically & thermodynamically against Pepsin and their activity was also tested on the in silico platform. The docking studies of API with Pepsin show that these are novel and unique inhibitors of Aspartic protease. Drug like properties of these compounds were validated in silico based on Lipinski's rule of Five by calculating ClogP, LogS, H-bond acceptors, H-Bond donors, rotational bonds, PSA, PB and BBB values. The Et/Ki and Et/Km values of API show that they follow the Michaelis-Menten kinetics. The binding of inhibitors with proteases was explained by using Van't Hoff plot and thermodynamic parameters viz. free energy (ΔG), Entropy (ΔS) and Enthalpy (ΔH). The Van't Hoff analysis showed that the value of Ki decreases with increase in temperature and the binding of the inhibitor are entropically driven. API act as new potent aspartic protease inhibitors with Ki, for Pepsin, ranges from 3.7 µM to 16.7 µM. Strong hydrophobic groups at C-4 & C-5 position in API favor binding of inhibitors with Pepsin. Experiments also showed that among C-2 aryl substituted imidazole, a 4-substitution on aryl ring is preferred and less polar substituent makes the molecule more active whereas polar substituents at 2-position on C-2 aryl ring makes the molecule less active. The docking studies of API with Pepsin further intensify and validate our results.

  15. Study of the rhizobacterium Azospirillum brasilense Sp245 using Mössbauer spectroscopy with a high velocity resolution: Implication for the analysis of ferritin-like iron cores

    Science.gov (United States)

    Alenkina, I. V.; Oshtrakh, M. I.; Tugarova, A. V.; Biró, B.; Semionkin, V. A.; Kamnev, A. A.

    2014-09-01

    The results of a comparative study of two samples of the rhizobacterium Azospirillum brasilense (strain Sp245) prepared in different conditions and of human liver ferritin using Mössbauer spectroscopy with a high velocity resolution demonstrated the presence of ferritin-like iron (i.e. iron similar to that found in ferritin-like proteins) in the bacterium. Mössbauer spectra of these samples were fitted in two ways: as a rough approximation using a one quadrupole doublet fit (the homogeneous iron core model) and using a superposition of quadrupole doublets (the heterogeneous iron core model). Both results demonstrated differences in the Mössbauer parameters for mammalian ferritin and for bacterial ferritin-like iron. Moreover, some differences in the Mössbauer parameters were observed between the two samples of A. brasilense Sp245 related to the differences in their preparation conditions.

  16. Rats exposed to 2.45GHz of non-ionizing radiation exhibit behavioral changes with increased brain expression of apoptotic caspase 3.

    Science.gov (United States)

    Varghese, Rini; Majumdar, Anuradha; Kumar, Girish; Shukla, Amit

    2018-03-01

    In recent years there has been a tremendous increase in use of Wi-Fi devices along with mobile phones, globally. Wi-Fi devices make use of 2.4GHz frequency. The present study evaluated the impact of 2.45GHz radiation exposure for 4h/day for 45days on behavioral and oxidative stress parameters in female Sprague Dawley rats. Behavioral tests of anxiety, learning and memory were started from day 38. Oxidative stress parameters were estimated in brain homogenates after sacrificing the rats on day 45. In morris water maze, elevated plus maze and light dark box test, the 2.45GHz radiation exposed rats elicited memory decline and anxiety behavior. Exposure decreased activities of super oxide dismutase, catalase and reduced glutathione levels whereas increased levels of brain lipid peroxidation was encountered in the radiation exposed rats, showing compromised anti-oxidant defense. Expression of caspase 3 gene in brain samples were quantified which unraveled notable increase in the apoptotic marker caspase 3 in 2.45GHz radiation exposed group as compared to sham exposed group. No significant changes were observed in histopathological examinations and brain levels of TNF-α. Analysis of dendritic arborization of neurons showcased reduction in number of dendritic branching and intersections which corresponds to alteration in dendritic structure of neurons, affecting neuronal signaling. The study clearly indicates that exposure of rats to microwave radiation of 2.45GHz leads to detrimental changes in brain leading to lowering of learning and memory and expression of anxiety behavior in rats along with fall in brain antioxidant enzyme systems. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Microwave-induced One-pot Synthesis of 2,4,5-trisubstituted Imidazoles Using Rochelle Salt as a Green Novel Catalyst

    Directory of Open Access Journals (Sweden)

    Balasaheb V. Shitole

    2015-09-01

    Full Text Available Rochelle Salt is used as an efficient catalyst for the synthesis of 2,4,5-triaryl-1H-imidazoles via condensation of benzil, ammonium acetate, and aromatic aldehydes. The key advantages of this process are the usage of an inexpensive and readily available catalyst, simple procedure, shorter reaction time, and high yield of products. DOI: http://dx.doi.org/10.17807/orbital.v7i3.720 

  18. Protective effects of β-glucan against oxidative injury induced by 2.45-GHz electromagnetic radiation in the skin tissue of rats.

    Science.gov (United States)

    Ceyhan, Ali Murat; Akkaya, Vahide Baysal; Güleçol, Şeyma Celik; Ceyhan, Betül Mermi; Özgüner, Fehmi; Chen, WenChieh

    2012-09-01

    In recent times, there is widespread use of 2.45-GHz irradiation-emitting devices in industrial, medical, military and domestic application. The aim of the present study was to investigate the effect of 2.45-GHz electromagnetic radiation (EMR) on the oxidant and antioxidant status of skin and to examine the possible protective effects of β-glucans against the oxidative injury. Thirty-two male Wistar albino rats were randomly divided into four equal groups: control; sham exposed; EMR; and EMR + β-glucan. A 2.45-GHz EMR emitted device from the experimental exposure was applied to the EMR group and EMR + β-glucan group for 60 min daily, respectively, for 4 weeks. β-glucan was administered via gavage at a dose of 50 mg/kg/day before each exposure to radiation in the treatment group. The activities of antioxidant enzymes, superoxide dismutase (SOD), glutathione peroxidase (GSH-Px) and catalase (CAT), as well as the concentration of malondialdehyde (MDA) were measured in tissue homogenates of the skin. Exposure to 2.45-GHz EMR caused a significant increase in MDA levels and CAT activity, while the activities of SOD and GSH-Px decreased in skin tissues. Systemic β-glucan significantly reversed the elevation of MDA levels and the reduction of SOD activities. β-glucan treatment also slightly enhanced the activity of CAT and prevented the depletion of GSH-Px activity caused by EMR, but not statistically significantly. The present study demonstrated the role of oxidative mechanisms in EMR-induced skin tissue damages and that β-glucan could ameliorate oxidative skin injury via its antioxidant properties.

  19. Mineralization of 2,4-Dichlorophenoxyacetic Acid (2,4-D) and Mixtures of 2,4-D and 2,4,5-Trichlorophenoxyacetic Acid by Phanerochaete chrysosporium

    Science.gov (United States)

    Yadav, J. S.; Reddy, C. A.

    1993-01-01

    Evidence is presented for mineralization of 2,4-dichlorophenoxyacetic acid (2,4-D) in nutrient-rich media (high-nitrogen and malt extract media) by wild-type Phanerochaete chrysosporium and by a peroxidase-negative mutant of this organism. Mass balance analysis of [U-ring-14C]2,4-D mineralization in malt extract cultures showed 82.7% recovery of radioactivity. Of this, 38.6% was released as 14CO2 and 27.0, 11.2, and 5.9% were present in the aqueous, methylene chloride, and mycelial fractions, respectively. 2,4-D and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) were simultaneously mineralized when presented as a mixture, and mutual inhibition of degradation was not observed. In contrast, a relatively higher rate of mineralization of 2,4-D and 2,4,5-T was observed when these compounds were tested as mixtures than when they were tested alone. PMID:16349039

  20. Electromagnetic fields at 2.45 GHz trigger changes in heat shock proteins 90 and 70 without altering apoptotic activity in rat thyroid gland

    Directory of Open Access Journals (Sweden)

    María José Misa Agustiño

    2012-07-01

    Non-ionizing radiation at 2.45 GHz may modify the expression of genes that codify heat shock proteins (HSP in the thyroid gland. Using the enzyme-linked immunosorbent assay (ELISA technique, we studied levels of HSP-90 and HSP-70. We also used hematoxilin eosin to look for evidence of lesions in the gland and applied the DAPI technique of fluorescence to search for evidence of chromatin condensation and nuclear fragmentation in the thyroid cells of adult female Sprague-Dawley rats. Fifty-four rats were individually exposed for 30 min to 2.45 GHz radiation in a Gigahertz transverse electromagnetic (GTEM cell at different levels of non-thermal specific absorption rate (SAR, which was calculated using the finite difference time domain (FDTD technique. Ninety minutes after radiation, HSP-90 and HSP-70 had decreased significantly (P<0.01 after applying a SAR of 0.046±1.10 W/Kg or 0.104±5.10−3 W/Kg. Twenty-four hours after radiation, HSP-90 had partially recovered and HSP-70 had recovered completely. There were few indications of lesions in the glandular structure and signs of apoptosis were negative in all radiated animals. The results suggest that acute sub-thermal radiation at 2.45 GHz may alter levels of cellular stress in rat thyroid gland without initially altering their anti-apoptotic capacity.

  1. Electromagnetic fields at 2.45 GHz trigger changes in heat shock proteins 90 and 70 without altering apoptotic activity in rat thyroid gland

    Science.gov (United States)

    Misa Agustiño, María José; Leiro, José Manuel; Jorge Mora, María Teresa; Rodríguez-González, Juan Antonio; Jorge Barreiro, Francisco Javier; Ares-Pena, Francisco José; López-Martín, Elena

    2012-01-01

    Summary Non-ionizing radiation at 2.45 GHz may modify the expression of genes that codify heat shock proteins (HSP) in the thyroid gland. Using the enzyme-linked immunosorbent assay (ELISA) technique, we studied levels of HSP-90 and HSP-70. We also used hematoxilin eosin to look for evidence of lesions in the gland and applied the DAPI technique of fluorescence to search for evidence of chromatin condensation and nuclear fragmentation in the thyroid cells of adult female Sprague-Dawley rats. Fifty-four rats were individually exposed for 30 min to 2.45 GHz radiation in a Gigahertz transverse electromagnetic (GTEM) cell at different levels of non-thermal specific absorption rate (SAR), which was calculated using the finite difference time domain (FDTD) technique. Ninety minutes after radiation, HSP-90 and HSP-70 had decreased significantly (Papplying a SAR of 0.046±1.10 W/Kg or 0.104±5.10−3 W/Kg. Twenty-four hours after radiation, HSP-90 had partially recovered and HSP-70 had recovered completely. There were few indications of lesions in the glandular structure and signs of apoptosis were negative in all radiated animals. The results suggest that acute sub-thermal radiation at 2.45 GHz may alter levels of cellular stress in rat thyroid gland without initially altering their anti-apoptotic capacity. PMID:23213477

  2. Structure, activity and thermostability investigations of OXA-163, OXA-181 and OXA-245 using biochemical analysis, crystal structures and differential scanning calorimetry analysis.

    Science.gov (United States)

    Lund, Bjarte Aarmo; Thomassen, Ane Molden; Carlsen, Trine Josefine Olsen; Leiros, Hanna Kirsti S

    2017-10-01

    The first crystal structures of the class D β-lactamases OXA-181 and OXA-245 were determined to 2.05 and 2.20 Å resolution, respectively; in addition, the structure of a new crystal form of OXA-163 was resolved to 2.07 Å resolution. All of these enzymes are OXA-48-like and have been isolated from different clinical Klebsiella pneumoniae strains and also from other human pathogens such as Pseudomonas aeruginosa and Escherichia coli. Here, enzyme kinetics and thermostability studies are presented, and the new crystal structures are used to explain the observed variations. OXA-245 had the highest melting point (T m = 55.8°C), as determined by differential scanning calorimetry, compared with OXA-163 (T m = 49.4°C) and OXA-181 (T m = 52.6°C). The differences could be explained by the loss of two salt bridges in OXA-163, and an overall decrease in the polarity of the surface of OXA-181 compared with OXA-245.

  3. CW/Pulsed H- ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    Science.gov (United States)

    Peng, S. X.; Ren, H. T.; Xu, Y.; Zhang, T.; Zhang, A. L.; Zhang, J. F.; Zhao, J.; Guo, Z. Y.; Chen, J. E.

    2015-04-01

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H- beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H- source able to produce very intense H- beams with important variation of the duty factor[1]. Recently, a new version of 2.45 GHz microwave H- ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H- ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H- beam with rms emittance about 0.16 π.mm.mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H- ion beam at 35 keV with rms emittance about 0.2 π.mm.mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H- source body is ϕ116 mm × 124 mm, and the entire H- source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper.

  4. WE-DE-207B-05: Measuring Spatial Resolution in Digital Breast Tomosynthesis: Update of AAPM Task Group 245

    Energy Technology Data Exchange (ETDEWEB)

    Scaduto, DA; Hu, Y-H; Zhao, W [Stony Brook Medicine, Stony Brook, NY (United States); Goodsitt, M; Chan, H-P [University Michigan, Ann Arbor, MI (United States); Olafsdottir, H [Image Owl, 105 Reykjavik (Iceland); Das, M [University Houston, Houston, TX (United States); Fredenberg, E [Philips Healthcare, Solna (Sweden); Geiser, W [UT MD Anderson Cancer Center, Houston, TX (United States); Goodenough, D [The George Washington University, Washington, DC (United States); Heid, P [ARCADES, Marseille (France); Liu, B [Massachusetts General Hospital, Boston, MA (United States); Mainprize, J [Sunnybrook Health Sciences Centre, North York, ON (Canada); Reiser, I [The University of Chicago, Chicago, IL (United States); Van Engen, R [LRCB, Nijmegen (Netherlands); Varchena, V [CIRS Inc., Norfolk, VA (United States); Vecchio, S [I.M.S., Pontecchio Marconi (Italy); Glick, S [Food and Drug Administration, Silver Spring, MD (United States)

    2016-06-15

    Purpose: Spatial resolution in digital breast tomosynthesis (DBT) is affected by inherent/binned detector resolution, oblique entry of x-rays, and focal spot size/motion; the limited angular range further limits spatial resolution in the depth-direction. While DBT is being widely adopted clinically, imaging performance metrics and quality control protocols have not been standardized. AAPM Task Group 245 on Tomosynthesis Quality Control has been formed to address this deficiency. Methods: Methods of measuring spatial resolution are evaluated using two prototype quality control phantoms for DBT. Spatial resolution in the detector plane is measured in projection and reconstruction domains using edge-spread function (ESF), point-spread function (PSF) and modulation transfer function (MTF). Spatial resolution in the depth-direction and effective slice thickness are measured in the reconstruction domain using slice sensitivity profile (SSP) and artifact spread function (ASF). An oversampled PSF in the depth-direction is measured using a 50 µm angulated tungsten wire, from which the MTF is computed. Object-dependent PSF is derived and compared with ASF. Sensitivity of these measurements to phantom positioning, imaging conditions and reconstruction algorithms is evaluated. Results are compared from systems of varying acquisition geometry (9–25 projections over 15–60°). Dependence of measurements on feature size is investigated. Results: Measurements of spatial resolution using PSF and LSF are shown to depend on feature size; depth-direction spatial resolution measurements are shown to similarly depend on feature size for ASF, though deconvolution with an object function removes feature size-dependence. A slanted wire may be used to measure oversampled PSFs, from which MTFs may be computed for both in-plane and depth-direction resolution. Conclusion: Spatial resolution measured using PSF is object-independent with sufficiently small object; MTF is object

  5. [Changes in Cell Surface Properties and Biofilm Formation Efficiency in Azospirillum brasilense Sp245 Mutants in the Putative Genes of Lipid Metabolism mmsB1 and fabG1].

    Science.gov (United States)

    Shumilova, E; Shelud'ko, A V; Filip'echeva, Yu A; Evstigneeva, S S; Ponomareva, E G; Petrova, L P; Katsy, E I

    2016-01-01

    The previously obtained insertion mutants ofAzospirillum brasilense Sp245 in the genes mmsBl and fabG1 (strains SK039 and Sp245.1610, respectively) were characterized by impaired flagellation and motility. The putative products of expression of these genes are 3-hydroxyisobutyrate dehydrogenase and 3-oxoacyl-[acyl-carrier protein] reductase, respectively. In the present work, A. brasilense- Sp245 strains SK039 and Sp245.1610 were found to have differences in the content of 3-hydroxyhexadecanoic, hexadecanoic, 3-hydroxytetradecanoic, hexadecenoic, octadecenoic, and nonadecanoic acids in their lipopolysaccharide prepa- rations, as well as in cell hydrophobicity and hemagglutination activity and dynamics of cell aggregation, in biomass amount, and in the relative content of lipopolysaccharide antigens in mature biofilms formed on hydrophilic or hydrophobic surfaces.

  6. Report on the low-RF-power and data-acquisition-systems of the 2.45 GHz Lower-Hybrid Transmitter at the ASDEX tokamak

    International Nuclear Information System (INIS)

    Zouhar, M.; Monaco, F.

    1989-03-01

    This report relates to the low-power section of the 2.45 GHz transmitter used for current drive experiments at the ASDEX tokamak. The high-RF-power section is dealt with elsewhere. Data acquisition and evaluation of quantities pertaining to the Lower Hybrid experiment are also treated here. As in the previous report on the 1.3 GHz system (M. Zouhar: 'Beschreibung des Niederleistungsteils des HF-Systems fuer die LH-Experimente in ASDEX.', IPP-report 4/218, February 1984), most space is spent in commenting upon the amplitude (power)- and phase-feedback control loops. (orig.)

  7. The relationship between visible light emission and species fraction of the hydrogen ion beams extracted from 2.45 GHz microwave discharge

    CERN Document Server

    Cortázar, O D; Tarvainen, O; Kalvas, T; Koivisto, H

    2015-01-01

    The relationship between Balmer-α and Fulcher-band emissions with extracted H +, H+2 , and H+3 ions is demonstrated for a 2.45 GHz microwave discharge. Ion mass spectra and optical measurements of Balmer-α and Fulcher-band emissions have been obtained with a Wien Filter having an optical view-port on the plasma chamber axis. The beam of approximately 1 mA is analyzed for different plasma conditions simultaneously with the measurement of light emissions both with temporal resolution. The use of visible light emissions as a valuable diagnostic tool for monitoring the species fraction of the extracted beams is proposed.

  8. High Concentration InGaN/GaN Multi-Quantum Well Solar Cells with a Peak Open-Circuit Voltage of 2.45 V

    International Nuclear Information System (INIS)

    Zhang Dong-Yan; Zheng Xin-He; Li Xue-Fei; Wu Yuan-Yuan; Wang Jian-Feng; Yang Hui

    2012-01-01

    We report InGaN/GaN multi-quantum well (MQW) solar cells with a comparatively high open-circuit voltage and good concentration properties. The open circuit voltage (V oc ) keeps increasing logarithmically with concentration ratio until 60 suns. The peak V oc of InGaN/GaN MQW solar cells, which has a predominant peak wavelength of 456 nm from electroluminescence measurements, is found to be 2.45 V when the concentration ratio reaches 333×. Furthermore, the dependence of conversion efficiency and fill factor on concentration ratio are analyzed. (cross-disciplinary physics and related areas of science and technology)

  9. Time-Domain Measurement of the Ear-to-Ear On-Body Path Gain at 2.45 GHz in a Radio Anechoic Environment

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Thaysen, Jesper; Jakobsen, Kaj Bjarne

    2012-01-01

    The ear-to-ear on-body path gain (jS21j) at 2:45 GHz is measured in the time domain. The measurements were conducted in a radio anechoic environment to study the effects of the on-body paths only. Two different monopole antenna configurations that are polarized normal and tangential to the surface...... of the head, respectively, are compared. The results are presented in terms of mean path gain, Cumulative Distribution Function, Average Fade Duration, and Level Crossing Rate. Several probability distributions are fitted to the data by the use of Maximum Likelihood Estimation and ranked according...

  10. Effect of a 2.45-GHz radiofrequency electromagnetic field on neutrophil chemotaxis and phagocytosis in differentiated human HL-60 cells.

    Science.gov (United States)

    Koyama, Shin; Narita, Eijiro; Suzuki, Yoshihisa; Taki, Masao; Shinohara, Naoki; Miyakoshi, Junji

    2015-01-01

    The potential public health risks of radiofrequency (RF) fields have been discussed at length, especially with the use of mobile phones spreading extensively throughout the world. In order to investigate the properties of RF fields, we examined the effect of 2.45-GHz RF fields at the specific absorption rate (SAR) of 2 and 10 W/kg for 4 and 24 h on neutrophil chemotaxis and phagocytosis in differentiated human HL-60 cells. Neutrophil chemotaxis was not affected by RF-field exposure, and subsequent phagocytosis was not affected either compared with that under sham exposure conditions. These studies demonstrated an initial immune response in the human body exposed to 2.45-GHz RF fields at the SAR of 2 W/kg, which is the maximum value recommended by the International Commission for Non-Ionizing Radiation Protection (ICNIRP) guidelines. The results of our experiments for RF-field exposure at an SAR under 10 W/kg showed very little or no effects on either chemotaxis or phagocytosis in neutrophil-like human HL-60 cells. © The Author 2014. Published by Oxford University Press on behalf of The Japan Radiation Research Society and Japanese Society for Radiation Oncology.

  11. Assessing the efficacy of co-inoculation of wheat seedlings with the associative bacteria Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245.

    Science.gov (United States)

    Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V

    2016-03-01

    Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants.

  12. Fate of the herbicides 2,4,5-T, atrazine, and DNOC in a shallow, anaerobic aquifer investigated by in situ passive diffusive emitters and laboratory batch experiments

    DEFF Research Database (Denmark)

    Arildskov, N.P.; Pedersen, Philip Grinder; Albrechtsen, Hans-Jørgen

    2001-01-01

    from 3 to 3.5 rubs, only 27% to 52% of the 2,4,5-T remained after 196 days. 2,4,5-trichlorophenol was identified as the major metabolite. A lag period of at least 50 days was observed, and no degradation occurred in HgCl2 amended controls, verifying that the process was microbially mediated...... following first-order kinetics. The removal mechanism was likely an abiotic reduction. At day 25, the first-order rate constant was 1.47 d(-1), but it decreased with time and seemed to stabilize at 0.35 d(-1) after 150 to 200 days. In the laboratory, batch experiments were conducted with sediments from 3...... to 4 rubs and from 8 to 9 rubs. In these incubations, formation of Fe2+ and depletion of sulfate showed iron and sulfate reduction in sediment from 3 to 3.5 rubs and sulfate reduction in 3.5 to 4 rubs sediment. In sediment from 8 to 9 rubs, the dominant redox process was methane formation. In sediment...

  13. The ameliorative effect of gallic acid on pancreas lesions induced by 2.45 GHz electromagnetic radiation (Wi-Fi in young rats

    Directory of Open Access Journals (Sweden)

    Senay Topsakal

    2017-07-01

    Full Text Available The aim of this study was to investigate the effects of electromagnetic radiation (EMR on the pancreas tissue of young rats and the ameliorative effect of Gallic acid (GA. Six-week-old, 48 male rats were equally divided into four groups: Sham group, EMR group (2.45 GHz, EMR (2.45 GHz+GA group (30 mg/kg/daily orally and GA group (30 mg/kg/daily. After 30 days, serum and pancreatic tissue samples were harvested for biochemical, histopathological and immunohistochemical analysis. Serum amylase, lipase, glucose, and tissue malondialdehyde, total oxidant status and oxidative stress index were increased, whereas total antioxidant status decreased in the EMR group. The histopathological examination of the pancreases indicated slight degenerative changes in some pancreatic endocrine and exocrine cells and slight inflammatory cell infiltrations in the EMR group. At the immunohistochemical examination, marked increase was observed in calcitonin gene related protein and Prostaglandin E2 expressions in pancreatic cells in this group. There were no changes in interleukin-6 expirations. GA ameliorated biochemical and pathological findings in the EMR+GA group. These findings clearly demonstrate that EMR can cause degenerative changes in both endocrine and exocrine pancreas cells in rats during the developmental period and GA has an ameliorative effect.

  14. Pantothenate kinase-associated neurodegeneration initially presenting as postural tremor alone in a Japanese family with homozygous N245S substitutions in the pantothenate kinase gene.

    Science.gov (United States)

    Yamashita, Satoshi; Maeda, Yasushi; Ohmori, Hiroyuki; Uchida, Yuji; Hirano, Teruyuki; Yonemura, Kiminobu; Uyama, Eiichiro; Uchino, Makoto

    2004-10-15

    We describe a 24-year-old Japanese woman with pantothenate kinase-associated neurodegeneration (PKAN) whose only early symptom was postural tremor in the right hand at around 18 years of age, leading to a diagnosis of essential tremor at age 21. Although she was treated with arotinolol hydrochloride and clonazepam, she gradually progressed to extrapyramidal and pyramidal signs several years later. T2-weighted magnetic resonance images (MRI) showed bilaterally marked hypointensity with a central region of hyperintensity in the globus pallidus, or the so-called "eye-of-the-tiger" sign. Six years have passed since the initial appearance of postural tremor, whereas she has not shown choreoathetosis, retinitis pigmentosa, optic atrophy, or seizure. Direct sequencing of the patient's genomic DNA revealed homozygous base substitutions in the pantothenate kinase gene (PANK2): the A764-->G substitution (N245S) due to consanguinity of her parents. Although the heterozygous form of this mutation has already been reported among several families, this is the first report of the homozygous mutation in a patient with atypical-type PKAN. This detailed description of the clinical features of a Japanese patient with PKAN arising from homozygous N245S mutations in PANK2 would be useful for elucidating the pathogenesis of PKAN.

  15. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  16. On the use of the Hα spectral line to determine the electron density in a microwave (2.45 GHz) plasma torch at atmospheric pressure

    International Nuclear Information System (INIS)

    Yubero, C.; Garcia, M.C.; Calzada, M.D.

    2006-01-01

    The electron density of an argon microwave (2.45 GHz) plasma flame generated at atmospheric pressure has been determined by using the Stark broadening of the experimentally measured H α line emitted by the discharge. The H β line was not observable under the experimental conditions of this discharge. Two methods have been employed to obtain the electron density from the Stark broadening of the H α line. The first used the Gigosos-Cardenoso computational model that considers the strong broadening of the H α line by ionic dynamics. Alternatively, a second method based on a calibration of Stark broadenings of H α and H β lines offered a simpler way to obtain the electron density

  17. Dosimetry of a set-up for the exposure of newborn mice to 2.45-GHZ WiFi frequencies.

    Science.gov (United States)

    Pinto, R; Lopresto, V; Galloni, P; Marino, C; Mancini, S; Lodato, R; Pioli, C; Lovisolo, G A

    2010-08-01

    This work describes the dosimetry of a two waveguide cell system designed to expose newborn mice to electromagnetic fields associated with wireless fidelity signals in the frequency band of 2.45 GHz. The dosimetric characterisation of the exposure system was performed both numerically and experimentally. Specific measures were adopted with regard to the increase in both weight and size of the biological target during the exposure period. The specific absorption rate (SAR, W kg(-1)) for 1 W of input power vs. weight curve was assessed. The curve evidenced an SAR pattern varying from 6 W kg(-1) during the first 5 weeks of the life of mice, with a peak resonance phenomenon at a weight around 5 g. This curve was used to set the appropriate level of input power during experimental sessions to expose the growing mice to a defined and constant dose.

  18. Ionophore silica-coated magnetite nanoparticles as a recyclable heterogeneous catalyst for one-pot green synthesis of 2,4,5-trisubstituted imidazoles.

    Science.gov (United States)

    Naeimi, Hossein; Aghaseyedkarimi, Dorsa

    2016-01-21

    Novel multi-SO3H functionalized strong Brønsted acidic ionic liquid coated magnetite nanoparticles have been prepared and applied as catalyst for the synthesis of 2,4,5-trisubstituted imidazoles. The results showed that a novel catalyst was very efficient for the reaction and could be magnetically separated and reused at least 6 times with less reduction in its catalytic activity. Operational simplicity, low cost of the catalyst used, high yields, environmental friendliness, wide applicability, reusability and easy recovery of the catalyst using an external magnet are the most important features of this methodology. The catalyst was characterized by Fourier transform infrared spectroscopy (FT-IR), X-Ray diffraction analysis (XRD), field emission scanning electron microscopy (FE-SEM), energy dispersive X-ray analysis (EDX), dynamic laser scattering (DLS) and vibrating sample magnetometry (VSM).

  19. Dielectric and magnetic properties of NiFe{sub 2}O{sub 4} at 2.45 GHz and heating capacity for potential uses under microwaves

    Energy Technology Data Exchange (ETDEWEB)

    Polaert, Isabelle, E-mail: isabelle.polaert@insa-rouen.fr [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Bastien, Samuel [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Legras, Benoit [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Estel, Lionel [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Braidy, Nadi [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada)

    2015-01-15

    This paper presents the dielectric and magnetic properties, measured at 2.45 GHz, of a new nickel ferrite, NiFe{sub 2}O{sub 4}, synthetized by plasma technology. These properties were measured by the small perturbation method in a resonant cavity, from 293 to 513 K. Using these values, the adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave irradiation was also modeled. The wave propagation equation (Maxwell's equation) coupled to the heat transfer in the solid was numerically solved. The influence of parameters such as the bed volume, its porosity, the microwave incident power or the microwave system geometry is discussed. This study demonstrates that NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K under microwaves and can probably achieve higher temperatures according to the thermal insulation. The magnetic contribution to heating overcomes the dielectric one in the explored temperature range. Very efficient energy yield (>90%) can then be achieved when the magnetic field position is centered over the bed. - Highlights: • A new nickel ferrite, NiFe{sub 2}O{sub 4}, was synthetized by plasma technology. • Its dielectric and magnetic properties were measured at 2.45 GHz. • The adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave was modeled. • NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K. • The magnetic contribution to heating overcomes the dielectric one from 293 K to 513 K.

  20. Solubility of acetic acid and trifluoroacetic acid in low-temperature (207-245 k) sulfuric acid solutions: implications for the upper troposphere and lower stratosphere.

    Science.gov (United States)

    Andersen, Mads P Sulbaek; Axson, Jessica L; Michelsen, Rebecca R H; Nielsen, Ole John; Iraci, Laura T

    2011-05-05

    The solubility of gas-phase acetic acid (CH(3)COOH, HAc) and trifluoroacetic acid (CF(3)COOH, TFA) in aqueous sulfuric acid solutions was measured in a Knudsen cell reactor over ranges of temperature (207-245 K) and acid composition (40-75 wt %, H(2)SO(4)). For both HAc and TFA, the effective Henry's law coefficient, H*, is inversely dependent on temperature. Measured values of H* for TFA range from 1.7 × 10(3) M atm(-1) in 75.0 wt % H(2)SO(4) at 242.5 K to 3.6 × 10(8) M atm(-1) in 40.7 wt % H(2)SO(4) at 207.8 K. Measured values of H* for HAc range from 2.2 × 10(5) M atm(-1) in 57.8 wt % H(2)SO(4) at 245.0 K to 3.8 × 10(8) M atm(-1) in 74.4 wt % H(2)SO(4) at 219.6 K. The solubility of HAc increases with increasing H(2)SO(4) concentration and is higher in strong sulfuric acid than in water. In contrast, the solubility of TFA decreases with increasing sulfuric acid concentration. The equilibrium concentration of HAc in UT/LS aerosol particles is estimated from our measurements and is found to be up to several orders of magnitude higher than those determined for common alcohols and small carbonyl compounds. On the basis of our measured solubility, we determine that HAc in the upper troposphere undergoes aerosol partitioning, though the role of H(2)SO(4) aerosol particles as a sink for HAc in the upper troposphere and lower stratosphere will only be discernible under high atmospheric sulfate perturbations.

  1. Synthesis and crystal structure of a new homoleptic tetraarylruthenium(IV) complex Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chang-Jiu; Wu, Xiu-Li; Ma, Xiu-Fang; Jia, Ai-Quan; Zhang, Qian-Feng [Anhui Univ. of Technology, Anhui (China). Inst. of Molecular Engineering and Applied Chemistry and Anhui Province Key Lab. of Metallurgy Engineering and Resources Recycling

    2017-08-01

    Treatment of [Ru(acac){sub 3}] (acac-=acetylacetonate) with (2,4,5-Me{sub 3}C{sub 6}H{sub 2})MgBr, followed by column chromatography in air, afforded the homoleptic tetraaryl-ruthenium(IV) complex [Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}] (1) in moderate yield. The product was characterized by proton NMR spectroscopy and microanalyses. Its crystal structure has also been established by X-ray crystallography.

  2. [Insertional mutation in the AZOBR_p60120 gene is accompanied by defects in the synthesis of lipopolysaccharide and calcofluor-binding polysaccharides in the bacterium Azospirillum brasilense Sp245].

    Science.gov (United States)

    Katsy, E I; Prilipov, A G

    2015-03-01

    In the bacterium Azospirillum brasilense Sp245, extracellular calcofluor-binding polysaccharides (Cal+ phenotype) and two types of lipopolysaccharides, LPSI and LPSII, were previously identified. These lipopolysaccharides share the same repeating O-polysaccharide unit but have different antigenic structures and different charges of their O-polysaccharides and/or core oligosaccharides. Several dozens of predicted genes involved in the biosynthesis of polysaccharides have been localized in the AZOBR_p6 plasmid of strain Sp245 (GenBank accession no. HE577333). In the present work, it was demonstrated that an artificial transposon Omegon-Km had inserted into the central region of the AZOBR_p60120 gene in the A. brasilense Sp245 LPSI- Cal- KM252 mutant. In A. brasilense strain Sp245, this plasmid gene encodes a putative glycosyltransferase containing conserved domains characteristic of the enzymes participating in the synthesis of O-polysaccharides and capsular polysaccharides (accession no. YP004987664). In mutant KM252, a respective predicted protein is expected to be completely inactivated. As a result of the analysis of the EcoRI fragment of the AZOBR_p6 plasmid, encompassing the AZOBR_p60120 gene and a number of other loci, novel data on the structure of AZOBR_p6 were obtained: an approximately 5-kb gap (GenBank accession no. KM189439) was closed in the nucleotide sequence of this plasmid.

  3. Performance comparison of low-grade ORCs (organic Rankine cycles) using R245fa, pentane and their mixtures based on the thermoeconomic multi-objective optimization and decision makings

    International Nuclear Information System (INIS)

    Feng, Yongqiang; Hung, TzuChen; Zhang, Yaning; Li, Bingxi; Yang, Jinfu; Shi, Yang

    2015-01-01

    Based on the thermoeconomic multi-objective optimization and decision makings, considering both exergy efficiency and LEC (levelized energy cost), the performance comparison of low-grade ORCs (organic Rankine cycles) using R245fa, pentane and their mixtures has been investigated. The effects of mass fraction of R245fa and four key parameters on the exergy efficiency and LEC are examined. The Pareto-optimal solutions are selected from the Pareto optimal frontier obtained by NSGA-II algorithm using three decision makings, including Shannon Entropy, LINMAP and TOPSIS. The deviation index is introduced to evaluate different decision makings. Research demonstrates that as the mass fraction of R245fa increasing, the exergy efficiency decreases first and then increases, while LEC presents a reverse trend. The optimum values from TOPSIS decision making are selected as the preferred Pareto-optimal solution for its lowest deviation index. The Pareto-optimal solutions for pentane, R245fa, and 0.5pentane/0.5R245fa in pairs of (exergy efficiency, LEC) are (0.5425, 0.104), (0.5502, 0.111), and (0.5212, 0.108), respectively. The mixture working fluids present lower thermodynamic performance and moderate economic performance than the pure working fluids under the Pareto optimization. - Highlights: • The thermoeconomic comparison between pure and mixture working fluids is investigated. • The Pareto-optimal solutions with bi-objective function using three decision makings are obtained. • The optimum values from TOPSIS decision making are selected as the preferred Pareto-optimal solution. • The mixture yields lower thermodynamic performance and moderate economic performance.

  4. Plasmid AZOBR_p1-borne fabG gene for putative 3-oxoacyl-[acyl-carrier protein] reductase is essential for proper assembly and work of the dual flagellar system in the alphaproteobacterium Azospirillum brasilense Sp245.

    Science.gov (United States)

    Filip'echeva, Yulia A; Shelud'ko, Andrei V; Prilipov, Alexei G; Burygin, Gennady L; Telesheva, Elizaveta M; Yevstigneyeva, Stella S; Chernyshova, Marina P; Petrova, Lilia P; Katsy, Elena I

    2018-02-01

    Azospirillum brasilense can swim and swarm owing to the activity of a constitutive polar flagellum (Fla) and inducible lateral flagella (Laf), respectively. Experimental data on the regulation of the Fla and Laf assembly in azospirilla are scarce. Here, the coding sequence (CDS) AZOBR_p1160043 (fabG1) for a putative 3-oxoacyl-[acyl-carrier protein (ACP)] reductase was found essential for the construction of both types of flagella. In an immotile leaky Fla - Laf - fabG1::Omegon-Km mutant, Sp245.1610, defects in flagellation and motility were fully complemented by expressing the CDS AZOBR_p1160043 from plasmid pRK415. When pRK415 with the cloned CDS AZOBR_p1160045 (fliC) for a putative 65.2 kDa Sp245 Fla flagellin was transferred into the Sp245.1610 cells, the bacteria also became able to assemble a motile single flagellum. Some cells, however, had unusual swimming behavior, probably because of the side location of the organelle. Although the assembly of Laf was not restored in Sp245.1610 (pRK415-p1160045), this strain was somewhat capable of swarming motility. We propose that the putative 3-oxoacyl-[ACP] reductase encoded by the CDS AZOBR_p1160043 plays a role in correct flagellar location in the cell envelope and (or) in flagellar modification(s), which are also required for the inducible construction of Laf and for proper swimming and swarming motility of A. brasilense Sp245.

  5. Computational model for calculating body-core temperature elevation in rabbits due to whole-body exposure at 2.45 GHz

    Science.gov (United States)

    Hirata, Akimasa; Sugiyama, Hironori; Kojima, Masami; Kawai, Hiroki; Yamashiro, Yoko; Fujiwara, Osamu; Watanabe, Soichi; Sasaki, Kazuyuki

    2008-06-01

    In the current international guidelines and standards with regard to human exposure to electromagnetic waves, the basic restriction is defined in terms of the whole-body average-specific absorption rate. The rationale for the guidelines is that the characteristic pattern of thermoregulatory response is observed for the whole-body average SAR above a certain level. However, the relationship between energy absorption and temperature elevation was not well quantified. In this study, we improved our thermal computation model for rabbits, which was developed for localized exposure on eye, in order to investigate the body-core temperature elevation due to whole-body exposure at 2.45 GHz. The effect of anesthesia on the body-core temperature elevation was also discussed in comparison with measured results. For the whole-body average SAR of 3.0 W kg-1, the body-core temperature in rabbits elevates with time, without becoming saturated. The administration of anesthesia suppressed body-core temperature elevation, which is attributed to the reduced basal metabolic rate.

  6. Early plant growth and biochemical responses induced by Azospirillum brasilense Sp245 lipopolysaccharides in wheat (Triticum aestivum L.) seedlings are attenuated by procyanidin B2.

    Science.gov (United States)

    Vallejo-Ochoa, Juan; López-Marmolejo, Mariel; Hernández-Esquivel, Alma Alejandra; Méndez-Gómez, Manuel; Suárez-Soria, Laura Nicolasa; Castro-Mercado, Elda; García-Pineda, Ernesto

    2018-03-01

    This study analyzes the effects of procyanidin B2 on early wheat plant growth and plant biochemical responses promoted by lipopolysaccharides (LPS) derived from the rhizobacteria Azospirillum brasilense Sp245. Measurements of leaf, root length, fresh weight, and dry weight showed in vitro plant growth stimulation 4 days after treatment with A. brasilense as well as LPS. Superoxide anion (O 2 ·- ) and hydrogen peroxide (H 2 O 2 ) levels increased in seedling roots treated with LPS (100 μg mL -1 ). The chlorophyll content in leaf decreased while the starch content increased 24 h after treatment in seedling roots. The LPS treatment induced a high increase in total peroxidase (POX) (EC 1.11.1.7) activity and ionically bound cell wall POX content in roots, when compared to respective controls. Early plant growth and biochemical responses observed in wheat seedlings treated with LPS were inhibited by the addition of procyanidin B2 (5 μg mL -1 ), a B type proanthocyanidin (PAC), plant-derived polyphenolic compound with binding properties of LPS. All results suggest first that the ionically bound cell wall POX enzymes could be a molecular target of A. brasilense LPS, and second that the recognition or association of LPS by plant cells is required to activate plant responses. This last event could play a critical role during plant growth regulation by A. brasilense LPS.

  7. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz

    International Nuclear Information System (INIS)

    Oizumi, T.; Laakso, I.; Hirata, A.; Fujiwara, O.; Watanabe, S.; Taki, M.; Kojima, M.; Sasaki, H.; Sasaki, K.

    2013-01-01

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye. (authors)

  8. Oxidative stress of brain and liver is increased by Wi-Fi (2.45GHz) exposure of rats during pregnancy and the development of newborns.

    Science.gov (United States)

    Çelik, Ömer; Kahya, Mehmet Cemal; Nazıroğlu, Mustafa

    2016-09-01

    An excessive production of reactive oxygen substances (ROS) and reduced antioxidant defence systems resulting from electromagnetic radiation (EMR) exposure may lead to oxidative brain and liver damage and degradation of membranes during pregnancy and development of rat pups. We aimed to investigate the effects of Wi-Fi-induced EMR on the brain and liver antioxidant redox systems in the rat during pregnancy and development. Sixteen pregnant rats and their 48 newborns were equally divided into control and EMR groups. The EMR groups were exposed to 2.45GHz EMR (1h/day for 5 days/week) from pregnancy to 3 weeks of age. Brain cortex and liver samples were taken from the newborns between the first and third weeks. In the EMR groups, lipid peroxidation levels in the brain and liver were increased following EMR exposure; however, the glutathione peroxidase (GSH-Px) activity, and vitamin A, vitamin E and β-carotene concentrations were decreased in the brain and liver. Glutathione (GSH) and vitamin C concentrations in the brain were also lower in the EMR groups than in the controls; however, their concentrations did not change in the liver. In conclusion, Wi-Fi-induced oxidative stress in the brain and liver of developing rats was the result of reduced GSH-Px, GSH and antioxidant vitamin concentrations. Moreover, the brain seemed to be more sensitive to oxidative injury compared to the liver in the development of newborns. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. The smell of fear: innate threat of 2,5-dihydro-2,4,5-trimethylthiazoline, a single molecule component of a predator odor

    Directory of Open Access Journals (Sweden)

    Jeffrey B Rosen

    2015-08-01

    Full Text Available In the last several years, the importance of understanding what innate threat and fear is, in addition to learning of threat and fear, has become evident. Odors from predators are ecologically relevant stimuli used by prey animals as warnings for the presence of danger. Of importance, these odors are not necessarily noxious or painful, but they have innate threat-like properties. This review summarizes the progress made on the behavioral and neuroanatomical fundamentals of innate fear of the predator odor, 2,5-dihydro-2,4,5-trimethylthiazoline (TMT, a component of fox feces. TMT is one of several single molecule components of predator odors that have been isolated in the last several years. Isolation of these single molecules has allowed for rapid advances in delineating the behavioral constraints and selective neuroanatomical pathways of predator odor induced fear. In naïve mice and rats, TMT induces a number of fear and defensive behaviors, including robust freezing, indicating it is an innate threat stimulus. However, there are a number of behavioral constraints that we do not yet understand. Similarly, while some of the early olfactory sensory pathways for TMT-induced fear are being delineated, the pathways from olfactory systems to emotional and motor output regions are less well understood. This review will focus on what we know and what we still need to learn about the behavior and neuroanatomy of TMT-induced fear.

  10. Development of occlusal traits and dental arch space from adolescence to adulthood: a 25-year follow-up study of 245 untreated subjects.

    Science.gov (United States)

    Jonsson, Teitur; Arnlaugsson, Sigurjon; Saemundsson, Sigurdur Runar; Magnusson, Thordur Eydal

    2009-04-01

    The purpose of this study was to examine longitudinally the development of specific occlusal traits and space conditions in an Icelandic sample. The sample comprised 245 adolescents examined clinically in the late mixed or permanent dentition and again 25 years later. All subjects were orthodontically untreated, and all had the full complement of teeth at both examinations. A significant increase in the prevalence of mandibular anterior crowding and mesial molar relationships and a decrease in the prevalence of excessive overjet and maxillary anterior spacing were seen. The persistence of malocclusion traits ranged from 17.9% to 53.4% for maxillary anterior spacing and crowding, mandibular spacing, overjet, overbite, and distal molar occlusion, whereas anterior mandibular crowding and molar crossbite were still found in 72.7% and 75.0%, respectively, at the second examination. Normal occlusal traits and space conditions at adolescence stayed mostly unchanged, with the exception of 11.2% of the subjects, who developed mandibular anterior crowding between the first and second examinations. Deterioration of normal occlusal traits and space relationships was uncommon in this study, whereas self-correction of malocclusion traits and space anomalies was relatively frequent.

  11. The therapeutic effect of a pulsed electromagnetic field on the reproductive patterns of male Wistar rats exposed to a 2.45-GHz microwave field

    Directory of Open Access Journals (Sweden)

    Sanjay Kumar

    2011-01-01

    Full Text Available INTRODUCTION: Environmental exposure to man-made electromagnetic fields has been steadily increasing with the growing demand for electronic items that are operational at various frequencies. Testicular function is particularly susceptible to radiation emitted by electromagnetic fields. OBJECTIVES: This study aimed to examine the therapeutic effects of a pulsed electromagnetic field (100 Hz on the reproductive systems of male Wistar rats (70 days old. METHODS: The experiments were divided into five groups: microwave sham, microwave exposure (2.45 GHz, pulsed electromagnetic field sham, pulsed electromagnetic field (100 Hz exposure, and microwave/pulsed electromagnetic field exposure. The animals were exposed for 2 hours/day for 60 days. After exposure, the animals were sacrificed, their sperm was used for creatine and caspase assays, and their serum was used for melatonin and testosterone assays. RESULTS: The results showed significant increases in caspase and creatine kinase and significant decreases in testosterone and melatonin in the exposed groups. This finding emphasizes that reactive oxygen species (a potential inducer of cancer are the primary cause of DNA damage. However, pulsed electromagnetic field exposure relieves the effect of microwave exposure by inducing Faraday currents. CONCLUSIONS: Electromagnetic fields are recognized as hazards that affect testicular function by generating reactive oxygen species and reduce the bioavailability of androgen to maturing spermatozoa. Thus, microwave exposure adversely affects male fertility, whereas pulsed electromagnetic field therapy is a non-invasive, simple technique that can be used as a scavenger agent to combat oxidative stress.

  12. The therapeutic effect of a pulsed electromagnetic field on the reproductive patterns of male Wistar rats exposed to a 2.45-GHz microwave field.

    Science.gov (United States)

    Kumar, Sanjay; Kesari, Kavindra Kumar; Behari, Jitendra

    2011-01-01

    Environmental exposure to man-made electromagnetic fields has been steadily increasing with the growing demand for electronic items that are operational at various frequencies. Testicular function is particularly susceptible to radiation emitted by electromagnetic fields. This study aimed to examine the therapeutic effects of a pulsed electromagnetic field (100 Hz) on the reproductive systems of male Wistar rats (70 days old). The experiments were divided into five groups: microwave sham, microwave exposure (2.45 GHz), pulsed electromagnetic field sham, pulsed electromagnetic field (100 Hz) exposure, and microwave/pulsed electromagnetic field exposure. The animals were exposed for 2 hours/day for 60 days. After exposure, the animals were sacrificed, their sperm was used for creatine and caspase assays, and their serum was used for melatonin and testosterone assays. The results showed significant increases in caspase and creatine kinase and significant decreases in testosterone and melatonin in the exposed groups. This finding emphasizes that reactive oxygen species (a potential inducer of cancer) are the primary cause of DNA damage. However, pulsed electromagnetic field exposure relieves the effect of microwave exposure by inducing Faraday currents. Electromagnetic fields are recognized as hazards that affect testicular function by generating reactive oxygen species and reduce the bioavailability of androgen to maturing spermatozoa. Thus, microwave exposure adversely affects male fertility, whereas pulsed electromagnetic field therapy is a non-invasive, simple technique that can be used as a scavenger agent to combat oxidative stress.

  13. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  14. Tris(1,10-phenanthroline-κN,N')nickel(II) bis-(2,4,5-tricarb-oxy-benzo-ate) monohydrate.

    Science.gov (United States)

    Zhong, Kai-Long; Ni, Chao; Qian, Ming-Yi

    2011-12-01

    In the title compound, [Ni(C(12)H(8)N(2))(3)](C(10)H(5)O(8))(2)·H(2)O, the Ni(II) cation is coordinated by six N atoms of the three bidentate chelating 1,10-phenanthroline ligands in a slightly distorted octa-hedral coordination geometry. The Ni-N bond lengths range from 2.074 (2) to 2.094 (2) Å. The dihedral angles between the three chelating NCCN groups to each other are 85.71 (3), 73.75 (2) and 85.71 (3)°, respectively. The Ni cation, the phenyl ring of the 1,10-phenanthroline ligand and the lattice water molecule are located on special positions (site symmetry 2). In the crystal, the uncoordinated 2,4,5-tricarb-oxy-benzeno-ate anions join with each other through O-H⋯O hydrogen bonds, forming a two-dimensional hydrogen-bonded layer structure along the bc plane. The layers are further linked via additional O-H⋯O inter-actions between water and carboxyl groups, resulting in a three-dimensional supra-molecular network.

  15. 2.45-GHz microwave irradiation adversely affects reproductive function in male mouse, Mus musculus by inducing oxidative and nitrosative stress.

    Science.gov (United States)

    Shahin, S; Mishra, V; Singh, S P; Chaturvedi, C M

    2014-05-01

    Electromagnetic radiations are reported to produce long-term and short-term biological effects, which are of great concern to human health due to increasing use of devices emitting EMR especially microwave (MW) radiation in our daily life. In view of the unavoidable use of MW emitting devices (microwaves oven, mobile phones, Wi-Fi, etc.) and their harmful effects on biological system, it was thought worthwhile to investigate the long-term effects of low-level MW irradiation on the reproductive function of male Swiss strain mice and its mechanism of action. Twelve-week-old mice were exposed to non-thermal low-level 2.45-GHz MW radiation (CW for 2 h/day for 30 days, power density = 0.029812 mW/cm(2) and SAR = 0.018 W/Kg). Sperm count and sperm viability test were done as well as vital organs were processed to study different stress parameters. Plasma was used for testosterone and testis for 3β HSD assay. Immunohistochemistry of 3β HSD and nitric oxide synthase (i-NOS) was also performed in testis. We observed that MW irradiation induced a significant decrease in sperm count and sperm viability along with the decrease in seminiferous tubule diameter and degeneration of seminiferous tubules. Reduction in testicular 3β HSD activity and plasma testosterone levels was also noted in the exposed group of mice. Increased expression of testicular i-NOS was observed in the MW-irradiated group of mice. Further, these adverse reproductive effects suggest that chronic exposure to nonionizing MW radiation may lead to infertility via free radical species-mediated pathway.

  16. Effects of prenatal exposure to WIFI signal (2.45GHz) on postnatal development and behavior in rat: Influence of maternal restraint.

    Science.gov (United States)

    Othman, Haifa; Ammari, Mohamed; Sakly, Mohsen; Abdelmelek, Hafedh

    2017-05-30

    The present study was carried out to investigate the potential combined influence of maternal restraint stress and 2.45GHz WiFi signal exposure on postnatal development and behavior in the offspring of exposed rats. 24 pregnant albino Wistar rats were randomly assigned to four groups: Control, WiFi-exposed, restrained and both WiFi-exposed and restrained groups. Each of WiFi exposure and restraint occurred 2h/day along gestation till parturition. The pups were evaluated for physical development and neuromotor maturation. Moreover, elevated plus maze test, open field activity and stationary beam test were also determined on postnatal days 28, 30 and 31, respectively. After behavioral tests, the rats were anesthetized and their brains were removed for biochemical analysis. Our main findings showed no detrimental effects on gestation progress and outcomes at delivery in all groups. Subsequently, WiFi and restraint, per se and mainly in concert altered physical development of pups with slight differences between genders. Behaviorally, the gestational WiFi irradiation, restraint and especially the associated treatment affected the neuromotor maturation mainly in male progeny. At adult age, we noticed anxiety, motor deficit and exploratory behavior impairment in male offspring co-exposed to WiFi radiation and restraint, and in female progeny subjected to three treatments. The biochemical investigation showed that, all three treatments produced global oxidative stress in brain of both sexes. As for serum biochemistry, phosphorus, magnesium, glucose, triglycerides and calcium levels were disrupted. Taken together, prenatal WiFi radiation and restraint, alone and combined, provoked several behavioral and biochemical impairments at both juvenile and adult age of the offspring. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  18. Comparative Analysis of the Effects of Severe Plastic Deformation and Thermomechanical Training on the Functional Stability of Ti50.5Ni24.5Pd25 High-Temperature Shape Memory Alloy

    Science.gov (United States)

    Atli, K. C.; Karaman, I.; Noebe, R. D.; Maier, H. J.

    2010-01-01

    We compare the effectiveness of a conventional thermomechanical training procedure and severe plastic deformation via equal channel angular extrusion to achieve improved functional stability in a Ti50.5Ni24.5Pd25 high-temperature shape memory alloy. Thermomechanical testing indicates that both methods result in enhanced shape memory characteristics, such as reduced irrecoverable strain and thermal hysteresis. The mechanisms responsible for the improvements are discussed in light of microstructural findings from transmission electron microscopy.

  19. Measurement and analysis of mass and charge distribution of 245Cm(nth,f) fission products thanks to the Lohengrin mass spectrometer (ILL-Grenoble)

    International Nuclear Information System (INIS)

    Rochman, Dimitri

    2001-01-01

    The general field in which this work takes place is the study of fission yields of minor actinides, dealing with the management of long-lived nuclear waste. This work, cooperation between CEA Cadarache and the Institut Laue Langevin, Grenoble, provides new data on thermal neutron induced fission of curium 245 and presents a physical analysis and their integral validations against important parameters. The first aim of this work was, using the Lohengrin recoil mass spectrometer at the I. L. L., to measure isotopic yields by using the nuclear charge resolution of the double anode ionisation chamber. The isotopic yields have been measured in this way from iron (Z = 26) up to strontium (Z = 38). When the ionisation chamber allowed no more nuclear charge separation, another separation method using a Parylene C passive absorber has been used, from yttrium (Z = 39) up to cadmium (Z = 48), the new optimized separation limit. The second part of the experimental work was to investigate the mass yields. The light peak and the symmetry region were already measured, so the measurements have been done for the heavy peak up to the mass A = 167 and for the very asymmetric region down to A = 67. For the first time on the Lohengrin spectrometer, the heavy peak has been measured; these measurements have shown the possibility to apply such a technique to other actinides in the same region. The data analysis (mean values, odd-even effects) has confirmed the high spectrometer performances, Le. the mass and charge resolution and small error bars. Furthermore it gives access to the kinetic energy distribution. Finally, the measurements allowed us to calculate the isotopic yield in the heavy peak thanks to an evaporation code named PACEII. Then some calculations and comparisons have been done for important parameters in reactor physics, the burn up monitoring, the neutron capture effect, the decay heat released by the fission products, the cumulative yield, or the total delayed neutron

  20. CW/Pulsed H{sup −} ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    Energy Technology Data Exchange (ETDEWEB)

    Peng, S. X., E-mail: sxpeng@pku.edu.cn; Ren, H. T.; Xu, Y.; Zhang, T.; Zhang, J. F.; Zhao, J.; Guo, Z. Y. [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871, People' s Republic of China (China); Zhang, A. L. [University of Chinese Academy of Sciences, Beijing 100049, People' s Republic of China (China); Chen, J. E. [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871, People' s Republic of China (China); University of Chinese Academy of Sciences, Beijing 100049, People' s Republic of China (China)

    2015-04-08

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H{sup −} beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H{sup −} source able to produce very intense H{sup −} beams with important variation of the duty factor{sup [1]}. Recently, a new version of 2.45 GHz microwave H{sup −} ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H{sup −} ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H{sup −} beam with rms emittance about 0.16 π·mm·mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H{sup −} ion beam at 35 keV with rms emittance about 0.2 π·mm·mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H{sup −} source body is ϕ116 mm × 124 mm, and the entire H{sup −} source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper.

  1. Stable Isotope Geochemistry of Extremely Well-Preserved 2.45-Billion-Year-Old Hydrothermal Systems in the Vetreny Belt, Baltic Shield: Insights into Paleohydrosphere

    Science.gov (United States)

    Zakharov, D. O.; Bindeman, I. N.

    2015-12-01

    The early Paleoproterozoic was an eventful period in the Earth's history. The first portions of free oxygen emerged in the atmosphere, Snowball Earth glaciations happened several times and the first supercontinent broke up due to extensive rifting. These events should have affected the stable isotopic composition of the hydrosphere. In this study, we use rocks that were altered in underwater hydrothermal systems to investigate the stable isotopic composition of the hydrosphere 2.39-2.45 billion years ago (hereinafter, Ga). Extremely low-δ18O (down to -27.5‰ SMOW) rocks from 2.39 Ga metamorphosed subglacial hydrothermal systems of the Belomorian belt, Baltic Shield formed at near-equatorial latitudes suggesting a Snowball (or Slushball) Earth glaciation. These results motivated us to look at temporally and geographically close hydrothermal systems from the unmetamorhposed 2.45 Ga Vetreny Belt rift. The length of the rift is 250 km and it is composed of high-Mg basalts, mafic-ultramafic intrusions and sedimentary successions. We examined several localities of high-Mg basalt flows that include astonishingly fresh pillow lavas, often with preserved volcanic glass, eruptive breccias, and hydrothermal alteration zones. Collected samples serve a great textural evidence of water-rock interaction that occurred in situ while basalts were cooling. The preliminary results from coexisting quartz and epidote (T, D18O=311°C), and from coexisting calcite and quartz (T, D18O=190°C) yield values of δ18O of involved water between -1.6 and -0.9 ‰. The values of δ13C in calcites vary between -4.0 and -2.3 ‰. It is likely that hydrothermal fluids operated in the Vetreny Belt rift were derived from seawater that is no different from modern oceanic water in terms of δ18O. Apparently, the rift was a Paleoproterozoic analog of the modern Red Sea, filled with oceanic water. The result is important because the Vetreny Belt rift predates the onset of Snowball Earth glaciation at 2

  2. Desain Beam Shaping Assembly (BSA berbasis D-D Neutron Generator 2,45 MeV untuk Uji Fasilitas BNCT

    Directory of Open Access Journals (Sweden)

    Desman P. Gulo

    2015-12-01

    Full Text Available Boron Neutron Capture Therapy (BNCT is one of the cancer treatments that are being developed in nowadays. In order to support BNCT treatment for cancer that exists in underneath skin like breast cancer, the facility needs a generator that is able to produce epithermal neutron. One of the generator that is able to produce neutron is D-D neutron generator with 2.45 MeV energy. Based on the calculation of this paper, we found that the total production of neutron per second (neutron yield from Neutron Generator (NG by PSTA-BATAN Yogyakarta is 2.55×1011 n/s. The energy and flux that we found is in the range of quick neutron. Thus, it needs to be moderated to the level of epithermal neutron which is located in the interval energy of 1 eV to 10 KeV with 109 n/cm2s flux. This number is the recommendation standard from IAEA. Beam Shaping Assembly (BSA is needed in order to moderate the quick neutron to the level of epithermal neutron. One part of BSA that has the responsibility in moderating the quick neutron to epithermal neutron is the moderator. The substance of moderator used in this paper is MgF2 and A1F3. The thickness of moderator has been set in in such a way by using MCNPX software in order to fulfill the standard of IAEA. As the result of optimizing BSA moderator, the data obtain epithermal flux with the total number of 4.64×108 n/cm2/s for both of moderators with the thickness of moderator up to 15 cm. At the end of this research, the number of epithermal flux does not follow the standard of IAEA. This is because the flux neutron that is being produced by NG is relatively small. In conclusion, the NG from PSTA-BATAN Yogyakarta is not ready to be used for the BNCT treatment facility for the underneath skin cancer like breast cancer.

  3. Wi-Fi (2.45 GHz)- and mobile phone (900 and 1800 MHz)-induced risks on oxidative stress and elements in kidney and testis of rats during pregnancy and the development of offspring.

    Science.gov (United States)

    Özorak, Alper; Nazıroğlu, Mustafa; Çelik, Ömer; Yüksel, Murat; Özçelik, Derviş; Özkaya, Mehmet Okan; Çetin, Hasan; Kahya, Mehmet Cemal; Kose, Seyit Ali

    2013-12-01

    The present study was designed to determine the effects of both Wi-Fi (2.45 GHz)- and mobile phone (900 and 1800 MHz)-induced electromagnetic radiation (EMR) on oxidative stress and trace element levels in the kidney and testis of growing rats from pregnancy to 6 weeks of age. Thirty-two rats and their 96 newborn offspring were equally divided into four different groups, namely, control, 2.45 GHz, 900 MHz, and 1800 MHz groups. The 2.45 GHz, 900 MHz, and 1,800 MHz groups were exposed to EMR for 60 min/day during pregnancy and growth. During the fourth, fifth, and sixth weeks of the experiment, kidney and testis samples were taken from decapitated rats. Results from the fourth week showed that the level of lipid peroxidation in the kidney and testis and the copper, zinc, reduced glutathione (GSH), glutathione peroxidase (GSH-Px), and total antioxidant status (TAS) values in the kidney decreased in the EMR groups, while iron concentrations in the kidney as well as vitamin A and vitamin E concentrations in the testis increased in the EMR groups. Results for fifth-week samples showed that iron, vitamin A, and β-carotene concentrations in the kidney increased in the EMR groups, while the GSH and TAS levels decreased. The sixth week results showed that iron concentrations in the kidney and the extent of lipid peroxidation in the kidney and testis increased in the EMR groups, while copper, TAS, and GSH concentrations decreased. There were no statistically significant differences in kidney chromium, magnesium, and manganese concentrations among the four groups. In conclusion, Wi-Fi- and mobile phone-induced EMR caused oxidative damage by increasing the extent of lipid peroxidation and the iron level, while decreasing total antioxidant status, copper, and GSH values. Wi-Fi- and mobile phone-induced EMR may cause precocious puberty and oxidative kidney and testis injury in growing rats.

  4. Brønsted acidic ionic liquid catalyzed an efficient and eco-friendly protocol for the synthesis of 2,4,5-trisubstituted-1H-imidazoles under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Janardhan Banothu

    2017-05-01

    Full Text Available A simple, highly efficient and eco-friendly protocol for the synthesis of 2,4,5-trisubstituted-1H-imidazoles via one-pot three component condensation of benzil/benzoin, aldehydes and ammonium acetate under solvent-free conditions has been achieved utilizing Brønsted acidic ionic liquid, (4-sulfobutyltris(4-sulfophenyl phosphonium hydrogen sulfate as catalyst. The remarkable features of this methodology are excellent yields in shorter reaction times, cleaner reaction profile, and environmentally benign nature, use of non-toxic, readily synthesizable, inexpensive and recyclable catalyst.

  5. Synthesis, characterization and catalytic application of silica supported tin oxide nanoparticles for synthesis of 2,4,5-tri and 1,2,4,5-tetrasubstituted imidazoles under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Ashok V. Borhade

    2017-02-01

    Full Text Available Highly efficient and eco-friendly, one pot synthesis of 1,2,4,5-tetra substituted imidazoles and 2,4,5-trisubstituted imidazoles was reported under solvent free conditions using nanocrystalline silica supported tin oxide (SiO2:SnO2 as a catalyst with excellent yield. The present methodology offers several advantages such as mild reaction conditions, short reaction time, good yield, high purity of product, recyclable catalyst without a noticeable decrease in catalytic activity and can be used for large scale synthesis. The synthesized SiO2:SnO2 nanocrystalline catalyst was characterized by XRD, BET surface area and TEM techniques.

  6. (Vapour + liquid) equilibrium data for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system at temperatures from (323.150 to 353.150) K

    International Nuclear Information System (INIS)

    Yang, Lixiang; Gong, Maoqiong; Guo, Hao; Dong, Xueqiang; Wu, Jianfeng

    2015-01-01

    Highlights: • VLE data for (R152a + R245fa) system were measured at temperatures. • The experiments were based on the static-analytic method. • VLE data were correlated using PR–vdWs and PR–HV–NRTL models. - Abstract: In this paper, (vapour + liquid) equilibrium (VLE) for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system was determined by a static-analytical method at T = (323.150 to 353.150) K. Values of the VLE were correlated by the Peng–Robison equation of state (PR EoS) using two different models, the van der Waals (vdWs) mixing rule and the Huron–Vidal (HV) mixing rule involving the non-random two-liquid (NRTL) activity coefficient model. The correlated results show good agreement with the experimental values. For the two models, the maximum average absolute deviations of the vapour phase mole fraction are 0.0034 and 0.0035, respectively.

  7. Isothermal (vapour + liquid) equilibrium measurements and correlation for the {n-butane (R600) + 1,1,1,3,3-pentafluoropropane (R245fa)} system at temperatures from (303.150 to 373.150) K

    International Nuclear Information System (INIS)

    Yang, Lixiang; Gong, Maoqiong; Guo, Hao; Dong, Xueqiang; Shen, Jun; Wu, Jianfeng

    2016-01-01

    Highlights: • VLE data for (R600 + R245fa) system at temperatures ranging from 303.15 to 373.15 K were measured. • The experiments were based on the static–analytic method. • Correlation of VLE data was made using PR–HV–NRTL model. - Abstract: The isothermal VLE for the {n-butane (R600) + 1,1,1,3,3-pentafluoropropane (R245fa)} system was measured at five temperatures from (303.150 to 373.150) K based on the static-analytical method. The experimental values were correlated by the Peng–Robison equation of state with the Huron–Vidal mixing rule involving the non-random two-liquid (NRTL) activity coefficient model. The results show that the experimental values are in good agreement with the calculated value. The maximum average absolute relative deviation of pressure and vapour phase mole fraction are 0.35%, 0.0047, respectively. Obviously azeotropic behaviour can be observed for the binary system.

  8. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  9. Theoretical study on molecular structure and vibrational analysis included FT-IR, FT-Raman and UV techniques of 2,4,5-trimethylbenzoic acid (monomer and dimer structures).

    Science.gov (United States)

    Karabacak, Mehmet; Bilgili, Sibel; Atac, Ahmet

    2015-01-05

    Theoretical study on the structural and vibrational analysis of monomer and dimer structures of 2,4,5-trimethylbenzoic acid (2,4,5-TMBA, C₁₀H₁₂O₂) were presented. The geometry of the molecule was fully optimized. The Fourier transform infrared (FT-IR) and the Fourier transform Raman (FT-Raman) spectra of the title molecule in solid phase were recorded in the region 4000-400 cm(-1) and 4000-50 cm(-1), respectively. The geometrical parameters and energies were investigated with the help of Density Functional Theory (DFT) employing B3LYP method and 6-311++G(d,p) basis set. The spectroscopic data of the molecule in the ground state were calculated by using DFT/B3LYP method with the 6-311++G(d,p) basis set. The vibrational spectra were calculated and fundamental vibrations were assigned on the basis of the potential energy distribution (PED) of the vibrational modes. The geometric parameters were compared with experimental data of the title molecule. The UV absorption spectrum of the studied compound was computed and recorded in the range of 190-400 nm dissolved in water and ethanol. Besides, charge transfer occurring in the molecule between HOMO and LUMO energies, frontier energy gap, molecular electrostatic potential (MEP) were calculated and presented. In addition these, thermodynamic properties and Mulliken atomic charges were performed. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Diseño, elaboración y evaluación de una membrana de 2,4,5-Trifenilimidazol Inmovilizado en Acetato de Polivinilo para la Detección

    OpenAIRE

    Jimenez Cutipa, Aida

    2016-01-01

    RESUMEN En el presente estudio se describe el diseño, elaboración y evaluación de una membrana inmovilizando 2,4,5-trifenilimidazol en acetato de polivinilo, la misma que es capaz de detectar nitratos en muestras de agua. La longitud de onda de máxima absorción de la membrana fue alrededor de 310 nm. La membrana presento una pendiente de 1.1977E-04, un intercepto de 0.00125 y un R2 = 0.9996, además según el análisis de varianza se obtuvo que , demostrando la existencia de una alta correl...

  11. DISEÑO, ELABORACIÓN Y EVALUACIÓN DE UNA MEMBRANA DE 2,4,5- TRIFENILIMIDAZOL INMOVILIZADO EN ACETATO DE POLIVINILO PARA LA DETECCIÓN DE NITRATOS EN MUESTRAS DE AGUA. AREQUIPA - 2016

    OpenAIRE

    JIMÉNEZ CUTIPA, AIDA

    2016-01-01

    En el presente estudio se describe el diseño, elaboración y evaluación de una membrana inmovilizando 2,4,5-trifenilimidazol en acetato de polivinilo, la misma que es capaz de detectar nitratos en muestras de agua. La longitud de onda de máxima absorción de la membrana fue alrededor de 310 nm. La membrana presento una pendiente de 1.1977E- 04, un intercepto de 0.00125 y un R2 = 0.9996, además según el análisis de varianza se obtuvo que  3.8844 10 13 0.05     , demostrand...

  12. 2.45 GHz Microwave Radiation Impairs Learning and Spatial Memory via Oxidative/Nitrosative Stress Induced p53-Dependent/Independent Hippocampal Apoptosis: Molecular Basis and Underlying Mechanism.

    Science.gov (United States)

    Shahin, Saba; Banerjee, Somanshu; Singh, Surya Pal; Chaturvedi, Chandra Mohini

    2015-12-01

    A close association between microwave (MW) radiation exposure and neurobehavioral disorders has been postulated but the direct effects of MW radiation on central nervous system still remains contradictory. This study was performed to understand the effect of short (15 days) and long-term (30 and 60 days) low-level MW radiation exposure on hippocampus with special reference to spatial learning and memory and its underlying mechanism in Swiss strain male mice, Mus musculus. Twelve-weeks old mice were exposed to 2.45 GHz MW radiation (continuous-wave [CW] with overall average power density of 0.0248 mW/cm(2) and overall average whole body specific absorption rate value of 0.0146 W/Kg) for 2 h/day over a period of 15, 30, and 60 days). Spatial learning and memory was monitored by Morris Water Maze. We have checked the alterations in hippocampal oxidative/nitrosative stress, neuronal morphology, and expression of pro-apoptotic proteins (p53 and Bax), inactive executioner Caspase- (pro-Caspase-3), and uncleaved Poly (ADP-ribose) polymerase-1 in the hippocampal subfield neuronal and nonneuronal cells (DG, CA1, CA2, and CA3). We observed that, short-term as well as long-term 2.45 GHz MW radiation exposure increases the oxidative/nitrosative stress leading to enhanced apoptosis in hippocampal subfield neuronal and nonneuronal cells. Present findings also suggest that learning and spatial memory deficit which increases with the increased duration of MW exposure (15 stress induced p53-dependent/independent activation of hippocampal neuronal and nonneuronal apoptosis associated with spatial memory loss. © The Author 2015. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  13. Two Zinc(II) metal-organic frameworks with mixed ligands of 5-amino-tetrazolate and l,2,4,5-benzenetetracarboxylate: Synthesis, structural diversity and photoluminescent properties

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiao-Bing [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Lu, Wen-Guan, E-mail: lwg@sgu.edu.cn [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Zhong, Di-Chang [School of Chemistry and Chemical Engineering, Gannan Normal University, Ganzhou 341000 (China)

    2017-06-15

    The reactions of Zn(NO{sub 3}){sub 2}·6H{sub 2}O with mixed ligands of 5-amino-tetrazole (Hatz) and l,2,4,5-benzenetetracarboxylic acid (H{sub 4}btec) under hydro(solvo)thermal conditions, gave two three-dimensional (3D) porous metal-organic frameworks (MOFs) of ([Zn{sub 3}(atz){sub 2}(btec)(DMF){sub 2}]·DMF·2H{sub 2}O){sub n} (1) and [Zn{sub 2}(Hprz)(atz)(btec)(H{sub 2}O)]{sub n} (2) in the absence and presence of piperazine (prz), respectively. 1 and 2 were characterized by infrared spectra (IR), elemental analyses (EA) and single-crystal/powder X-ray diffraction. In 1, the adjacent 1D [Zn{sub 3}(btec)]{sub n}{sup 2n+} chains are linked together by atz{sup −} ligands to form a 3D porous MOF with 1D tetragonal channels filled with coordinated and guest DMF, and lattice water molecules. In 2, the adjacent 2D [Zn{sub 2}(btec)]{sub n} wavelike sheets are pillared through atz{sup −} ligands to generate a 3D layered-pillared porous MOF with 1D open channels, which are occupied by coordinated Hprz{sup +} cations and coordinated water molecules. Additionally, thermal stabilities and photoluminescent properties of both compounds in the solid-state at room temperature have been investigated and discussed in detail. - Graphical abstract: Two new MOFs constructed from Zn(II) salts with mixed ligands of 5-amino-tetrazole and l,2,4,5-benzenetetracarboxylic acid were synthesized under different reaction conditions. Structural diversities indicate that the reaction solvent system or the presence of organic base play crucial roles in modulating structures of these compounds. And more, their thermal stability and luminescence are also discussed. - Highlights: • Two new Zn(II) MOFs based on mixed ligands were synthesized. • The two Zn(II) MOFs exhibit different structural motifs. • The two Zn(II) MOFs are photoluminscent in the solid state at room temperature.

  14. Probing photochromic properties by correlation of UV-visible and infra-red absorption spectroscopy: a case study with cis-1,2-dicyano-1,2-bis(2,4,5-trimethyl-3-thienyl)ethene.

    Science.gov (United States)

    Spangenberg, Arnaud; Piedras Perez, Jose Alejandro; Patra, Abhijit; Piard, Jonathan; Brosseau, Arnaud; Métivier, Rémi; Nakatani, Keitaro

    2010-02-01

    Quantification of the relative composition of the isomers in a photochromic system at any irradiation time interval is a critical issue in determining absolute quantum yields. For this purpose, we have developed a simple and convenient protocol involving combination of UV-visible and infra-red absorption spectroscopy. Photochromic cyclization reaction of cis-l,2-dicyano-l,2-bis(2,4,5-trimethyl-3-thieny1)ethene (CMTE) is analyzed to demonstrate the efficiency of the proposed methodology. This approach is based on the fact that the two isomers show distinctive infra-red bands. Detailed investigations of the UV-visible and infra-red spectra of the mixture obtained at different irradiation times in CCl(4) supported by quantum chemical computations lead to the unambiguous estimation of molar absorption coefficients of the closed isomer (epsilon(CF) = 4650 L mol(-1) cm(-1) at 512 nm). It facilitates the first determination of absolute quantum yields of this reversible photochromic reaction in CCl(4) by fitting the UV-visible spectral data (Phi(OF-->CF) = 0.41 +/- 0.05 and Phi(CF-->OF) = 0.12 +/- 0.02 at 405 nm and 546 nm, respectively).

  15. Experimental (FT-IR and FT-Raman) and theoretical (HF and DFT) investigation, NMR, NBO, electronic properties and frequency estimation analyses on 2,4,5-trichlorobenzene sulfonyl chloride

    Science.gov (United States)

    Gayathri, R.; Arivazhagan, M.

    2012-11-01

    The present work deals with the structural, electronic, and vibrational analyses of the biomolecule 2,4,5-trichlorobenzene sulfonyl chloride (TCBSC). TCBSC is a novel pharmaceutical compound used in dyes, pesticides, pigments, fluorescence brighteners and intermediate for agricultural chemicals in the manufacture of insecticides. Quantum chemical calculation of geometrical structure and energies of TCBSC was carried out by density functional theory (B3LYP) and ab initio (HF) methods at 6-311+G(d,p) and 6-311++G(d,p) standard basis set. The stability of the molecule arising from hyperconjugative interaction and charge delocalization has been analyzed using natural bond orbital (NBO) analysis. NMR analysis shows that the isotropic chemical shifts of carbon and hydrogen atom of TCBSC are giving the reasonable shielding to the molecule. Another interesting property shows nonlinear optical (NLO) behavior. Moreover, we have not only simulated highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) but also determined the transition state and energy band gap.

  16. Microsatellite-based fine mapping of the Van der Woude syndrome locus to an interval of 4.1 cM between D1S245 and D1S414

    Energy Technology Data Exchange (ETDEWEB)

    Sander, A.; Schmelzle, R. [Univ. of Hamburg (Germany); Murray, J.C. [Univ. of Iowa, Iowa City, IA (United States); Scherpbier-Heddema, T.; Buetow, K.H. [Fox Chase Center, Philadelphia, PA (United States); Weissenbach, J. [Institut Pasteur, Paris (France); Ludwig, K.; Zingg, M.

    1995-01-01

    Van der Woude syndrome (VWS) is an autosomal dominant craniofacial disorder characterized by lip pits, clefting of the primary or secondary palate, and hypodontia. The gene has been localized, by RFLP-based linkage studies, to region 1q32-41 between D1S65-REN and D1S65-TGFB2. In this study we report the linkage analysis of 15 VWS families, using 18 microsatellite markers. Multipoint linkage analysis places the gene, with significant odds of 2,344:1, in a 4.1-cM interval flanked by D1S245 and D1S414. Two-point linkage analysis demonstrates close linkage of VWS with D1S205 (lod score [Z] = 24.41 at {theta} = .00) and with D1S491 (Z = 21.23 at {theta} = .00). The results revise the previous assignment of the VWS locus and show in an integrated map of the region 1q32-42 that the VWS gene resides more distally than previously suggested. When information about heterozygosity of the closely linked marker D1S491 in the affected members of the VWS family with a microdeletion is taken into account, the VWS critical region can be further narrowed, to the 3.6-cM interval between D1S491 and D1S414. 38 refs., 3 figs., 2 tabs.

  17. Tris(1,10-phenanthroline-κ2 N,N′)nickel(II) bis­(2,4,5-tricarb­oxy­benzo­ate) monohydrate

    Science.gov (United States)

    Zhong, Kai-Long; Ni, Chao; Qian, Ming-Yi

    2011-01-01

    In the title compound, [Ni(C12H8N2)3](C10H5O8)2·H2O, the NiII cation is coordinated by six N atoms of the three bidentate chelating 1,10-phenanthroline ligands in a slightly distorted octa­hedral coordination geometry. The Ni—N bond lengths range from 2.074 (2) to 2.094 (2) Å. The dihedral angles between the three chelating NCCN groups to each other are 85.71 (3), 73.75 (2) and 85.71 (3)°, respectively. The Ni cation, the phenyl ring of the 1,10-phenanthroline ligand and the lattice water molecule are located on special positions (site symmetry 2). In the crystal, the uncoordinated 2,4,5-tricarb­oxy­benzeno­ate anions join with each other through O—H⋯O hydrogen bonds, forming a two-dimensional hydrogen-bonded layer structure along the bc plane. The layers are further linked via additional O—H⋯O inter­actions between water and carboxyl groups, resulting in a three-dimensional supra­molecular network. PMID:22199595

  18. Publications | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Women who work in South Korea and Taiwan had access to NGOs and government services when facing difficulties while women in the Gulf region have nowhere to turn. Transnational marriage migration largely occurs outside the planning and control of the State. In both lines of domestic work, brokers... Case Study ...

  19. 48 CFR 245.7308 - Antitrust notification.

    Science.gov (United States)

    2010-10-01

    ... action would tend to create or maintain a situation inconsistent with the antitrust laws. (c) If the Attorney General advises that the proposed disposition is inconsistent with the antitrust laws, do not... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Antitrust notification...

  20. 32 CFR 245.5 - Terms.

    Science.gov (United States)

    2010-07-01

    ... limited to, Global Positioning System (GPS), Tactical Air Navigation (TACAN), VHF Omnidirectional range... responsible for North American aerospace warning and control. Headquartered in Colorado Springs, CO, NORAD is... include Military Operations Areas, Prohibited Areas, Restricted Areas and Warning Areas. [71 FR 61889, Oct...

  1. 46 CFR 172.245 - Survival conditions.

    Science.gov (United States)

    2010-10-01

    ... stage of flooding: (a) Final waterline. The final waterline, in the final condition of sinkage, heel...) Small watertight cargo tank hatch cover that maintains the high integrity of the deck; (4) Class 1 door... nonopening type; (7) Retractable inflatable seal; or (8) Guillotine door. (b) Heel angle. The maximum angle...

  2. Reference: 245 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available llison R et al. 2005 Aug. Plant Physiol. 138(4):2097-110. Autophagy is an important mechanism for nonselecti.... 4 2097-110 16040659 2005 Aug Plant physiology Doelling Jed H|Suttangkakul Anongpat|Thompson Allison R|Vierstra Richard D

  3. 8 CFR 245a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... attainment of particular functional skills related to communicative ability, subject matter knowledge, and English language competency, and attainment of these skills is measured either by successful completion of... performance standards of the English/citizenship course prescribed by the recognized program in which he or...

  4. 7 CFR 245.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... an institution or boarding house, but who are living as one economic unit. FDPIR means the food... section. Household application means an application for free and reduced price meal or milk benefits... city, county, township, school district, or other political subdivision of a State, or for a...

  5. 8 CFR 245.1 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ..., such as pay receipts supported by affidavits of co-workers, which is accompanied by evidence that the... alien entrepreneur (as defined in section 216A(f)(1) of the Act), or an alien spouse or child (as...

  6. 245 HUMANISM AND THE LAW: TOWARDS AFRICAN ...

    African Journals Online (AJOL)

    Ike Odimegwu

    heavens, does not exist; and that human beings, using their own intelligence and cooperating liberally with one another, can build an enduring citadel of peace and beauty upon the earth. 26. Thus, Lamont's philosophy of development is man centered and atheistic. This is contrary to Henri de Lubac's conviction contained ...

  7. 17 CFR 245.100 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... pension plan which provides for an individual account for each participant and for benefits based solely... security of such issuer held in an individual account plan is temporarily suspended by the issuer or by a... United States and its territories and possessions under all individual account plans (as defined in...

  8. 8 CFR 245.2 - Application.

    Science.gov (United States)

    2010-01-01

    ... he or she had previously been authorized to work as an H-1 or L-1 nonimmigrant, and, is in possession... the denial of an application but such denial shall be without prejudice to the alien's right to renew...

  9. Publications | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  10. To eat or not to eat? Indicators for reduced food intake in 91,245 patients hospitalized on nutritionDays 2006-2014 in 56 countries worldwide: a descriptive analysis.

    Science.gov (United States)

    Schindler, Karin; Themessl-Huber, Michael; Hiesmayr, Michael; Kosak, Sigrid; Lainscak, Mitja; Laviano, Alessandro; Ljungqvist, Olle; Mouhieddine, Mohamed; Schneider, Stéphane; de van der Schueren, Marian; Schütz, Tatjana; Schuh, Christian; Singer, Pierre; Bauer, Peter; Pichard, Claude

    2016-11-01

    Inadequate nutrition during hospitalization is strongly associated with poor patient outcome, but ensuring adequate food intake is not a priority in clinical routine worldwide. This lack of priority results in inadequate and unbalanced food intake in patients and huge amounts of wasted food. We evaluate the main factors that are associated with reduced meal intake in hospitalized patients and the differences between geographical regions. We conducted a descriptive analysis of data from 9 consecutive, annual, and cross-sectional nutritionDay samples (2006-2014) in a total of 91,245 adult patients in 6668 wards in 2584 hospitals in 56 countries. A general estimation equation methodology was used to develop a model for meal intake, and P-value thresholding was used for model selection. The proportion of patients who ate a full meal varied widely (24.7-61.5%) across world regions. The factors that were most strongly associated with reduced food intake on nutritionDay were reduced intake during the previous week (OR: 0.20; 95% CI: 0.17, 0.22), confinement to bed (OR: 0.49; 95% CI: 0.44, 0.55), female sex (OR: 0.53; 95% CI: 0.5, 0.56), younger age (OR: 0.74; 95% CI: 0.64, 0.85) and older age (OR: 0.80; 95% CI: 0.74; 0.88), and low body mass index (OR: 0.84; 95% CI: 0.79, 0.90). The pattern of associated factors was homogenous across world regions. A set of factors that are associated with full meal intake was identified and is applicable to patients hospitalized in any region of the world. Thus, the likelihood for reduced food intake is easily estimated through access to patient characteristics, independent of world regions, and enables the easy personalization of food provision. This trial was registered at clinicaltrials.gov as NCT02820246. © 2016 American Society for Nutrition.

  11. All projects related to | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-03-17

    A proposed law in the Philippines to increase the excise tax on tobacco by 215% will likely have implications for tobacco control and consumption, and public health, not just for that country but for the region. Start Date: March 17, 2012. End Date: May 17, 2013. Topic: TAX REFORM, TOBACCO INDUSTRY, DISEASES, ...

  12. 48 CFR 245.7309-13 - Eligibility of bidders.

    Science.gov (United States)

    2010-10-01

    ... civilian employee of the Department of Defense or the United States Coast Guard whose duties include any functional or supervisory responsibility for disposal of contractor inventory; (b) A member of the United States Armed Forces, including the Coast Guard, whose duties include any functional or supervisory...

  13. 40_245 - 250_Hussaini, A. Ahmad and S. Sani

    African Journals Online (AJOL)

    user pc

    imine (Silver and Bassler 1967). The field of Sc base complexes has been fast developing ... ed for antibacterial activity against Escherichia coli and Staphylococ activity against Aspergillums niger and Candida ... de, aniline, ligand, potentiometry, antibacterial, antifungal. chemical compounds double bond (C=N) methine ...

  14. 48 CFR 52.245-1 - Government Property.

    Science.gov (United States)

    2010-10-01

    ..., explosives, controlled substances, radioactive materials, hazardous materials or wastes, or precious metals... stewardship responsibilities for the management of Government property. Provide means to furnish, as in... Management Regulation 102-71.20 (41 CFR 102-71.20). Sensitive property means property potentially dangerous...

  15. 48 CFR 1552.245-70 - Government property.

    Science.gov (United States)

    2010-10-01

    ... contamination by any hazardous or toxic substances. 10. Contract Closeout. The contractor shall complete a... (EPA) contractors performing Government property management responsibilities under EPA contracts. These.... The CPC may request support for contract property management oversight, including property...

  16. 48 CFR 245.7305 - Sale approval and award.

    Science.gov (United States)

    2010-10-01

    ... that the sale price is fair and reasonable, taking into consideration— (i) Knowledge or tests of the market; (ii) Current published prices for the property; (iii) The nature, condition, quantity, and...) Approve award to the responsible bidder whose bid is most advantageous to the Government, price and other...

  17. No. 245-Alcohol Use and Pregnancy Consensus Clinical Guidelines.

    Science.gov (United States)

    Carson, George; Cox, Lori Vitale; Crane, Joan; Croteau, Pascal; Graves, Lisa; Kluka, Sandra; Koren, Gideon; Martel, Marie-Jocelyne; Midmer, Deana; Nulman, Irena; Poole, Nancy; Senikas, Vyta; Wood, Rebecca

    2017-09-01

    To establish national standards of care for the screening and recording of alcohol use and counselling on alcohol use of women of child-bearing age and pregnant women based on the most up-to-date evidence. Published literature was retrieved through searches of PubMed, CINAHL, and the Cochrane Library in May 2009 using appropriate controlled vocabulary (e.g., pregnancy complications, alcohol drinking, prenatal care) and key words (e.g., pregnancy, alcohol consumption, risk reduction). Results were restricted to literature published in the last five years with the following research designs: systematic reviews, randomized control trials/controlled clinical trials, and observational studies. There were no language restrictions. Searches were updated on a regular basis and incorporated in the guideline to May 2010. Grey (unpublished) literature was identified through searching the websites of health technology assessment (HTA) and HTA-related agencies, national and international medical specialty societies, clinical practice guideline collections, and clinical trial registries. Each article was screened for relevance and the full text acquired if determined to be relevant. The evidence obtained was reviewed and evaluated by the members of the Expert Workgroup established by the Society of Obstetricians and Gynaecologists of Canada. The quality of evidence was evaluated and recommendations were made according to guidelines developed by the Canadian Task Force on Preventive Health Care. The quality of evidence was rated using the criteria described by the Canadian Task Force on Preventive Health Care (Table 1). The Public Health Agency of Canada and the Society of Obstetricians and Gynaecologists of Canada. These consensus guidelines have been endorsed by the Association of Obstetricians and Gynecologists of Quebec; the Canadian Association of Midwives; the Canadian Association of Perinatal, Women's Health and Neonatal Nurses (CAPWHN); the College of Family Physicians of Canada; the Federation of Medical Women of Canada; the Society of Rural Physicians of Canada; and Motherisk. RECOMMENDATIONS. Copyright © 2017. Published by Elsevier Inc.

  18. 24 CFR 990.245 - Types of appeals.

    Science.gov (United States)

    2010-04-01

    ... demand for housing in the foreseeable future. (e) Appeal to substitute actual project cost data. A PHA may appeal its PEL if it can produce actual project cost data derived from actual asset management, as... economic hardship that is impacting the PHA's ability to maintain rental and other revenue. (c) Appeal for...

  19. 245-IJBCS-Article-Dr Obodai E A

    African Journals Online (AJOL)

    RHUMSIKI

    The study was conducted in the White Volta River at Nawuni to identify the fishing gears used by the fishermen, assess fish species composition and their relative abundance. The results indicated that fishing gears such as gill nets, traps and hook-and-line were used. Most of the net mesh sizes used by the fishermen did ...

  20. 7 CFR 245.6a - Verification requirements.

    Science.gov (United States)

    2010-01-01

    ... accordance with paragraph (h) of this section. (4) Official poverty line. For the purposes of this section, “official poverty line” means that described in section 1902(l)(2)(A) of the Social Security Act (42 U.S.C... official poverty line or in States that otherwise identify households that have income that is not more...

  1. 48 CFR 245.608-5 - Special items screening.

    Science.gov (United States)

    2010-10-01

    ..., would otherwise be classified as industrial plant equipment (IPE), other plant equipment (OPE), or automatic data processing equipment (ADPE). (2) The plant clearance officer will perform the initial... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Reporting, Redistribution, and...

  2. 8 CFR 245a.2 - Application for temporary residence.

    Science.gov (United States)

    2010-01-01

    ... though his or her income may be below the poverty level, may be admissible. The alien's employment... officer or employee of the Justice Department or bureau of agency thereof, will be permitted to examine... in connection with the legalization program shall be considered an “employee of the Justice...

  3. 48 CFR 245.7001 - Selection, appointment, and termination.

    Science.gov (United States)

    2010-10-01

    ... contracting activity for the Defense Logistics Agency, or the head of the contract administration office for... officers, the appointment authority shall consider experience, training, education, business acumen...

  4. Dicty_cDB: VHE245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

  5. 40 CFR 61.245 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ...: EC15NO91.055 Where: HT = Net heating value of the sample, MJ/scm (BTU/scf); where the net enthalpy per mole....740 × 10 7 (g-mole) (MJ)/(ppm-scm-kcal) (metric units); or 4.674 × 108 ((g-mole) (Btu)/(ppm-scf-kcal)) (English units) Ci = Concentration of sample component “i” in ppm, as measured by Method 18 of appendix A...

  6. 42 CFR 403.245 - Loss of certification.

    Science.gov (United States)

    2010-10-01

    ... fact. (c) If a policy that displays the emblem, or that has been marketed as a certified policy without the emblem, loses certification, the insuring organization must notify each holder of the policy, or...

  7. 8 CFR 245.10 - Adjustment of status upon payment of additional sum under section 245(i).

    Science.gov (United States)

    2010-01-01

    ... record; (iv) A public college or public school transcript; (v) Income tax records; (vi) A certified copy... Federal, state, or local governmental agency keeping such record; (viii) A transcript from a private or religious school that is registered with, or approved or licensed by, appropriate State or local authorities...

  8. A novel polymeric catalyst for the one-pot synthesis of 2,4,5-triaryl ...

    Indian Academy of Sciences (India)

    in biochemical processes. They are well-known as inhibitors of P38MAP kinase, fungicides, herbicides, antiinflammatory agents, antithrombotic agents, plant growth regulators and therapeutic agents. In addition, they are used in photography as photosensitive com- pounds. Some substituted triarylimidazoles are selec-.

  9. 48 CFR 1852.245-71 - Installation-accountable Government property.

    Science.gov (United States)

    2010-10-01

    ..., physical inventory, financial control, and reporting of the property subject to this clause shall be... assume accountability and financial reporting responsibility for such property. The contractor shall... property, and the contractor assumes the following user responsibilities: [Insert contractor user...

  10. Yeast Interacting Proteins Database: YPL070W, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL070W MUK1 Cytoplasmic protein of unknown function containing a Vps9 domain; computation... name MUK1 Bait description Cytoplasmic protein of unknown function containing a Vps9 domain; computation

  11. 48 CFR 245.604 - Restrictions on purchase or retention of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... civilian employee of the DoD or the U.S. Coast Guard; or (ii) Is a member of the armed forces of the United States, including the Coast Guard; and (iii) Has any functional or supervisory responsibilities for or...

  12. 17 CFR 245.103 - Issuer right of recovery; right of action by equity security owner.

    Science.gov (United States)

    2010-04-01

    ...)) provides that any profit realized by a director or executive officer from any purchase, sale or other... U.S.C. 7244(a)(1)) will inure to and be recoverable by the issuer, regardless of any intention on... transaction that involves a purchase, sale or other acquisition or transfer (other than a grant, exercise...

  13. 2.45 GHz microwave-excited atmospheric pressure air microplasmas based on microstrip technology

    International Nuclear Information System (INIS)

    Kim, Jaeho; Terashima, Kazuo

    2005-01-01

    A plasma system based on microstrip technology was developed for the generation of atmospheric pressure microplasmas. A discharge gap was placed between the striplines and the ground plane on the transverse cross section in the direction of microwave propagation. This microstrip structure permits the concentration of electric fields at the discharge gap, which is confirmed by a computer simulation using the three-dimensional simulation code based on the finite-difference time-domain method, and can produce atmospheric pressure plasmas even in air. The microplasmas were sustained in the discharge gap (width: 0.2 mm, length: 6 mm) at a microwave power of 1 W. The experimentally measured rotational temperature of nitrogen molecules was 800 K, indicating these plasmas to be nonthermal plasmas. This plasma system will provide a portable microplasma system utilizing a small semiconductor microwave source and a large-scale atmospheric pressure nonthermal plasma using the array configuration

  14. 27 CFR 19.245 - Bonds and penal sums of bonds.

    Science.gov (United States)

    2010-04-01

    ... processor: (A) General The amount of tax on spirits, denatured spirits, articles, and wines deposited in... transit to bonded premises 10,000 200,000 (iv) Distiller and processor The amount of tax on spirits produced during a period of 15 days, and the amount of tax on spirits, denatured spirits, articles, and...

  15. 48 CFR 245.302 - Contracts with foreign governments or international organizations.

    Science.gov (United States)

    2010-10-01

    ... commercial sales to foreign governments or international organizations. “Major defense equipment” is defined... significant military equipment on the United States Munitions List having a nonrecurring research, development... to these requests, approvals may be granted only by the Director, Defense Security Cooperation Agency...

  16. 40 CFR 80.245 - How does a small refiner apply for a sulfur baseline?

    Science.gov (United States)

    2010-07-01

    ... gasoline produced in 1997-1998: (i) Batch number assigned to the batch under § 80.65(d) or § 80.101(i); (ii... level and average volume of gasoline produced during each annual averaging period that the refinery was... baseline will be determined based on the average sulfur content of gasoline produced by the refinery during...

  17. 48 CFR 5152.245-9001 - Government property for installation support services (cost-reimbursement contracts).

    Science.gov (United States)

    2010-10-01

    ... makes no warranty, express or implied, regarding the condition or fitness for use of any property. To... responsible under the express terms of this contract; (iv) That results from willful misconduct or lack of... premises. The term does not include foundations for production equipment. (d) Location of the property. The...

  18. 48 CFR 245.7309-2 - Condition and location of property.

    Science.gov (United States)

    2010-10-01

    ..., express or implied, as to quantity, kind, character, quality, weight, size, or description of the property... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor...

  19. Rectenna à 2.45 GHz utilisant une antenne à dipôle arrondi

    OpenAIRE

    Okba , Abderrahim; Takacs , Alexandru; Aubert , Hervé

    2017-01-01

    National audience; Cet article présente la conception et les résultats obtenus pour une rectenna fonctionnant dans les bandes UMTS et ISM. Cette rectenna, développée pour des applications 'Internet des Objets', est composée d'une antenne à dipôle arrondi et d'un redresseur haute efficacité. Les résultats expérimentaux montrent de très bonnes performances pour cette rectenna. Le redresseur peut délivrer 490µW sur une charge de 1.5KΩ pour une puissance RF en entrée du redresseur de 0 dBm....

  20. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    OBEMBE

    radiation induces DNA damage in Sprague Dawley rat's reproductive ... affect both male and female fertility adversely. ... 4% relative humidity. Exposures were whole body irradiation with the animal at 12 cm from the MW antenna of dimensions 12 x 5 cm. The animals were divided into ten groups of three males and three.

  1. Effect of axial magnetic field on a 2.45 GHz permanent magnet ECR ion source

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, T., E-mail: tsubasa@oshima-k.ac.jp; Wada, H.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Asaji, T. [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan)

    2016-02-15

    Herein, we conduct a fundamental study to improve the generation efficiency of a multi-charged ion source using argon. A magnetic field of our electron cyclotron resonance ion source is composed of a permanent magnet and a solenoid coil. Thereby, the axial magnetic field in the chamber can be tuned. Using the solenoid coil, we varied the magnetic field strength in the plasma chamber and measured the ion beam current extracted at the electrode. We observed an approximately three times increase in the Ar{sup 4+} ion beam current when the magnetic field on the extractor-electrode side of the chamber was weakened. From our results, we can confirm that the multi-charged ion beam current changes depending on magnetic field intensity in the plasma chamber.

  2. 18 CFR 367.2450 - Account 245, Derivative instrument liabilities-Hedges

    Science.gov (United States)

    2010-04-01

    ..., Derivative instrument liabilities—Hedges (a) This account must include the change in the fair value of... service company must record the change in the fair value of a derivative instrument liability related to a... change in the fair value of a derivative instrument liability related to a fair value hedge in this...

  3. Amberlyst A-15: Reusable catalyst for the synthesis of 2,4,5 ...

    Indian Academy of Sciences (India)

    K A 2010 Research Journal of Pharmaceutical, Biolog- ical and Chemical Sciences 1(4) 943; (p) Baroniya S,. Anwar Z, Sharma P K, Dudhe R and Kumar N 2010 1(3). 172; (q) Wang M, Gao J and Song Z 2010 Preparative. Biochemistry and Biotechnology 40(4) 347. 20. (a) Whiten D M and Sonnenberg B 1964 J. Org. Chem ...

  4. All-Solid-State 2.45-to-2.78-THz Source

    Science.gov (United States)

    Mehdi, Imran; Chattopadhyay, Goutam; Schlecht, Erich T.; Lin, Robert H.; Sin, Seith; Peralta, Alejandro; Lee, Choonsup; Gill, John J.; Pearson, John C.; Goldsmith, Paul F.; hide

    2011-01-01

    Sources in the THz range are required in order for NASA to implement heterodyne instruments in this frequency range. The source that has been demonstrated here will be used for an instrument on the SOFIA platform as well as for upcoming astrophysics missions. There are currently no electronic sources in the 2 3- THz frequency range. An electronically tunable compact source in this frequency range is needed for lab spectroscopy as well as for compact space-deployable heterodyne receivers. This solution for obtaining useful power levels in the 2 3- THz range is based on utilizing power-combined multiplier stages. Utilizing power combining, the input power can be distributed between different multiplier chips and then recombined after the frequency multiplication. A continuous wave (CW) coherent source covering 2.48 2.75 THz, with greater than 10 percent instantaneous and tuning bandwidth, and having l 14 W of output power at room temperature, has been demonstrated. This source is based on a 91.8 101.8-GHz synthesizer followed by a power amplifier and three cascaded frequency triplers. It demonstrates that purely electronic solid-state sources can generate a useful amount of power in a region of the electromagnetic spectrum where lasers (solid-state or gas) were previously the only available coherent sources. The bandwidth, agility, and operability of this THz source has enabled wideband, high-resolution spectroscopic measurements of water, methanol, and carbon monoxide with a resolution and signal-to-noise ratio unmatched by other existing systems, providing new insight in the physics of these molecules. Further - more, the power and optical beam quality are high enough to observe the Lamb-dip effect in water. The source frequency has an absolute accuracy better than 1 part in 1012, and the spectrometer achieves sub-Doppler frequency resolution better than 1 part in 108. The harmonic purity is better than 25 dB. This source can serve as a local oscillator for a variety of heterodyne systems, and can be used as a method for precision control of more powerful but much less frequency-agile quantum mechanical terahertz sources.

  5. Sud du Sahara | Page 245 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue French. Read more about African Copyright and Access to Knowledge Network (ACA2K). Langue English. Read more about Effects of Radio on Perception of Agricultural Biotechnology in Africa. Langue English. Read more about Les droits des consommateurs en matière de TIC en Afrique australe. Langue French.

  6. Article Synthesis and Trypanocidal Activity of Novel 2,4,5-Triaryl-N-Hydroxylimidazole Derivatives

    Directory of Open Access Journals (Sweden)

    Edson Ferreira da Silva

    2013-03-01

    Full Text Available Herein, we report the design, synthesis and trypanocidal activity of some novel trisubstituted imidazole derivatives. These heterocyclic derivatives were structurally planned by exploring the concept of molecular hybridisation between two arylhydrazones derived from megazol, which has potent trypanocidal activity. The trypanocidal activity of these triarylimidazole derivatives was evaluated against infective trypomastigote forms of T. cruzi and the derivative 2'-(4-bromophenyl-1-methyl-5'-phenyl-1H,3'H-2,4'-biimidazol-3'-ol showed moderate biological activity (IC50 = 23.9 µM when compared to benznidazole, a standard trypanocidal drug. These compounds did not present cytotoxic effects at concentrations near the trypanocidal IC50, being considered a good starting point for the development of new anti-Chagas drug candidates.

  7. Antibacterial activity of synthesized 2,4,5-trisubstituted imidazole derivatives

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Siddiqui, S.A.; Siddiqui, M.S.R.A.; Goswami, U.; Srinivasan, K.V.; Khan, M.I.

    release or inhibiting the p38 MAP kinase (1), anti-allergic activity (2) and analgesic activity (3). They are also sensitizers of multidrug-resistant cancer cells (4), pesticides (5), antibiotics (6) or sodium-channel mod- ulators (7). Some imidazole...

  8. Sanitary Norms of the Design of Industrial Enterprises. SN 245-71.

    Science.gov (United States)

    1979-07-09

    Cyclohexene . (89). Cyclohexanol . (90). Cyclohexanone. (91) . Cyclohexanoaeoxime. (92) . Carbon tetrachloride. (93). Epichlorhydrin. (94). Ethylene glycol. (95...products ot organic synthesis (alcohol, ethyl ether, etc.) and oil gases during processing/treatment is more than 5000 m3/h. 21. Production of...formalin, urotropin, yiantaerythryte, methylpyrrolidone, polyvinylpyrollidone, Froducts cr organic synthesis (alcohol, ethyl alcohol, etc.) of oil gas

  9. Space-Time Uncertainty and Cosmology: a Proposed Quantum Model of the Universe [ 245Kb

    Directory of Open Access Journals (Sweden)

    Tosto S.

    2013-10-01

    Full Text Available The paper introduces a cosmological model of the quantum universe. The aim of the model is (i to identify the possible mechanism that governs the matter/antimatter ratio existing in the universe and concurrently to propose (ii a reasonable growth mechanism of the universe and (iii a possible explanation of the dark energy. The concept of timespace uncertainty, on which is based the present quantum approach, has been proven able to bridge quantum mechanics and relativity.

  10. Amberlyst A-15: Reusable catalyst for the synthesis of 2,4,5 ...

    Indian Academy of Sciences (India)

    Abstract. One-pot multi-component condensation of benzyl, aldehydes, ammonium acetate and primary amines were used for synthesis of 2 ... Heterocyclic compounds with imidazole ring systems have many pharmaceutical activities and ... in the synthesis of many therapeutic agents. Omepra- zole, Pimobendan, Losarton ...

  11. 48 CFR 245.608-7 - Reimbursement of cost for transfer of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... of contractor inventory. The Defense Logistics Agency will pay for the movement of industrial plant equipment under the direction and control of the Defense Industrial Plant Equipment Center. ... DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY...

  12. 7 CFR 245.9 - Special assistance certification and reimbursement alternatives.

    Science.gov (United States)

    2010-01-01

    ... Provision 2 school's total daily meal counts to the school's total enrollment, adjusted by an attendance... direct certification; Food Distribution Program on Indian Reservations data; statistical sampling of the... Provision 3 school's total daily meal counts to the school's total enrollment, adjusted by an attendance...

  13. 7 CFR 245.11 - Action by State agencies and FNSROs.

    Science.gov (United States)

    2010-01-01

    ... previous year on the basis of local data collected by a city or county zoning and/or economic planning..., FNS will also require each State agency to report the aggregate number of students who were terminated...

  14. 8 CFR 245a.3 - Application for adjustment from temporary to permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... who is or was an aged, blind, or disabled individual (as defined in section 1614(a)(1) of the Social... ability to support himself or herself even though his or her income may be below the poverty level is not... of the Department of Justice or bureau of agency thereof, will be permitted to examine individual...

  15. : tous les projets | Page 245 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: PEACE RESEARCH, CONFLICT RESOLUTION, REFUGEES, INTERNATIONAL NEGOTIATIONS. Région: Middle East, Palestine, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 720,673.00. Dialogue sur les solutions à la question des réfugiés palestiniens. Projet.

  16. Education and Conflict in Haiti: Rebuilding the Education Sector after the 2010 Earthquake. Special Report 245

    Science.gov (United States)

    Luzincourt, Ketty; Gulbrandson, Jennifer

    2010-01-01

    In Haiti, education both promotes and ameliorates conflict. This report describes the education sector before the 2010 earthquake, then presents recommendations on how Haiti and the international community can increase access to and the quality of Haitian schools and modernize the organization and function of the national education sector.…

  17. Design of a seismic energy dissipator for an interruptor type 3AS2-45; Diseno de un disipador de energia sismica para un interruptor tipo 3AS2-45

    Energy Technology Data Exchange (ETDEWEB)

    Castro Felix, Jaime

    2004-02-15

    With the aid of the theory behind seismically isolated structures and the bi-linear behavior of an isolated system of Multiple Degrees of Freedom (MDOF), the information obtained on the spectral analysis is complemented with the purpose of simulating one itself for the design of a dissipator of seismic energy. The seismicity in the world is briefly explained, (in Mexico in special for the Geothermal Field of Cerro Prieto), the types of earthquakes, etc., to give way to a documentation of the state-of-the-art in advanced seismic resistant systems and to a procedure to establish the level of seismic qualification of electrical equipment from the level of seismic performance for the Mexican Republic. [Spanish] Con la ayuda de la teoria detras de estructuras aisladas sismicamente y el comportamiento bilineal de un sistema de aislamiento de Multiples Grados de Libertad (MDOF), se complementa la informacion recabada sobre el analisis espectral con el fin de simular uno propio para el diseno de un disipador de energia sismica. Se explica brevemente la sismicidad en el mundo, en Mexico, en especial el Campo Geotermico de Cerro Prieto, los tipos de sismos, etc., para dar paso a una documentacion del estado del arte en sistemas sismorresistentes avanzados y a un procedimiento para establecer el nivel de calificacion sismica de equipos electricos a partir del Nivel de desempeno sismico para la Republica Mexicana.

  18. 77 FR 50521 - Agency Information Collection Activities: Under Section 245A of the INA, Form I-687; Extension...

    Science.gov (United States)

    2012-08-21

    ... DEPARTMENT OF HOMELAND SECURITY U.S. Citizenship and Immigration Services [OMB Control Number 1615... Homeland Security (DHS), U.S. Citizenship and Immigration Services (USCIS) will be submitting the following... Coordination Division, Office of Policy and Strategy, U.S. Citizenship and Immigration Services, Department of...

  19. SU-E-T-245: MR Guided Focused Ultrasound Increased PARP Related Apoptosis On Prostate Cancer in Vivo

    Energy Technology Data Exchange (ETDEWEB)

    Chen, L; Chen, X; Cvetkovic, D; Gupta, R; Yang, D; Ma, C [Fox Chase Cancer Center, Philadelphia, PA (United States)

    2014-06-01

    Purpose: Our previous study demonstrated that significant tumor growth delay was observed in the mice treated with pulsed high intensity focused ultrasound (pHIFU). The purpose of this study is to understand the cell killing mechanisms of pHIFU. Methods: Prostate cancer cells (LNCaP), were grown orthotopically in 17 nude mice. Tumor-bearing mice were treated using pHIFU with an acoustic power of 25W, pulse width 100msec and 300 pulses in one sonication under MR guidance. Mutiple sonications were used to cover the whole tumor volume. Temperature (less than 40 degree centigrade in the focal spot) was monitored using MR thermometry. Animals were euthanized at pre-determined time points (n=2) after treatment: 0 hours; 6 hrs; 24 hrs; 48 hrs; 4 days and 7 days. Two tumorbearing mice were used as control. Three tumor-bearing mice were treated with radiation (RT, 2 Gy) using 6 MV photon beams. RT treated mice were euthanized at 0 hr, 6 hrs and 24 hrs. The tumors were processed for immunohistochemical (IHC) staining for PARP (a surrogate of apoptosis). A multispectral imaging analysis system was used to quantify the expression of PARP staining. Cell apoptosis was calculated based on the PARP expression level, which is the intensity of the DAB reaction. Results: Our data showed that PARP related apoptosis peaked at 48 hrs and 7 days in pHIFU treated mice, which is comparable to that for the RT group at 24 hrs. The preliminary results from this study were consistent with our previous study on tumor growth delay using pHIFU. Conclusion: Our results demonstrated that non-thermal pHIFU increased apoptotic tumor cell death through the PARP related pathway. MR guided pHIFU may have a great potential as a safe, noninvasive treatment modality for cancer therapy. This treatment modality might be able to synergize with PARP inhibitors to achieve better result.

  20. 8 CFR 1245.10 - Adjustment of status upon payment of additional sum under section 245(i).

    Science.gov (United States)

    2010-01-01

    ... county or municipal hospital record; (iv) A public college or public school transcript; (v) Income tax... payment to the Federal, state, or local governmental agency keeping such record; (viii) A transcript from a private or religious school that is registered with, or approved or licensed by, appropriate State...

  1. 8 CFR 245.22 - Evidence to demonstrate an alien's physical presence in the United States on a specific date.

    Science.gov (United States)

    2010-01-01

    ... record; (4) A public college or public school transcript; (5) Income tax records; (6) A certified copy of..., or local governmental agency keeping such record; or (8) A transcript from a private or religious school that is registered with, or approved or licensed by, appropriate State or local authorities...

  2. Structural Stability and Deformation of Solvated Sm@C2(45)-C90 under High Pressure

    Science.gov (United States)

    Cui, Jinxing; Yao, Mingguang; Yang, Hua; Liu, Ziyang; Liu, Shijie; Du, Mingrun; Li, Quanjun; Liu, Ran; Cui, Tian; Liu, Bingbing

    2016-08-01

    Solvated fullerenes recently have been shown to exhibit novel compression behaviors compared with the pristine fullerenes. However, less attention has been focused on the large cage endohedral metallofullerenes. Here, we have firstly synthesized solvated Sm@C90 microrods by a solution drop-drying method, and then studied the transformations under high pressure. The pressure-induced structural evolutions of Sm@C90 molecules both undergo deformation and collapse. The band gaps of both samples decrease with increasing pressure. The trapped Sm atom plays a role in restraining the compression of the adjacent bonds. The solvent plays a role in protecting Sm@C90 against collapse in the region of 12-20 GPa, decreasing and postponing the change of band gap. Above 30 GPa, the carbon cages collapse. Released from 45 GPa, the compressed solvated Sm@C90 forms a new ordered amorphous carbon cluster (OACC) structure with metal atoms trapped in the units of amorphous carbon clusters, which is different from the OACC structure formed by compressing solvated C60 and C70. This discovery opens the door for the creation of new carbon materials with desirable structural and physical properties when suitable starting materials are selected.

  3. Computer simulation and experimental study of the polysaccharide-polysaccharide interaction in the bacteria Azospirillum brasilense Sp245

    Science.gov (United States)

    Arefeva, Oksana A.; Kuznetsov, Pavel E.; Tolmachev, Sergey A.; Kupadze, Machammad S.; Khlebtsov, Boris N.; Rogacheva, Svetlana M.

    2003-09-01

    We have studied the conformational properties and molecular dynamics of polysaccharides by using molecular modeling methods. Theoretical and experimental results of polysaccharide-polysaccharide interactions are described.

  4. 7 CFR 245.6 - Application, eligibility and certification of children for free and reduced price meals and free...

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION... income (such as earnings, wages, welfare, pensions, support payments, unemployment compensation, social... application is being made for a child(ren) who is a member of a household receiving assistance under the Food...

  5. 40 CFR 1048.245 - How do I demonstrate that my engine family complies with evaporative emission standards?

    Science.gov (United States)

    2010-07-01

    ... paragraph (e) of this section. (b) Your engine family does not comply if any fuel system representing that... the useful life. (d) If you adjust the emission levels for deterioration, round them to the same... standard for each test fuel system. (e) You may demonstrate that your engine family complies with the...

  6. 8 CFR 245.15 - Adjustment of status of certain Haitian nationals under the Haitian Refugee Immigrant Fairness...

    Science.gov (United States)

    2010-01-01

    ... a child from his or her parents due to any of the following: (1) The death or disappearance of... death or disappearance, as that term is defined in § 204.3(b) of this chapter, of one parent and the... unmarried son or daughter of a principal HRIFA beneficiary, even if the individual would not otherwise be...

  7. SU-F-T-245: The Investigation of Failure Mode and Effects Analysis and PDCA for the Radiotherapy Risk Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Xie, J; Wang, J; P, J; Chen, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)

    2016-06-15

    Purpose: To optimize the clinical processes of radiotherapy and to reduce the radiotherapy risks by implementing the powerful risk management tools of failure mode and effects analysis(FMEA) and PDCA(plan-do-check-act). Methods: A multidiciplinary QA(Quality Assurance) team from our department consisting of oncologists, physicists, dosimetrists, therapists and administrator was established and an entire workflow QA process management using FMEA and PDCA tools was implemented for the whole treatment process. After the primary process tree was created, the failure modes and Risk priority numbers(RPNs) were determined by each member, and then the RPNs were averaged after team discussion. Results: 3 of 9 failure modes with RPN above 100 in the practice were identified in the first PDCA cycle, which were further analyzed to investigate the RPNs: including of patient registration error, prescription error and treating wrong patient. New process controls reduced the occurrence, or detectability scores from the top 3 failure modes. Two important corrective actions reduced the highest RPNs from 300 to 50, and the error rate of radiotherapy decreased remarkably. Conclusion: FMEA and PDCA are helpful in identifying potential problems in the radiotherapy process, which was proven to improve the safety, quality and efficiency of radiation therapy in our department. The implementation of the FMEA approach may improve the understanding of the overall process of radiotherapy while may identify potential flaws in the whole process. Further more, repeating the PDCA cycle can bring us closer to the goal: higher safety and accuracy radiotherapy.

  8. Decree No. 895, Special Law on the expropriation and disposition of rural lands exceeding 245 hectares, 18 February 1988.

    Science.gov (United States)

    1988-01-01

    This Law contains rules on the expropriation of land that was not broken into parcels as mandated by Article 105 of the Constitution of El Salvador. Such land is to be taken over by the Government unless it is the land of farming cooperatives or communities. Under the Law, a legal presumption exists that the owner of such land is responsible for the fact that it has not been broken up. The Salvadoran Institute of Agrarian Transformation (ISTA) is charged with taking possession and disposing of expropriated land. It is to determine indemnification for the land and to pay indemnification by means of agrarian reform bonds, which can be used by the holder for financing various agricultural projects. It is to transfer the land to farmers, farming communities, and farming cooperatives, with preference given to those already exploiting the land; no individual is to receive more than seven hectares. ISTA is also to set the terms by which those given land are to pay for it, and, in no case, is it to receive less than it gave to those from whom it expropriated the land. full text

  9. SU-E-T-245: MR Guided Focused Ultrasound Increased PARP Related Apoptosis On Prostate Cancer in Vivo

    International Nuclear Information System (INIS)

    Chen, L; Chen, X; Cvetkovic, D; Gupta, R; Yang, D; Ma, C

    2014-01-01

    Purpose: Our previous study demonstrated that significant tumor growth delay was observed in the mice treated with pulsed high intensity focused ultrasound (pHIFU). The purpose of this study is to understand the cell killing mechanisms of pHIFU. Methods: Prostate cancer cells (LNCaP), were grown orthotopically in 17 nude mice. Tumor-bearing mice were treated using pHIFU with an acoustic power of 25W, pulse width 100msec and 300 pulses in one sonication under MR guidance. Mutiple sonications were used to cover the whole tumor volume. Temperature (less than 40 degree centigrade in the focal spot) was monitored using MR thermometry. Animals were euthanized at pre-determined time points (n=2) after treatment: 0 hours; 6 hrs; 24 hrs; 48 hrs; 4 days and 7 days. Two tumorbearing mice were used as control. Three tumor-bearing mice were treated with radiation (RT, 2 Gy) using 6 MV photon beams. RT treated mice were euthanized at 0 hr, 6 hrs and 24 hrs. The tumors were processed for immunohistochemical (IHC) staining for PARP (a surrogate of apoptosis). A multispectral imaging analysis system was used to quantify the expression of PARP staining. Cell apoptosis was calculated based on the PARP expression level, which is the intensity of the DAB reaction. Results: Our data showed that PARP related apoptosis peaked at 48 hrs and 7 days in pHIFU treated mice, which is comparable to that for the RT group at 24 hrs. The preliminary results from this study were consistent with our previous study on tumor growth delay using pHIFU. Conclusion: Our results demonstrated that non-thermal pHIFU increased apoptotic tumor cell death through the PARP related pathway. MR guided pHIFU may have a great potential as a safe, noninvasive treatment modality for cancer therapy. This treatment modality might be able to synergize with PARP inhibitors to achieve better result

  10. 8 CFR 1240.34 - Renewal of application for adjustment of status under section 245 of the Act.

    Science.gov (United States)

    2010-01-01

    ... IMMIGRATION REVIEW, DEPARTMENT OF JUSTICE IMMIGRATION REGULATIONS PROCEEDINGS TO DETERMINE REMOVABILITY OF ALIENS IN THE UNITED STATES Exclusion of Aliens (for Proceedings Commenced Prior to April 1, 1997) § 1240... the United States; and second, the applicant's later absence from and return to the United States must...

  11. 7 CFR 245.8 - Nondiscrimination practices for children eligible to receive free and reduced price meals and...

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION... Nondiscrimination practices for children eligible to receive free and reduced price meals and free milk. School Food... 7 Agriculture 4 2010-01-01 2010-01-01 false Nondiscrimination practices for children eligible to...

  12. 8 CFR 245a.4 - Adjustment to lawful resident status of certain nationals of countries for which extended...

    Science.gov (United States)

    2010-01-01

    ... support himself or herself even though his or her income may be below the poverty level may be admissible... confidentiality. (i) No person other than a sworn officer or employee of the Department of Justice or bureau or... be considered an employee of the Department of Justice or bureau or agency thereof. (ii) No...

  13. Imagem e palavra na leitura de narrativa - doi: 10.5007/2175-795X.2011v29n1p245

    Directory of Open Access Journals (Sweden)

    Flávia Brocchetto Ramos

    2011-10-01

    Full Text Available A produção infantil contemporânea explora as várias linguagens constitutivas da obra literária infantil – palavra e ilustração. A leitura dessas obras possibilita ao leitor a construção de significados na interação entre os códigos verbal e visual. A fim de investigar esse processo de leitura realizado a partir da interação com a linguagem verbal e visual, realiza-se estudo sobre a narrativa Ah, cambaxirra, se eu pudesse..., de Ana Maria Machado e Graça Lima (2003. Enfocam-se dois aspectos: a análise de possibilidades de leitura propostas pelas linguagens, a partir de estudos de Genette (1982, Iser (1976, Kleiman (2002, Parsons (1992 e Zilberman (1998, e os sentidos construídos por crianças de terceira série do ensino fundamental, seguindo princípios de pesquisa qualitativa (BAUER; GASKELL, 2003; EISNER, 1998. O estudo confirma a ampliação de sentidos do texto, pela inter-relação entre as linguagens. Entretanto, a análise da leitura das crianças sinaliza que os sentidos construídos privilegiam a palavra, em detrimento de aspectos visuais. A perspectiva observada na leitura infantil é efeito da abordagem da literatura na escola, que não forma leitores proficientes. O artigo objetiva contribuir para pesquisas na área como também para instrumentalizar mediadores de leitura.

  14. 8 CFR 245.13 - Adjustment of status of certain nationals of Nicaragua and Cuba under Public Law 105-100.

    Science.gov (United States)

    2010-01-01

    ... hospital record; (D) A public college or public school transcript; and (E) Income tax records; (iv) A copy... under the age of 21, attended a private or religious school in the United States on or prior to December 1, 1995, a transcript from such private or religious school, provided that the school: (A) Is...

  15. Integrated safety assessment report: Integrated Safety Assessment Program: Millstone Nuclear Power Station, Unit 1 (Docket No. 50-245): Draft report

    International Nuclear Information System (INIS)

    1987-04-01

    The Integrated Safety Assessment Program (ISAP) was initiated in November 1984, by the US Nuclear Regulatory Commission to conduct integrated assessments for operating nuclear power reactors. The integrated assessment is conducted in a plant-specific basis to evaluate all licensing actions, licensee initiated plant improvements and selected unresolved generic/safety issues to establish implementation schedules for each item. In addition, procedures will be established to allow for a periodic updating of the schedules to account for licensing issues that arise in the future. This report documents the review of Millstone Nuclear Power Station, Unit No. 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit No. 1, is one of two plants being reviewed under the pilot program for ISAP. This report indicates how 85 topics selected for review were addressed. This report presents the staff's recommendations regarding the corrective actions to resolve the 85 topics and other actions to enhance plant safety. The report is being issued in draft form to obtain comments from the licensee, nuclear safety experts, and the Advisory Committee for Reactor Safeguards (ACRS). Once those comments have been resolved, the staff will present its positions, along with a long-term implementation schedule from the licensee, in the final version of this report

  16. 40 CFR 180.426 - 2-[4,5-Dihydro-4-methyl-4-(1-methylethyl)-5-oxo-1H-imidazol-2-yl]-3-quinoline carboxylic acid...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false 2- -3-quinoline carboxylic acid... Tolerances § 180.426 2- -3-quinoline carboxylic acid; tolerance for residues. A tolerance is established for residues of the herbicide 2- -3-quinoline carboxylic acid, in or on the raw agricultural commodity soybean...

  17. 24 CFR 245.416 - Initial submission of materials to HUD: Conversion from project-paid utilities to tenant-paid...

    Science.gov (United States)

    2010-04-01

    ... projects, and utility rate information, as obtained from the utility supplier; (iv) The estimated monthly... HUD: Conversion from project-paid utilities to tenant-paid utilities or a reduction in tenant utility... AUTHORITIES TENANT PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Procedures for Requesting Approval of a...

  18. 47 CFR 15.245 - Operation within the bands 902-928 MHz, 2435-2465 MHz, 5785-5815 MHz, 10500-10550 MHz, and 24075...

    Science.gov (United States)

    2010-10-01

    ... limited to intentional radiators used as field disturbance sensors, excluding perimeter protection systems. (b) The field strength of emissions from intentional radiators operated within these frequency bands shall comply with the following: Fundamental frequency (MHz) Field strength of fundamental (millivolts...

  19. Integrated-plant-safety assessment Systematic Evaluation program. Millstone Nuclear Power Station, Unit 1, Northeast Nuclear Energy Company, Docket No. 50-245

    International Nuclear Information System (INIS)

    1982-11-01

    The Systematic Evaluation Program was initiated in February 1977 to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides: (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the Millstone Nuclear Power Station, Unit 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit 1, is one of ten plants reviewed under Phase II of this program. This report indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  20. Simulation and Experimental Studies of a 2.45GHz Magnetron Source for an SRF Cavity with Field Amplitude and Phase Controls

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Haipeng [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Plawski, Tomasz E. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Rimmer, Robert A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Dudas, A. [Muons Inc., Batavia, IL (United States); Neubauer, M. L. [Muons Inc., Batavia, IL (United States)

    2016-06-01

    Phase lock to an SRF cavity by using injection signal through output waveguide of a magnetron has been demonstrated [1, 3]. Amplitude control using magnetic field trimming and anode voltage modulation has been studied using MATLAB/Simulink simulations [2]. Based on these, we are planning to use an FPGA based digital LLRF system, which allows applying various types of control algorithms in order to achieve the required accelerating field stability. Since the 1497 MHz magnetron is still in the design stage, the proof of principle measurements of a commercial 2450 MHz magnetron are carried out to characterize the anode I-V curve, output power (the tube electronic efficiency), frequency dependence on the anode current (frequency pushing) and the Rieke diagram (frequency pulling by the reactive load). Based on early Simulink simulation, experimental data and extension of the Adler equation governing injection phase stability by Chen’s model, the specification of the new LLRF control chassis for both 2450 and 1497MHz systems are presented in this paper.

  1. BJ-1108, a 6-Amino-2,4,5-trimethylpyridin-3-ol analogue, regulates differentiation of Th1 and Th17 cells to ameliorate experimental autoimmune encephalomyelitis.

    Science.gov (United States)

    Kang, Youra; Timilshina, Maheshwor; Nam, Tae-Gyu; Jeong, Byeong-Seon; Chang, Jae-Hoon

    2017-02-28

    CD4 + T cells play an important role in the initiation of an immune response by providing help to other cells. Among the helper T subsets, interferon-γ (IFN-γ)-secreting T helper 1 (Th1) and IL-17-secreting T helper 17 (Th17) cells are indispensable for clearance of intracellular as well as extracellular pathogens. However, Th1 and Th17 cells are also associated with pathogenesis and contribute to the progression of multiple inflammatory conditions and autoimmune diseases. In the current study, we found that BJ-1108, a 6-aminopyridin-3-ol analogue, significantly inhibited Th1 and Th17 differentiation in vitro in a concentration-dependent manner, with no effect on proliferation or apoptosis of activated T cells. Moreover, BJ-1108 inhibited differentiation of Th1 and Th17 cells in ovalbumin (OVA)-specific OT II mice. A complete Freund's adjuvant (CFA)/OVA-induced inflammatory model revealed that BJ-1108 can reduce generation of proinflammatory Th1 and Th17 cells. Furthermore, in vivo studies showed that BJ-1108 delayed onset of disease and suppressed experimental autoimmune encephalomyelitis (EAE) disease progression by inhibiting differentiation of Th1 and Th17 cells. BJ-1108 treatment ameliorates inflammation and EAE by inhibiting Th1 and Th17 cells differentiation. Our findings suggest that BJ-1108 is a promising novel therapeutic agent for the treatment of inflammation and autoimmune disease.

  2. Investigation of an experimental ejector refrigeration machine operating with refrigerant R245fa at design and off-design working conditions. Part 1. Theoretical analysis

    KAUST Repository

    Shestopalov, K.O.

    2015-07-01

    © 2015 Elsevier Ltd and IIR.All rights reserved. The ejector refrigeration machine (ERM) offers several advantages over other heat-driven refrigeration machine, including simplicity in design and operation, high reliability and low installation cost, which enable its wide application in the production of cooling. In this paper the theoretical analysis of ejector design and ejector refrigeration cycle performance is presented. It is shown that ERM performance characteristics depend strongly on the operating conditions, the efficiency of the ejector used, and the thermodynamic properties of the refrigerant used. A 1-D model for the prediction of the entrainment ratio ω, and an optimal design for ejectors with cylindrical and conical-cylindrical mixing chambers are presented in this paper. In order to increase ERM performance values, it is necessary first of all to improve the performance of the ejector.

  3. CCDC 782643: Experimental Crystal Structure Determination : tetrakis(mu~2~-4,5-imidazoledicarboxylato)-tetrakis(1,2-propanediamine)-tetra-cobalt octacosahydrate

    KAUST Repository

    Wang, Shuang

    2011-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  4. Early life exposure to 2.45GHz WiFi-like signals: effects on development and maturation of the immune system.

    Science.gov (United States)

    Sambucci, Manolo; Laudisi, Federica; Nasta, Francesca; Pinto, Rosanna; Lodato, Rossella; Lopresto, Vanni; Altavista, Pierluigi; Marino, Carmela; Pioli, Claudio

    2011-12-01

    The development of the immune system begins during embryogenesis, continues throughout fetal life, and completes its maturation during infancy. Exposure to immune-toxic compounds at levels producing limited/transient effects in adults, results in long-lasting or permanent immune deficits when it occurs during perinatal life. Potentially harmful radiofrequency (RF) exposure has been investigated mainly in adult animals or with cells from adult subjects, with most of the studies showing no effects. Is the developing immune system more susceptible to the effects of RF exposure? To address this question, newborn mice were exposed to WiFi signals at constant specific absorption rates (SAR) of 0.08 or 4 W/kg, 2h/day, 5 days/week, for 5 consecutive weeks, starting the day after birth. The experiments were performed with a blind procedure using sham-exposed groups as controls. No differences in body weight and development among the groups were found in mice of both sexes. For the immunological analyses, results on female and male newborn mice exposed during early post-natal life did not show any effects on all the investigated parameters with one exception: a reduced IFN-γ production in spleen cells from microwaves (MW)-exposed (SAR 4 W/kg) male (not in female) mice compared with sham-exposed mice. Altogether our findings do not support the hypothesis that early post-natal life exposure to WiFi signals induces detrimental effects on the developing immune system. Copyright © 2011 Elsevier Ltd. All rights reserved.

  5. Multibeam collection for TN245: Multibeam data collected aboard Thomas G. Thompson from 2009-12-14 to 2010-01-09, Seattle, WA to Punta Arenas, Chile

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. The Effect of Technology on Alienation from Work. Testing Blauner's Inverted U-Curve Hypothesis for 110 Industrial Organizations and 245 Retrained Printers.

    Science.gov (United States)

    Hull, Frank M.; And Others

    1982-01-01

    Presents new evidence on the effect of technology on worker alienation, using data from the organizational level as well as the individual level. In the latter approach, the impact of automation on the work of newspaper printers is examined. (SK)

  7. Integrated Plant Safety Assessment: Systematic Evaluation Program. Millstone Nuclear Power Station, Unit 1, Northeast Nuclear Energy Company, Docket No. 50-245. Final report

    International Nuclear Information System (INIS)

    1983-02-01

    This report documents the review of the Millstone Nuclear Power Station, Unit 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit 1, is one of ten plants reviewed under Phase II of this program. This report indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license. This report also addresses the comments and recommendations made by the Advisory Committee on Reactor Safeguards in connection with its review of the Draft Report, issued in November 1982

  8. Wearable slot antenna at 2.45 GHz for off-body radiation: Analysis of efficiency, frequency shift, and body absorption.

    Science.gov (United States)

    Fernandez, Marta; Espinosa, Hugo G; Thiel, David V; Arrinda, Amaia

    2018-01-01

    The interaction of body-worn antennas with the human body causes a significant decrease in antenna efficiency and a shift in resonant frequency. A resonant slot in a small conductive box placed on the body has been shown to reduce these effects. The specific absorption rate is less than international health standards for most wearable antennas due to small transmitter power. This paper reports the linear relationship between power absorbed by biological tissues at different locations on the body and radiation efficiency based on numerical modeling (r = 0.99). While the -10 dB bandwidth of the antenna remained constant and equal to 12.5%, the maximum frequency shift occurred when the antenna was close to the elbow (6.61%) and on the thigh (5.86%). The smallest change was found on the torso (4.21%). Participants with body-mass index (BMI) between 17 and 29 kg/m 2 took part in experimental measurements, where the maximum frequency shift was 2.51%. Measurements showed better agreement with simulations on the upper arm. These experimental results demonstrate that the BMI for each individual had little effect on the performance of the antenna. Bioelectromagnetics. 39:25-34, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  9. Effect of electromagnetic fields at 2.45 GHz on the levels of cellular stress proteins HSP-90 and 70 in the rat thyroid

    International Nuclear Information System (INIS)

    Misa Agustino, M. J.; Alvarez-Folgueras, M.; Jorge-Mora, M. T.; Jorge Barreiro, F. J.; Ares Pena, F. J.; Lleiro, J.; Lopez Martin, M. E.

    2011-01-01

    In this study we analyzed the cellular stress levels achieved by heat shock proteins (HSP) 90 and 70 in rat thyroid tissue after exposure to radio waves in TWG experimental system. Parallel measurements of body stress in animals by rectal temperature probes allow us to determine whether there is any interaction between temperature increases and cellular stress.

  10. Safety Evaluation Report related to the full-term operating license for Millstone Nuclear Power Station, Unit No. 1 (Docket No. 50-245)

    International Nuclear Information System (INIS)

    1985-10-01

    The Safety Evaluation Report for the full-term operating license application filed by the Connecticut Light and Power Company, the Hartford Electric Light Company, Western Massachusetts Electric Company and the Millstone Point Company [(now known as Connecticut Light and Power Company (CL and P) and Western Massachusetts Electric Company (WMECO) having authority to possess Millstone-1, 2, and 3, and the Northeast Nuclear Energy Company (NNECO) as the responsible entity for operation of the facilities)] for Millstone Nuclear Power Station Unit 1 has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in the town of Waterford, Connecticut. Subject to favorable resolution of the items discussed in this report, the staff concludes that the facility can continue to be operated without endangering the health and safety of the public

  11. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  12. Production and action pattern of inulinase from Aspergillus Niger-245: hydrolysis of inulin from several sources Produção e mecanismo de ação de inulinase de Aspergillus niger-245: hidrólise de inulinas de diferentes origens

    Directory of Open Access Journals (Sweden)

    Vinícius D’Arcadia Cruz

    1998-10-01

    Full Text Available A strain of Aspergillus niger isolated from soil samples showed great capacity to produce extracellular inulinase. Although the enzyme has been synthesized in presence of monosaccharides, sucrose and sugar cane molasse, the productivity was significantly higher (pUma linhagem de Aspergillus niger isolada de amostras de solo mostrou grande capacidade de produzir inulinase extracelular. Embora a enzima tenha sido sintetizada na presença de monossacarídeos, sacarose e melaço de cana, a produtividade foi significativamente maior (p<0.01 quando o microrganismo foi inoculado em meios formulados com extrato de dália e inulina pura, como fontes de carbono. Em relação à fonte de nitrogênio, os melhores resultados foram obtidos com caseína e outras fontes de nitrogênio proteico, comparativamente ao nitrogênio mineral. Entretanto, somente foi encontrada significância (p<0.01 entre a produtividade obtida nos meios preparados com caseína e sulfato de amônia. O pH ótimo da enzima purificada foi localizado entre 4.0 e 4.5 e a temperatura ótima a 60ºC. Quando tratada por 30 minutos nesta temperatura nenhuma perda de atividade foi observada. A enzima mostrou capacidade de hidrolisar sacarose, rafinose e inulina, da qual liberou apenas unidades de frutose, mostrando, portanto, um mecanismo de exo-ação. Atuando sobre inulinas de diversas fontes, a enzima mostrou maior velocidade de hidrólise sobre o polissacarídeo da chicória, comparativamente, às inulinas de raízes de dalia e alcachofra.

  13. Effect of electromagnetic fields at 2.45 GHz on the levels of cellular stress proteins HSP-90 and 70 in the rat thyroid; Efecto de los campos electromagneticos a 2,45 GHz sobre los niveles de proteinas de estres celular HSP-90 y 70 en el toroides de rata

    Energy Technology Data Exchange (ETDEWEB)

    Misa Agustino, M. J.; Alvarez-Folgueras, M.; Jorge-Mora, M. T.; Jorge Barreiro, F. J.; Ares Pena, F. J.; Lleiro, J.; Lopez Martin, M. E.

    2011-07-01

    In this study we analyzed the cellular stress levels achieved by heat shock proteins (HSP) 90 and 70 in rat thyroid tissue after exposure to radio waves in TWG experimental system. Parallel measurements of body stress in animals by rectal temperature probes allow us to determine whether there is any interaction between temperature increases and cellular stress.

  14. Polinização por Apis mellifera em soja transgênica [Glycine max (L. Merrill] Roundup Ready™ cv. BRS 245 RR e convencional cv. BRS 133 = Pollination by Apis mellifera in transgenic soy (Glycine max (L. Merrill Roundup Ready™ cv. BRS 245 RR and conventional cv. BRS 133

    Directory of Open Access Journals (Sweden)

    Tais da Silva Lopes

    2008-04-01

    Full Text Available O objetivo deste estudo foi verificar a influência de Apis mellifera na produção de grãos e qualidade de sementes da soja transgênica Glycine max (L. Merrill Roundup Ready™ e convencional. A soja transgênica foi plantada intercalada com a convencional, em 18 parcelas, em três tratamentos: gaiolas com abelhas A. mellifera, gaiolas sem abelhas e áreas descobertas, com livre visitação de insetos. Na soja transgênica, em três parcelas de cada tratamento, foi aplicado glifosato, 30 dias após a emergência. Os parâmetros analisados foram: produção de grãos; número de vagens por planta; peso de 100 sementes e porcentagem de germinação das sementes. Não houve diferença entre as cultivares, entretanto a produção de 2.757,40 kg ha-1 obtida na área coberta por gaiola com abelhas, e2.828,47 kg ha-1 na área livre para visitação de insetos foram superiores a 2.000,53 kg ha-1 da área coberta por gaiola sem abelhas. O número de vagens por planta foi maior na área coberta por gaiola com abelhas (38,28 e área livre (32,65, quando comparado com o daárea coberta por gaiola sem abelhas (21,19. O peso médio de 100 sementes e a germinação das sementes não foram diferentes entre as cultivares e nem entre os tratamentos. Concluise que, para as cultivares estudadas, houve benefício na produção de grãos de 37,84%,quando foi permitida a visita de abelhas.This research was carried out to evaluate the influence of Africanized honeybees in grain production and seed quality of Glycine max (L. Merrill Roundup Ready™ transgenic soy, as well as of conventional soy. Transgenic soy was interposed with conventional soybean, in 18 plots and three treatments: covered area with Africanized honeybees, covered area without honeybees, and uncovered area with free insect visitation. The herbicide Glyphosate was applied on three plots of each treatment of transgenic soy, 30 days after emergence. Grain production, number of pods/plant, weight per 100 seeds, and seed germination percentage were evaluated. There was no difference among cultivars; however, the production in the covered area with honeybees (2757.4 kg ha-1 and in the uncovered area (2828.47 kg ha-1 were higher than in the covered area without honeybees (2000.53 kg ha-1. The number of pods/plant was greater than in the covered area with honeybees (38.28 and in the uncovered area (32.65 as compared to the covered area without honeybees (21.19. The weight per 100 seeds seed germination did not differ among cultivars or treatments. It can be concluded that, for these cultivars, there was a rise in grain production of 37.84% when honeybee visits were allowed.

  15. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  16. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers

    Science.gov (United States)

    Shekoohi-Shooli, F.; Mortazavi, S.M.J.; Shojaei-fard, M.B.; Nematollahi, S.; Tayebi, M.

    2016-01-01

    Background: The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi) routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people’s health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. Material and Methods: 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group).The first stage one -day test: Group A (received vitamin C 250 mg/kg/day orally together with 8- hour/day Wi-Fi exposure).Group B (exposed to Wi-Fi radiation). Group C (received vitamin C). Group D or Control (was neither exposed to radiation of Wi-Fi modem nor did receive vitamin C). The second phase of experiment had done for five consecutive days. It involved Group E (received vitamin C), Group F (exposed to Wi-Fi radiation), Group G (received vitamin C together with Wi-Fi radiation). The distance between animals’ restrainers was 20 cm away from the router antenna. Finally, blood samples were collected and assayed the level of hepatic enzymes including alkaline phosphatase(ALP), alanine amino transferase(ALT) aspartate amino transferase (ASL), gamma glutamyl transferase (GGT) and the concentration of Blood Glucose, Cholesterol , Triglyceride(TG),High density lipoprotein (HDL)and low density lipoprotein (LDL). Results: Data obtained from the One day test showed an increase in concentration of blood glucose, decrease in Triglyceride level and GGT factor (P<0.05), however no observed significant difference on the Cholesterol , HDL , LDL level and hepatic enzymes activities in compare to control group. Groups of the five-day test showed reduction in the amount of blood glucose, elevation of cholesterol level and LDL relative to control group(P<0.05). Conclusion: WiFi exposure may exert alternations on the metabolic parameters and hepatic enzymes activities through stress oxidative and increasing of free radicals, but the use of vitamin C protects them from changing induced. Also taking optimum dose of vitamin C is essential for radioprotective effect and maintaining optimum health. PMID:27853723

  17. Abu-Rabia, S. (1996. Attitudes and cultural background and their relationship to reading comprehension in a second language: A comparison of three different social contexts. International Journal of Applied Linguistics24(5, 711-721. Afflerbach, P. (1986

    Directory of Open Access Journals (Sweden)

    Inayatullah Kakepoto

    2012-09-01

    Full Text Available This study investigated the effect of content familiarity and test format on Iranian English learners. The participants of this were advanced students studying at different language institutes in Isfahan, Iran. To sample the subjects of this study, the latest version of Oxford Placement Test was administered to 428 students studying at advanced level in 6 different language institutes. Based on the results of the OPT test and for the sake of homogeneity 70 students were considered as the target participants of the study. Each participant was given a test of reading comprehension with familiar content and unfamiliar content. Each test contained multiple choice, true/false, and fill in the blanks test items. Factorial design results indicated that test takers had a significantly better performance on content familiar tests and sub tests. It also became clear that their performance on multiple choice section either in content familiar and content unfamiliar test was superior to that of true/false and fill in the blanks. It will be of endless help to test makers and language teachers to be aware of the role test format and content of the test can play on test takers’ performance.

  18. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers.

    Science.gov (United States)

    Shekoohi-Shooli, F; Mortazavi, S M J; Shojaei-Fard, M B; Nematollahi, S; Tayebi, M

    2016-09-01

    The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi) routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people's health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group).The first stage one -day test: Group A (received vitamin C 250 mg/kg/day orally together with 8- hour/day Wi-Fi exposure).Group B (exposed to Wi-Fi radiation). Group C (received vitamin C). Group D or Control (was neither exposed to radiation of Wi-Fi modem nor did receive vitamin C). The second phase of experiment had done for five consecutive days. It involved Group E (received vitamin C), Group F (exposed to Wi-Fi radiation), Group G (received vitamin C together with Wi-Fi radiation). The distance between animals' restrainers was 20 cm away from the router antenna. Finally, blood samples were collected and assayed the level of hepatic enzymes including alkaline phosphatase(ALP), alanine amino transferase(ALT) aspartate amino transferase (ASL), gamma glutamyl transferase (GGT) and the concentration of Blood Glucose, Cholesterol , Triglyceride(TG),High density lipoprotein (HDL)and low density lipoprotein (LDL). Data obtained from the One day test showed an increase in concentration of blood glucose, decrease in Triglyceride level and GGT factor (P<0.05), however no observed significant difference on the Cholesterol , HDL , LDL level and hepatic enzymes activities in compare to control group. Groups of the five-day test showed reduction in the amount of blood glucose, elevation of cholesterol level and LDL relative to control group(P<0.05). WiFi exposure may exert alternations on the metabolic parameters and hepatic enzymes activities through stress oxidative and increasing of free radicals, but the use of vitamin C protects them from changing induced. Also taking optimum dose of vitamin C is essential for radioprotective effect and maintaining optimum health.

  19. CCDC 1404074: Experimental Crystal Structure Determination : (2-((4,5-diphenyl-3H-benzo[e]indol-2-yl)(phenyl)methylene)-4,5-diphenyl-2H-benzo[g]indolato)(difluoro)borate

    KAUST Repository

    Chua, Ming Hui

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  20. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers

    Directory of Open Access Journals (Sweden)

    Shekoohi-Shooli F.

    2016-09-01

    Full Text Available Background: The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people’s health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. Material and Methods: 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group.The first stage one –day test: Group A (received vitamin C 250 mg/kg/day orally together with 8- hour/day Wi-Fi exposure. Group B (exposed to Wi-Fi radiation. Group C (received vitamin C. Group D or Control (was neither exposed to radiation of Wi-Fi modem nor did receive vitamin C. The second phase of experiment had done for five consecutive days. It involved Group E (received vitamin C, Group F (exposed to Wi-Fi radiation, Group G (received vitamin C together with Wi-Fi radiation. The distance between animals’ restrainers was 20 cm away from the router antenna. Finally, blood samples were collected and assayed the level of hepatic enzymes including alkaline phosphatase(ALP, alanine amino transferase(ALT aspartate amino transferase (ASL, gamma glutamyl transferase (GGT and the concentration of Blood Glucose, Cholesterol , Triglyceride(TG,High density lipoprotein (HDLand low density lipoprotein (LDL. Results: Data obtained from the One day test showed an increase in concentration of blood glucose, decrease in Triglyceride level and GGT factor (P<0.05, however no observed significant difference on the Cholesterol , HDL , LDL level and hepatic enzymes activities in compare to control group. Groups of the five-day test showed reduction in the amount of blood glucose, elevation of cholesterol level and LDL relative to control group(P<0.05. Conclusion: WiFi exposure may exert alternations on the metabolic parameters and hepatic enzymes activities through stress oxidative and increasing of free radicals, but the use of vitamin C protects them from changing induced. Also taking optimum dose of vitamin C is essential for radioprotective effect and maintaining optimum health.

  1. CCDC 782644: Experimental Crystal Structure Determination : tetrakis(mu~2~-4,5-imidazoledicarboxylato)-tetrakis(1,2-propanediamine)-tetra-indium tri-potassium trinitrate acetonitrile solvate hydrate

    KAUST Repository

    Wang, Shuang

    2011-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  2. Activity of chalcones derived from 2,4,5-trimethoxybenzaldehyde against Meloidogyne exigua and in silico interaction of one chalcone with a putative caffeic acid 3-O-methyltransferase from Meloidogyne incognita.

    Science.gov (United States)

    Nunes, Alexandro Silva; Campos, Vicente Paulo; Mascarello, Alessandra; Stumpf, Taisa Regina; Chiaradia-Delatorre, Louise Domenghini; Machado, Alan Rodrigues Teixeira; Santos Júnior, Helvécio Martins; Yunes, Rosendo Augusto; Nunes, Ricardo José; Oliveira, Denilson Ferreira

    2013-12-01

    Meloidogyne exigua is a parasitic nematode of plants that causes great losses to coffee farmers. In an effort to develop parasitic controls, 154 chalcones were synthesized and screened for activity against this nematode. The best results were obtained with (2E)-1-(4'-nitrophenyl)-3-(2,4,5-trimethoxyphenyl)prop-2-en-1-one (6) with a 50% lethal concentration (LC50) of 171 μg/ml against M. exigua second-stage juveniles, in comparison to the commercially-available nematicide carbofuran which had an LC50 of 260 μg/ml under the same conditions. When coffee plants were used, 6 reduced the nematode population to ~50% of that observed in control plants. To investigate the mechanism of action of 6, an in silico study was carried out, which indicated that 6 may act against M. exigua through inhibition of a putative caffeic acid 3-O-methyltransferase homodimer, the amino acid sequence of which was determined by examining the genome of Meloidogyne incognita. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Technical evaluation report on the adequacy of station electric-distribution-system voltages for the Millstone Nuclear Power Station, Units 1 and 2. Docket Nos. 50-245, 50-336

    International Nuclear Information System (INIS)

    Selan, J.C.

    1983-01-01

    This report documents the technical evaluation of the adequacy of the station electric-distribution-system voltages for the Millstone Nuclear Power Station, Units 1 and 2. The evaluation is to determine if the onsite distribution system, in conjunction with the offsite power sources, has sufficient capacity to automatically start and operate all Class 1E loads within the equipment voltage ratings under certain conditions established by the Nuclear Regulatory Commission. The analyses submitted demonstrate that adequate voltages will be supplied to the Class 1E equipment under the worst-case conditions analyzed

  4. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available APELGEAWTPLKLYYSHGFIRQR 180 ... Query: 245 PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPEDDLFAGI 286 ... PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPE...DDLFAGI Sbjct: 241 PAGAFFGTPVEVQRRLWPTEEFELAQTRVRTAIPEDDLFAGI 282

  5. ORF Alignment: NC_004193 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NEIVKLAQSITDAQQEEMHSLQNIEPYEVVNAS 180 ... Query: 245 TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK 287 ... ... TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK Sbjct: 241 TYSEWFPTSDYEVIEAPSFSFTKMNEYKENYAYSEIWIPVRKK 283

  6. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ENLINVYRKIGYKAVGTSAVTGEGMEELKSYLKDKISFFAGPSGVGKSSLINLIQSNIRL 180 ... Query: 245 NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRY...ISY 278 ... NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISY Sbjct: 241 NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISY 274

  7. Optical simulations for the S3 project - Super separator spectrometer - gamma-electron coincidence spectroscopy of a transfermium nucleus: the 251Md101

    International Nuclear Information System (INIS)

    Dechery, Fabien

    2012-01-01

    In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr

  8. Comment on 'degradation of polychlorinated dibenzo-p-dioxin and dibenzofuran contaminants in 2,4,5-T by photoassisted iron-catalyzed hydrogen peroxide by J.J. Pignatello and L.Q. Huang, Wat. Res. 27, 1731-1736 (1993)'

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.

    A doubt has been raised on the use of a salts as catalyst for the degradation process. The impact of H@d2@@ O@d2@@ on degradation of PCDD and PCDF is not well defined. The observed variation in the concentration of the different congeners of PCDDs...

  9. Researching Identity and Interculturality

    DEFF Research Database (Denmark)

    Lønsmann, Dorte

    2016-01-01

    Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp.......Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp....

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 21 LYQIHRFDPHTPVEETMEALHDLVKAGKVRYIGASSMYAWQFSKMQYTAERHGWTKFVSM 180 ... Query: 245 GDRAVVEAVTRIAGERGVPRARVALAWL...LHQDTVTAPIVGASRPGHLEDAVAAVXXXXXX 304 ... GDRAVVEAVTRIAGERGVPRARVALAWLLHQDTVTAPIVGASRPGHLEDAVAAV ... Sbjct: 241 GDRAVVEAVTRIA...GERGVPRARVALAWLLHQDTVTAPIVGASRPGHLEDAVAAVELTLSE 300 ...

  11. Penetration effects in 111Cd

    International Nuclear Information System (INIS)

    Giannatiempo, A.; Perego, A.; Passeri, A.

    1984-01-01

    Penetration effects in the conversion process of the 7/2 + ->5/2 + , 171 keV and 5/2 + ->1/2 + , 245 keV transitions in 111 Cd have been investigated. The decay of 111 In has been studied to deduce the relative intensity of the K-conversion lines Isub(K)(171)/Isub(K)(245) and the ratio Isub(K)(245)/Isub(L+M...)(245). The values obtained for the penetration parameters of the two transitions are 0 1 (245)<=1.9. (orig.)

  12. Application of alpha spectrometry to the discovery of new elements by heavy-ion-beam bombardment

    International Nuclear Information System (INIS)

    Nitschke, J.M.

    1983-05-01

    Starting with polonium in 1898, α-spectrometry has played a decisive role in the discovery of new, heavy elements. For even-even nuclei, α-spectra have proved simple to interpret and exhibit systematic trends that allow extrapolation to unknown isotopes. The early discovery of the natural α-decay series led to the very powerful method of genetically linking the decay of new elements to the well-established α-emission of daughter and granddaughter nuclei. This technique has been used for all recent discoveries of new elements including Z = 109. Up to mendelevium (Z = 101), thin samples suitable for α-spectrometry were prepared by chemical methods. With the advent of heavy-ion accelerators new sample preparation methods emerged. These were based on the large momentum transfer associated with heavy-ion reactions, which produced energetic target recoils that, when ejected from the target, could be thermalized in He gas. Subsequent electrical deposition or a He-jet technique yielded samples that were not only thin enough for α-spectroscopy, but also for α- and #betta#-recoil experiments. Many variations of these methods have been developed and are discussed. For the synthesis of element 106 an aerosol-based recoil transport technique was devised. In the most recent experiments, α-spectrometry has been coupled with the magnetic analysis of the recoils. The time from production to analysis of an isotope has thereby been reduced to 10 - 6 s; while it was 10 - 1 to 10 0 s for He-jets and 10 1 to 10 3 s for rapid chemical separations. Experiments are now in progress to synthesize super heavy elements (SHE) and to analyze them with these latest techniques. Again, α-spectrometry will play a major role since the expected signature for the decay of a SHE is a sequence of α-decays followed by spontaneous fission

  13. Case report

    African Journals Online (AJOL)

    ebutamanya

    13 nov. 2015 ... de décomprimer les voies optiques. L'évolution a été marquée par une amélioration immédiate des perturbations visuelles. Pan African Medical Journal. 2015; 22:245 doi:10.11604/pamj.2015.22.245.7535. This article is available online at: http://www.panafrican-med-journal.com/content/article/22/245/full/.

  14. Development of a Hardware-in-the-Loop Simulator for Control Moment Gyroscope-Based Attitude Control Systems

    Science.gov (United States)

    2015-12-01

    SPEED CAN MODULE ...............................32 J. MAXON EC 45 FLAT BRUSHLESS DC MOTORS AND MAXON EPOS2 24/5 MOTOR CONTROLLERS...momentum wheel and gimbal axis are driven by Maxon EC 45 Flat brushless DC motors . The gimbal motor includes an additional 1024-count, two-channel MILE...EC 45 FLAT BRUSHLESS DC MOTORS AND MAXON EPOS2 24/5 MOTOR CONTROLLERS Each CMG utilizes two Maxon EPOS2 24/5 motor controllers; one to control the

  15. ORF Alignment: NC_004432 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Mycoplasma penetrans HF-2] ... Length = 245 ... Query: 8 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYME...WVKKNEKNIKGIFV 67 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYMEW...VKKNEKNIKGIFV Sbjct: 1 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYMEWVKKNEKNIKGIFV 60 ... Query: 128 TVSVGKI

  16. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VRVHPVGGGGPVVLLLDG 60 ... Query: 230 GVRADPGRTVVXXXXXXXXXXXXXXXEFPELVSRVACQSASLWWTPGAAXXXXXXXXXXX 289 ... ... ... GVRADPGRTVV ... EFPELVSRVACQSASLWWTPGAA ... Sbjct: 121 GVRADPG...RTVVAGQSLGGLSALYAALEFPELVSRVACQSASLWWTPGAADLPDPLGGPVG 180 ... Query: 350 WRHAL 354 ... WRHAL Sbjct: 241 WRHAL 245

  17. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TVLIRRECFKKAGLFDPKLPSSQDWDM 183 ... VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM Sbjc...t: 121 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM 180 ... Query: 244 GL 245 ... GL Sbjct: 241 GL 242 ...TVSVIIPTHNRAKLLKRAIISVLNQTFEDFEIIVVDDASSDNTPNIIESIKDSRIRYIR 60 ... Query: 124 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSP

  18. ORF Alignment: NC_000521 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tative ... [Plasmodium falciparum 3D7] ... Length = 172 ... Query: 186 DVKLFFFKKRIIYLTDEINKKTADELIS...QLLYLDNINHNDIKIYINSPGGSINEGLAILD 245 ... DVKLFFFKKRIIYLTDEINKKTADELISQLL...YLDNINHNDIKIYINSPGGSINEGLAILD Sbjct: 1 ... DVKLFFFKKRIIYLTDEINKKTADELISQLLYLDNINHNDIKIYINSPGGSINEGLAILD 60 ... Qu

  19. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sine kinase) ... Length = 245 ... Query: 67 ... NGYCAPYSGKVCKEYLTGQVWYSLEDPTGGWKNEQVTTALWDELIS...DLTGLCREAAEKML 126 ... NGYCAPYSGKVCKEYLTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTGLCREAAEKML Sbj...ct: 15 ... NGYCAPYSGKVCKEYLTGQVWYSLEDPTGGWKNEQVTTALWDELISDLTGLCREAAEKML 74 ... Query: 187 CSSLPHYNASMRRPNCSYIGLTEL

  20. 78 FR 66949 - Homeland Security Science and Technology Advisory Committee (HSSTAC)

    Science.gov (United States)

    2013-11-07

    ... Executive Director, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane... Director, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Technology, such as new developments in systems engineering, cyber-security, knowledge management and how...

  1. 75 FR 2555 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-01-15

    ... Technology Advisory Committee will meet January 26-28, 2010, at the Department of Homeland Security, 1120..., Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410...

  2. 77 FR 56662 - Homeland Security Science and Technology Advisory Committee (HSSTAC)

    Science.gov (United States)

    2012-09-13

    ... after Sept. 12: http://www.dhs.gov/homeland-security-science-and-technology-advisory-committee-hsstac... Director, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410..., Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410...

  3. Errata to: Characteristics of humic acid fluvic acids in Arabian Sea sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Sardessai, S.

    stream_size 1 stream_content_type text/plain stream_name Indian_J_Mar_Sci_24_245.pdf.txt stream_source_info Indian_J_Mar_Sci_24_245.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  4. Rules of the Road, Western Rivers.

    Science.gov (United States)

    1972-08-01

    Harbor, Island 82.100 Mississipgi River. of St. Croix, Virgin Islands. 82.103 Mississippi Passes, La., to Sa- 82.245 Sonda de Vieques. bine Pass, Tex...Christiansted Harbor Channel Lighted Buoy 1; thence to stack at Little Princess north- westward of leper settlement. §82.245 Sonda de Vieques. A line

  5. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Homi Bhabha Centre for Science Education: Admission to PhD Programme in Science Education - 2018 · More Details Abstract Fulltext PDF. pp 244-244 Information and Announcements. Physics Training and Talent Search · More Details Abstract Fulltext PDF. pp 245-245 Flowering Trees. Gymnosporia montana Benth.

  6. DIOXINS AND ENDOMETRIOSIS: COHORT STUDY OF WOMEN IN WEST VIRGINIA

    Science.gov (United States)

    Kanawha Valley of West Virginia has a history of 2,3,7,8-tetrachlorodibenzo-p-dioxin contamination (dioxin, TCDD). The bulk of the dioxin found in this area appears to be derived from the production of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) and the disposal of associated wa...

  7. Anil, Dr Arga Chandrashekar

    Indian Academy of Sciences (India)

    Date of birth: 23 January 1959. Specialization: Biological Oceanography, Marine Ecology, Marine Biology Address: Chief Scientist, National Institute of Oceanography, Dona Paula 403 004, Goa Contact: Office: (0832) 245 0404. Residence: (0832) 241 3765. Mobile: 94238 19755. Fax: (0832) 245 0615

  8. Geologic Mapping of the Summit and Western Flank of Alba Mons, Mars

    Science.gov (United States)

    Crown, D. A.; Berman, D. C.; Platz, T.; Scheidt, S. P.; Hauber, E.; Weitz, C. M.

    2017-06-01

    This investigation employs imaging and topographic datasets to produce two 1:1M-scale geologic maps covering the Alba Mons summit (245-255°E, 32.5-47.5°N) and western flank (230-245°E, 37.5-47.5°N).

  9. 40 CFR 80.250 - How is the small refiner sulfur baseline and volume determined?

    Science.gov (United States)

    2010-07-01

    ...=Baseline volume. VI=Volume of gasoline batch i. n = Total number of batches of gasoline produced from....245(a)(3); or, for a foreign refinery, the total number of batches of gasoline produced and imported... gasoline produced and imported into the U.S. pursuant to § 80.245(c)(2)). i = Individual batch of gasoline...

  10. 77 FR 65799 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-10-31

    ...-245-AD; Amendment 39-17236; AD 2012-21-20] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes.... SUMMARY: We are adopting a new airworthiness directive (AD) for certain Airbus Model A330-200 freighter...: 2012-21-20 Airbus: Amendment 39-17236. Docket No. FAA-2012-0596; Directorate Identifier 2011-NM-245-AD...

  11. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 116; Issue 5. Volume 116, Issue 5. August 2004, pages 245-300. pp 245-250. Synthesis, characterization and emission properties of quinolin-8-olato chelated ruthenium organometallics · Bikash Kumar Panda · More Details Abstract Fulltext PDF. The reaction of ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 23, Issue 3. March 2018, pages 245-413. pp 245-248 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 249-249 Science Smiles. Science Smiles · More Details Abstract ...

  13. Gymnosporia montana Benth.(Mountain Spike Thorn)

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Gymnosporia montana Benth. (Mountain Spike Thorn). Flowering Trees Volume 23 Issue 2 February 2018 pp 245-245. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/023/02/0245-0245 ...

  14. 76 FR 71331 - Department of Defense Task Force on the Care, Management, and Transition of Recovering Wounded...

    Science.gov (United States)

    2011-11-17

    .... Anthony Riverwalk Wyndham Hotel-Peraux Room, 300 East Travis Street, San Antonio, TX 78205. FOR FURTHER... Policies 1:30 p.m.-2:30 p.m. Post DD 214 Challenges Panel 2:30 p.m.-2:45 p.m. Break 2:45 p.m.-3:45 p.m...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 245 of 245 ... Vol 13, No 2 (2014), Sewage disposal methods in a sub-urban community in Edo state, Nigeria, Abstract PDF. AR Isara, AQ Aigbokhaode. Vol 16, No 1 (2017), Sleep deprivation and coffee consumption induced changes in blood pressure, body mass index and blood glucose in male Wistar albino rats ...

  16. 78 FR 51729 - Board of Scientific Counselors, National Institute for Occupational Safety and Health (BSC, NIOSH)

    Science.gov (United States)

    2013-08-21

    ... Institute for Occupational Safety and Health (BSC, NIOSH) In accordance with section 10(a) (2) of the...://www.cdc.gov/niosh/bsc/ ) or call (202) 245-0625 or (202) 245-0626 for building access information.../niosh/bsc/ ). Contact Person for More Information: John Decker, Executive Secretary, BSC, NIOSH, CDC...

  17. Život i djelo Dmitrija Ivanoviča Mendeljejeva - povodom 100. obljetnice smrti

    Directory of Open Access Journals (Sweden)

    Vaščić, V.

    2007-04-01

    Full Text Available The life and activities of D. I. Mendeleyev are presented primarily in view of his role in the progress of chemistry. Born in Tobolsk in 1834 to a numerous and poor family, burdened by the family's bad luck and his ill health, he graduated natural sciences in 1855 at St. Petersburg and was awarded a gold medal for exceptional success. In 1855/56 he was teacher at a secondary school in Odessa. He obtained his MSc degree in 1856 in St. Petersburg where he was appointed lecturer in 1857. He was guest scientist 1859-1861 at the University in Heidelberg where he investigated the behavior of gases under various pressures and temperatures and discovered the criticaltemperature of liquefaction. He achieved his PhD degree in 1865 in St. Petersburg with a thesis on ethanol/water mixtures. Therein he had proven the existence of alcohol hydrates. His work later enabled the elaboration of modern conceptions on solvate formation in solutions. In 1865 he was elected professor at the University in St. Petersburg where he worked until 1890 when he was forced to retire. Preparing his textbook "Fundamentals of Chemistry" in 1869, he discovered that properties of chemical elements depend periodically on atomic weights. This enabled the elaboration of a periodic system as the base for classification in chemistry, as well as for further research and development of chemical science and technology. The international scientific community accepted Mendeleyev's system with distrust and it was generally acknowledged not before three "prophecies" of Mendeleyev were realized by the discovery of gallium (1875, scandium (1879 and germanium (1886. Later, in verification of his predictions, other elements - including transuranics - were discovered. Hence, in honor of the creator of the periodic system, the element of atomic number 101 was named mendelevium (1955. Mendeleyev was reactivated in 1892 as director of the Central Bureau for Measures and Weights where he worked until

  18. Slow Food: por um alimento bom, limpo e justo

    OpenAIRE

    Porazzi, Fabiele

    2012-01-01

    REVIEW:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. RESEÑA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. http://dx.doi.org/10.5007/1807-1384.2012v9n1p384 RESENHA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p.

  19. Somatic embryogenesis in Malaysian cultivars of sweet potato (Ipomoea batatas L.).

    OpenAIRE

    De Silva, Angela Ee

    2017-01-01

    Three Malaysian sweet potato cultivars, namely Ipomoea batatas (L.) cv. Gendut, Jalomas and Telong, were investigated for their abilities to produce somatic embryos. Shoot meristems were used as the starting materials and cultured on Murashige and Skoog basal media (Murashige and Skoog, 1962) in the presence of auxin 2,4-dichlorophenoxyacetic acid (2,4-D) or 2,4,5-trichlorophenoxyacetic acid (2,4,5-T). Auxin 2,4,5-T at 5 µM was most effective for the initiation of primary embryogenic formati...

  20. South African Medical Journal - Vol 83, No 4 (1993)

    African Journals Online (AJOL)

    Indications for colonoscopy An analysis based on indications and diagnostic yield · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. Berkowitz, M. Kaplan, 245-248 ...

  1. Bestimmung und Deutung von Angebotskurven Ein Beispiel

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1930-01-01

    textabstractIn English: Determination and Interpretation of Supply Curves: an example In: David F. Hendry and Mary S. Morgan (Eds), The Foundations of Econometric Analysis, Cambridge University Press, New York, 1995, pp. 233-245

  2. Phylogenetic placement of Dapisostemon gen. nov. and Streptostemon, two tropical heterocytous genera (Cyanobacteria)

    Czech Academy of Sciences Publication Activity Database

    Hentschke, G. S.; Johansen, J. R.; Pietrasiak, N.; Fiore, M.F.; Rigonato, J.; Sant’Anna, C. L.; Komárek, Jiří

    2016-01-01

    Roč. 245, č. 2 (2016), s. 129-143 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : new cyanobacterial genera * phylogeny * tropical habitats Subject RIV: EF - Botanics Impact factor: 1.240, year: 2016

  3. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  4. 48 CFR 1845.505-14 - Reports of Government property. (NASA supplements paragraphs (b))

    Science.gov (United States)

    2010-10-01

    .... (NASA supplements paragraphs (b)) (b) When the clause at 1852.245-73, Financial Reporting of NASA... contractor acquired property for purposes of reporting the acquisition cost in the property classifications...

  5. 78 FR 14101 - Homeland Security Science and Technology Advisory Committee (HSSTAC)

    Science.gov (United States)

    2013-03-04

    ... the Department of Homeland Security (DHS), Science and Technology Directorate, 1120 Vermont Avenue NW... Director, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Hanson, HSSTAC Executive Director, Science and Technology Directorate, Department of Homeland Security...

  6. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,964 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  7. Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania

    Czech Academy of Sciences Publication Activity Database

    Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David

    2011-01-01

    Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology

  8. 29 CFR 4.188 - Ineligibility for further contracts when violations occur.

    Science.gov (United States)

    2010-07-01

    ... liable for injuries to third parties resulting therefrom. * * * The employer will be liable for acts of... the concept “controlling interest”. See Regal Mfg. Co., Decision of the Administrator, PC-245, March 1...

  9. Literature Search and Analysis for Cultural Resources in Areas 1 through 5 of the Rock River, Illinois

    Science.gov (United States)

    1982-03-01

    Valleys in Northwestern Costa Rica," for Symposium on The Southern Frontiers of Mesoamerica , 74th Annual Meeting of the American Anthropological...Archaeology of South America (Anthropology 240) Archaeology of Mesoamerica (Anthropology 245) Anthropological Fieldwork I (Anthropology 280) Anthropological

  10. Pharmaceuticals, benzene, toluene and chlorobenzene removal from contaminated groundwater by combined UV/H2O2 photo-oxidation and aeration

    Czech Academy of Sciences Publication Activity Database

    Lhotský, O.; Krákorová, Eva; Mašín, P.; Žebrák, R.; Linhartová, Lucie; Křesinová, Zdena; Kašlík, J.; Steinová, J.; Rodsand, T.; Filipová, Alena; Petrů, K.; Kroupová, K.; Cajthaml, Tomáš

    2017-01-01

    Roč. 120, SEP 1 2017 (2017), s. 245-255 ISSN 0043-1354 Institutional support: RVO:61388971 Keywords : Pharmaceuticals * BTEX * Chlorobenzene Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 6.942, year: 2016

  11. 76 FR 7231 - Wild Horse and Burro Advisory Board; Meeting

    Science.gov (United States)

    2011-02-09

    ... Sheraton Phoenix Downtown Hotel, 340 N. 3rd Street, Phoenix, Arizona, 85004. The hotel phone number for... June 15, 2010 Minutes Program Updates Gathers Adoptions Budget Facilities Break (2:20 p.m.--2:45 p.m...

  12. Experimental Evaluation of Tachistoscopic Measurement: A Step Beyond Wundt’s Criticism

    Czech Academy of Sciences Publication Activity Database

    Vobořil, Dalibor; Jelínek, Martin; Květon, Petr

    2014-01-01

    Roč. 127, č. 2 (2014), 245–252 ISSN 0002-9556 Institutional support: RVO:68081740 Keywords : history of psychology * tachistoscop * experimental instruments Subject RIV: AN - Psychology Impact factor: 0.619, year: 2014

  13. Dvě ontologie české demokracie: T. G. Masaryk a J. L. Fischer

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    2015-01-01

    Roč. 63, č. 2 (2015), s. 233-245 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Masaryk * Fischer * democracy * providence * order * structure * function * individuality * sociality * crisis Subject RIV: AA - Philosophy ; Religion

  14. 76 FR 50808 - Certification Related to the Khmer Rouge Tribunal

    Science.gov (United States)

    2011-08-16

    ...), and Delegation of Authority 245-1, I hereby certify that the United Nations and Government of Cambodia are taking credible steps to address allegations of corruption and mismanagement within the...

  15. Comparing Demonstratives in Kwa

    African Journals Online (AJOL)

    nt'. The following sub-sections discuss the categories of demonstratives in the various languages in more detail. 3.1. Akan ...... languages: a classification and description of Africa s largest family,. 216-245. Lanham: University Press of America.

  16. Assessing the Current State of Amber Force Field Modifications for DNA

    Czech Academy of Sciences Publication Activity Database

    Galindo-Murillo, R.; Robertson, J.; Zgarbová, M.; Šponer, Jiří; Otyepka, M.; Jurečka, P.; Cheatham III, T. E.

    2016-01-01

    Roč. 12, č. 8 (2016), s. 4114-4127 ISSN 1549-9618 Institutional support: RVO:68081707 Keywords : molecular- dynamics simulations * particle mesh ewald * pair opening kinetics Subject RIV: BO - Biophysics Impact factor: 5.245, year: 2016

  17. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Olympic Peninsula

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data for the Olympic Peninsula project of 2005, totaling approximately 114.59 sq mi: 24.5 for Clallam...

  18. South African Journal of Education - Vol 24, No 4 (2004)

    African Journals Online (AJOL)

    Using teacher action research to promote constructivist learning environments in South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Jill M Aldridge, Barry J Fraser, Mokgoko P Sebela, 245-253 ...

  19. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,925 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  20. 77 FR 37060 - Critical Infrastructure and Key Resources (CIKR) Asset Protection Technical Assistance Program...

    Science.gov (United States)

    2012-06-20

    .../IP/IICD, 245 Murray Lane SW., Mailstop 0602, Arlington, VA 20598-0602. Email requests should go to... Agency's National Preparedness Directorate to assist state and local first responders, emergency managers...

  1. 78 FR 50075 - Statewide Communication Interoperability Plan Template and Annual Progress Report

    Science.gov (United States)

    2013-08-16

    ... Collection Request should be forwarded to DHS/NPPD/CS&C/OEC, 245 Murray Lane SW., Mail Stop 0640, Arlington... will assist states in their strategic planning for interoperable and emergency communications while...

  2. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,909 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  3. Změny Římského statutu Mezinárodního trestního soudu

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2010-01-01

    Roč. 9, č. 8 (2010), s. 245-251 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : public international law * International Criminal Court * crime of agression Subject RIV: AG - Legal Sciences

  4. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,958 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  5. 76 FR 44024 - Agency Information Collection Activities: Submission for Review; Information Collection Request...

    Science.gov (United States)

    2011-07-22

    ... DEPARTMENT OF HOMELAND SECURITY [Docket No. DHS-2011-0059] Agency Information Collection Activities: Submission for Review; Information Collection Request for the Department of Homeland Security...). Mail: Science and Technology Directorate, ATTN: Chief Information Office--Daniel Purcell, 245 Murray...

  6. Microwave Plasma System: PVA Tepla 300

    Data.gov (United States)

    Federal Laboratory Consortium — Description:CORAL Name: Microwave AsherA tool using microwave oxygen plasma to remove organics on the surfacesSpecifications / Capabilities:Frequency: 2.45 GHzPower:...

  7. Horae pomeridianae Jana Josefa Ignáce Brentnera

    Czech Academy of Sciences Publication Activity Database

    Kapsa, Václav

    2001-01-01

    Roč. 38, 3-4 (2001), s. 245-262 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z8059909 Keywords : Brentner * Horae pomeridianae * Instrumental Music Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Serious games for higher education: a framework for reducing design complexity

    NARCIS (Netherlands)

    Westera, Wim; Nadolski, Rob; Hummel, Hans; Wopereis, Iwan

    2008-01-01

    Westera, W., Nadolski, R., Hummel, H. G. K., & Wopereis, I. (2008). Serious games for higher education: a framework for reducing design complexity. Journal of Computer Assisted Learning, 24(5), 420-432.

  9. 78 FR 35009 - Applications for New Awards; National Institute on Disability and Rehabilitation Research...

    Science.gov (United States)

    2013-06-11

    ... evaluating innovative technologies, facilitating service delivery system changes, stimulating the production... submission process, contact Marlene Spencer at (202) 245-7532. Page Limit: The application narrative (Part... text in the application narrative, including titles, headings, footnotes, quotations, references, and...

  10. in the Niger-Delta

    African Journals Online (AJOL)

    Nekky Umera

    Disciplinary Journal, Ethiopia. Vol. ... Asagba, R. B. - Department of Psychology, University of Ibadan, Nigeria. Abstract. The Niger Delta Region of Nigeria has ..... Journal of Abnormal Psychology, 101, 234-. 245. Arnold, A; Cooper,C and Robertson, ...

  11. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  12. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,981 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  13. The Chlamydomonas genome reveals the evolution of key animal and plant functions

    Czech Academy of Sciences Publication Activity Database

    Merchant, S.S.; Prochnik, S. E.; Bišová, Kateřina

    2007-01-01

    Roč. 318, - (2007), s. 245-251 ISSN 0036-8075 Institutional research plan: CEZ:AV0Z50200510 Keywords : chlamydomonas reinhardtii * alga * eukaryotic cell Subject RIV: EE - Microbiology, Virology Impact factor: 26.372, year: 2007

  14. Administrative Management Competencies for Safety Professionals.

    Science.gov (United States)

    Blair, Earl H.; Logan, Joyce P.

    1999-01-01

    In a 1997 study, 245 safety professionals and educators identified and prioritized management competencies that are important for safety professionals. Results show that the most important competencies are communication, listening, motivating others, creative thinking, and flexibility. (JOW)

  15. Disease: H01646 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e the first-line antidepressant drug treatment of depression and replaced tricyclic antidepressants (TCA) an... randomized clinical trials of SSRI treatment of depression. ... JOURNAL ... BMC Psychiatry 14:245 (2014) DOI:10

  16. Preparation of graphite derivatives by selective reduction of graphite oxide and isocyanate functionalization

    Czech Academy of Sciences Publication Activity Database

    Kumar, A. R. S. S.; Piana, Francesco; Mičušík, M.; Pionteck, J.; Banerjee, S.; Voit, B.

    2016-01-01

    Roč. 182, 1 October (2016), s. 237-245 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : graphite oxide * surface modification * conductive nanoparticles Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.084, year: 2016

  17. Acquisition of the Joint Surveillance Target Attack Radar System

    National Research Council Canada - National Science Library

    Meling, John

    1994-01-01

    .... The program includes 20 aircraft and 95 ground station modules that interact with aircraft. The Joint STARS has an estimated total life-cycle cost of about $24.5 billion (then-year dollars). Objectives...

  18. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ) andMn(II) complexes of poly(methyl vinyl ether-alt-maleic anhydride). Synthesis, characterization and thermodynamic parameters. Hidayet Mazi Ali Gulpinar. Volume 126 Issue 1 January 2014 pp 239-245 ...

  19. Small molecule inhibitors of protein interaction with glycosaminoglycans (SMIGs), a novel class of bioactive agents with anti-inflammatory properties

    Czech Academy of Sciences Publication Activity Database

    Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.

    2014-01-01

    Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014

  20. Vávrovice (okr. Opava)

    Czech Academy of Sciences Publication Activity Database

    Zezulová, M.; Šedo, Ondrej

    2002-01-01

    Roč. 43, - (2002), s. 243-245 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z8001916 Keywords : Bohemian part of Silesia * industrial area * pottery kilns Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Der Umgang mit den beschlagnahmten Kunstwerken aus Schlössern des ehemaligen Herrscherhauses Habsburg-Lothringen. Ein Dilemma für die junge Tschechoslowakische Republik nach 1918

    Czech Academy of Sciences Publication Activity Database

    Uhlíková, Kristina

    2016-01-01

    Roč. 70, 1/2 (2016), s. 232-245 ISSN 0029-9626 Institutional support: RVO:68378033 Keywords : Archduke Franz Ferdinand d´Este * history of monument preservation * castles Subject RIV: AL - Art , Architecture, Cultural Heritage

  2. Changes in vegetation and grazing capacity following honey mesquite control

    Science.gov (United States)

    McDaniel, Kirk C.; Brock, John H.; Haas, Robert H.

    1982-01-01

    Honey mesquite kill and suppression, vegetation response, and changes in grazing use and capacity were evaluated following brush control in north-central Texas. Tree grubbing was most effective for eliminating honey mesquite, but because of soil and plant damage the treatment did not increase grazing capacity or improve range condition compared to nontreated rangeland. Aerial application of 2,4,5-T + picloram was more effective in klllmg and defoliating honey mesquite than 2,4,5-T alone, but both treatments significantly increased forage production. The 2,4,5-T + picloram and 2,4,5-T sprays provided a 7 to 16% increase in grazing capacity over a 4-year period on light and heavy honey mesquite infested pastures, respectively.

  3. Full Data of Yeast Interacting Proteins Database (Annotation Updated Version) - Yeast Interacting Proteins Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ast two-hybrid method. (Fields, S. & Song, O. K. (1989) Nature (London) 340, 245-246.) Data analysis method As the indicator of relia...bility of the interactions obtained by the experiment, t

  4. Core Data of Yeast Interacting Proteins Database (Annotation Updated Version) - Yeast Interacting Proteins Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available hod As the indicator of reliability of the interactions obtained by the experiment, the literature informati...(Fields, S. & Song, O. K. (1989) Nature (London) 340, 245-246.) Data analysis met

  5. 10 CFR 110.23 - General license for the export of byproduct material.

    Science.gov (United States)

    2010-01-01

    ...) Actinium-225 and -227, americium-241 and -242m, californium-248, -249, -250, -251, -252, -253, and -254, curium-240, -241, -242, -243, -244, -245, -246 and -247, einsteinium-252, -253, -254 and -255, fermium...

  6. Significance of uniaxial and hydrostatic pressure studies on ancient oceanic rocks in tectonics

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, K.V.L.N.S.; Ramana, Y.V.

    showed the lowest value of compressive strength (45 MPa) and pyroxenite gave the highest value (269 MPa), while meta volcanics exhibited narrow limits of 58 to 245 MPa. Standard correlations were obtained for compressive strength to G/P ratio...

  7. Robust assessment of moderate heavy metal contamination levels in floodplain sediments: A case study on the Jizera River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Matys Grygar, Tomáš; Nováková, Tereza; Bábek, O.; Elznicová, J.; Vadinová, N.

    2013-01-01

    Roč. 452, May (2013), s. 233-245 ISSN 0048-9697 Institutional support: RVO:61388980 Keywords : Background * Enrichment factor * Fluvial sediments * Heavy metals * Pollution Subject RIV: DD - Geochemistry Impact factor: 3.163, year: 2013

  8. How fat works

    National Research Council Canada - National Science Library

    Wood, Philip A. (Philip Allen)

    2006-01-01

    ... for Making Good Decisions 192 IV. The Environment 17. Nutrient Labeling 203 18. 209 Alternative Medicine and Fad Diets 19. 214 Media Coverage of Health Research 225 Glossary 231 References Index 245 Ackn...

  9. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,919 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  10. Stuck in the Middle Without a Coherent Strategy: An Allusion to Future War

    Science.gov (United States)

    2014-05-22

    superlative of comparison only.245 ― Charles Dickens , A Tale of Two Cities Concluding Reflections towards a New Future Akin to the epigraph above...is not an option. Cries of ‘et tu Brute’ by US policy makers may become more familiar as traditional planning assumptions for 245 Charles Dickens ...Washington, DC: US Government Printing Office, March 2014. Dickens , Charles . A Tale of Two Cities. Oxford: Harper Collins, 2010. Dobbins, James

  11. ALENCE OF DIABETES LITUS AND IMPAIRED GLUCOSE ...

    African Journals Online (AJOL)

    Its. The crude prevalences for diabetes mellitus and IGT e 2.45% and 2.7% respectively. The age-adjusted valences using a standard world population were 4.5% nfidence interval (CI) 1.54 -7.42) and 5.1% (CI 2.45- 5.51) diabetes and IGT respectively. The prevalence of diabetes similar in male and female workers (P ...

  12. Developing Advanced Academic Degree Educational Profiles for Career Fields

    Science.gov (United States)

    2007-03-01

    analysis, and investment theory and capital budgeting. 3 4.5 qtr PSYC 245 SEMINAR: ORGANIZATIONAL BEHAVIOR Analysis of organizational behavior...market structure and pricing, risk analysis, and investment theory and capital budgeting. 3 4.5 qtr PSYC 245 SEMINAR: ORGANIZATIONAL BEHAVIOR...change. 3 4.5 QTR PSYC 259 PSYCHOLOGY OF INDIVIDUAL AND GROUP DECISION MAKING Examination of processes in organizational decision making and group

  13. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  14. Investigation of Laser Plasma Chemistry in CO2-N-2-H2O Using O-18 Labeled Water

    Czech Academy of Sciences Publication Activity Database

    Ferus, Martin; Kubelík, Petr; Juha, Libor; Civiš, Svatopluk

    2009-01-01

    Roč. 39, 3-4 (2009), s. 245-245 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278; GA MŠk LA08024 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : LIDB plasma * atmosphere * isotopes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009

  15. Nonstate Actors in Colombia: Threat and Response

    Science.gov (United States)

    2002-05-01

    Data taken from Mauricio Rubio, “ La Justicia en una Sociedad Violenta,” in Maria Victoria Llorente and Malcolm Deas, Reconocer la Guerra para...from the Publications Office by calling (717) 245-4133, FAX (717) 245-3820, or via the Internet at Rita.Rummel@ carlisle.army.mil ***** Most 1993, 1994...settled old political scores. Over the period from 1948-66, la violencia claimed the lives of over 200,000 Colombians.5 The illegal drug industry

  16. Low Mach and Peclet number limit for a model of stellar tachocline and upper radiative zones

    Czech Academy of Sciences Publication Activity Database

    Donatelli, D.; Ducomet, B.; Kobera, M.; Nečasová, Šárka

    2016-01-01

    Roč. 2016, Č. 245 (2016), s. 1-31 ISSN 1072-6691 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : Navier-Stokes- Fourier -Poisson system * radiation transfer * compressible magnetohydrodynamics Subject RIV: BA - General Mathematics Impact factor: 0.954, year: 2016 http://ejde.math.txstate.edu/Volumes/2016/245/abstr.html

  17. Controlling Hazel, Aspen Suckers, and Mountain Maple with Picloram

    Science.gov (United States)

    Donald A. Perala

    1971-01-01

    Tests showed that picloram/2,4-D mixture was equal to or superior to 2,4-D alone or a 2,4,5-D/2,4,5-T mixture in controlling hazel, aspen suckers, and mountain maple for reforestation purposes. Survival of red pine planted 9 months after treatment was not influenced by residual soil effects of picloram. However, foliar application contributed to mortality of...

  18. Comparison of bromide and nitrate transport in the Bainsvlei soil of ...

    African Journals Online (AJOL)

    DRINIE

    2004-01-01

    Jan 1, 2004 ... the Bainsvlei soil of South Africa under natural rainfall conditions. For this purpose, KBr- and KNO3 solutions were applied to a. 2.45 x 2.45 m2 plot at rates of 13.5 g Br·m-2 and 20 g N·m-2 respectively. The subsequent movement of the solutes through the soil was investigated through studies of the water ...

  19. Low Mach and Peclet number limit for a model of stellar tachocline and upper radiative zones

    Czech Academy of Sciences Publication Activity Database

    Donatelli, D.; Ducomet, B.; Kobera, M.; Nečasová, Šárka

    2016-01-01

    Roč. 2016, Č. 245 (2016), s. 1-31 ISSN 1072-6691 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : Navier-Stokes-Fourier-Poisson system * radiation transfer * compressible magnetohydrodynamics Subject RIV: BA - General Mathematics Impact factor: 0.954, year: 2016 http://ejde.math.txstate.edu/Volumes/2016/245/abstr.html

  20. Comment on "Nuclear Emissions During Self-Nucleated Acoustic Cavitation"

    OpenAIRE

    Naranjo, B.

    2006-01-01

    In a recent Letter to PRL, Taleyarkhan and coauthors claim to observe DD fusion produced by acoustic cavitation. Among other evidence, they provide a proton recoil spectrum that they interpret as arising from 2.45 MeV DD fusion neutrons. My analysis concludes the spectrum is inconsistent with 2.45 MeV neutrons, cosmic background, or a PuBe source, but it is consistent with a Cf-252 source.

  1. Performance and feed utilisation in Saanen goats as influenced by ...

    African Journals Online (AJOL)

    There were little castration and diet effects on performance of goats from arrival to weaning. Males grew faster (222 vs 183 g/day), had lower feed conversion ratios (3.13 vs 4.11 g DM/g gain) and higher dry matter intake (751 vs 744g/day) than castrates during the weaning to 24.5 kg live weight period. However, in the 24.5 ...

  2. Bush control in grassland by aerial spraying | F | African Journal of ...

    African Journals Online (AJOL)

    The results are reported of three trials in which chemicals were applied from an aircraft to control bush on severely infested natural grassland in Mozambique. Acacia nilotica, A. borleae and Dichrostachys cinerea were killed by a mixture of 2,4-D and 2,4,5-T at 1,8 kg/ha, by 2,4,5-T alone at 1,8 kg/ha and by silvex at 0,5 ...

  3. Interspecific cooperation: enhanced growth, attachment and strain-specific distribution in biofilms through Azospirillum brasilense-Pseudomonas protegens co-cultivation.

    Science.gov (United States)

    Pagnussat, Luciana A; Salcedo, Florencia; Maroniche, Guillermo; Keel, Christoph; Valverde, Claudio; Creus, Cecilia M

    2016-10-01

    Plant-growth-promoting bacteria belonging to Azospirillum and Pseudomonas genera are major inhabitants of the rhizosphere. Both are increasingly commercialized as crops inoculants. Interspecific interaction in the rhizosphere is critical for inoculants aptness. The objective of this work was to evaluate Azospirillum and Pseudomonas interaction in mixed biofilms by co-cultivation of the model strains Azospirillum brasilense Sp245 and Pseudomonas protegens CHA0. The results revealed enhanced growth of both strains when co-cultured in static conditions. Moreover, Sp245 biofilm formed in plastic surfaces was increased 2-fold in the presence of CHA0. Confocal microscopy revealed highly structured mixed biofilms showing Sp245 mainly on the bottom and CHA0 towards the biofilm surface. In addition, A. brasilense biofilm was thicker and denser when co-cultured with P. protegens. In a colony-colony interaction assay, Sp245 changed nearby CHA0 producing small colony phenotype, which accounts for a diffusible metabolite mediator; though CHA0 spent medium did not affect Sp245 colony phenotype. Altogether, these results point to a cooperative interaction between A. brasilense Sp245 and P. protegens CHA0 in which both strains increase their static growth and produce structured mixed biofilms with a strain-specific distribution. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. OSSOS. IV. Discovery of a Dwarf Planet Candidate in the 9:2 Resonance with Neptune

    Science.gov (United States)

    Bannister, Michele T.; Alexandersen, Mike; Benecchi, Susan; Chen, Ying-Tung; Delsanti, Audrey; Fraser, Wesley C.; Gladman, Brett; Granvik, Mikael; Grundy, Will M.; Guilbert-Lepoutre, Aurelie; hide

    2016-01-01

    We report the discovery and orbit of a new dwarf planet candidate, 2015 RR245, by the Outer Solar System Origins Survey (OSSOS). The orbit of 2015 RR245 is eccentric (e 0.586), with a semimajor axis near 82 au, yielding a perihelion distance of 34 au. 2015 RR245 has g - r 0.59 +/- 0.11 and absolute magnitude Hr 3.6 +/- 0.1; for an assumed albedo of pV 12, the object has a diameter of approximately 670 km. Based on astrometric measurements from OSSOS and Pan-STARRS1, we find that 2015 RR245 is securely trapped on ten-megayear timescales in the 9:2 mean-motion resonance with Neptune. It is the first trans-Neptunian object (TNO) identied in this resonance. On hundred-megayear timescales, particles in 2015 RR245-like orbits depart and sometimes return to the resonance, indicating that 2015 RR245 likely forms part of the long-lived metastable population of distant TNOs that drift between resonance sticking and actively scattering via gravitational encounters with Neptune. The discovery of a 9:2 TNO stresses the role of resonances in the long-term evolution of objects in the scattering disk and reinforces the view that distant resonances are heavily populated in the current solar system. This object further motivates detailed modeling of the transient sticking population.

  5. Uptake of three labelled polychlorinated aromatics by chlorella fusca

    International Nuclear Information System (INIS)

    Wihlidal, H.; Stehlik, G.; Gruen, W.; Wiesinger, F.

    1978-12-01

    The uptake of labelled 2,4,5-Trichlorphenoxyethanol (2,4,5-TE), 2,4-Dichlorphenoxy acetic acid (2,4-D) and 2,4,5,2',4',5'-Hexachlorobiphenyl (''PCB'') by Chlorella fusca was tested. Whereas 2,4,5-TE was labelled with sup(3H) in the ring system, 2,4-D and ''PCB'' were labelled with 14 C in the sidechain or ring system, respectively. Under the chosen experimental conditions the concentration of 2,4,5-TE in the algae reached a maximum after 8 hours at least; the following (considerable) release of labelled compound is ascribed to metabolisation to 2,4,5-T. After 72 hours the total uptake by 50 mg (moist weight) Chlorella fusca /ml came to an amount of 1,8% which was in good accordance with the amount of 2,4-D taken up during the same period. Whereas the uptake was low for 2,4-D it was high for 2,4,5,2',4',5'-Hexachlorobiphenyl (''PCB''); in both cases the uptake led to an equilibrium between the concentration of these compounds in the uptake medium and the cell after a few hours. (author)

  6. Photo-triggered solvent-free metamorphosis of polymeric materials.

    Science.gov (United States)

    Honda, Satoshi; Toyota, Taro

    2017-09-11

    Liquefaction and solidification of materials are the most fundamental changes observed during thermal phase transitions, yet the design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion remains challenging. Here, we demonstrate that solvent-free repeatable molecular architectural transformation between liquid-star and nonliquid-network polymers that relies on cleavage and reformation of a covalent bond in hexaarylbiimidazole. Liquid four-armed star-shaped poly(n-butyl acrylate) and poly(dimethyl siloxane) with 2,4,5-triphenylimidazole end groups were first synthesized. Subsequent oxidation of the 2,4,5-triphenylimidazoles into 2,4,5-triphenylimidazoryl radicals and their coupling with these liquid star polymers to form hexaarylbiimidazoles afforded the corresponding nonliquid network polymers. The resulting nonliquid network polymers liquefied upon UV irradiation and produced liquid star-shaped polymers with 2,4,5-triphenylimidazoryl radical end groups that reverted to nonliquid network polymers again by recoupling of the generated 2,4,5-triphenylimidazoryl radicals immediately after terminating UV irradiation.The design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion is challenging. Here, the authors show solvent-free repeatable molecular architectural transformation between liquid-star and non-liquid-network polymers by the cleavage and reformation of covalent bonds in the polymer chain.

  7. Early versus late diagnosis in community-acquired bacterial meningitis

    DEFF Research Database (Denmark)

    Bodilsen, J; Brandt, C T; Sharew, A

    2018-01-01

    OBJECTIVES: To examine clinical characteristics and outcome of patients with late diagnosis of community-acquired bacterial meningitis (CABM). METHODS: We conducted a chart review of all adults with proven CABM in three centres in Denmark from 1998 through to 2014. Patients were categorized...... as early diagnosis of CABM immediately on admission, or late diagnosis if CABM was not listed in referral or admission records and neither lumbar puncture nor antibiotic therapy for meningitis was considered immediately on admission. We used modified Poisson regression analysis to compute adjusted relative...... differences (p 65 years (56/113, 50% versus 67/245, 27%), neck stiffness (35/97, 36% versus 183/234, 78%), concomitant pneumonia (26/113, 23% versus 26/245, 11%), and meningococcal meningitis (6/113, 5% versus 52/245, 21%). These variables...

  8. Modeling and Re-Engineering of Azotobacter vinelandii Alginate Lyase to Enhance Its Catalytic Efficiency for Accelerating Biofilm Degradation.

    Directory of Open Access Journals (Sweden)

    Chul Ho Jang

    Full Text Available Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect.

  9. Evidence for biosynthesis of lactase-phlorizin hydrolase as a single-chain high-molecular weight precursor

    DEFF Research Database (Denmark)

    Skovbjerg, H; Danielsen, E M; Noren, Ove

    1984-01-01

    Precursor forms of lactase-phlorizin hydrolase, sucrase-isomaltase and aminopeptidase N were studied by pulse-labelling of organ-cultured human intestinal biopsies. After labelling the biopsies were fractionated by the Ca2+-precipitation method and the enzymes isolated by immunoprecipitation....... The results indicate that the lactase-phlorizin hydrolase is synthesized as a Mr 245 000 polypeptide, which is intracellularly cleaved into its mature Mr 160 000 form. Sucrase-isomaltase is shown to be synthesized as a single chain precursor (Mr 245 000 and 265 000) while the precursor of aminopeptidase N...

  10. 77 FR 10574 - Proposal Review Panel for Chemistry; Notice of Meeting

    Science.gov (United States)

    2012-02-22

    ... announces the following meeting: Name: Centers for Chemical Innovation (CCI) 2012 Phase II Full Proposal... 5, 2012 8 a.m.-9:15 a.m. Closed-Executive Session 9:15 a.m.-12:15 p.m. Open-CEOP Center & Poster Presentations 12:15 p.m. -1:30 p.m. Closed-Executive Session 1:30 p.m.-2:45 p.m. Open-Center Q&A 2:45 p.m.-5:30...

  11. Committed effective doses at various times after intakes of radionuclides

    CERN Document Server

    Phipps, A W; Kendall, G M; Silk, T J; Stather, J W

    1991-01-01

    This report contains details of committed effective doses at nine times after intake from intakes by ingestion and inhalation of 1 mu 1 AMAD particles by adults. Data are given for various chemical forms of 359 nuclides. It complements NRPB-R245 which describes the changes which have taken place since the last NRPB compendium of dose per unit intake factors (dose coefficients) and gives summary tables. Information on committed equivalent doses to organs is given in NRPB-M288. The information given in these memoranda is also available as a microcomputer package - NRPB-SR245.

  12. Committed equivalent organ doses and committed effective doses from intakes of radionuclides

    CERN Document Server

    Phipps, A W; Kendall, G M; Silk, T J; Stather, J W

    1991-01-01

    This report contains details of committed equivalent doses to individual organs for intakes by ingestion and inhalation of 1 mu m AMAD particles of 359 nuclides by infants aged 3 months, by children aged 1, 5, 10 and 15 years, and by adults. It complements NRPB-R245 which describes the changes which have taken place since the last NRPB compendium of dose per unit intake factors (dose coefficients) and gives summary tables. Information on the way committed doses increase with the integration period is given in NRPB-M289. The information given in these memoranda is also available as a microcomputer package - NRPB-SR245.

  13. Serum testosterone as a prognostic factor in patients with advanced prostatic carcinoma

    DEFF Research Database (Denmark)

    Iversen, P; Rasmussen, F; Christensen, I J

    1994-01-01

    In 245 patients with previously untreated advanced carcinoma of the prostate, serum concentrations of testosterone have been measured before androgen deprivation therapy, and patients were divided in quartiles according to their serum concentration. Pretreatment level of serum testosterone was co...... parameters suggest that low serum testosterone merely is a consequence of the advanced malignancy rather than a causative factor in the pathogenesis of prostatic cancer.......In 245 patients with previously untreated advanced carcinoma of the prostate, serum concentrations of testosterone have been measured before androgen deprivation therapy, and patients were divided in quartiles according to their serum concentration. Pretreatment level of serum testosterone...

  14. Intramolecular B/N frustrated Lewis pairs and the hydrogenation of carbon dioxide.

    Science.gov (United States)

    Courtemanche, Marc-André; Pulis, Alexander P; Rochette, Étienne; Légaré, Marc-André; Stephan, Douglas W; Fontaine, Frédéric-Georges

    2015-06-18

    The FLP species 1-BR2-2-NMe2-C6H4 (R = 2,4,6-Me3C6H2, 2,4,5-Me3C6H2) reacts with H2 in sequential hydrogen activation and protodeborylation reactions to give (1-BH2-2-NMe2-C6H4)2. While reacts with H2/CO2 to give formyl, acetal and methoxy-derivatives, reacts with H2/CO2 to give C6H4(NMe2)(B(2,4,5-Me3C6H2)O)2CH2. The mechanism of CO2 reduction is considered.

  15. Body-Worn Spiral Monopole Antenna for On-Body Communications (Invited Paper)

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren Helstrup; Thaysen, Jesper

    2015-01-01

    A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna was designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) hearing instruments at 2.45 GHz and has been simulated, prototyped, and measured. The antenna ...... yielded a measured and simulated E2E path gain at 2.45 GHz of –82.1 dB and –85.9 dB, respectively. The radiation pattern of the antenna when mounted in the ear is presented and discussed....

  16. Survival Signaling in Prostate Cancer: Role of Androgen Receptor and Integrins in Regulating Survival

    Science.gov (United States)

    2011-01-01

    Prostate Cancer Predoctoral Training Award (W81XWH- 08-1-0058) to L.L., and the American Cancer Society (RSG-05-245- 01- CSM ) to C.K.M. Additional support...Prostate Cancer Predoctoral Training Award (W81XWH-08-1-0058) (L.E.L.), and the American Cancer Society (RSG-05-245-01- CSM ) (C.K.M). Additional...Schmittgen TD . Analysis of relative gene expression data using real-time quantitative PCR and the 2(-ΔΔC(T)) Method. Methods 2001; 25: 402-8. 26. Sun

  17. Indigenous uses of economically important flora of Margallah Hills ...

    African Journals Online (AJOL)

    Informal interviews provided data about 245 useful plants of 77 families of 55 trees, 54 shrubs, 105 herbs, 15 climber, 10 grasses and 6 crops recorded from the Margallah Hills National Park, Islamabad. Two hundred and fifteen local/ vernacular names were noted of total plants. The inhabitants of the park have for a long ...

  18. HLA-G levels in serum and plasma

    Czech Academy of Sciences Publication Activity Database

    Rudstein-Svetlicky, N.; Loewenthal, R.; Hořejší, Václav; Gazit, E.

    2007-01-01

    Roč. 69, č. 1 (2007), s. 140-142 ISSN 0001-2815 Institutional research plan: CEZ:AV0Z50520514 Keywords : HLA-G * serum * plasma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.245, year: 2007

  19. Do the Big-Five Personality Traits Predict Empathic Listening and Assertive Communication?

    Science.gov (United States)

    Sims, Ceri M.

    2017-01-01

    As personality traits can influence important social outcomes, the current research investigated whether the Big-Five had predictive influences on communication competences of active-empathic listening (AEL) and assertiveness. A sample of 245 adults of various ages completed the self-report scales. Both Agreeableness and Openness uniquely…

  20. Rising trend and indications of caesarean section at the university of ...

    African Journals Online (AJOL)

    2009-10-05

    5.1%). .... 5. 176. 14.8. Total. 1192. 100. Booking status. Booked. 941. 78.9. Unbooked. 251. 21.1. Total. 1192. 100. Type of C/S. Emergency. 947. 79.4. Elective. 245. 20.6 .... Those who cannot afford have to resort to other.

  1. Organic Rankine Cycle recovering stage heat from MSF desalination distillate water

    International Nuclear Information System (INIS)

    Al-Weshahi, Mohammed A.; Anderson, Alexander; Tian, Guohong

    2014-01-01

    Highlights: • The ORC model is validated against measured performance of an existing ORC unit. • This ORC model highlights the importance of refrigerant choice (R245fa performs better than R134a for this specific application). • For heat recovery from desalination plant, ORC evaporator and cooling water temperatures significantly influence the performance. - Abstract: This investigation addresses the potential for heat recovery from Multi Stage Flash (MSF) desalination plant hot distillate water to power an Organic Rankine Cycle (ORC), comparing R134a and R245fa refrigerants as the working fluid. Using design characteristics of an existing ORC unit, the model was first validated against its measured output. The distillate hot water from MSF stages is utilised to provide heat to the ORC and performance is investigated for both working fluids and for the number of MSF stages for heat recovery. For the specific MSF plant investigated, the net produced ORC power is found the highest with extraction up to MSF powering stage 8, generating 359 kW when R245fa is used and 307 kW when R134a is used. Both refrigerants exhibit an increase of power output and decrease of energy efficiency as heat is recovered from more MSF stages. The influence of variation of the evaporator and cooling temperature on ORC performance is demonstrated to be significant for both refrigerants, with R245fa performing better in this specific application

  2. Using Storybooks as a Character Education Tools

    Science.gov (United States)

    Turan, Fethi; Ulutas, Ilkay

    2016-01-01

    This study aims to investigate the views and implementations of preschool teachers in "giving character education through picture storybooks." Descriptive review method was used in the research and supported with focus group interviews. For this reason data were took from two study groups (for the descriptive study group n = 245, for the…

  3. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... in to report inappropriate content. Sign in Transcript Statistics Add translations 15,542 views 40 Like this ... Administration 56,193 views 2:45 Coping With Depression - Duration: 4:50. Veterans Health Administration 7,056 ...

  4. Energy loss and online directional track visualization of fast electrons with the pixel detector Timepix

    Czech Academy of Sciences Publication Activity Database

    Granja, C.; Krist, Pavel; Chvátil, David; Šolc, J.; Pospíšil, S.; Jakubek, J.; Opalka, L.

    2013-01-01

    Roč. 59, DEC (2013), s. 245-261 ISSN 1350-4487 Institutional support: RVO:61389005 Keywords : interaction of radiation with matter * dE/dx detectors * particle tracking detectors * hybrid pixel detectors * active nuclear emulsion * energy loss Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.140, year: 2013

  5. 27 November 2014 - Warsaw University of Technology (PL) Vice-Rector for Research R. Bacewicz visitng the ALICE control room and undergorund experimental area with WUT students, accompanied by A. Charkiewicz and A. Siemko; joint signature ceremony with HNINP Director-General M. Jezabek

    CERN Multimedia

    Guillaume, Jeanneret

    2014-01-01

    CERN-PHOTO-201411-245-95: from left to right: Professor D.Sc.Ph.D. Rajmund Bacewicz, Vice-Rector for Research, Warsaw University of Technology, CERN Director-General R. Heuer and Prof. Marek Jeżabek, Director-General, Henryk Niewodniczanski Institute of Nuclear Physics, Republic of Poland

  6. Community Environmental Response Facilitation Act (CERFA) Report, Sacramento Army Depot, Sacramento, California

    Science.gov (United States)

    1994-04-01

    REFER TO NAP #) Map Number: 48197R EPA ID Number: CAD983592080 Facility: BUZZ OATES ENTERPRIZES Address: 8615 ELDER CREEK RD City: SACRAMENTO Zip...pesticides such as DDT, Aldrin -Dieldrin, and the herbicide 2,4,5-T. 2. Request Office of Legal Counsel verify the exemption from CERCLA for routine

  7. Spatial monsoon variability with respect to NAO and SO

    Indian Academy of Sciences (India)

    Geophys. Biokl. B29. 245–252. Rasmusson E M and Carpenter T H 1983 The relationships between the eastern pacific sea surface temperature and rainfall over India and Sri Lanka; Mon. Wea. Rev. 111. 354–384. Rogers J C 1984 The association between the NAO and the. Southern oscillation in the Northern Hemisphere ...

  8. 75 FR 22163 - Meeting of the Federal Advisory Committee on Juvenile Justice

    Science.gov (United States)

    2010-04-27

    ... Review. 11:45 a.m.-1:15 p.m.--Working Lunch: FACJJ Subcommittee Meetings (closed). 1:15 pm-2:45 p.m.--Review and Discussion of Drafts--Small Groups. 2:45-3 p.m.--Break. 3-4 p.m.--Work on Annual Report--Small...

  9. 21 CFR 524.1982 - Proparacaine hydrochloride ophthalmic solution.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Proparacaine hydrochloride ophthalmic solution... ANIMAL DRUGS § 524.1982 Proparacaine hydrochloride ophthalmic solution. (a) Specifications. The drug is an aqueous solution containing 0.5 percent proparacaine hydrochloride, 2.45 percent glycerin as a...

  10. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Bikash Kumar Panda. Articles written in Journal of Chemical Sciences. Volume 116 Issue 5 August 2004 pp 245-250. Synthesis, characterization and emission properties of quinolin-8-olato chelated ruthenium organometallics · Bikash Kumar Panda · More Details Abstract ...

  11. Evaluation of Response to Super-Ovulation, Estrous ...

    African Journals Online (AJOL)

    Bos taurus indicus) com inseminac¸a˜o artificial em tempo fixo. Acta Sci Vet;31; 244–245. Baruselli P S, MF. de Sa´ Filho, CM Martins, L F Nasser, MFG NogueiraCM Barros and GA Bo. 2006. Superovulation and embryo transfer in Bos indicus ...

  12. Effect of Physical and Flexibility Exercise on Plasma Levels of Some ...

    African Journals Online (AJOL)

    Ozer J, Ratner M, Shaw M, Bailey W, Schomaker S. The current state of serum biomarkers of hepatotoxicity. Toxicol 2008; 245: 194–205. 25. Dufour DR, Lott JA, Nolte FS, Gretch DR, Koff RS, Seeff. LB. Diagnosis and monitoring of hepatic injury. II. Recommendations for use of laboratory tests in screening, diagnosis, and ...

  13. Correlates of In-Law Conflict and Intimate Partner Violence against Chinese Pregnant Women in Hong Kong

    Science.gov (United States)

    Chan, Ko Ling; Tiwari, Agnes; Fong, Daniel Y. T.; Leung, Wing Cheong; Brownridge, Douglas A.; Ho, Pak Chung

    2009-01-01

    This study examines correlates of in-law conflict with intimate partner violence (IPV) against pregnant women in a cohort of Chinese pregnant women who visited antenatal clinics in Hong Kong. This was a territory-wide, cross-sectional study of 3,245 pregnant women recruited from seven hospitals in Hong Kong. Participants were invited to complete…

  14. Computer Generated Imagery (CGI) Current Technology and Cost Measures Feasibility Study.

    Science.gov (United States)

    1980-09-26

    3, March 1979, pp. 234-245. F-18 Lu, S. Y. and K.S. Fu, "A Syntactic Approach to Texture Analysis", CGIP, Vol. 7, June 1978. Machover , C., M...Neighbors and C. Stuart, "Graphics displays: Factors in systems design", IEEE Spectrum, October 1977. Machover , C., M. Neighbors and C. Stuart, "Graphics

  15. The Autism-Spectrum Quotient--Italian Version: A Cross-Cultural Confirmation of the Broader Autism Phenotype

    Science.gov (United States)

    Ruta, Liliana; Mazzone, Domenico; Mazzone, Luigi; Wheelwright, Sally; Baron-Cohen, Simon

    2012-01-01

    The Autism Spectrum Quotient (AQ) has been used to define the "broader" (BAP), "medium" (MAP) and "narrow" autism phenotypes (NAP). We used a new Italian version of the AQ to test if difference on AQ scores and the distribution of BAP, MAP and NAP in autism parents (n = 245) versus control parents (n = 300) were…

  16. Dicty_cDB: Contig-U00406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 20464, 5' e... 38 0.79 3 ( EJ670368 ) 1092955055704 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.89 3 ( BV378352 ) S245P634FG5.T0 Span...ishGrayWolf Canis lupus STS ge... 48 0.92 1 ( CT571268 ) Mouse DNA sequence from cl

  17. AFRRI Reports, Second Quarter 1992.

    Science.gov (United States)

    1992-07-01

    release assay for the also appreciated. estimation of mouse cytotoxins. Transplantation 6:761. 27. Freshney , R. I. 1987. Measurement of cytotoxicity and...viability. In Culture of Animal Cells. A Manual of Basic Technique. 2nd ed. R. REFERENCES I. Freshney . ed. Alan R. Liss. Inc., New York. p. 245. 28

  18. N-(2-Mercaptoethyl)-1,3-Propanediamine (WR-1065) Protects Thymocytes from Programed Cell Death

    Science.gov (United States)

    1992-03-15

    cytotoxlns. Transplantation 6:76 1. 27. Freshney . R. 1. 1987. Measurement of cytotoxicity and viability. In Culture of Animal Cells. A Manual of Saslc...Technique. 2nd ed. R1. REFERENCES 1. Freshney . ed. Alan R. Liss, Inc.. New York. p. 245. 28. Brunk. C. F.. K. C. Jones. and T. W. James. 1979. Assay

  19. 75 FR 4336 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-01-27

    ... resources in the form of fresh, nutritious, unprepared locally grown fruits, vegetables, honey and herbs... it displays a currently valid OMB control number. Food and Nutrition Service Title: 7 CFR part 245...,432. Food and Nutrition Service Title: Quality Control Review Schedule. OMb Control Number: 0584-0299...

  20. Margaret Atwood: "The handmaid´s tale"

    OpenAIRE

    Pache, Walter

    1992-01-01

    Margaret Atwood: "The handmaid´s tale". - In: Große Werke der Literatur / [hrsg. von Hans Vilmar Geppert]. - Augsburg : Presse-Dr.- u. Verl.-GmbH. - Bd. 2. (1992). - S. 245-267. - Veränd. auch ersch. in: Anglistentag: Proceedings. 1991 (1992). S. 386-400

  1. The Distinct Roles of Sociometric and Perceived Popularity in Friendship: Implications for Adolescent Depressive Affect and Self-Esteem

    Science.gov (United States)

    Litwack, Scott D.; Aikins, Julie Wargo; Cillessen, Antonius H. N.

    2012-01-01

    The primary goal of this study was to examine the similarities and distinctions between two types of popularity, sociometric and perceived, in their associations with friendship characteristics and how they in turn are related to depressive affect and self-esteem. Among 245 eighth graders, sociometric popularity was associated with a greater…

  2. The prevalence of thrombocytopenia in plasmodium falciparum ...

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2013-06-23

    Jun 23, 2013 ... cine. New York, McGraw Hill. 1989:245-64. 2. Nathan DG, Orkin SH, Ginsburg. D, Thomas Look A. Nathan and. Oski's Haematology of Infancy and Childhood. 6th ed. Saunders,. Philadelphia. 2003: 133-4. 3. WHO. Global malaria programme. Geneva, Switzerland. 2008. 4. WHO Guidelines for the treatment.

  3. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration ... 6,432 views 4:50 Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration 54,464 ...

  4. Rapid identification and classification of Listeria spp. and serotype assignment of Listeria monocytogenes using fourier transform-infrared spectroscopy and artificial neural network analysis

    Science.gov (United States)

    The use of Fourier Transform-Infrared Spectroscopy (FT-IR) in conjunction with Artificial Neural Network software, NeuroDeveloper™ was examined for the rapid identification and classification of Listeria species and serotyping of Listeria monocytogenes. A spectral library was created for 245 strains...

  5. Team Theory and Decentralized Resource Allocation: An Example.

    Science.gov (United States)

    1982-02-01

    continues through Walras [1954, pp. 84-86, 90-91, 105-106, 169-172, 243-254, and 184-1951, Pareto 11927, pp. 233-2341, Barone, pp. 245-290 in von Hayek...politique (Deuxi~me edition), Marcel Girard, Paris. Walras , L. [19541, Elements of Pure Economics, ed. and tr. by W. Jaffe, George Allen and Unwin

  6. A ten year histopathological review of breast lumps in a tertiary ...

    African Journals Online (AJOL)

    37%) followed by fibrocystic change disease which accounted for 238 (24.5%). Fibroadenoma had a mean age of 22.3 (SD = 5.5) years. This was followed closely by invasive ductal carcinoma with a mean age of 48.2 (SD = 4.1) years.

  7. Tropical Journal of Obstetrics and Gynaecology - Vol 34, No 3 (2017)

    African Journals Online (AJOL)

    Giant fibroadenoma of the breast in late third trimester · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Moukit, R Aitbouhou, M.E. El Hassani, A Babahabib, J Kouach, R.D. Moussaoui, 243-245. http://dx.doi.org/10.4103/TJOG.TJOG_51_17 ...

  8. File list: Pol.Epd.05.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.05.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...245,SRX663247,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.05.RNA_polymerase_II.AllCell.bed ...

  9. In-the-Ear Spiral Monopole Antenna for Hearing Instruments

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren Helstrup; Thaysen, Jesper

    2014-01-01

    A novel in-the-ear (ITE) antenna solution for hearing instruments that operates at 2.45 GHz is presented. The antenna consists of a quarter wave monopole and a ground plane that are placed in the ear. The simulated path gain | S 21 |is − 86 dB and the measured path gain is − 80 dB. Simulations...

  10. Water resources data for Texas, water year 1997. Volume 4. Ground-water data. Water-data report (Annual), 1 October 1996-30 September 1997

    Energy Technology Data Exchange (ETDEWEB)

    Gandara, S.C.; Jones, R.E.; Barbie, D.L.

    1997-12-03

    Water-resources data for the 1997 water year for Texas consists of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 4 contains water levels for 790 observation wells and 245 water-quality data for monitoring wells.

  11. Like Father, Like Son? The Link between Parents' Moral Disengagement and Children's Externalizing Behaviors

    Science.gov (United States)

    Camodeca, Marina; Taraschi, Emanuela

    2015-01-01

    This work considers a still uninvestigated research issue-namely, whether parents' moral disengagement affected preschool children's externalizing behavior. Participants were 245 children (126 girls and 119 boys) aged 3-6 years. Parents' moral disengagement was assessed in terms of their externalization of blame and their indifference in reactions…

  12. One-pot synthesis of novel 1, 8-dioxo-decahydroacridines ...

    Indian Academy of Sciences (India)

    Ramakrishana V T 1996 J. Org. Chem. 61 5083. 4. Srividya N, Ramamurthy P and Ramakrishnan V T 1998. Spectrochim. Acta 54 245. 5. Demeunynck M and Charmantray F 2001 Curr. Pharm. Des. 7 1703. 6. Bonacorso H G, Drekener R L, Rodrigues I R, Vezzosi. R P, Costa M B, Martins M A P and Zanatta N 2005. J. Fluor.

  13. Chamois introductions to Central Europe and New Zealand

    Czech Academy of Sciences Publication Activity Database

    Martínková, Natália; Zemanová, Barbora; Kranz, A.; Giménez, M. D.; Hájková, Petra

    2012-01-01

    Roč. 61, 3-4 (2012), s. 239-245 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : Alpine chamois * animal translocations * introduction * invasive species * Rupicapra rupicapra Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  14. 40 CFR Table 7 to Subpart Vvvvvv... - Partially Soluble HAP

    Science.gov (United States)

    2010-07-01

    ...-Trichloroethane (methyl chloroform) 71556 2. 1,1,2,2-Tetrachloroethane 79345 3. 1,1,2-Trichloroethane 79005 4. 1,1-Dichloroethylene (vinylidene chloride) 75354 5. 1,2-Dibromoethane 106934 6. 1,2-Dichloroethane (ethylene dichloride) 107062 7. 1,2-Dichloropropane 78875 8. 1,3-Dichloropropene 542756 9. 2,4,5-Trichlorophenol 95954 10. 1,4...

  15. 40 CFR Table 7 to Subpart Hhhhh of... - Partially Soluble Hazardous Air Pollutants

    Science.gov (United States)

    2010-07-01

    ... No. 1. 1,1,1-Trichloroethane (methyl chloroform) 71556 2. 1,1,2,2-Tetrachloroethane 79345 3. 1,1,2-Trichloroethane 79005 4. 1,1-Dichloroethylene (vinylidene chloride) 75354 5. 1,2-Dibromoethane 106934 6. 1,2-Dichloroethane (ethylene dichloride) 107062 7. 1,2-Dichloropropane 78875 8. 1,3-Dichloropropene 542756 9. 2,4,5...

  16. the bacteriological safety and antimicrobial

    African Journals Online (AJOL)

    GB

    2013-03-01

    Mar 1, 2013 ... serotypes Typhimurium, Enteritidis and. Infantis from human infections, food stuffs and farm animals in Italy. Epidemiol Infec,. 2004; 132: 245-251. 34. Centinkaya F, Cibik G, Soyuteniz E, Ozkin C,. Kayali R, Levent B. Shigella and Salmonella contamination in various foodstuffs in Turkey. Food Control, 2008 ...

  17. Divergent adaptations in different parts of introduced range in tetraploid Vicia cracca

    Czech Academy of Sciences Publication Activity Database

    Líblová, Z.; Eliášová, A.; Münzbergová, Zuzana

    2017-01-01

    Roč. 234, SEP 2017 (2017), s. 245-255 ISSN 0367-2530 Institutional support: RVO:67985939 Keywords : common garden experiments * autoploid * cytotype * biological invasions * evolutionary plasticity Subject RIV: EH - Ecology, Behaviour OBOR OECD: Plant sciences, botany Impact factor: 1.125, year: 2016

  18. Supramolecular interactions between chiral ions: Synthesis and characterization of [M-II(bpy)(3)][VO(O-2)(ox)(bpy)].7H(2)O (M = Fe and Ni)

    Czech Academy of Sciences Publication Activity Database

    Antal, P.; Tatiersky, J.; Schwendt, P.; Žák, Z.; Gyepes, Robert

    2013-01-01

    Roč. 1032, JAN 2013 (2013), s. 240-245 ISSN 0022-2860 Institutional support: RVO:61388955 Keywords : vanadium(V) * iron(II) * nickel(II) complexes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.599, year: 2013

  19. Adhesion of osteoblasts on chemically patterned nanocrystalline diamonds

    Czech Academy of Sciences Publication Activity Database

    Kalbáčová, M.; Michalíková, Lenka; Barešová, V.; Kromka, Alexander; Rezek, Bohuslav; Kmoch, S.

    2008-01-01

    Roč. 245, č. 10 (2008), s. 2124-2127 ISSN 0370-1972 R&D Projects: GA AV ČR KAN400100701 Institutional research plan: CEZ:AV0Z10100521 Keywords : cell growth * nanocrystalline diamond * surface termination Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.166, year: 2008

  20. Climate influences on upper Limpopo River flow | Jury | Water SA

    African Journals Online (AJOL)

    This study demonstrates how the regional climate affects river flow in the upper Limpopo Valley of southern Africa (21–24.5S, 26–30E). The catchment basin receives inflow from the Crocodile, Marico, Mahalapse and Lotsane Rivers, and lies on the eastern fringe of the Kalahari plateau, known for water-deficit conditions.

  1. Penetration of slow waves into an overdense plasma

    International Nuclear Information System (INIS)

    Motley, R.W.; Bernabei, S.; Hooke, W.M.; McWilliams, R.; Olson, L.

    1978-06-01

    Probe measurements are reported of the propagation of a 2.45 GHz slow wave launched into a linear, overdense test plasma by a phased double waveguide. We find that waves in the frequency interval omega/sub LH/ < omega < omega/sub pe/ penetrate to the plasma interior only if they satisfy the accessibility criterion

  2. Mini-remote-control Antenna for On-body Wireless Communication Systems

    DEFF Research Database (Denmark)

    Larsen, Lauge K.; Kvist, Søren Helstrup; Yatman, William H.

    2012-01-01

    Two commercially available, compact antennas are evaluated for use in a small 55mm 39mm 15mm Remote Control (RC). The influence of the body on the path gain (jS21j) at 2:45 GHz between the remote control and a monopole parallel to the side of the head is evaluated. The measurements are made on tw...

  3. Teachers' Rooms Environmental Assessment Scale: Development and Psychometric Evaluation

    Science.gov (United States)

    Arslan, Suna

    2016-01-01

    Teachers' rooms are important parts of educational environments, as the quality of the physical-spatial and psychosocial conditions may affect the personal and occupational developments of teachers as well as the education processes. In Study 1 (n = 245), a Teachers' Rooms-Environmental Assessment Scale (TREAS) measure of the current conditions of…

  4. Risk stratification by endocrinologists of patients with type 2 diabetes in a Danish specialised outpatient clinic

    DEFF Research Database (Denmark)

    Munch, Lene; Arreskov, Anne B; Sperling, Michael

    2016-01-01

    professionals, and compared with the endocrinologists' assessments. In order to test the degree of concordance, we conducted Cohen's kappa, McNemar's test for marginal homogeneity, and Bowker's test for symmetry. RESULTS: Of 245 newly referred patients, 209 (85 %) were stratified by the endocrinologists...

  5. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close About Military Sexual Trauma Veterans Health Administration Loading... Unsubscribe from Veterans ... views 4:50 Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration 53,436 views 2: ...

  6. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Administration 54,012 views 2:45 Cognitive Processing Therapy for PTSD - Duration: 2:41. Veterans Health Administration ... 663 views 53:29 What is Cognitive Processing Therapy (CPT) [for posttraumatic stress disorder]? - Duration: 2:01. ...

  7. Download this PDF file

    African Journals Online (AJOL)

    FIRST LADY

    Furthermore, 17.0% of the respondents stated traffic jam, 42.0% stated slow vehicular movement and 24.5% of the respondents stated few vehicles on the road. The implication of this is that the effect of flooding on transportation land use had led to the slow vehicular movement in Benin City, resulting to waste of precious ...

  8. Waste prevention for sustainable resource and waste management

    DEFF Research Database (Denmark)

    Sakai, Shin-Ichi; Yano, Junya; Hirai, Yasuhiro

    2017-01-01

    included invited experts and researchers in several countries who were in charge of 3R policies, and an additional review of 245 previous studies. It was found that, regarding policy development, the decoupling between environmental pressures and economy growth was recognized as an essential step towards...

  9. 75 FR 36374 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2010-06-25

    ... Senate Committee on Homeland Security and Governmental Affairs, the Chair of the House Committee on... 8166, Washington, DC 20202-1510. Telephone: (202) 245-7077. If you use a telecommunications device for..., audiotape, or computer diskette) on request to the contact person listed under FOR FURTHER INFORMATION...

  10. Measuring the environmental literacy of teachers

    African Journals Online (AJOL)

    Erna Kinsey

    researchers have made an effort to define it or to refine descriptions of it. Examples can be found in, inter alia, Clacherty (1992:26), Roth. (1992:1) and Subbarini (1998:245). Although we are aware of the possibility of being labelled positivistic, a definition of environmental literacy was developed from the various efforts of ...

  11. Socioeconomic inequities and payment coping mechanisms used in ...

    African Journals Online (AJOL)

    A socioeconomic status (SES) index was used to divide the respondents into SES quartiles (Q1 (poorest), Q2, Q3, Q4 (least poor)). The coping mechanisms were disaggregated by SES. Results: The mean monthly expenditure for the treatment of diabetes was .56,245.11 ($356). Expenditures were mostly incurred through ...

  12. The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line

    DEFF Research Database (Denmark)

    Xu, Xun; Pan, Shengkai; Liu, Xin

    2011-01-01

    Chinese hamster ovary (CHO)-derived cell lines are the preferred host cells for the production of therapeutic proteins. Here we present a draft genomic sequence of the CHO-K1 ancestral cell line. The assembly comprises 2.45 Gb of genomic sequence, with 24,383 predicted genes. We associate most...

  13. Genetic interaction between Lrp6 and Wnt5a during mouse development

    Czech Academy of Sciences Publication Activity Database

    Andersson, E.; Bryjová, Lenka; Biris, K.; Yamaguchi, T.P.; Arenas, E.; Bryja, Vítězslav

    2010-01-01

    Roč. 239, č. 1 (2010), s. 237-245 ISSN 1058-8388 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt 5a * Lrp6 * somitogenesis Subject RIV: BO - Biophysics Impact factor: 2.864, year: 2010

  14. 76 FR 61746 - Western Digital Technologies, Inc.: Hard Drive Development Engineering Group Irvine (Formerly at...

    Science.gov (United States)

    2011-10-05

    ... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...

  15. 76 FR 41274 - Committee Name: Homeland Security Science and Technology Advisory Committee (HSSTAC)

    Science.gov (United States)

    2011-07-13

    ... renewal of the charter of the Homeland Security Science and Technology Advisory Committee (HSSTAC) is... Director, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410..., cyber-security, knowledge management and how best to leverage related technologies funded by other...

  16. 75 FR 18516 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-04-12

    ...; notice of closed Federal Advisory Committee meeting SUMMARY: The Homeland Security Science and Technology.... DATES: The Homeland Security Science and Technology Advisory Committee will meet April 20, 2010 from 8...: Ms. Tiwanda Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray...

  17. 75 FR 28275 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-05-20

    ...: The Homeland Security Science and Technology Advisory Committee met on April 20, 2010 from 8:30 a.m... and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410, Washington... for the Under Secretary of Homeland Security for Science and Technology. The Homeland Security Science...

  18. 75 FR 39955 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-07-13

    ... Homeland Security Science and Technology Advisory Committee meeting will be open to the public on July 20th... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Protection programs in Science & Technology and updates on homeland security sensitive Federally Funded...

  19. 78 FR 45255 - Homeland Security Science and Technology Advisory Committee (HSSTAC)

    Science.gov (United States)

    2013-07-26

    ... Security Science and Technology Advisory Committee (HSSTAC) is necessary and in the public interest in connection with the Department of Homeland Security, Science and Technology Directorate's performance of its... Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410, Washington, DC 20528...

  20. Security Locks

    Science.gov (United States)

    Hart, Kevin

    2010-01-01

    According to a 2008 "Year in Review" report by Educational Security Incidents, an online repository that collects data on higher education security issues, the total number of security incidents reported at universities and colleges worldwide rose to 173 in 2008, a 24.5 percent increase over 2007. The number of institutions…