Fine genetic mapping of a locus controlling short internode length in melon (Cucumis melo L.)
Compact and dwarfing vining habits in melon (Cucumis melo L.; 2n = 2x = 24) may have commercial importance since they can contribute to the promotion of concentrated fruit set and can be planted in higher plant densities than standard vining types. A diminutive (dwarf) melon mutant line (PNU-D1) wi...
Risti, Andika Pranata; Herawati, Netti
2017-01-01
Theaim of this study wasto get the best treatment fruit leather from mixed soursop (Annoma muricata L.) and melon (Cucumis melo L.). The study used a Complete Randomized Design (CRD) with 6 treatments and 3 replications.The treatments were SM1 (soursop 100 : melon 0), SM2 (soursop80 : melon 20), SM3 (soursop60 : melon40), SM4 (soursop40 : melon60) SM5 (soursop20 : melon80) and SM6 (soursop 0 : melon 100). The data were analyzed statistically using ANOVA and DNMRT at 5%. Thestudyshowed that ...
Medieval emergence of sweet melons, Cucumis melo (Cucurbitaceae).
Paris, Harry S; Amar, Zohar; Lev, Efraim
2012-07-01
Sweet melons, Cucumis melo, are a widely grown and highly prized crop. While melons were familiar in antiquity, they were grown mostly for use of the young fruits, which are similar in appearance and taste to cucumbers, C. sativus. The time and place of emergence of sweet melons is obscure, but they are generally thought to have reached Europe from the east near the end of the 15th century. The objective of the present work was to determine where and when truly sweet melons were first developed. Given their large size and sweetness, melons are often confounded with watermelons, Citrullus lanatus, so a list was prepared of the characteristics distinguishing between them. An extensive search of literature from the Roman and medieval periods was conducted and the findings were considered in their context against this list and particularly in regard to the use of the word 'melon' and of adjectives for sweetness and colour. Medieval lexicographies and an illustrated Arabic translation of Dioscorides' herbal suggest that sweet melons were present in Central Asia in the mid-9th century. A travelogue description indicates the presence of sweet melons in Khorasan and Persia by the mid-10th century. Agricultural literature from Andalusia documents the growing of sweet melons, evidently casabas (Inodorous Group), there by the second half of the 11th century, which probably arrived from Central Asia as a consequence of Islamic conquest, trade and agricultural development. Climate and geopolitical boundaries were the likely causes of the delay in the spread of sweet melons into the rest of Europe.
Directory of Open Access Journals (Sweden)
Lady Diana Tetelepta
2016-10-01
Full Text Available ABSTRACTMelon (Cucumis melo L. is a high economic value horticultural crop that is cultivated in some regions of Indonesia under fertilization management. Application of inorganic fertilizer continuously can reduce soil microbial abundance. One of the soil microbial that promote plant growth is arbuscular mycorrhizal fungi (AMF and Azospirillum sp. The aim of this study was to analysed the effect of AMF and Azospirillum sp. in promoting growth and production of melon. The experiment was carried out in a greenhouse and was arranged in a completely randomized design with five replicates. Five treatments tested were: control, fertilized with NPK, inoculated with AMF, inoculated with Azospirillum sp., inoculated with AMF + Azospirillum sp. The results showed that the effect of AMF on root growth and shoot growth were similar to NPK fertilizer. Azospirillum sp. increased root growth. On the other side, the effect of Azospirillum sp. on shoot growth was similar to NPK fertilizer. However, AMF and Azospirillum sp. inoculation solely increased plant height, fruit weight, fruit diameter, flavor and length of fruit storage. Meanwhile, combination of AMF and Azospirillum sp. increased plant height, root growth, shoot growth, fruit weight, fruit diameter, flavor and length of fruit storage. This study revealed that application of AMF and Azospirillum sp. in melon cultivation was more effective and efficient than NPK fertilizer.Keywords: arbuscular mycorrhizal fungi, Azospirillum sp., Cucumis melo L.
Directory of Open Access Journals (Sweden)
Schaefer Hanno
2007-04-01
Full Text Available Abstract Background Melon, Cucumis melo, and cucumber, C. sativus, are among the most widely cultivated crops worldwide. Cucumis, as traditionally conceived, is geographically centered in Africa, with C. sativus and C. hystrix thought to be the only Cucumis species in Asia. This taxonomy forms the basis for all ongoing Cucumis breeding and genomics efforts. We tested relationships among Cucumis and related genera based on DNA sequences from chloroplast gene, intron, and spacer regions (rbcL, matK, rpl20-rps12, trnL, and trnL-F, adding nuclear internal transcribed spacer sequences to resolve relationships within Cucumis. Results Analyses of combined chloroplast sequences (4,375 aligned nucleotides for 123 of the 130 genera of Cucurbitaceae indicate that the genera Cucumella, Dicaelospermum, Mukia, Myrmecosicyos, and Oreosyce are embedded within Cucumis. Phylogenetic trees from nuclear sequences for these taxa are congruent, and the combined data yield a well-supported phylogeny. The nesting of the five genera in Cucumis greatly changes the natural geographic range of the genus, extending it throughout the Malesian region and into Australia. The closest relative of Cucumis is Muellerargia, with one species in Australia and Indonesia, the other in Madagascar. Cucumber and its sister species, C. hystrix, are nested among Australian, Malaysian, and Western Indian species placed in Mukia or Dicaelospermum and in one case not yet formally described. Cucumis melo is sister to this Australian/Asian clade, rather than being close to African species as previously thought. Molecular clocks indicate that the deepest divergences in Cucumis, including the split between C. melo and its Australian/Asian sister clade, go back to the mid-Eocene. Conclusion Based on congruent nuclear and chloroplast phylogenies we conclude that Cucumis comprises an old Australian/Asian component that was heretofore unsuspected. Cucumis sativus evolved within this Australian
Identification of Local Melon (Cucumis melo L. var. Bartek Based on Chromosomal Characters
Directory of Open Access Journals (Sweden)
BUDI SETIADI DARYONO
2011-12-01
Full Text Available Bartek is one of local melon varieties mainly cultivated in Pemalang, Central Java. Bartek has three variations of fruits; Long-Green, Ellips-Green, and Yellow. Chromosome characterization of the Bartek was investigated to determine the genetic variation. The main purpose of this research was to determine the genetic characters of Bartek including chromosome number, mitosis, cell cycle, and karyotype. Squash method was used for chromosome preparation. The results showed that all of Bartek observed in this study have similar diploid (2n chromosome number = 24. According to the total number of chromosome, Bartek is closer to melon than cucumber. The mitotic analysis exhibited that the Bartek has similar karyotype formula, 2n = 2x = 24m. Based on the R value of the three kinds of Bartek (R < 0.27, it indicated that three kinds of Bartek were considered to be originated from similar species and one of melon varieties (Cucumis melo L. var. Bartek.
Bhawna; Chaduvula, Pavan K; Bonthala, Venkata S; Manjusha, Verma; Siddiq, Ebrahimali A; Polumetla, Ananda K; Prasad, Gajula M N V
2015-01-01
Cucumis melo L. that belongs to Cucurbitaceae family ranks among one of the highest valued horticulture crops being cultivated across the globe. Besides its economical and medicinal importance, Cucumis melo L. is a valuable resource and model system for the evolutionary studies of cucurbit family. However, very limited numbers of molecular markers were reported for Cucumis melo L. so far that limits the pace of functional genomic research in melon and other similar horticulture crops. We developed the first whole genome based microsatellite DNA marker database of Cucumis melo L. and comprehensive web resource that aids in variety identification and physical mapping of Cucurbitaceae family. The Cucumis melo L. microsatellite database (CmMDb: http://65.181.125.102/cmmdb2/index.html) encompasses 39,072 SSR markers along with its motif repeat, motif length, motif sequence, marker ID, motif type and chromosomal locations. The database is featured with novel automated primer designing facility to meet the needs of wet lab researchers. CmMDb is a freely available web resource that facilitates the researchers to select the most appropriate markers for marker-assisted selection in melons and to improve breeding strategies.
Directory of Open Access Journals (Sweden)
Marlove Fátima Brião Muniz
2004-06-01
Full Text Available O objetivo do trabalho foi avaliar a eficiência de diferentes testes na identificação do nível de vigor e da qualidade sanitária de lotes de sementes de melão (Cucumis melo L.. Foram avaliados quatro lotes de sementes das cultivares Gaúcho e Carvalho, submetidas aos testes de primeira contagem de germinação, emergência em campo, deterioração controlada, envelhecimento acelerado e sanidade. Os resultados indicaram que os testes de deterioração controlada e envelhecimento acelerado apresentam sensibilidade suficiente para avaliação do potencial fisiológico de sementes de melão, mas os testes de avaliação de plântulas não mostraram sensibilidade suficiente para realizar uma estratificação dos lotes pelo vigor. Aspergillus spp. e Fusarium oxysporum foram encontrados associados às sementes.The objective of this work was to evaluate the efficiency of different vigour tests in the identification of vigour levels and health quality of melon (Cucumis melo L. seeds. Four seed lots of Gaúcho and Carvalho cultivars were evaluated. Seeds were submitted to the first germination counting, field emergence, controlled deterioration and aging, cold vigour and health tests. Results indicated that controlled deterioration and accelerated aging tests presented enough sensibility for evaluating the physiological potential of melon seeds. Tests of seedling evaluation did not show enough sensibility to identify hiht quality seed lots. Aspergillus ssp. and Fusarium oxysporum were detected associated with seeds.
Faske, T R
2013-03-01
Cucumis melo var. texanus, a wild melon commonly found in the southern United States and two accessions, Burleson Co. and MX 1230, expressed resistance to Meloidogyne incognita in preliminary experiments. To characterize the mechanism of resistance, we evaluated root penetration, post-penetration development, reproduction, and emigration of M. incognita on these two accessions of C. melo var. texanus. Additionally, we evaluated 22 accessions of C. melo var. texanus for their reaction against M. incognita in a greenhouse experiment. Fewer (P ≤ 0.05) J2 penetrated the root system of C. melo var. texanus accessions (Burleson Co. and MX 1230) and C. metuliferus (PI 482452) (resistant control), 7 days after inoculation (DAI) than in C. melo 'Hales Best Jumbo' (susceptible control). A delayed (P ≤ 0.05) rate of nematode development was observed at 7, 14, and 21 DAI that contributed to lower (P ≤ 0.05) egg production on both accessions and C. metuliferus compared with C. melo. Though J2 emigration was observed on all Cucumis genotypes a higher (P ≤ 0.05) rate of J2 emigration was observed from 3 to 6 DAI on accession Burleson Co. and C. metuliferus than on C. melo. The 22 accessions of C. melo var. texanus varied relative to their reaction to M. incognita with eight supporting similar levels of nematode reproduction to that of C. metuliferus. Cucumis melo var. texanus may be a useful source of resistance against root-knot nematode in melon.
Directory of Open Access Journals (Sweden)
Pablo Forlan Vargas
2008-02-01
Full Text Available Objetivou-se com este trabalho avaliar a qualidade de frutos de cinco cultivares de melão rendilhado (Cucumis melo L., cultivados em casa de vegetação, em função do sistema de produção. O experimento foi instalado em casa de vegetação na UNESP-FCAV, Jaboticabal-SP, no período de novembro de 2005 à fevereiro de 2006. O experimento foi delineado em esquema fatorial 5 X 2, em blocos casualizados com quatro repetições. Os tratamentos resultaram da combinação de cinco híbridos de melão rendilhado: Maxim, Bônus 2, Shinju 200, Fantasy e Louis e dois sistemas de cultivo: no solo e em substrato de fibra da casca de coco. As características avaliadas foram: massa fresca do fruto, espessura de mesocarpo, intensidade de rendilhamento da casca, pH, sólidos solúveis totais, acidez titulável, índice de maturação (RATIO, e vitamina C. Não houve interação significativa entre os sistemas de cultivo e cultivares para nenhuma das características avaliadas. O cultivo de melão em substrato resultou em frutos com qualidade superior ao cultivo em solo. Os híbridos Louis e Fantasy foram os que apresentaram melhor desempenho qualitativo de frutos.The aim of this study was to evaluate the fruit quality of five net melon (Cucumis melo L. cultivars, grown in a greenhouse, in function of production system. The study was carried out in a greenhouse at UNESP-FCAV, Jaboticabal-SP, Brazil, during the period of November, 2005 to February, 2006. The study was carried out using a 5 x 2 factorial scheme, in randomized complete block design with four repetitions. The treatments resulted the combination of five net melon hybrids: Maxim, Bônus 2, Shinju 200, Fantasy and Louis and two cultivations systems: in soil and in coconut fiber substrate. The characters evaluated were: fresh weight of fruit, mesocarp thickness, fruit shape index, pH, total soluble solids, titratable acidity, maturation index (RATIO; and vitamin C. No interactions were observed
Directory of Open Access Journals (Sweden)
Najmah Farhati
2017-09-01
Full Text Available Melon (Cucumis melo L. has economic potential to be cultivated because the fruit contains protein, fat, carbohydrate, calcium, phosphor, fiber, iron, vitamin A, vitamin B1, vitamin B2, vitamin C, and niacin. Fusarium wilt caused by Fusarium oxysporum will decrease melon crop production. One of controlling method to Fusarium wilt diseases on melon plants which safe for environtmental by using biological control. One of microorganisms which can be biological control agent is Vesicular Arbuscular Mycorrhiza (VAM. This research use experimental method with a Completely Randomized Design (CRD. The experimental treatment consists of two types of treatment which combine 5 doses of VAM mixture ( 0 g/plant, 10 g/plant, 12,5 g/plant, 15 g/plant, 17,5 g/plant and two inoculation method VAM is inoculated when seeds are planted and inoculation when the seedlings are replanted. Each treatment was repeated 3 times and each unit consist of three plant, so there are 30 units of experiments or 90 plants. The main variabels are observed consist of the incubation periode of the disease and the intensity of fusarium wilt and the supporting variabels consist of pH, temperature, humidity, and the scale of infection. The mixed MVA 15 g/plant dosage inoculated when seeds are planted and 15 g/plant dosage inoculated when the seedlings are replanted is the most effective to suppress incubation period of Fusarium wilt disease.
Branham, Sandra E; Levi, Amnon; Katawczik, Melanie; Fei, Zhangjun; Wechter, W Patrick
2018-04-01
Four QTLs and an epistatic interaction were associated with disease severity in response to inoculation with Fusarium oxysporum f. sp. melonis race 1 in a recombinant inbred line population of melon. The USDA Cucumis melo inbred line, MR-1, harbors a wealth of alleles associated with resistance to several major diseases of melon, including powdery mildew, downy mildew, Alternaria leaf blight, and Fusarium wilt. MR-1 was crossed to an Israeli cultivar, Ananas Yok'neam, which is susceptible to all of these diseases, to generate a recombinant inbred line (RIL) population of 172 lines. In this study, the RIL population was genotyped to construct an ultra-dense genetic linkage map with 5663 binned SNPs anchored to the C. melo genome and exhibits the overall high quality of the assembly. The utility of the densely genotyped population was demonstrated through QTL mapping of a well-studied trait, resistance to Fusarium wilt caused by Fusarium oxysporum f. sp. melonis (Fom) race 1. A major QTL co-located with the previously validated resistance gene Fom-2. In addition, three minor QTLs and an epistatic interaction contributing to Fom race 1 resistance were identified. The MR-1 × AY RIL population provides a valuable resource for future QTL mapping studies and marker-assisted selection of disease resistance in melon.
Paris, Harry S; Janick, Jules; Daunay, Marie-Christine
2011-09-01
The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word 'gherkin' back to languages of the geographical nativity of C. sativus, the Indian
Cucurbits [Cucumber, melon, pumpkin and squash
The focus of this chapter is on the edible members of the Cucurbitaceae family. The three important food-grade cucurbit genera Citrullus, Cucumis, and Cucurbita include the species Citrullus lanatus watermelons), Cucumis melo (cantaloupes and other sweet melons), Cucumis sativa (cucumbers and pick...
Directory of Open Access Journals (Sweden)
Songxiao Cao
Full Text Available Lipoxygenases (LOXs are a class of non-heme iron-containing dioxygenases that catalyse oxidation of polyunsaturated fatty acids to produce hydroperoxidation that are in turn converted to oxylipins. Although multiple isoforms of LOXs have been detected in several plants, LOXs in oriental melon have not attracted much attention. Two full-length LOX cDNA clones, CmLOX10 and CmLOX13 which have been isolated from oriental melon (Cucumis melo var. makuwa Makino cultivar "Yumeiren", encode 902 and 906 amino acids, respectively. Bioinformatics analysis showed that CmLOX10 and CmLOX13 included all of the typical LOX domains and shared 58.11% identity at the amino acid level with each other. The phylogenetic analysis revealed that CmLOX10 and CmLOX13 were members of the type 2 13-LOX subgroup which are known to be involved in biotic and abiotic stress. Heterologous expression of the full-length CmLOX10 and truncated CmLOX13 in Escherichia coli revealed that the encoded exogenous proteins were identical to the predicted molecular weights and possessed the lipoxygenase activities. The purified CmLOX10 and CmLOX13 recombinant enzymes exhibited maximum activity at different temperature and pH and both had higher affinity for linoleic acid than linolenic acid. Chromatogram analysis of reaction products from the CmLOX10 and CmLOX13 enzyme reaction revealed that both enzymes produced 13S-hydroperoxides when linoleic acid was used as substrate. Furthermore, the subcellular localization analysis by transient expression of the two LOX fusion proteins in tobacco leaves showed that CmLOX10 and CmLOX13 proteins were located in plasma membrane and chloroplasts respectively. We propose that the two lipoxygenases may play different functions in oriental melon during plant growth and development.
Characteristics and composition of cucumis melo seed oil
International Nuclear Information System (INIS)
Mushtaq, S.; Batool, F.; Akhtar, T.; Tariq, M.I.
2011-01-01
A comprehensive characterization study was carried out on Cucumis melo seed oil, in order to evaluate its suitability as an edible vegetable oil. The oil was extracted by sohxlet apparatus using n-hexane as solvent that produced a yield of 47.33% (w/w). The oil was found to have light yellow colour and an agreeable odour, showing density up to 0.728 g/cm/sup 3/. The values of refractive index, iodine number and saponification number came out to be 1.466 (at 25 deg. C), 135.6 g/100 g and 301.6 mg KOH/100 g, respectively. GC-analysis gave total unsaturation content of 64.9% with linolenic acid (C18:3) being the predominant showing a proportion of 43.4%, followed by heptadecanoic acid (C17:0) with 23.1% and palmitic acid (C16:0) with 8.7%. The physicochemical properties of this oil are highly comparable to those of soybean and sunflower oils. Therefore, the test melon seed-oil could be developed into different commercial products to serve as an alternate vegetable oil in region like Pakistan, where this melon grows abundantly. (author)
Paris, Harry S.; Janick, Jules; Daunay, Marie-Christine
2011-01-01
Background The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. Findings The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word ‘gherkin’ back to languages of the geographical nativity of C
Directory of Open Access Journals (Sweden)
N.G. Muller
2013-01-01
Full Text Available O melão (Cucumis melo L. é uma fruta muito apreciada por suas qualidades e sua produção vem crescendo e ganhando espaço no mercado nacional e internacional. Em regiões como o Noroeste do Rio Grande do Sul, destaca-se como uma nova alternativa de renda para vários agricultores. Neste contexto, o presente trabalho teve como objetivo analisar o potencial fitoquímico de alguns cultivares de melão da região Noroeste do Rio Grande do Sul. A análise fitoquímica utilizando como farmacógeno as folhas, foi realizada para a verificação da presença de metabólitos secundários, tais como: saponinas, cumarinas, cardiotônicos, cianogenéticos, alcalóides, taninos, antraquinonas, flavonoides, e óleos voláteis. Também foi avaliado o teor de suco a partir dos frutos. Dentre os cinco cultivares analisados, Gaúcho, Imperial, Hy Mark, Magelan, e Cantaloupe, o cultivar Gaucho apresentou a maior variedade em metabólitos secundários. Na avaliação do teor de suco a cultivar Magelan se destacou em comparação às demais cultivares testadas.The melon (Cucumis melo L. is a fruit highly appreciated for its qualities and its production has been growing and gaining space in the national and in the international market. In regions like the northwest of Rio Grande do Sul - Brazil, it stands out as a new income alternative for farmers. In this context, this study aimed to analyze the phytochemical potential of some melon cultivars in the northwest region of Rio Grande do Sul. The phytochemical analysis, using the leaves as pharmacogen, was performed to verify the presence of secondary metabolites such as saponins, coumarins, cardiac glycosides, cyanogenetic glicosides, alkaloids, tannins, anthraquinones, flavonoids and volatile oils. The juice content from the fruits was also evaluated. Among the five analyzed cultivars, Gaucho, Imperial, Hy Mark, Magelan and Cantaloupe, cultivar Gaucho had the greatest variety of secondary metabolites. In the
Directory of Open Access Journals (Sweden)
Khoirul Bariyyah
2015-08-01
Full Text Available This research was addressed to study the effect of plant growth media composition and nutrients concentration on yield of Cucumis melo L. The research was designed in complete factorial test of 4x4 with three replicates. Mixed growth media of bokashi:cocopeat:husk charcoal were tested in four compositions, i.e. 90%:5%:5% (M1, 80%:10%:10%(M2, 70%:15%:15% (M3 and 60%:20%:20% (M4 respectively. The other tested factor was nutrients concentraion that consists of four levels, i.e. control/no nutrient given (K0, 2 g/L (K1, 4 g/L (K2 and 6 g/L (K3. The Action 434 variety of Cucumis melo L. seedlings were then transplanted into 10 kg’s polybag and allowed to grow till harvested. The results showed that Chlorophyll content of M1 plants were higher than others, but the highest sugar content was resulted by M3 plants, and the highest thick of flesh fruit was resulted by interaction 60% bokashi:20% cocopeat:20% husk charcoal with 4 g/L nutrient concentration.
Directory of Open Access Journals (Sweden)
Oksilia
2012-06-01
Full Text Available The objective of this research was to observe the physical and chemical characteristics of ice cream made with various formulations of Cucumis melo L. puree and soybean milk. The experiment was designed using Factorial Randomized Block Design with two treatments and each combination was replicated three times. The factors investigated were formulations of Cucumis melo L. puree (10, 12.5 and 15 % and soybean milk (40, 50 and 60%. The ice cream’s viscosity, overrun and melting time were determined, where as protein, fat and potassium content were analyzed. The results showed that the interaction of Cucumis melo L. puree and soybean milk formulation had significant effect on viscosity and overrun. Modified ice cream made with 12.5% Cucumis melo L. puree and 40% soybean milk was the best formula for producing modified ice cream. The resulted ice cream had viscosity of 1.03 cP, overrun 53.93% and melting time 23,58 minutes, while the protein, fat and potassium content were 5.18%, 70% and 1083.33 mg/L, respectively.
Agrobacterium mediated transformation of Tunisian Cucumis melo ...
African Journals Online (AJOL)
Transgenic Cucumis melo cv. Maazoun containing the neomycin phosphotransferase II (NPT II) chimeric gene conferring resistance to kanamycin were obtained from cotyledons explants inoculated with Agrobacterium tumefaciens (GV3101) that contained the binary vector plasmid pADI. Transformed shoots were obtained ...
Postharvest firmness behaviour of near-isogenic lines of melon
Tijskens, L.M.M.; Dos-Santos, N.; Jowkar, M.M.; Obando-Ulloa, J.M.; Moreno, E.; Schouten, R.E.; Monforte, A.J.; Fernández-Trujillo, J.P.
2009-01-01
In two consecutive seasons the firmness of 13¿15 near-isogenic lines (NILs) of melons (Cucumis melo L.) was followed during storage at 21 °C. Firmness was measured using non-destructive compression of whole melon fruit to a predefined compression distance of 2 mm. The same individuals (about 6 per
2011-01-01
Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L.) over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL) analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS). Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org), an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits) with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD) were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability observed for this trait in
Directory of Open Access Journals (Sweden)
Schaffer Arthur
2011-07-01
Full Text Available Abstract Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L. over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS. Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org, an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability
Sabnis, D D; Hart, J W
1976-01-01
Proteins in sieve tube exudate from Cucumis melo L., Cucumis sativus L. and Cucurbita maxima Duch. were analysed by gel electrophoresis and isoelectric focusing. Estimated molecular weights and isoelectric points for the major and minor proteins from each plant species are presented. Electrophoresis revealed striking differences between the protein complements of exudatc from the two genera investigated. Similarly, although a few exudate proteins from the two species of Cucumis possessed identical molecular weights, several major proteins were peculiar to each species. Isoelectric focusing of proteins in exudate samples from the three plants confirmed the marked differences in their protein complements. Furthermore, focusing also revealed differences between cultivars of Cucumis sativus. Both Cucumis sativus and Cucurbita maxima possessed relatively large amounts of basic proteins; these were absent in exudate from Cucumis melo. The implications of these results are discussed in relation to present concepts regarding the interrelationships and possible functional roles of P-proteins.
Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment
DEFF Research Database (Denmark)
Bernillon, Stéphane; Biais, Benoit; Deborde, Catherine
2013-01-01
Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non...
Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment
Bernillon, S.; Biais, B.; Deborde, C.; Maucort, M.; Cabasson, C.; Gibon, Y.; Hansen, T.; Husted, S.; Vos, de R.C.H.; Mumm, R.; Jonker, H.; Ward, J.L.; Miller, S.J.; Baker, J.M.; Burger, J.; Tadmor, Y.; Beale, M.H.; Schjoerring, J.K.; Schaffer, A.; Rolin, D.; Hall, R.D.; Moing, A.
2013-01-01
Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non-volatile
Switzenberg, Jessica A; Beaudry, Randy M; Grumet, Rebecca
2015-06-01
Ethylene is a key factor regulating sex expression in cucurbits. Commercial melons (Cucumis melo L.) are typically andromonoecious, producing male and bisexual flowers. Our prior greenhouse studies of transgenic melon plants expressing the dominant negative ethylene perception mutant gene, etr1-1, under control of the carpel- and nectary-primordia targeted CRAB'S CLAW (CRC) promoter showed increased number and earlier appearance of carpel-bearing flowers. To further investigate this phenomenon which could be potentially useful for earlier fruit production, we observed CRC::etr1-1 plants in the field for sex expression, fruit set, fruit development, and ripening. CRC::etr1-1 melon plants showed increased number of carpel-bearing open flowers on the main stem and earlier onset by 7-10 nodes. Additional phenotypes observed in the greenhouse and field were conversion of approximately 50% of bisexual buds to female, and elongated ovaries and fruits. Earlier and greater fruit set occurred on the transgenic plants. However, CRC::etr1-1 plants had greater abscission of young fruit, and smaller fruit, so that final yield (kg/plot) was equivalent to wild type. Earlier fruit set in line M5 was accompanied by earlier appearance of ripe fruit. Fruit from line M15 frequently did not exhibit external ripening processes of rind color change and abscission, but when cut open, the majority showed a ripe or overripe interior accompanied by elevated internal ethylene. The non-ripening external phenotype in M15 fruit corresponded with elevated etr1-1 transgene expression in the exocarp. These results provide insight into the role of ethylene perception in carpel-bearing flower production, fruit set, and ripening.
7 CFR 319.56-26 - Melon and watermelon from certain countries in South America.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Melon and watermelon from certain countries in South... and Vegetables § 319.56-26 Melon and watermelon from certain countries in South America. (a) Cantaloupe and watermelon from Ecuador. Cantaloupe (Cucumis melo) and watermelon (fruit) (Citrullus lanatus...
Sánchez, M.V.; Agüero, R.; Rivera, C.
1998-01-01
Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV) que infectan el cultivo de melón (Cucumis melo L.) para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, ...
Instrumental and sensory analyses of quality attributes of grafted specialty melons.
Guan, Wenjing; Zhao, Xin; Huber, Donald J; Sims, Charles A
2015-11-01
Soilborne disease management remains a great challenge in melon production with the phaseout of soil fumigant methyl bromide. Grafting has been shown to be an effective approach to control soilborne diseases. However, previous research has yielded mixed results regarding the impacts of rootstock on fruit quality. Very few studies have assessed melon quality attributes using both sensory evaluation and instrumental methods. Galia melon 'Arava' (Cucumis melo L. var. reticulatus Ser.) and honeydew melon 'Honey Yellow' (C. melo L. var. inodorus Naud.) were grafted onto commercial hybrid squash (Cucurbita maxima Duchesne × Cucurbita moschata Duchesne) rootstocks and root-knot nematode-resistant Cucumis metulifer E. Mey. ex Naud. rootstock. The grafting combinations were evaluated under different production conditions. Grafting with hybrid squash rootstocks resulted in reduced soluble solids content (SSC) and decreased sensory ratings of 'Arava' fruit. By contrast with grafted 'Arava', grafted 'Honey Yellow' did not exhibit significant differences in sensory properties and instrumental measurements regardless of production conditions and rootstock selection. The effects of grafting on fruit quality attributes differed between the two distinctive types of melon scion used. Potential negative impacts of rootstocks on melon fruit quality need to be considered in the selection and use of disease-resistant rootstocks. © 2014 Society of Chemical Industry.
The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo
Latrasse, David; Rodriguez-Granados, Natalia Y.; Veluchamy, Alaguraj; Mariappan, Kiruthiga Gayathri; Bevilacqua, Claudia; Crapart, Nicolas; Camps, Celine; Sommard, Vivien; Raynaud, Cé cile; Dogimont, Catherine; Boualem, Adnane; Benhamed, Moussa; Bendahmane, Abdelhafid
2017-01-01
BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.
The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo
Latrasse, David
2017-05-08
BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.
Protection of melon plants against Cucumber mosaic virus infection ...
African Journals Online (AJOL)
This study was carried out to characterize a virus causing severe mosaic, yellowing, stunting and leaf deformation on melon (Cucumis melo L.), and evaluate the capacity of Pseudomonas fluorescens as biofertilizer to improve plant growth and restrict the accumulation of the virus in the plant. The virus was identified as an ...
REQUERIMENTOS DE POLINIZAÇÃO DO MELOEIRO (Cucumis melo l. NO MUNICÍPIO DE ACARAÚ - CE - BRASIL
Directory of Open Access Journals (Sweden)
Raimundo Maciel Sousa
2009-01-01
Full Text Available This work was carried in commercial areas cultivate with muskmelon (Cucumis melo L., variety AF- 646, in the municipal district of Acaraú, state of Ceará, Brazil. The investigation was split in four treatments: hand cross pollination, open pollination in presence of the honey bee hives, open pollination and resricted pollination. The observed variables were: rate of fruit set, fruit weight and seed number of fruits. The hand cross pollination showed the best effect to number of fruit set, fruit weight and seed number of fruits, following to open pollination in presence of the honey bee hives, open pollination and resricted pollination, without fruit set. Considering the melon cultivated at open fields and during the dry season in NE Brazil, it is possible to conclude that it depends on biotic pollinators and that honeybees promote efficientily the pollination.
Directory of Open Access Journals (Sweden)
Mojtaba Sankian
2014-05-01
Full Text Available Background: Melon (Cucumis melo allergy is one of the most common food allergies, characterized by oral allergy syndrome. To date, two allergen molecules, Cuc m 1 and Cuc m 2, have been fully characterized in melon pulp, but there are few reports about the molecular characteristics of Cuc m 3. Methods:The Cuc m 3 cDNA has been characterized by rapid amplification of cDNA ends (RACE, which revealed a 456 base-pair (bp fragment encoding a 151-amino acid polypeptide with a predicted molecular mass of 16.97 kDa, and identified 79 and 178 bp untranslated sequences at the 5′ and 3´ ends, respectively. Results: In silico analysis showed strong similarities between Cuc m 3 and other plant pathogen-related protein 1s from cucumber, grape, bell pepper, and tomato. Conclusion: Here we report the identification and characterization of the Cuc m 3 cDNA, which will be utilized for further analyses of structural and allergenic features of this allergen
Directory of Open Access Journals (Sweden)
Ana Amiroh
2016-12-01
Full Text Available Recently, most cultivation and planting of Melon (Cucumis melo L. by farmers using inorganic fertilizers with an excessive dosage, and this causes the lowland productivity decrease with consequent. The soil organic matter decreased as low as time increasing. Application and using of mature organic matter are an alternative to solve these problems in order the lowland become more conducive and productive for growth of melon. But increasing pests and diseases attaching to the plants may caused by adding immature organic matters into soil. Sources to make bokashi like as paddy straw and water hyacinth is immense but it’s not yet used. This research was aimed to study, know and usage of paddy straw and water hyacinth bokashi’s on melon growing at lowland. Experiment was conducted at Lowland Experiment Station of Agricultural Faculty, Brawijaya, in Jatikerto Village, Kromengan Distric, Malang, from April-June 2015. Experiment was applied in a Randomized Block Design (RBD with double factors Types and Dosages of Bokashis. There is seven combinations of treatment with three replications, each treatment consisted four individual plants. Result showed there is significant difference between types and dosages of bokashi on plant length at 28, 35, 42 dan 49 days after planting (d,a,p respectively. The significant difference between treatment also shown by leaf area at 28 - 49 (d.a.p.. Application of paddy straw bokashi was better than hyacinth bokashi on melon growth. The best yield shows that by using paddy straw bokashi with 5 ton/ha of dosage gives melon with 2,56 kg /plant fresh weight.
Belles Albert, José Mª; López-Gresa, María Pilar; Fayos, J.; Pallás Benet, Vicente; Rodrigo Bravo, Ismael; Conejero Tomás, Vicente
2008-01-01
[EN] In the present work, we have looked for the nature of the phenylpropanoids biosynthesized during the plant-pathogen reaction of two systems, Cucumis sativus and Cucumis melo infected with either prunus necrotic ringspot virus (PNRSV) or melon necrotic spot virus (MNSV), respectively. An accumulation of p-coumaric, caffeic and/or ferulic acids was observed in infected plant extracts hydrolysed with P-glucosidase or esterase. Analysis of undigested samples by HPLC/ESI revealed that these c...
Directory of Open Access Journals (Sweden)
SIMONE DE SOUZA MACÊDO
2017-01-01
Full Text Available The aim of this work was to perform botanical identification and to estimate genetic diversity in two sequential inbred generations (progenies S1 and S2 of melon accessions from traditional agriculture in the state of Maranhão, in order to generate useful information for commercial melon breeding. Two field experiments were carried out in a completely randomized block, using four replicates of 15 accessions from a first selfing cycle in 2013, and three replicates of 25 subaccessions (generation S2 in 2014. Flower and fruit descriptors were measured to obtain quantitative and qualitative data, in addition to a systematized photographic documentation of fruit for visually comparing the progenies S1 and S2. Distance matrices for quantitative and qualitative data were obtained and used to perform a joint analysis and UPGMA method. Large genetic diversity was found in the accessions analysed, since the presence of melon progenies was observed in the Cucumis melo ssp. agrestis, with its botanical varieties momordica and conomom, and of the Cucumis melo ssp. melo, with the botanical varieties cantalupensis and chandalak. Divergence analysis showed the formation of three groups in generation S1 and four groups in S2. However, the groups were not separated either by subspecies or by botanical variety. Thus, in addition to the large genetic diversity among and within melon accessions from family farming in the state of Maranhão, the progenies presented a large introgression of traits of the different subspecies and their botanical varieties due to the reproductive system and seed management of these species.
Directory of Open Access Journals (Sweden)
Flavia Paiva Coutinho
2010-03-01
Full Text Available Rhizosphere soil samples were collected in a semiarid area, in the region of the São Francisco River valley, Petrolina, Pernambuco state, Brazil, to study the diversity of filamentous fungi in a soil cultivated with melon (Cucumis melo L. cv. Gold Mine and receiving different organic amendments: Treatment 1 (control, without organic compost; T2 (77% coconut fiber, 20% goat manure and 3% K2SO4; T3 (10% Ricinus communis leaves and stems, 50% Pennisetum purpureum leaves and 40% goat manure; T4 (77% coconut fiber, 20% goat manure and 3% termophosphate; T5 (47% Pennisetum purpureum leaves, 50% goat manure and 3% K2SO4; and T6 (57% Pennisetum purpureum leaves, 40% goat manure and 3% termophosphate. Fungal isolation was carried out by the serial dilution technique to 1:1000. The Sorensen index of similarity, frequency and distribution of the fungi were evaluated. Seventy-eight species of filamentous fungi were isolated and identified, plus several Basidiomycota (04 and Mycelia sterilia (02. The predominant genera were Aspergillus and Penicillium, with 15 and 13 species, respectively. A greater number of species was found in the sowing period (49, and in relation to the organic fertilization, treatment 6 provided the greatest species diversity (43 species. Most of the species are saprobes and only a few are considered to be potential pathogens on melon plants, such as Fusarium oxysporum, F. solani and Myrothecium roridum.Foram coletadas amostras de solo rizosférico em uma área semiárida, na região do Vale do São Francisco, Petrolina, Pernambuco, Brasil, com o objetivo de conhecer a diversidade dos fungos filamentosos presentes em solo cultivado com melão (Cucumis melo cv. Gold Mine e adubado com diferentes compostos orgânicos: Tratamento 1 (controle, sem adição de compostos orgânicos; T2 (77% de bagaço de côco, 20% de esterco de caprino e 3% de K2SO4; T3 (10% de torta de mamona, 50% de capim elefante e 40% de esterco de caprino; T4 (77% de
Solmaz, Ilknur; Kacar, Yildiz Aka; Simsek, Ozhan; Sari, Nebahat
2016-08-01
Snake melon is an important cucurbit crop especially in the Southeastern and the Mediterranean region of Turkey. It is consumed as fresh or pickled. The production is mainly done with the local landraces in the country. Turkey is one of the secondary diversification centers of melon and possesses valuable genetic resources which have different morphological characteristics in case of snake melon. Genetic diversity of snake melon genotypes collected from different regions of Turkey and reference genotypes obtained from World Melon Gene Bank in Avignon-France was examined using 13 simple sequence repeat (SSR) markers. A total of 69 alleles were detected, with an average of 5.31 alleles per locus. The polymorphism information content of SSR markers ranged from 0.19 to 0.57 (average 0.38). Based on cluster analysis, two major groups were defined. The first major group included only one accession (61), while the rest of all accessions grouped in the second major group and separated into different sub-clusters. Based on SSR markers, cluster analysis indicated that considerably high genetic variability exists among the examined accessions; however, Turkish snake melon accessions were grouped together with the reference snake melon accessions.
Directory of Open Access Journals (Sweden)
Aydemir BARIŞ
2016-06-01
Full Text Available Melon fly [Myiopardalis pardalina (Bigot, 1891 (Diptera: Tephritidae] is the most important pest of the melons (Cucumis melo L. (Cucurbitaceae: Cucurbitales. The larvae cause to damage by feeding in seed cavity. Also, the tissues damaged by larvae turn brown and occurring scent spread in melon. This study aims to determine change in the taste of melon tissues damaged by larvae for the first time in Turkey. For this purpose, Kırkağaç and İpsala variety melons widely utilized in the province Ankara were selected in this study. Fruit taste (points, water-soluble dry matter, titratable acidity (TA and pH measurements were included in analysis of melon. Statistical differences were determined in Kırkağaç melon with melon fly with respect to control in terms of all of the features discussed in the fruit analysis. A statistically significant difference was observed compared to the control in the other measurements excluding the only titratable acidity in İpsala melon with melon fly.
Directory of Open Access Journals (Sweden)
Auri Brackmann
2006-08-01
Full Text Available Este experimento teve por objetivos avaliar a permeabilidade de filmes de polietileno de diferentes espessuras e densidades ao O2 e ao CO2, a composição gasosa (O2, CO2 e etileno formada no interior das embalagens e a qualidade físico-química de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos no sistema hidropônico "Nutrient Film Technique" (NFT e armazenados em embalagens de polietileno. Os tratamentos avaliados foram: (1 armazenamento refrigerado (sem uso de filme; (2 polietileno de baixa densidade (PEBD de 40µm; (3 PEBD de 60µm; (4 PEBD de 90µm; (5 polietileno de média densidade (PEMD de 40µm; (6 PEMD de 60µm. Os frutos permaneceram armazenados durante 25 dias a 3,8±0,2°C e por mais dois dias a 20°C. Os filmes de PEBD de 60 e 90µm e o PEMD de 60µm apresentaram menor permeabilidade ao CO2, mantendo as maiores concentrações de CO2 nas embalagens. O filme de PEBD de 90µm apresentou menor permeabilidade ao O2. A menor concentração de etileno foi obtida com o uso de PEBD de 40µm. O uso de filmes reduziu drasticamente a perda de massa dos frutos, quando comparados aos frutos não embalados. Os frutos acondicionados na embalagem de PEBD de 40µm mantiveram uma maior firmeza da polpa após o período de armazenamento, não diferindo estatisticamente dos frutos armazenados em PEMD de 40µm. Já a incidência de podridões foi significativamente menor nos frutos armazenados em PEMD de 60µm. De modo geral, os filmes avaliados mantêm semelhante a qualidade físico-química de melões híbrido Torreon produzidos hidroponicamente no sistema NFT.This study was carried out to evaluate the permeability to O2 and CO2, and gas composition (O2, CO2 and ethylene inside packages of different thickness and density polyethylene films. Moreover, the physical and chemical quality of Torreon hybrid melon fruit (Cucumis melo L. var. cantalupensis Naud. grown in a Nutrient Film Technique hydroponic system and stored
Controlling fusarium wilt disease in melon(cucumis melo L.) using tilllered onion bulb extract
International Nuclear Information System (INIS)
Yushu, Z.; Guo, Q.; Xuezheng, W.; Yanan, Z.; Yuting, Li.
2017-01-01
Melon wilt disease is a soil-borne disease caused by Fusarium oxysporum f. sp. niveum. This disease incur of the heavy economic loss in melon crops. To decrease damage to melons, many control methods have been developed. However, many of the current control methods have limitations and disadvantages. For example, fungicides may cause health concerns for both humans and the environment due to high toxin content and the presence of residues. Therefore, biological control methods that reduce or eliminate the risk of environmental contamination and threats to human health are urgently needed to solve these issues and to protect melon crops from wilt disease.In this research, we assessed the efficacy of tillered onion bulb extract (TOE) for biocontrol of melon wilt disease in melon. Different concentrations of the TOE have been shown to have inhibitory effects on Fusariumspore germination and growth, pathogenic bacterial biomass, and fungal sporulation, with increased inhibitory effects at higher TOE concentrations. In melon wilt disease, concentrations of TOE greater than 250 mg/mL produced the highest protective effects in both susceptible and resistant melon cultivars. The disease index in resistant varieties was 18%, and the disease control effect was 63.51%, while the disease index in susceptible varieties was 21.41%, and the disease control effect reached 65.96%. These values indicate stronger control effects than those achieved using 40% Ning WP melon blight. High concentrations (over 500 mg/mL) of TOE had strong inhibitory effects on melon seed germination and the activity of protective enzymes in melon cultivars. (author)
Caractéristiques physiques de la production du melon cantaloup Cucumis melo L., cultivé sous serre
Directory of Open Access Journals (Sweden)
Hannachi, C.
1994-01-01
Full Text Available Physical Characteristics Of Muskmelon Production, Cucumis melo L., Cultivated Under Greenhouse- Tunisia. Seven varieties of cantaloup muskmelon (Pancha, Sugdor, Supersprint, F^6802, Gallicum, Polidor, Pallas were cultivated in plastic house and tested for yield and fruit quality (fruit weight, index of refraction, thickness of flesh. Supersprint, Pancha and Sugdor were the more productive varieties. Their early yield represents 61 %, 62 %> and 53 %> of total yield : 4, 2 ; 5, 2 and 5, 7 kg/m2 respectively. Fruits had a commercial weight of more than 500 g and an acceptable gustative quality ; IR> 10. Fruit weight was positively correlated with viable seed number (pancha : IR was appreciated for Pancha, Sugdor and F^802 (IR> 12. The flesh of these three varieties was well developped, and it was probably influenced by the important seed number (523-610 seeds/fruit. It was 3 cm wide and 6 times as thick as the cortex (0, 5 cm. Pancha was significantly distinguished from others by the fruit number (6 fruits/plant. The introduction of honey bees may improve pollination of flowers and allowed to exploit better its potentialities.
A conserved ethylene biosynthesis enzyme leads to andromonoecy in two cucumis species.
Directory of Open Access Journals (Sweden)
Adnane Boualem
Cucumis sativus (cucumber and Cucumis melo (melon that have diverged over 40 My ago. The isolation of the genes for andromonoecy in Cucumis species provides a molecular basis for understanding how sexual systems arise and are maintained within and between species.
The Effect of Microwave Radiation on Prickly Paddy Melon (Cucumis myriocarpus
Directory of Open Access Journals (Sweden)
Graham Brodie
2012-01-01
Full Text Available The growing list of herbicide-resistant biotypes and environmental concerns about chemical use has prompted interest in alternative methods of managing weeds. This study explored the effect of microwave energy on paddy melon (Cucumis myriocarpus plants, fruits, and seeds. Microwave treatment killed paddy melon plants and seeds. Stem rupture due to internal steam explosions often occurred after the first few seconds of microwave treatment when a small aperture antenna was used to apply the microwave energy. The half lethal microwave energy dose for plants was 145 J/cm2; however, a dose of at least 422 J/cm2 was needed to kill seeds. This study demonstrated that a strategic burst of intense microwave energy, focused onto the stem of the plant is as effective as applying microwave energy to the whole plant, but uses much less energy.
Cantaloupe melon ( Cucumis melo L. conservation using hydrocooling
Directory of Open Access Journals (Sweden)
Edna Maria Mendes Aroucha
2016-04-01
Full Text Available ABSTRACT Maintaining cantaloupe melon at field temperature impairs conservation as it speeds up cell metabolism and transpiration, and, consequently, reduces shelf life. This study aimed to evaluate the conservation of Torreon hybrid cantaloupe using the hydrocooling treatment. Fruits were harvested at the commercial maturity stage (60 days after planting, in the morning, at the Nova California Farm, municipality of Mossoró-RN, in September 2007. One set of fruit was immersed in chilled water at 5 ºC for 5 min, at the packing house, while the remaining set was not hydro cooled. Then, both sets (treated and untreated with hydrocooling were pre-cooled in air forced tunnels at 7 ºC, until the temperature in the pulp reached 10 ºC. Both fruit sets were stored for 0, 14, 21, 28 and 35 days under modified atmosphere at 3 ± 1 oC and 90 ± 5% RH. After each storage period, the fruits were incubated in an atmosphere-controlled chamber at 20 ± 2 oC and 80 ± 5% de RH, for seven days. The following characteristics were evaluated: external and internal appearance, mass loss, soluble solids, firmness and titrable acidity. The experiment was arranged in a completely randomized split-plot design with four replications of three fruits. The plots consisted of the hydrocooling conditions (with and without fruit soaking in chilled water, and the sub-plots consisted of the storage times (0, 14, 21, 28 and 35 days.The treatment with hydrocooling was efficient in keeping the firmness and soluble solids of the fruits and shortened the pre-cooling time in the cooling tunnel. However, hydrocooling did not increase fruit shelf-life.
International Nuclear Information System (INIS)
Villegas Ocampo, A.
2002-01-01
The fertilizer injection through irrigation system is a common practice in second melon sowings. Nevertheless, the application of some phosphoric sources by that way can have problems due to the absorption reactions and precipitation in the ground, which reduces its mobility and assimilation by the plants. Phosphoric sources of fertirrigation to diverse doses, were evaluated in melon (Cucusmis melo L.) Cantaloupe cv Hy Mark in second sowings, about the phosphoric absorption and the fruit commercial production , (b) the content of soluble P in the solution of the ground, to correlate this with the optimal production and thus obtain the external requirement of P and (c) to quantify the economic costs of the application of the different sources. The experiment took place in the ground of the Inceptisol order, sub-group Vertic Haplustepts in Carrillo, Guanacaste, in the property Melones de Sardinal S.A. The used sources of P2O5 were: Map(12-60-0) in doses of 36 and 54 kg/ha, H3PO4 to 36kg/ha and Fertg (8-24-0) in doses of 18 and 36 kg/ha. Besides, establishing in absolute witness 0 kg/ha. The melon redeeming was evaluated in number of cajas/ha, sizes 9, 12, 15 and 18. According to the dry weight and the nourishment concentration of the aerial biomass of each sample, the absorption of nourishment in the cultivation in kg/ha and g/ha was calculated, for a sowing density of 12940 plantas/ha. The external efficiency of phosphorus for melon with the different sources was determined, for getting this were made applications of progressively increasing doses of P. The dose of phosphorus to reach that requirement (concentration of P in the solution of the ground that is necessary for an optimal yield), in the balance point it's obtained by means of interpolation of the dose of P through the isotherm and the correlation of the optimal yield of the cultivation. The greater absorption of P took place in the stage of previous growth to the flowering and in the beginning and arrival
Marker-assisted selection of Fusarium wilt-resistant and gynoecious melon (Cucumis melo L.).
Gao, P; Liu, S; Zhu, Q L; Luan, F S
2015-12-08
In this study, molecular markers were designed based on the sex determination genes ACS7 (A) and WIP1 (G) and the domain in the Fusarium oxysporum-resistant gene Fom-2 (F) in order to achieve selection of F. oxysporum-resistant gynoecious melon plants. Markers of A and F are cleaved amplified polymorphic sequences that distinguish alleles according to restriction analysis. Twenty F1 and 1863 F2 plants derived from the crosses between the gynoecious line WI998 and the Fusarium wilt-resistant line MR-1 were genotyped based on the markers. The results showed that the polymerase chain reaction and enzyme digestion results could be effectively used to identify plants with the AAggFF genotype in F2 populations. In the F2 population, 35 gynoecious wilt-resistant plants were selected by marker-assisted selection and were confirmed by disease infection assays, demonstrating that these markers can be used in breeding to select F. oxysporum-resistant gynoecious melon plants.
High-quality total RNA isolation from melon (Cucumis melo L. fruits rich in polysaccharides
Directory of Open Access Journals (Sweden)
Gabrielle Silveira de Campos
2017-08-01
Full Text Available Melon, a member of the family Cucurbitaceae, is the fourth most important fruit in the world market and, on a volume basis, is Brazil’s main fresh fruit export. Many molecular techniques used to understand the maturation of these fruits require high concentrations of highly purified RNA. However, melons are rich in polyphenolic compounds and polysaccharides, which interfere with RNA extraction. This study aimed to determine the most appropriate method for total RNA extraction from melon fruits. Six extraction buffers were tested: T1 guanidine thiocyanate/phenol/chloroform; T2 sodium azide/?-mercaptoethanol; T3 phenol/guanidine thiocyanate; T4 CTAB/PVP/?-mercaptoethanol; T5 SDS/sodium perchlorate/PVP/?-mercaptoethanol, and T6 sarkosyl/PVP/guanidine thiocyanate, using the AxyPrepTM Multisource Total RNA Miniprep Kit. The best method for extracting RNA from both mature and green fruit was based on the SDS/PVP/?-mercaptoethanol buffer, because it rapidly generated a high quality and quantity of material. In general, higher amounts of RNA were obtained from green than mature fruits, probably due to the lower concentration of polysaccharides and water. The purified material can be used as a template in molecular techniques, such as microarrays, RT-PCR, and in the construction of cDNA and RNA-seq data.
DEFF Research Database (Denmark)
Pateraki, Irene; Sanmartin, Maite; Kalamaki, Mary S.
2004-01-01
of a GalLDH full-length cDNA from melon (Cucumis melo L.) are described. Melon genomic DNA Southern analysis indicated that CmGalLDH was encoded by a single gene. CmGalLDH mRNA accumulation was detected in all tissues studied, but differentially expressed during fruit development and seed germination....... It is hypothesized that induction of CmGalLDH gene expression in ripening melon fruit contributes to parallel increases in the AA content and so playing a role in the oxidative ripening process. Higher CmGalLDH message abundance in light-grown seedlings compared with those raised in the dark suggests that Cm......GalLDH expression is regulated by light. Finally, various stresses and growth regulators resulted in no significant change in steady state levels of CmGalLDH mRNA in 20-d-old melon seedlings. To the authors' knowledge, this is the first report of GalLDH transcript induction in seed germination and differential gene...
DNA fingerprinting of Chinese melon provides evidentiary support of seed quality appraisal.
Gao, Peng; Ma, Hongyan; Luan, Feishi; Song, Haibin
2012-01-01
Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs) are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines). Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC) were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines) were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR) codes of 471 melon varieties (lines) were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications.
DNA Fingerprinting of Chinese Melon Provides Evidentiary Support of Seed Quality Appraisal
Gao, Peng; Ma, Hongyan; Luan, Feishi; Song, Haibin
2012-01-01
Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs) are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines). Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC) were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines) were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR) codes of 471 melon varieties (lines) were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications. PMID:23285039
DNA fingerprinting of Chinese melon provides evidentiary support of seed quality appraisal.
Directory of Open Access Journals (Sweden)
Peng Gao
Full Text Available Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines. Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR codes of 471 melon varieties (lines were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications.
Directory of Open Access Journals (Sweden)
Ricardo Fabiano Hettwer Giehl
2008-04-01
Full Text Available Objetivou-se neste trabalho avaliar o crescimento e as mudanças físico-químicos durante a maturação de melões (Cucumis melo var. cantalupensis Naud., híbrido Torreon. As plantas foram cultivadas no sistema hidropônico NFT ("Nutrient Film Technique", em Santa Maria, RS, durante o período de janeiro a abril. Diariamente, foram marcadas as flores pistiladas em antese, anotando-se a data desse evento. Foram efetuadas as medidas lineares do diâmetro longitudinal e transversal dos frutos a cada três dias, iniciando-se após a antese. A partir dos 25 dias após a antese (DAA, realizou-se, a cada três dias, a colheita de 10 frutos, aleatoriamente. Foram analisados os parâmetros: síntese de etileno, respiração, firmeza da polpa, teor de sólidos solúveis totais, acidez total titulável e coloração da polpa. O aumento no diâmetro longitudinal e transversal dos frutos ocorreu até aproximadamente os 26-29 DAA. A partir desse momento, iniciou-se o processo de maturação dos frutos. Nessa fase, verificou-se intenso incremento na síntese de etileno, com pico aos 37 DAA (44 ± 4,6mL kg-1 h-1, o que culminou no aumento da respiração e na diminuição da acidez total titulável e da firmeza de polpa. Além disso, a cor da polpa dos frutos tornou-se gradativamente mais vermelha. Os frutos desprenderam da planta aproximadamente aos 37 DAA, quando apresentaram uma média de 10,5°Brix de sólidos solúveis totais.This research had the aim of evaluating the physicochemical growth and changes during maturation of hybrid Torreon melons (Cucumis melo var. cantalupensis Naud.. Melon plants were cultivated in the NFT (Nutrient Film Technique hidroponic system from January to April 2004 in Santa Maria, RS, Brazil. Flowers in anthesis were daily tagged and linear measures of longitudinal and transverse diameter were made at a 3-day interval, beginning at anthesis. Starting from 25 days after anthesis (DAA, 10 fruits were randomly harvested each 3
Ibrahim, Doaa S
2017-02-01
The central nervous system is one of the most vulnerable organs affected by the oxidative stress associated with diabetes mellitus. Healthy food provides an important source for antioxidants. Therefore, the protective effect of Cucumis melo var. flexuosus (C. melo var. flexuosus) leaf extract on the brains of diabetic rats was investigated. Adult male albino rats divided into 5 groups of 6 rats each were assigned into a normal control group and four diabetic groups. Diabetes was induced in rats by a single intraperitoneal injection of streptozotocin (STZ; 60 mg/kg bw). One of the four diabetic groups was left untreated and was considered as a diabetic control group while the three other groups were treated with C. melo var. flexuosus leaf extract at the doses of 30, 60 and 120 mg/kg bw for a period of 30 days. After completion of experimental duration plasma and brains were used for evaluating biochemical changes. The obtained data showed that C. melo var. flexuosus leaf extract treatment lowered blood glucose, glycated hemoglobin, brain tumor necrosis factor-alpha, interleukin levels, brain malondialdehyde content and caspase-3 activity. Furthermore, the treatment resulted in a marked increase in plasma dopamine, melatonin, brain vascular endothelial growth factor-A levels, brain catalase and superoxide dismutase activities. From the present study, it can be concluded that the C. melo var. flexuosus leaf extract exerts a neuroprotective effect against oxidative damage associated with diabetes.
Biological effects and application of proton beam (H+) implantation on melon seeds
International Nuclear Information System (INIS)
Sun Xun; Ren Ruixing; Meng Hui; Shi Jinguo; Tang Zhangxiong; Tao Xianping
2006-01-01
Various doses and energy of the proton beam (H + ) were used to treat dry seeds of melon (Cucumis melo L.). Results show that, the proton beam irradiation can induced structural variations of chromosomes and abnormal behaviors during mitosis and meiosis. The percentage of cells with chromosomal aberration increased with the increment of energy and dose of the proton. The micronuclei, chromosomal bridge and chromosomal fragments were included in chromosomal aberration. The proton beam was effective in inducing mutants of early maturity. A early maturity line T 63-1-17-8-1-3 was selected from the progenies of the seeds treated with the proton beam. (authors)
Directory of Open Access Journals (Sweden)
Juan Carlos Di Trani de la Hoz
2007-06-01
Full Text Available Se observaron las visitas observadas a flores seleccionadas en un cultivo del Distrito de San Lorenzo, Chiriquí, del 6 de Enero y el 19 de Febrero del 2002, desde las 6:30 am hasta las 4:30 pm, y se anotaron características de las visita, como el tiempo de visita y el tipo de recurso colectado. Las visitas fueron mayormente para la recolección de néctar (casi 3/4. La recolección de polen se concentró hacia las primeras horas de la mañana, cesando definitivamente a las 11:00 am. El tiempo medio de recolección fue similar para ambos recursos, pero fue marcadamente distinto para cada sexo floral. Las visitas a flores femeninas fueron significativamente (Prueba t Student, pBee (Apis mellifera, Hymenoptera: Apoidea visitation to cantaloupe Cucumis melo (Cucurvitaceae flowers in Panama. Flower visits by bees were observed in a melon cultivated field of San Lorenzo district, in Chiriquí, Panama, from January 6 to February 19, 2002, from 6:30 am to 4:30 pm We recorded the duration of each foraging event and the type of resource collected. Flower visits were mostly for nectar collection (∼75 %. Pollen foraging was concentrated in the first hours of the morning and ended by 11:00 am The mean collection time was similar for both food resources, but was different between flower sexes. Flower visits to female flowers took longer (Student's t test, p<0.0001, with a mean time duration of 8.4±4.4 s, whereas in male flowers mean visitation time was of 4.0±1.5 s. Finally, the mean time for each floral sex remained practically constant through the evolution of the crop. Our results were similar to the found ones in temperate zone crops, so apparently tropical conditions of Panama do not change the bee visit patterns on melon flowers. Rev. Biol. Trop. 55 (2: 677-680. Epub 2007 June, 29.
Sensory and quality analysis of different melon cultivars after prolonged storage.
Hoberg, Edelgard; Ulrich, Detlef; Schulz, Hartwig; Tuvia-Alkali, Sharon; Fallik, Elazar
2003-10-01
The purpose of this work was to evaluate the sensory and general quality of four different melon cultivars (Cucumis melo L.) immediately after harvest and at the end of storage and marketing simulation. After 16 days of storage at 5 degrees C and additional 3 days at 20 degrees C, only cultivar 'C-8' had a poor general appearance due to significant low firmness and relatively high decay incidence compared to the cultivars '5080', 'Ideal' and '7302'. The cultivar '7302' was found to have the higher overall quality. The human-sensory and organoleptic analyses revealed that the cultivars can be differentiated on the basis of retronasal odour. The texture of the melons seems to be dependent on the genotype. All the complex perceptions analysed in this work contribute to the acceptability, which is in the fresh fruits of '7302' the best and in 'Ideal' the worst. After storage and marketing simulation 'Ideal' and 'C-8' are no longer favoured, but '5080' and '7302', despite different characters, were found to be similarly accepted. It can be concluded that with the aid of the human-sensory method developed to characterize the melon varieties it is possible to distinguish the different genotypes.
Shankar, Kripa; Singh, Sumit K; Kumar, Durgesh; Varshney, Salil; Gupta, Abhishek; Rajan, Sujith; Srivastava, Ankita; Beg, Muheeb; Srivastava, Anurag Kumar; Kanojiya, Sanjeev; Mishra, Dipak K; Gaikwad, Anil N
2015-10-01
Cucumis melo ssp. agrestis var. agrestis (CMA) is a wild variety of C. melo. This study aimed to explore anti-dyslipidemic and anti-adipogenic potential of CMA. For initial anti-dyslipidemic and antihyperglycemic potential of CMA fruit extract (CMFE), male Syrian golden hamsters were fed a chow or high-fat diet with or without CMFE (100 mg/kg). Further, we did fractionation of this CMFE into two fractions namely; CMA water fraction (CMWF) and CMA hexane fraction (CMHF). Phytochemical screening was done with liquid chromatography-mass spectrometry LC- (MS)/MS and direct analysis in real time-MS to detect active compounds in the fractions. Further, high-fat diet fed dyslipidemic hamsters were treated with CMWF and CMHF at 50 mg/kg for 7 days. Oral administration of CMFE and both fractions (CMWF and CMHF) reduced the total cholesterol, triglycerides, low-density lipoprotein cholesterol, and very low-density lipoprotein-cholesterol levels in high fat diet-fed dyslipidemic hamsters. CMHF also modulated expression of genes involved in lipogenesis, lipid metabolism, and reverse cholesterol transport. Standard biochemical diagnostic tests suggested that neither of fractions causes any toxicity to hamster liver or kidneys. CMFE and CMHF also decreased oil-red-O accumulation in 3T3-L1 adipocytes. Based on these results, it is concluded that CMA possesses anti-dyslipidemic and anti-hyperglycemic activity along with the anti-adipogenic activity. The oral administration of Cucumis melo agrestis fruit extract (CMFE) and its fractions (CMWF and CMHF) improved serum lipid profile in HFD fed dyslipidemic hamsters.CMFE, CMWF and CMHF significantly attenuated body weight gain and eWAT hypertrophy.The CMHF decreased lipogenesis in both liver and adipose tissue.CMFE and CMHF also inhibited adipogenesis in 3T3-L1 adipocytes. Abbreviation used: CMA: Cucumis melo ssp. agrestis var. agrestis, CMFE: CMA fruit extract, CMWF: CMA water fraction, CMHF: CMA hexane fraction, FAS: Fatty acid
Cultivation and uses of cucurbits
Cultivated cucurbits have spread through trade and exploration from their respective Old and New World centers of origin to the six arable continents and are important in local, regional and world trade. Cucumber (Cucumis sativus L.), melon (Cucumis melo L.), pumpkin, squash and gourd (Cucurbita spp...
Volatile emerging contaminants in melon fruits, analysed by HS-SPME-GC-MS.
Cincotta, Fabrizio; Verzera, Antonella; Tripodi, Gianluca; Condurso, Concetta
2018-03-01
The aim of this research was to develop and validate a headspace-solid phase micro-extraction-gas chromatography-mass spectrometry (HS-SPME-GC-MS) method for the determination of volatile emerging contaminants in fruit. The method showed good precision (RSD ≤ 14%) and satisfactory recoveries (99.1-101.7%) and LOD and LOQ values ranging between 0.011-0.033 μg kg -1 and 0.037-0.098 μg kg -1 , respectively. The method was applied to investigate the content of volatile emerging contaminants in two varieties of melon fruit (Cucumis melo L.) cultivated adjoining high-risk areas. Glycol ethers, BHT, BHA and BTEX (benzene, toluene, ethylbenzene and xylene) were determined in melon fruit pulps for the first time, with different sensitivities depending on sample and variety. Although the amount of the volatile contaminants in the melon samples were in the order of µg kg -1 , the safety of vegetable crops cultivated near risk areas should be more widely considered. The results showed that this accurate and reproducible method can be useful for routine safety control of fruits and vegetables.
Esteban-Cuesta, Irene; Drees, Nathalie; Ulrich, Sebastian; Stauch, Peter; Sperner, Brigitte; Schwaiger, Karin; Gareis, Manfred; Gottschalk, Christoph
2018-03-31
Fruits and vegetables have increasingly been related to foodborne outbreaks. Besides surface contamination, a possible internalization of microorganisms into edible parts of plants during growth has already been observed. To examine an actual risk for the consumer, microbial contamination of the rind and pulp of 147 muskmelons from international trade was assessed using cultural and biochemical methods, polymerase chain reaction and matrix-assisted laser desorption/ionization-time of flight mass spectrometry. One hundred percent of the rind samples [3.69-8.92 log colony forming units (CFU) g -1 ] and 89.8% of the pulp samples (maximum load 3.66 log CFU g -1 ) were microbiologically contaminated. Among the 432 pulp isolates, opportunistic and potentially pathogenic bacteria were identified, mainly Staphylococcus spp. (48.9%), Clostridium spp. (42.9%) and Enterobacteriaceae (27.9%). Salmonella spp., Escherichia coli and isolates of the Bacillus cereus group were found on the rind (1.4%, 0.7% and 42.9%, respectively) and in the pulp (0.7%, 1.4% and 4.7%). Clostridium perfringens was isolated from the rind of seven melons. The present study revealed a regularly occurring internal contamination of melons. Possible health risks for consumers because of an occurrence of microorganisms in melon pulp should be considered in future food safety assessments. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.
Fernandez-Bayon, J M; Barnes, J D; Ollerenshaw, J H; Davison, A W
1993-01-01
Two cultivars of watermelon (Citrullus lanatus) and muskmelon (Cucumis melo), which are widely grown in Spain, were exposed to ozone (70 nl litre(-1), 6 h d(-1)) for 21 days. Ozone sensitivity was assessed by recording the extent of visible injury, changes in fast-fluorescence kinetics, the relative-growth rate (R) of root (RR) and shoot (RS), and effects on the number of flowers produced per plant. Leaf gas exchange was measured in order to provide some indication of the factors underlying differential response to ozone. After 9-10 days of fumigation, all the cultivars developed typical visible symptoms of zone injury on the older leaves. However, significant (P watermelon, there was a marked reduction in the rate of CO(2) assimilation as a result of exposure to ozone, and this was accompanied by a parallel decrease in stomatal conductance. Mean plant-relative-growth rate (R) was markedly (P watermelon, but there were no significant effects on R in muskmelon. Ozone reduced root growth relative to the shoot in three out of four cultivars-an effect that may be of considerable ecological significance. Moreover, exposure to ozone reduced flower production in both muskmelon and watermelon, which indicated effects on yield. There was no correlation between a variety of methods used to assess ozone sensitivity and visible injury, and reasons for this are discussed. This observation draws clear attention to the dangers in ranking plants for ozone sensitivity purely on the basis of visible symptoms. It is concluded from this study that ozone-insensitive genotypes should be identified and considered for planting in the major areas of melon production concentrated on the Mediterranean coast of Spain.
Directory of Open Access Journals (Sweden)
Y. Ulung Anggraito
2012-02-01
Full Text Available Indonesian farmers are very dependence on certificated seed from another countries. In the other side the natural resources andmen powers very abundance. For these reason it is properly developed the research in agriculture sector, especially on plants breeding.It can be hoped that in the future the dependence on certificated seed from another countries can be minimized. The objective of thisresearch were: (1 to find out the concentration and dipping period which is effective to induce polyploid in musk melon plant, (2identify the weight, diameter, dan flesh thickness of tetraploid musk melon as result of colchicines treatment. The sample of this researchwas Action 434 musk melon cultivar, product of Chia-Thai Seed, Thailand. The number of sample was 480 plants, which plants on fieldrandomly. There were four colchicines concentration as an independent variable: 0.0%, 0.05%, 0.10% and 0.2%. The dipping periodwere 12, 16, 20, and 24 hours for each concentration respectively. Completely Random Design was used in three replications. Datameasurement were analyzed with Two Way ANOVA, DMRT, and LSD. From this research can be concluded that: (1 0.2 % colchicinesis the most effective concentration to induce polyploid on musk melon, with dipping period effective varied from 16–24 hours, (2 thereare changes in weight, diameter, and flesh thickness characters, with the increased tendency of each character in definite norm.
Gonda, Itay; Davidovich-Rikanati, Rachel; Bar, Einat; Lev, Shery; Jhirad, Pliaa; Meshulam, Yuval; Wissotsky, Guy; Portnoy, Vitaly; Burger, Joseph; Schaffer, Arthur A; Tadmor, Yaakov; Giovannoni, James J; Fei, Zhangjun; Fait, Aaron; Katzir, Nurit; Lewinsohn, Efraim
2018-04-01
Studies on the active pathways and the genes involved in the biosynthesis of L-phenylalanine-derived volatiles in fleshy fruits are sparse. Melon fruit rinds converted stable-isotope labeled L-phe into more than 20 volatiles. Phenylpropanes, phenylpropenes and benzenoids are apparently produced via the well-known phenylpropanoid pathway involving phenylalanine ammonia lyase (PAL) and being (E)-cinnamic acid a key intermediate. Phenethyl derivatives seemed to be derived from L-phe via a separate biosynthetic route not involving (E)-cinnamic acid and PAL. To explore for a biosynthetic route to (E)-cinnamaldehyde in melon rinds, soluble protein cell-free extracts were assayed with (E)-cinnamic acid, CoA, ATP, NADPH and MgSO 4 , producing (E)-cinnamaldehyde in vitro. In this context, we characterized CmCNL, a gene encoding for (E)-cinnamic acid:coenzyme A ligase, inferred to be involved in the biosynthesis of (E)-cinnamaldehyde. Additionally we describe CmBAMT, a SABATH gene family member encoding a benzoic acid:S-adenosyl-L-methionine carboxyl methyltransferase having a role in the accumulation of methyl benzoate. Our approach leads to a more comprehensive understanding of L-phe metabolism into aromatic volatiles in melon fruit. Copyright © 2018 Elsevier Ltd. All rights reserved.
Powdery Mildew Control and Yield Response of Inodorus Melon
Directory of Open Access Journals (Sweden)
Ippolito Camele
Full Text Available The research was carried out on melon (Cucumis melo L. var. inodorus Naud. in 2006 and 2007 at “Pantanello” Experimental Farm (40° 24’N; 16° 48’E; 10 m a.s.l.; Metaponto, southern Italy to evaluate the efficacy of a low environmental impact control strategy against powdery mildew of cucurbits. Winter melon was treated with a new anti-oidium formulation, called Stifénia, obtained from fenugreek seeds and stimulating the plant self-defence. The adopted experimental design included two control strategies (1. biological, using Stifénia and 2. conventional, using penconazole, myclobutanil and sulphur and an untreated control (treated with water alone applied to two cultivars of inodorus melon (cv ‘Amarillo’ and HF1 ‘Cocorito’, the latter a genotype resistant to powdery mildew. Stifénia applications were not effective against the disease; in fact, there were no differences in percentage of attacked plant surface between treated plots and untreated ones. The melon marketable yield was significantly higher with the conventional strategy respect to Stifénia and control. Repeated applications of Stifénia resulted in a significant decrease of marketable yield even in comparison with the untreated control. The cultivars significantly affected powdery mildew development, since the resistant one (‘Cocorito’ was attacked later and damaged always lower than the non-resistant genotype (‘Amarillo’. Laboratory analyses carried out on infected leaves always confirmed that Golovinomyces cichoracearum D.C. was responsible of the disease.
International Nuclear Information System (INIS)
Baloch, A. M.; Liu, S.; Wang, X.; Luan, F.; Baloch, A. W.; Baloch, M. J.
2016-01-01
In the current experiment, the quantitative trait loci (QTL) analysis was done by composite interval mapping method to detect QTLs in edge, central parts and fruit shape of melon. In this context, 235 F/sub 2/ populations along with their parents were evaluated for fruit size, shape and color under replicated trail at Horticulture Experimental Station of Northeast Agricultural University, Harbin, China, during the growing year 2014. Moreover, 96 pairs of CAPS markers were used to construct a linkage map using F/sub 2/ population that was derived from the cross between two contrasting parents (MR-1 and Topmark). The total length of linkage map was found to be 4984.1cM with an average of 51.9177 cM between the markers. In a total, we detected ten QTLs, in which one was major, while others were minor. Five QTLs were detected in the edge part of melon fruit and three QTLs were detected in central parts of melon and all were considered as Brix content. Two QTLs were related with fruit shape. Our present genetic and QTLs mapping would be proved useful in plant breeding programs for the improvement of economically important horticultural traits. (author)
Effect of chromium toxicity on germination and early seedling growth ...
African Journals Online (AJOL)
USER
2010-07-19
Jul 19, 2010 ... germination and early seedling growth of melon (Cucumis melo L.). Chromium ... chromium on seed germination and seedling growth- biomass in early ..... such critical regulatory mechanisms are likely to operate in seeds at ...
Sodium and chloride exclusion and retention by non-grafted and grafted melon and Cucurbita plants
Edelstein, M.; Plaut, Z.; Ben-Hur, M.
2011-01-01
The effects of grafting on Na and Cl– uptake and distribution in plant tissues were quantified in a greenhouse experiment using six combinations of melon (Cucumis melo L. cv. Arava) and pumpkin (Cucurbita maxima Duchesne×Cucurbita moschata Duchesne cv. TZ-148): non-grafted, self-grafted, melons grafted on pumpkins, and pumpkins grafted on melons. Total Na concentration in shoots of plants with pumpkin or melon rootstocks was 400 mmol kg−1, respectively, regardless of the scion. In contrast, shoot Cl– concentrations were quite similar among the different scion–rootstock combinations. Na concentrations in exudates from cut stems of plants with a pumpkin rootstock were very low (<0.18 mM), whereas those in the exudates of plants with melon rootstocks ranged from 4.7 mM to 6.2 mM, and were quite similar to the Na concentration in the irrigation water. Root Na concentrations averaged 11.7 times those in the shoots of plants with pumpkin rootstocks, while in plants with melon rootstocks, values were similar. Two mechanisms could explain the decrease in shoot Na concentrations in plants with pumpkin rootstocks: (i) Na exclusion by the pumpkin roots; and (ii) Na retention and accumulation within the pumpkin rootstock. Quantitative analysis indicated that the pumpkin roots excluded ∼74% of available Na, while there was nearly no Na exclusion by melon roots. Na retention by the pumpkin rootstocks decreased its amount in the shoot by an average 46.9% compared with uniform Na distribution throughout the plant. In contrast, no retention of Na could be found in plants grafted on melons. PMID:20729482
Sodium and chloride exclusion and retention by non-grafted and grafted melon and Cucurbita plants.
Edelstein, M; Plaut, Z; Ben-Hur, M
2011-01-01
The effects of grafting on Na and Cl(-) uptake and distribution in plant tissues were quantified in a greenhouse experiment using six combinations of melon (Cucumis melo L. cv. Arava) and pumpkin (Cucurbita maxima Duchesne×Cucurbita moschata Duchesne cv. TZ-148): non-grafted, self-grafted, melons grafted on pumpkins, and pumpkins grafted on melons. Total Na concentration in shoots of plants with pumpkin or melon rootstocks was 400 mmol kg(-1), respectively, regardless of the scion. In contrast, shoot Cl(-) concentrations were quite similar among the different scion-rootstock combinations. Na concentrations in exudates from cut stems of plants with a pumpkin rootstock were very low (<0.18 mM), whereas those in the exudates of plants with melon rootstocks ranged from 4.7 mM to 6.2 mM, and were quite similar to the Na concentration in the irrigation water. Root Na concentrations averaged 11.7 times those in the shoots of plants with pumpkin rootstocks, while in plants with melon rootstocks, values were similar. Two mechanisms could explain the decrease in shoot Na concentrations in plants with pumpkin rootstocks: (i) Na exclusion by the pumpkin roots; and (ii) Na retention and accumulation within the pumpkin rootstock. Quantitative analysis indicated that the pumpkin roots excluded ∼74% of available Na, while there was nearly no Na exclusion by melon roots. Na retention by the pumpkin rootstocks decreased its amount in the shoot by an average 46.9% compared with uniform Na distribution throughout the plant. In contrast, no retention of Na could be found in plants grafted on melons.
Sánchez, M V; Agüero, R; Rivera, C
2001-03-01
Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.
Allelopathy by extracts of Caatinga species on melon seeds
Directory of Open Access Journals (Sweden)
Andreya Kalyana de Oliveira
2016-04-01
Full Text Available The melon crop is of great socioeconomic importance in Brazil and some species from the Caatinga biome show allelopathic effects on other species. The aim of this study was to assess leaf and seed extracts of cumaru (Amburana cearensis (Allemao A.C. Sm., the jujube tree (Zizyphus joazeiro Mart., Jucá (Caesalpinia ferrea Mart. Ex. Tul. Var. Ferrea and mulungu (Erythrina velutina Willd. on the emergence of melon seeds (Cucumis melo L.. Leaves and seeds were used to produce extracts for each species at concentrations of a 1%, b 0.5% c 0.25%, d 0.125% and e 0% (control. The experiment was conducted with each extract type and its respective concentrations in a completely randomized design, with four replicates, each of 20 seeds. The percentage emergence and rate index, percentage of abnormal seedlings, seedling dry matter and seedling shoot and root length were assessed. Seed extracts of A. cearensis prevented melon germination, whereas the other extracts had no effect on this variable. Leaf extracts of A. cearensis and leaf and seed extracts of Z. joazeiro, C. ferrea and E. velutina resulted in abnormal melon seedlings. The percentage of abnormal melon seedlings exceeded 30% when treated with C. ferrea seed extract at the highest concentration. Most extracts did not affect seedling dry matter, but E. velutina leaf and seed extract increased the dry matter accumulation of melon seedlings and Z. joazeiro seed extract decreased dry matter accumulation at a concentration of 0.25%. The highest concentrations of mulungu and jucá leaf extracts promoted the shoot growth of melon seedlings. The extract from E. velutina seeds negatively affected root length compared to the control, similar to the effect of C. ferrea and E. velutina leaf extracts at the highest concentrations. Extracts of different organs of Caatinga plants can affect the emergence and characteristics related to seedling growth, depending on the concentration. Most extracts did not affect
International Nuclear Information System (INIS)
Kantoglu, Y.; Secer, E.; Kunter, B.; Erzurum, K.; Maden, S.; Yanmaz, R.
2009-01-01
Fusarium wilt is a vascular disease of the Cucurbitaceae family, especially in muskmelon (Cucumis melo L.), caused by the soil fungus Fusarium oxysporum f. sp. melonis (FOM). This pathogen persists in the soil for extended periods of time, and the only effective control is the use of resistant varieties. Fusarium oxysporum f. sp. melonis is a very serious disease factor for farmers in Turkey. In this research, we show a method for mass-selection of melon mutants resistant to Fusarium wilt. In vitro selection of resistant cells, which are come from irradiated and non-irradiated explants, is done using culture filtrates of different FOM races. According to our results we determined effective irradiation doses and filtrate treatment dose by Linear Regression Analysis. According to our results 21.75 Gy is effective dose for in vitro Yuva cv. explants to induce mutation and for filtrate treatment 6.73% is the proper dose to select survive calluses and plantlets. We recommended using 10 and 20 Gy gamma ray doses for in vitro melon plantlets to induce mutation by our results. We succeed to regenerate 6% plantlets which were obtained and selected from irradiated plantlets and regenerated in in vitro medias which were include 6.73 % filtrate. Although 16.7% of resistant or tolerant plantlets can continue their viability in greenhouse conditions after disease inoculation treatment, we observed 4 plants had a surviving capability in a limited time. That is very important for breeding cycle and this research can lead to the development of new melon cultivars that will be resistant to Fusarium wilt.
Effects of different irrigation regimes and nitrogen levels on yield and ...
African Journals Online (AJOL)
Jane
2011-08-31
Aug 31, 2011 ... levels on yield and quality of melon (Cucumis melo L.) M. Simsek1* and N. ... fertilization have significant adverse effects on water resources ... usage of water to meet the needs of plants (Stewart and. Nielsen, 1990).
African Journal of Biotechnology - Vol 10, No 34 (2011)
African Journals Online (AJOL)
... microcephaly associated (ASPM) gene mutation is a major cause of primary ... Optimization of somatic embryogenesis induction in Iranian melon (Cucumis melo cv. ... related gene expression in response to enhanced UV-B radiation in Arabidopsis ... Exobiopolymer from polyhydroxyalkanoate-producing transgenic yeast ...
Directory of Open Access Journals (Sweden)
Budi Setiadi Daryono
2018-01-01
Full Text Available This research aims to develop cultivars with superior phenotypes of melon and high level of productivity. This research used the individual results of crossing between melon ♀ ‘Hikapel' with ♂ 'Hikadi Aromatik'. The research included qualitative and quantitative phenotype characterization test. The research was conducted in Center of Agrotechnology Innovation University of Gadjah Mada (PIAT-UGM, Kalitirto, Berbah, Sleman, Yogyakarta and Laboratory of Genetics Faculty of Biology UGM on December 2016 until March 2017. Quantitative data analysis used ANOVA testing through PKBT-STAT 2.02 software with Random Complete Block Design (RCBD method at significance level of 1% and 5%. Melon 'Hikapel Aromatik' has several advantages including oval shape, without net, without lobes, crispy texture, skin-collored yellow RHS (6A, has a 7-14 brix, has volatile aromatic compound and transposon influenced. Based on the results of recapitulation of variance, the characters of 'Hikapel Aromatik' was not uniform.
Directory of Open Access Journals (Sweden)
Yazhong eJin
2016-05-01
Full Text Available Alcohol dehydrogenases (ADH, encoded by multigene family in plants, play a critical role in plant growth, development, adaptation, fruit ripening and aroma production. Thirteen ADH genes were identified in melon genome, including 12 ADHs and one formaldehyde dehydrogenease (FDH, designated CmADH1-12 and CmFDH1, in which CmADH1 and CmADH2 have been isolated in Cantaloupe. ADH genes shared a lower identity with each other at the protein level and had different intron-exon structure at nucleotide level. No typical signal peptides were found in all CmADHs, and CmADH proteins might locate in the cytoplasm. The phylogenetic tree revealed that 13 ADH genes were divided into 3 groups respectively, namely long-, medium- and short-chain ADH subfamily, and CmADH1,3-11, which belongs to the medium-chain ADH subfamily, fell into 6 medium-chain ADH subgroups. CmADH12 may belong to the long-chain ADH subfamily, while CmFDH1 may be a Class III ADH and serve as an ancestral ADH in melon. Expression profiling revealed that CmADH1, CmADH2, CmADH10 and CmFDH1 were moderately or strongly expressed in different vegetative tissues and fruit at medium and late developmental stages, while CmADH8 and CmADH12 were highly expressed in fruit after 20 days. CmADH3 showed preferential expression in young tissues. CmADH4 only had slight expression in root. Promoter analysis revealed several motifs of CmADH genes involved in the gene expression modulated by various hormones, and the response pattern of CmADH genes to ABA, IAA and ethylene were different. These CmADHs were divided into ethylene-sensitive and –insensitive groups, and the functions of CmADHs were discussed.
Directory of Open Access Journals (Sweden)
Sathishkumar Natarajan
Full Text Available Powdery mildew is one of the most common fungal diseases in the world. This disease frequently affects melon (Cucumis melo L. and other Cucurbitaceous family crops in both open field and greenhouse cultivation. One of the goals of genomics is to identify the polymorphic loci responsible for variation in phenotypic traits. In this study, powdery mildew disease assessment scores were calculated for four melon accessions, 'SCNU1154', 'Edisto47', 'MR-1', and 'PMR5'. To investigate the genetic variation of these accessions, whole genome re-sequencing using the Illumina HiSeq 2000 platform was performed. A total of 754,759,704 quality-filtered reads were generated, with an average of 82.64% coverage relative to the reference genome. Comparisons of the sequences for the melon accessions revealed around 7.4 million single nucleotide polymorphisms (SNPs, 1.9 million InDels, and 182,398 putative structural variations (SVs. Functional enrichment analysis of detected variations classified them into biological process, cellular component and molecular function categories. Further, a disease-associated QTL map was constructed for 390 SNPs and 45 InDels identified as related to defense-response genes. Among them 112 SNPs and 12 InDels were observed in powdery mildew responsive chromosomes. Accordingly, this whole genome re-sequencing study identified SNPs and InDels associated with defense genes that will serve as candidate polymorphisms in the search for sources of resistance against powdery mildew disease and could accelerate marker-assisted breeding in melon.
Natarajan, Sathishkumar; Kim, Hoy-Taek; Thamilarasan, Senthil Kumar; Veerappan, Karpagam; Park, Jong-In; Nou, Ill-Sup
2016-01-01
Powdery mildew is one of the most common fungal diseases in the world. This disease frequently affects melon (Cucumis melo L.) and other Cucurbitaceous family crops in both open field and greenhouse cultivation. One of the goals of genomics is to identify the polymorphic loci responsible for variation in phenotypic traits. In this study, powdery mildew disease assessment scores were calculated for four melon accessions, 'SCNU1154', 'Edisto47', 'MR-1', and 'PMR5'. To investigate the genetic variation of these accessions, whole genome re-sequencing using the Illumina HiSeq 2000 platform was performed. A total of 754,759,704 quality-filtered reads were generated, with an average of 82.64% coverage relative to the reference genome. Comparisons of the sequences for the melon accessions revealed around 7.4 million single nucleotide polymorphisms (SNPs), 1.9 million InDels, and 182,398 putative structural variations (SVs). Functional enrichment analysis of detected variations classified them into biological process, cellular component and molecular function categories. Further, a disease-associated QTL map was constructed for 390 SNPs and 45 InDels identified as related to defense-response genes. Among them 112 SNPs and 12 InDels were observed in powdery mildew responsive chromosomes. Accordingly, this whole genome re-sequencing study identified SNPs and InDels associated with defense genes that will serve as candidate polymorphisms in the search for sources of resistance against powdery mildew disease and could accelerate marker-assisted breeding in melon.
da Silva Sousa, Jonas; de Castro, Rubens Carius; de Albuquerque Andrade, Gilliane; Lima, Cleidiane Gomes; Lima, Lucélia Kátia; Milhome, Maria Aparecida Liberato; do Nascimento, Ronaldo Ferreira
2013-12-01
A multiresidue method based on the sample preparation by modified QuEChERS and detection by gas chromatography coupled to single quadruple mass spectrometers (GC-SQ/MS) was used for the analysis of 35 multiclass pesticides in melons (Cucumis melo inodorus) produced in Ceara-Brazil. The rates of recovery for pesticides studied were satisfactory (except for the etridiazole), ranging from 85% to 117% with a relative standard deviation (RSD) of less than 15%, at concentrations between 0.05 and 0.20 mg kg(-1). The limit of quantification (LOQ) for most compounds was below the MRLs established in Brazil. The combined relative uncertainty (Uc) and expanded uncertainty (Ue) was determined using repeatability, recovery and calibration curves data for each pesticide. Analysis of commercial melons samples revealed the presence of pesticides bifenthrin and imazalil at levels below the MRLs established by ANVISA, EU and USEPA. Copyright © 2013 Elsevier Ltd. All rights reserved.
Phenotypic and molecular evaluation of genetic diversity of rapeseed
African Journals Online (AJOL)
STORAGESEVER
2009-10-05
Oct 5, 2009 ... seed yield per plant, 1000-seed weight, oil content and protein content) were analyzed in a three-year ... regard to many characters of value for breeding process. (Cowling ..... tances determined by molecular markers and heterosis ..... Comparative analysis of cultivated melon groups (Cucumis melo L.).
Carlucci, A.; Raimondo, M.L.; Santos, J.; Phillips, A.J.L.
2012-01-01
Plectosphaerella cucumerina, most frequently encountered in its Plectosporium state, is well known as a pathogen of several plant species causing fruit, root and collar rot, and collapse. It is considered to pose a serious threat to melon (Cucumis melo) production in Italy. In the present study, an
Serological and molecular detection and prevalence of Cucurbit ...
African Journals Online (AJOL)
During the 2009 growing seasons, virus-like symptoms were noticed on cucurbit crops (melons (Cucumis melo L.) and watermelons [Citrullus lanatus (Thunb.) Matsum and Nakai)] grown in the Sistan region. The symptoms were widespread and included initial chlorotic lesions followed by yellowing of whole leaves and ...
Directory of Open Access Journals (Sweden)
M.V. Sánchez
1998-03-01
Full Text Available Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV que infectan el cultivo de melón (Cucumis melo L. para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, sorgo y arroz, y con poco control de malezas; mientras que la finca B con una corta trayectoria en la producción del melón y un mayor control de malezas. La diversidad de especies vegetales fue estudiada en cuadrantes de 100 m2 en cinco diferentes comunidades de plantas previamente seleccionadas en la finca A (cultivo, canal de drenaje, charral, potrero mejorado, y semi-bosque y tres en la finca B (cultivo, charral, pastizal natural, semi-bosque. El número de cuadrantes estudiados dependió del área total cultivada en cada una de las fincas. Todas las especies de plantas representadas en cada cuadrante se recolectaron e identificaron pero solo aquellas especies que presentaron síntomas virales en el campo fueron analizadas por ELISA para determinar la presencia de los cuatro virus estudiados. La diversidad de especies, porcentaje de cobertura y época de aparición de las especies hospederas fue monitoreada durante un año calendario en cinco fechas diferentes. Un total de 86 y 72 especies de plantas fueron identificadas en las fincas A y B respectivamente. Catorce encontradas positivas por lo menos para uno de los cuatro virus. Los cuatro virus fueron encontrados en cada finca en cada fecha de muestreo indicando que la permanencia y abundancia de algunas especies hospederas garantiza la permanencia de los cuatro virus en el campo como fuente de inóculo primario para la próxima siembra. Varias especies de plantas hospederas silvestres previamente
Energy Technology Data Exchange (ETDEWEB)
Betts, C.; Ruf, R.H. Jr.
1966-01-01
Cantaloupe (Cucumis melo L. var. reticulatus) and lettuce (Lactuca sativa L. var. crispa) were grown in the greenhouse in redwood boxes with bare and plastic mulched soil. Soil temperature in the bare boxes was equated to the plastic mulch with buried temperature coils. Bottled CO/sub 2/ was used to bring the concentration around the plants in bare soil up to the concentration around mulched plants. Carbon dioxide was sampled in leaf canopy. The temperature treatment increased the yields of the bare soil so that they were comparable to those of the plastic mulched soil. Yields from the soil with the auxiliary CO/sub 2/ were lower than those of the mulched treatment.
Directory of Open Access Journals (Sweden)
Hong Zhang
Full Text Available We used a next-generation high-throughput sequencing platform to resequence the Xinguowei and Shouxing melon cultivars, the parents of Fengwei melon. We found 84% of the reads (under a coverage rate of "13×" placed on the reference genome DHL92. There were 2,550,000 single-nucleotide polymorphisms and 140,000 structural variations in the two genomes. We also identified 1,290 polymorphic genes between Xinguowei and Shouxing. We combined specific length amplified fragment sequencing (SLAF-seq and bulked-segregant analysis (super-BSA to analyze the two parents and the F2 extreme phenotypes. This combined method yielded 12,438,270 reads, 46,087 SLAF tags, and 4,480 polymorphic markers (average depth of 161.81×. There were six sweet trait-related regions containing 13 differential SLAF markers, and 23 sour trait-related regions containing 48 differential SLAF markers. We further fine-mapped the sweet trait to the genomic regions on chromosomes 6, 10, 11, and 12. Correspondingly, we mapped the sour trait-related genomic regions to chromosomes 2, 3, 4, 5, 9, and 12. Finally, we positioned nine of the 61 differential markers in the sweet and sour trait candidate regions on the parental genome. These markers corresponded to one sweet and eight sour trait-related genes. Our study provides a basis for marker-assisted breeding of desirable sweet and sour traits in Fengwei melons.
(Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran
African Journals Online (AJOL)
ajl11
2012-10-30
Oct 30, 2012 ... resistance of melon cultivars to three important soil-borne plant pathogens found worldwide. Key words: Melon ... use of cultivars resistant to plant diseases is one of the ..... emerging disease of melons worldwide. Plant Dis.
Paiva Coutinho, Flavia
2007-01-01
A rizosfera é a região do solo influenciada pelas raízes, as quais disponibilizam nutrientes através dos exsudados, afetando intensamente a atividade e o desenvolvimento dos microrganismos. Dentre esses, destacam-se os solubilizadores de P, considerados de grande importância na rizosfera por possuírem habilidade para disponibilizar, para as plantas, o fosfato insolúvel presente nos compostos. Foram coletadas amostras de solo rizosférico em áreas cultivadas com melão (Cucumis melo cv. Gold Min...
Generation of a BAC-based physical map of the melon genome
Directory of Open Access Journals (Sweden)
Puigdomènech Pere
2010-05-01
Full Text Available Abstract Background Cucumis melo (melon belongs to the Cucurbitaceae family, whose economic importance among horticulture crops is second only to Solanaceae. Melon has high intra-specific genetic variation, morphologic diversity and a small genome size (450 Mb, which make this species suitable for a great variety of molecular and genetic studies that can lead to the development of tools for breeding varieties of the species. A number of genetic and genomic resources have already been developed, such as several genetic maps and BAC genomic libraries. These tools are essential for the construction of a physical map, a valuable resource for map-based cloning, comparative genomics and assembly of whole genome sequencing data. However, no physical map of any Cucurbitaceae has yet been developed. A project has recently been started to sequence the complete melon genome following a whole-genome shotgun strategy, which makes use of massive sequencing data. A BAC-based melon physical map will be a useful tool to help assemble and refine the draft genome data that is being produced. Results A melon physical map was constructed using a 5.7 × BAC library and a genetic map previously developed in our laboratories. High-information-content fingerprinting (HICF was carried out on 23,040 BAC clones, digesting with five restriction enzymes and SNaPshot labeling, followed by contig assembly with FPC software. The physical map has 1,355 contigs and 441 singletons, with an estimated physical length of 407 Mb (0.9 × coverage of the genome and the longest contig being 3.2 Mb. The anchoring of 845 BAC clones to 178 genetic markers (100 RFLPs, 76 SNPs and 2 SSRs also allowed the genetic positioning of 183 physical map contigs/singletons, representing 55 Mb (12% of the melon genome, to individual chromosomal loci. The melon FPC database is available for download at http://melonomics.upv.es/static/files/public/physical_map/. Conclusions Here we report the construction
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Alessandra Aparecida Zilio Cozzo de
2007-07-01
Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a{sup *}) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a{sup *} and b{sup *}), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)
Directory of Open Access Journals (Sweden)
Wasmo Wakmana
2016-10-01
Full Text Available A mosaic disease of pumpkin (Cucurbita maxima was spread widely in Sulawesi. Since the virus had not yet been identified, a study was conducted to identify the disease through mechanical inoculation, aphid vector transmission, host range, and electron microscopic test. Crude sap of infected pumpkin leaf samples was rubbed on the cotyledons of healthy pumpkin seedlings for mechanical inoculation. For insect transmission, five infective aphids were infected per seedling. Seedlings of eleven different species were inoculated mechanically for host range test. Clarified sap was examined under the electron microscope. Seeds of two pumpkin fruits from two different infected plants were planted and observed for disease transmission up to one-month old seedlings. The mosaic disease was transmitted mechanically from crude sap of different leaf samples to healthy pumpkin seedlings showing mosaic symptoms. The virus also infected eight cucurbits, i.e., cucumber (Cucumis sativus, green melon (Cucumis melo, orange/rock melon (C. melo, zucchini (Cucurbita pepo, pumpkin (Cucurbita maxima, water melon (Citrulus vulgaris, Bennicosa hispida, and blewah (Cucurbita sp.. Aphids transmitted the disease from one to other pumpkin seedlings. The virus was not transmitted by seed. The mosaic disease of pumpkin at Maros, South Sulawesi, was associated with flexious particles of approximately 750 nm length, possibly a potyvirus, such as water melon mosaic virus rather than papaya ringspot virus or zucchini yellow mosaic virus.
Effects of gamma radiation on melon read-to-eat
Energy Technology Data Exchange (ETDEWEB)
Pires, Juliana A.; Polizel, Francine Fernanda, E-mail: jujuba_angelo@yahoo.com.br, E-mail: fran_sininho@hotmail.com [Faculdade de Tecnologia em Piracicaba (FATEP), Piracicaba, SP (Brazil); Harder, Marcia N.C.; Silva, Lucia C.A.S.; Arthur, Paula B.; Arthur, Valter, E-mail: mnharder@terra.com.br, E-mail: lcasilva@cena.usp.br, E-mail: paula.arthur@hotmail.com, E-mail: arthur@cena.usp.br [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)
2013-07-01
This work comes from the irradiation of Cantaloupe melons (Cucumis melo L.), with the aid of gamma irradiation (Co60) to physical and chemical changes to assess their conservation. The research aimed to evaluate the effects of irradiation on melons, including the possibility of conservation, through pH, acidity, soluble solids and fresh squash. The samples were minimally processed and submitted to gamma radiation Co{sup 60} at doses of 0 (control); 1kGy and 2kGy. Physicochemical analyzes were made in periods of 1, 7 and 14 days after irradiation treatment. On day 1 and day 7, pH levels in irradiated samples had increased compared to control. Since the 14th day, the dose decreased 1kGy equaling the control. Soluble solids showed a statistical gradual decrease according to the increase of dose. The 14th had no significant difference while the 7th the dose was increased. The 1kGy sample decreased in another dose compared to the control. In fresh squash, absent statistics were observed for all samples in the three periods. And for the analysis of titratable acidity, there was observed no significant difference at day 1. There was observed a decrease in the 2kGy and 1kGy dose to 7 days compared to the control. On 14th day, a reduction in the dose of 2kGy and deterioration of 1kGy dose of the sample. Therefore, it demonstrates the irradiation doses of 2kGy, 1kGy physic-chemically alters the Cantaloupe melon pH, soluble solids content and acidity. And the dose of 2kGy is the one that longer preserves samples based on acidity values, greater and smaller values of soluble solids. (author)
Effects of gamma radiation on melon read-to-eat
International Nuclear Information System (INIS)
Pires, Juliana A.; Polizel, Francine Fernanda; Harder, Marcia N.C.; Silva, Lucia C.A.S.; Arthur, Paula B.; Arthur, Valter
2013-01-01
This work comes from the irradiation of Cantaloupe melons (Cucumis melo L.), with the aid of gamma irradiation (Co60) to physical and chemical changes to assess their conservation. The research aimed to evaluate the effects of irradiation on melons, including the possibility of conservation, through pH, acidity, soluble solids and fresh squash. The samples were minimally processed and submitted to gamma radiation Co 60 at doses of 0 (control); 1kGy and 2kGy. Physicochemical analyzes were made in periods of 1, 7 and 14 days after irradiation treatment. On day 1 and day 7, pH levels in irradiated samples had increased compared to control. Since the 14th day, the dose decreased 1kGy equaling the control. Soluble solids showed a statistical gradual decrease according to the increase of dose. The 14th had no significant difference while the 7th the dose was increased. The 1kGy sample decreased in another dose compared to the control. In fresh squash, absent statistics were observed for all samples in the three periods. And for the analysis of titratable acidity, there was observed no significant difference at day 1. There was observed a decrease in the 2kGy and 1kGy dose to 7 days compared to the control. On 14th day, a reduction in the dose of 2kGy and deterioration of 1kGy dose of the sample. Therefore, it demonstrates the irradiation doses of 2kGy, 1kGy physic-chemically alters the Cantaloupe melon pH, soluble solids content and acidity. And the dose of 2kGy is the one that longer preserves samples based on acidity values, greater and smaller values of soluble solids. (author)
Directory of Open Access Journals (Sweden)
Melisa E. Yonny
2017-01-01
Full Text Available Early production of melon plant (Cucumis melo is carried out using tunnels structures, where extreme temperatures lead to high reactive oxygen species production and, hence, oxidative stress. Malondialdehyde (MDA is a recognized biomarker of the advanced oxidative status in a biological system. Thus a reliable, sensitive, simple, selective, and rapid separative strategy based on ultra-high-performance liquid chromatography coupled to positive electrospray-tandem mass spectrometry (UPLC-(+ESI-MS/MS was developed for the first time to measure MDA, without derivatization, in leaves of melon plants exposed to stress conditions. The detection and quantitation limits were 0.02 μg·L−1 and 0.08 μg·L−1, respectively, which was demonstrated to be better than the methodologies currently reported in the literature. The accuracy values were between 96% and 104%. The precision intraday and interday values were 2.7% and 3.8%, respectively. The optimized methodology was applied to monitoring of changes in MDA levels between control and exposed to thermal stress conditions melon leaves samples. Important preliminary conclusions were obtained. Besides, a comparison between MDA levels in melon leaves quantified by the proposed method and the traditional thiobarbituric acid reactive species (TBARS approach was undertaken. The MDA determination by TBARS could lead to unrealistic conclusions regarding the oxidative stress status in plants.
Analysis of expressed sequence tags generated from full-length enriched cDNA libraries of melon
Directory of Open Access Journals (Sweden)
Bendahmane Abdelhafid
2011-05-01
Full Text Available Abstract Background Melon (Cucumis melo, an economically important vegetable crop, belongs to the Cucurbitaceae family which includes several other important crops such as watermelon, cucumber, and pumpkin. It has served as a model system for sex determination and vascular biology studies. However, genomic resources currently available for melon are limited. Result We constructed eleven full-length enriched and four standard cDNA libraries from fruits, flowers, leaves, roots, cotyledons, and calluses of four different melon genotypes, and generated 71,577 and 22,179 ESTs from full-length enriched and standard cDNA libraries, respectively. These ESTs, together with ~35,000 ESTs available in public domains, were assembled into 24,444 unigenes, which were extensively annotated by comparing their sequences to different protein and functional domain databases, assigning them Gene Ontology (GO terms, and mapping them onto metabolic pathways. Comparative analysis of melon unigenes and other plant genomes revealed that 75% to 85% of melon unigenes had homologs in other dicot plants, while approximately 70% had homologs in monocot plants. The analysis also identified 6,972 gene families that were conserved across dicot and monocot plants, and 181, 1,192, and 220 gene families specific to fleshy fruit-bearing plants, the Cucurbitaceae family, and melon, respectively. Digital expression analysis identified a total of 175 tissue-specific genes, which provides a valuable gene sequence resource for future genomics and functional studies. Furthermore, we identified 4,068 simple sequence repeats (SSRs and 3,073 single nucleotide polymorphisms (SNPs in the melon EST collection. Finally, we obtained a total of 1,382 melon full-length transcripts through the analysis of full-length enriched cDNA clones that were sequenced from both ends. Analysis of these full-length transcripts indicated that sizes of melon 5' and 3' UTRs were similar to those of tomato, but
Metabolomics in melon: A new opportunity for aroma analysis
Allwood, J.W.; Cheung, W.W.L.; Xu, Y.; Mumm, R.; Vos, de C.H.; Deborde, C.; Biais, B.; Maucourt, M.; Berger, Y.; Schaffer, A.; Rolin, D.; Moing, A.; Hall, R.D.; Goodacre, R.
2014-01-01
Cucumis melo fruit is highly valued for its sweet and refreshing flesh, however the flavour and value are also highly influenced by aroma as dictated by volatile organic compounds (VOCs). A simple and robust method of sampling VOCs on polydimethylsiloxane (PDMS) has been developed. Contrasting
Directory of Open Access Journals (Sweden)
Christian Krarup
2009-06-01
Full Text Available The nature and development of specific symptoms of chilling injury (CI and the variation in sensitivity to the disorder of different cultivars of cantaloupe melons (Cucumis melo L. subsp. melo var. cantalupensis Naudin was assessed during two seasons. Twenty-three cultivars of the Eastern Shipper (2, Western Shipper (13 and Galia (8 types were grown in a semiarid environment in Curacaví (33º27’ S, 70º38’ W, Chile, using common cultural practices. Fruits were harvested at the half-slip stage, except Galia (3/5 color, graded ,washed, and stored for 18 days at 0 ºC, with an additional 3 days at 20 ºC. Symptoms of CI appeared with varying intensity in almost all cultivars and were generally similar. Symptoms developed progressively: surface discoloration progressed from light pink to brownish to black, followed by large sunken areas, and eventually, discrete indentations and net whitening. Surface decay was not present in most fruits and should be considered a consequence rather than a symptom of CI. Cultivars had different sensitivities to the disorder; some cultivars were severely injured (Athena, Colima and Revigal whereas others developed almost no symptoms of CI (Hy-Mark, Gal 96, and Voyager I. The response variability to chilling showed the need for precise temperature recommendations for these cultivars, and signaled a potential for future long-term transport or storage of some cultivars.La naturaleza y el desarrollo de los síntomas de daño por enfriamiento (CI y la variación en sensibilidad de diversos cultivares de melones reticulados (Cucumis melo L. subsp. melo var. cantalupensis Naudin a este desorden fisiológico se evaluaron durante dos temporadas. Veintitrés cultivares de los tipos Eastern (1, Western (15 y Galia (8 se cultivaron en un ambiente semi-árido en Curacaví (33º27’ S, 70º38’ O, Chile, en cultivos realizados de manera convencional, y los frutos se cosecharon al estado de madurez de medio desprendimiento
Directory of Open Access Journals (Sweden)
Julie Carillon
2016-04-01
Full Text Available Background: In spontaneously hypertensive rats (SHR, a model of human essential hypertension, oxidative stress is involved in the development of cardiac hypertrophy and fibrosis associated with hypertension. Dietary supplementation with agents exhibiting antioxidant properties could have a beneficial effect in remodeling of the heart. We previously demonstrated a potent anti-hypertrophic effect of a specific melon (Cucumis melo L. concentrate with antioxidant properties in spontaneously hypertensive rats. Relaxin and atrial natriuretic peptide (ANP were reported to reduce collagen deposition and fibrosis progression in various experimental models. Objective: The aim of the present investigation was to test the hypothesis that, beside reduction in oxidative stress, the melon concentrate may act through relaxin, its receptor (relaxin/insulin-like family peptide receptor 1, RXFP1, and ANP in SHR. Design and results: The melon concentrate, given orally during 4 days, reduced cardiomyocyte size (by 25% and totally reversed cardiac collagen content (Sirius red staining in SHR but not in their normotensive controls. Treatment with the melon concentrate lowered cardiac nitrotyrosine-stained area (by 45% and increased by 17–19% the cardiac expression (Western blot of superoxide dismutase (SOD and glutathione peroxidase. In addition, plasma relaxin concentration was normalized while cardiac relaxin (Western blot was lowered in treated SHR. Cardiac relaxin receptor level determined by immunohistochemical analysis increased only in treated SHR. Similarly, the melon concentrate reversed the reduction of plasma ANP concentration and lowered its cardiac expression. Conclusions: The present results demonstrate that reversal of cardiac fibrosis by the melon concentrate involves antioxidant defenses, as well as relaxin and ANP pathways restoration. It is suggested that dietary SOD supplementation could be a useful additional strategy against cardiac hypertrophy
Fukino, Nobuko; Ohara, Takayoshi; Monforte, Antonio J; Sugiyama, Mitsuhiro; Sakata, Yoshiteru; Kunihisa, Miyuki; Matsumoto, Satoru
2008-12-01
Powdery mildew caused by Podosphaera xanthii is an important foliar disease in melon. To find molecular markers for marker-assisted selection, we constructed a genetic linkage map of melon based on a population of 93 recombinant inbred lines derived from crosses between highly resistant AR 5 and susceptible 'Earl's Favourite (Harukei 3)'. The map spans 877 cM and consists of 167 markers, comprising 157 simple sequence repeats (SSRs), 7 sequence characterized amplified region/cleavage amplified polymorphic sequence markers and 3 phenotypic markers segregating into 20 linkage groups. Among them, 37 SSRs and 6 other markers were common to previous maps. Quantitative trait locus (QTL) analysis identified two loci for resistance to powdery mildew. The effects of these QTLs varied depending on strain and plant stage. The percentage of phenotypic variance explained for resistance to the pxA strain was similar between QTLs (R (2) = 22-28%). For resistance to pxB strain, the QTL on linkage group (LG) XII was responsible for much more of the variance (41-46%) than that on LG IIA (12-13%). The QTL on LG IIA was located between two SSR markers. Using an independent population, we demonstrated the effectiveness of these markers. This is the first report of universal and effective markers linked to a gene for powdery mildew resistance in melon.
Zhang, Yunxia; Cheng, Chunyan; Li, Ji; Yang, Shuqiong; Wang, Yunzhu; Li, Ziang; Chen, Jinfeng; Lou, Qunfeng
2015-09-25
Differentiation and copy number of repetitive sequences affect directly chromosome structure which contributes to reproductive isolation and speciation. Comparative cytogenetic mapping has been verified an efficient tool to elucidate the differentiation and distribution of repetitive sequences in genome. In present study, the distinct chromosomal structures of five Cucumis species were revealed through genomic in situ hybridization (GISH) technique and comparative cytogenetic mapping of major satellite repeats. Chromosome structures of five Cucumis species were investigated using GISH and comparative mapping of specific satellites. Southern hybridization was employed to study the proliferation of satellites, whose structural characteristics were helpful for analyzing chromosome evolution. Preferential distribution of repetitive DNAs at the subtelomeric regions was found in C. sativus, C hystrix and C. metuliferus, while majority was positioned at the pericentromeric heterochromatin regions in C. melo and C. anguria. Further, comparative GISH (cGISH) through using genomic DNA of other species as probes revealed high homology of repeats between C. sativus and C. hystrix. Specific satellites including 45S rDNA, Type I/II, Type III, Type IV, CentM and telomeric repeat were then comparatively mapped in these species. Type I/II and Type IV produced bright signals at the subtelomeric regions of C. sativus and C. hystrix simultaneously, which might explain the significance of their amplification in the divergence of Cucumis subgenus from the ancient ancestor. Unique positioning of Type III and CentM only at the centromeric domains of C. sativus and C. melo, respectively, combining with unique southern bands, revealed rapid evolutionary patterns of centromeric DNA in Cucumis. Obvious interstitial telomeric repeats were observed in chromosomes 1 and 2 of C. sativus, which might provide evidence of the fusion hypothesis of chromosome evolution from x = 12 to x = 7 in
International Nuclear Information System (INIS)
Siqueira, Alessandra Aparecida Zilio Cozzo de
2007-01-01
Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a * ) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a * and b * ), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)
(Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran
African Journals Online (AJOL)
ajl11
2012-10-30
Oct 30, 2012 ... Melon is an important dessert fruit in the Sistan region of. Iran, but its cultivation is threatened by attacks of. Macrophomina phaseolina (Tassi), Monosporascus cannonballus (Pollack and Uecker) and Rhizoctonia solani (Kuhn) (Safarnezhad, 2004). Melon death induced by these soil-borne plant pathogenic ...
7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Watermelon, squash, cucumber, and oriental melon from... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from the Republic of Korea. Watermelon (Citrullus lanatus), squash (Cucurbita maxima), cucumber (Cucumis...
Enhanced Virulence Gene Activity of Agrobacterium in Muskmelon (Cucumis melo L. cv. ‘Birdie’
Directory of Open Access Journals (Sweden)
Abul K.M. MOHIUDDIN
2011-05-01
Full Text Available Muskmelon (Cucumis melo L. cultivar ‘Birdie’, was evaluated for its response to the tumorigenic Agrobacterium tumefaciens and the oncogenic A. rhizogenes strains. Stem and petiole of three week-old in vitro-grown muskmelon plants were inoculated with five strains of A. tumefaciens and A. rhizogenes each and observed phenotypic expressions i.e. induction of crown galls and hairy roots. This phenotypic expression was efficaciously increased when virulence gene activity of different strains of two Agrobacterium species was enhanced. Intensive studies on enhancement of virulence gene activity of Agrobacterium found to be correlated to the appropriate light intensity (39.3 μmol m-2 s-1 with a specific concentration of monocyclic phenolic compound, acetosyringone (20 μM. The gene activity was also influenced by several other physical factors e.g. plant tissue type, Agrobacterium species and their strains, and plant tissue-Agrobacterium interaction. Among the different A. tumefaciens strains, LBA4404 showed the best virulence gene activity in both stem and petiole through the formation of higher rate of crown galls. On the other hand, strain 15834 of A. rhizogenes showed better gene activity in stem and 8196 in petiole through the formation of higher rate of hairy roots as well as higher average number of hairy roots. Among the two different types of explants, petiole was more susceptible to both Agrobacterium species. Thus it was concluded that future muskmelon transformation study can efficiently be carried out with LBA4404, 15834 and 8196 strains using petiole explants by adding 20 μM of acetosyringone in the medium.
Directory of Open Access Journals (Sweden)
Micheline Tavares Paduan
2007-01-01
Full Text Available O interesse pela cultura do melão no Brasil tem aumentado muito nos últimos anos, pelas crescentes exportações e pelo incremento no consumo do mercado interno. O objetivo deste trabalho foi avaliar as características físicas e químicas, assim como a atividade da pectinametilesterase dos frutos de tipos de melão (Cucumis melo L., produzidos em ambiente protegido, no município de Centenário do Sul-PR. Os tipos estudados foram: Valenciano ('Amarelo-Ouro', Caipira ('Gaúcho Caipira', Net Melon ('Net Galia', Orange ('Orange Melon' e Pele-de-Sapo ('Filipo', com cinco repetições, utilizando seis frutos por repetição em delineamento inteiramente casualizado. Os frutos do Valenciano e Pele-de-Sapo destacaram-se quanto à massa, com valores 2,02 e 2,07 kg, respectivamente, e formatos alongados, enquanto os demais tipos apresentaram formatos arredondados e massa em torno de 1,4 kg. Os melões Pele-de-Sapo apresentaram espessura da polpa de 43,36 mm, estatisticamente superior à dos frutos Valenciano, com 38,98 mm. A menor espessura de polpa, 24,78 cm, e a maior espessura de casca, 9,74 mm, foram encontradas nos frutos do tipo Caipira que diferiu estatisticamente dos outros tipos. Os valores de pH não se apresentaram estatisticamente diferentes e variaram de 6,24 a 6,48. O Net Melon apresentou polpa com 12,3ºBrix e diferiu estatisticamente do Orange, Valenciano e Pele-de-Sapo, com 11;12; 10,34 e 9,94 ºBrix, respectivamente. O Caipira atingiu 5,06ºBrix, e também o menor conteúdo de acidez, 0,10 g de ac. cítrico.100-1 g de suco, o que inviabiliza sua comercialização. A atividade da pectinametilesterase na polpa dos frutos foi muito baixa, inferior a 0,005 PEu x 10(4 mL-1, nos cinco tipos avaliados. Na região norte do Paraná (Vale do Paranapanema, sob condições de cultivo protegido, os melões Pele-de-Sapo, Net Melon, Orange e Valenciano apresentaram boas características físicas e químicas dos frutos, destacando-se o Net Melon
Amaro, Ana Luísa Leite Fernandes
2012-01-01
Current fresh-cut technologies are effective in the effort of maintaining visual quality during the fresh-cut fruit supply chain. However, studies on extended shelf life based on appearance attributes or microbial stability have neglected the understanding of the effect of processing technologies and conservation techniques in the aromatic, nutritional, and functional properties of processed fruit. Three technologies were evaluated for their effects on quality of fresh-cut melon, with emphasi...
Genetic diversity of cucumber estimated by morpho-physiological and EST-SSR markers.
Pandey, Sudhakar; Ansari, Waquar Akhter; Pandey, Maneesh; Singh, Bijendra
2018-02-01
In the present study, genetic variation among 40 cucumber genotypes was analyzed by means of morpho-physiological traits and 21 EST-SSR markers. Diversity was observed for morpho-physiological characters like days to 50% female flowering (37-46.9, number of fruits/plant (1.33-5.80), average fruit weight (41-333), vine length (36-364), relative water content (58.5-92.7), electrolyte leakage (15.9-37.1), photosynthetic efficiency (0.40-0.75) and chlorophyll concentration index (11.1-28.6). The pair wise Jaccard similarity coefficient ranged from 0.00 to 0.27 for quantitative traits and 0.24 to 0.96 for EST-SSR markers indicating that the accessions represent genetically diverse populations. With twenty-one EST-SSR markers, polymorphism revealed among 40 cucumber genotypes, number of alleles varied 2-6 with an average 3.05. Polymorphism information content varied from 0.002 to 0.989 (mean = 0.308). The number of effective allele (Ne), expected heterozygosity (He) and unbiased expected heterozygosity (uHe) of these EST-SSRs were 1.079-1.753, 0.074-0.428 and 0.074-0.434, respectively. Same 21 EST-SSR markers transferability checked in four other Cucumis species: snapmelon ( Cucumis melo var. momordica ), muskmelon ( Cucumis melo L.), pickling melon ( Cucumis melo var. conomon ) and wild muskmelon ( Cucumis melo var. agrestis ) with frequency of 61.9, 95.2, 76.2, and 76.2%, respectively. Present study provides useful information on variability, which can assist geneticists with desirable traits for cucumber germplasm utilization. Observed physiological parameters may assists in selection of genotype for abiotic stress tolerance also, EST-SSR markers may be useful for genetic studies in related species.
Molecular Cloning, Characterization, and Expression of Cuc m 2, a Major Allergen in Cucumis melo
Directory of Open Access Journals (Sweden)
Mojtaba Sankian
2013-05-01
Full Text Available Background: Several studies reported the clinical features of IgE-mediated hypersensitivity after ingestion of melon. Melon allergy is a common IgE-mediated fruit allergy in Iran. This prompted us to investigate immunochemical and molecular properties of the major allergen in melon fruit, to compare the IgE-binding capacity of the natural protein with the recombinant allergen, and to determine cross-reactivity of the major allergen with closely-related allergens from other plants displaying clinical cross-reactivity with melon. Methods: Identification and molecular characterization of the major melon allergen were performed using IgE immunoblotting, allergen-specific ELISA, affinity-based purifications, cross-inhibition assays, cloning, and expression of the allergen in Escherichia coli. Results: Melon profilin was identified and isolated as a major IgE-binding component and designated as Cuc m 2. Sequencing corresponding cDNA revealed an open reading frame of 363 bp coding for 131 amino acid residues and two fragments of 171 bp and 383 bps for the 5’and 3’ UTRs, respectively. Significant cross-reactivity was found between melon profilin and Cynodon dactylon, tomato, peach, and grape profilins in cross-inhibition assays. Although the highest degree of amino acid identity was revealed with watermelon profilin, there was no significant cross-reactivity between melon and watermelon profilins. Conclusion: Melon profilin is the major IgE-binding component in melon extract, and the recombinant and natural forms exhibited similar IgE-binding capacities. A part of the fruit-fruit and pollen-fruit cross-reactions could be explained by the presence of this conserved protein; however, sequence homology provides insufficient information to predict IgE cross-reactivity of profilins.
Directory of Open Access Journals (Sweden)
José Francismar de Medeiros
2008-12-01
Full Text Available O uso de água salina na irrigação é muito comum em cultivos de melão em regiões semi-áridas, o que pode resultar na salinização do solo e redução de rendimento se o manejo da irrigação não for adequado. O presente trabalho teve como objetivo avaliar o crescimento e o acúmulo de N, P e K em plantas de melão (Cucumis melo, L. irrigadas com água salina. Os tratamentos estudados resultaram da combinação de dois fatores: salinidade da água de irrigação (1,1; 2,5 e 4,5 dS m-1 e materiais de melão (híbrido Trusty e cultivar Orange Flesh. O delineamento estatístico adotado foi de blocos inteiramente casualizados com quatro repetições, com tratamentos arranjados em esquema fatorial 3 x 2. A época de coleta de plantas foi analisado como outro fator e os resultados interpretados por análise multivariada. As plantas amostradas foram fracionadas em folhas + ramos e frutos, determinaram-se as produções de matérias secas e os conteúdos de N, P e K nestes materiais. Os acúmulos dos nutrientes nos frutos e de fitomassa seca na planta diminuíram com o incremento da salinidade da água de irrigação. Os frutos exportaram, em média, 57,1%, 67,1% e 70,0% dos totais de N, P, K, absorvidos pela planta e alocados na parte aérea, mostrando, portanto, que foram o principal dreno para estes nutrientes na planta.The use of saline water for irrigation is very common in cultivation of melon in semiarid zones, which can result in the soil salinization if irrigation management is not appropriate. The growth and accumulation of N, P and K by melon (Cucumis melo, L. irrigated with saline water was evaluated. Treatments resulted from the combination of the factors irrigation water salinity levels (1.1; 2.5 and 4.5 dS m-1 and melon materials (hybrid Trusty and cultivar Orange Flesh. Treatments were arranged following a completely randomized block design with four replications, arranged in 3 x 2 factorial. Another factor analyzed was time of
Polyploidization facilitates biotechnological in vitro techniques in the genus Cucumis.
Skálová, Dagmar; Ondřej, Vladan; Doležalová, Ivana; Navrátilová, Božena; Lebeda, Aleš
2010-01-01
Prezygotic interspecific crossability barrier in the genus Cucumis is related to the ploidy level of the species (cucumber (C. sativus), x = 7; muskmelon (C. melo) and wild Cucumis species, x = 12). Polyploidization of maternal plants helps hybridization among other Cucumis species by overcoming prezygotic genetic barriers. The main objective of this paper is to compare the results of several methods supporting interspecific crosses in cucumber without and with polyploidization (comparison between diploid (2x) and mixoploid (2x/4x) cucumber maternal plants). Mixoploid plants were obtained after in vivo and in vitro polyploidization by colchicine and oryzalin. Ploidy level was estimated by flow cytometry. Embryo rescue, in vitro pollination, and isolation of mesophyll protoplast were tested and compared. Positive effect of polyploidization was observed during all experiments presented by higher regeneration capacity of cultivated mixoploid cucumber embryos, ovules, and protoplasts. Nevertheless, the hybrid character of putative hybrid accessions obtained after cross in vivo and in vitro pollination was not confirmed.
Directory of Open Access Journals (Sweden)
Raquel Silviana Neitzke
2009-12-01
Full Text Available Variedades crioulas de melão (Cucumis melo são cultivadas no Sul do Brasil para consumo familiar e também para comercialização dos frutos. No entanto, existe uma carência de trabalhos relativos a sua caracterização. Este trabalho teve por objetivo caracterizar e avaliar a variabilidade genética de variedades crioulas de melão do Sul do Brasil mantidos no Banco Ativo de Germoplasma de Cucurbitáceas da Embrapa Clima Temperado. Foram caracterizados 14 acessos utilizando 26 descritores morfológicos de fruto. Os dados foram analisados pelos métodos de agrupamento de Tocher e hierárquico UPGMA. Os métodos de agrupamento foram parcialmente concordantes. O acesso C88 possui características distintas, ficando isolado dos demais, pois é o único entre todos os avaliados que apresenta formato piriforme e sem gomos, cor de epicarpo creme, cor de polpa branca e ruptura profunda no fruto. Existe grande variabilidade genética, para caracteres de frutos, nas variedades crioulas de melão conservadas nesse Banco Ativo de Germoplasma, com potencial para uso no melhoramento genético, destacando-se o acesso C71 por possuir sabor adocicado e polpa de cor laranja e o C72, por apresentar elevados valores de peso de fruto e espessura de polpa.Melon landraces (Cucumis melo are cultivated in South of Brazil for family consumption and also for marketing fruits. However, there is a lack of works related to characterization of these landraces. The objective of this work was to characterize and evaluate genetic variability of melon landraces from South of Brazil which are maintained in the Cucurbitaceae Genebank at Embrapa Clima Temperado, trough morphological characterization. Fourteen accessions were characterized in 26 morphological fruit descriptors. Data were analyzed by Tocher grouping method and UPGMA hierarchical. The two methods agreed partially. The accession C88 has unique characteristics, being isolated when compared to the other accessions, it
Directory of Open Access Journals (Sweden)
Maria M. Rinaldi
2006-12-01
Full Text Available O objetivo deste trabalho foi determinar o período de armazenamento pós-colheita e a aceitabilidade pelo consumidor de melão híbrido 'F1 Jangada' (Cucumis melo L., produzido em sistema hidropônico, mantido em condições ambiente (22 ± 2 ºC e umidade relativa de 40 ± 5%. O experimento compreendeu o período de 21-6-2005 a 2-8-2005. Foi utilizado o esquema fatorial 5 x 2, em delineamento experimental inteiramente casualizado, com cinco períodos de armazenamento (0; 7; 21; 28 e 42 dias e dois tipos de substrato (areia e fibra de coco, com três repetições, em que cada repetição consistiu em cinco frutos de meloeiro. Foram avaliados o pH, a acidez titulável, os sólidos solúveis, a perda de massa fresca, a análise sensorial e a decisão de compra dos melões. Foram verificados efeitos do tipo de substrato e tempo de armazenamento sobre os valores de pH dos melões. A acidez titulável dos melões diminuiu significativamente nos primeiros sete dias de armazenamento, em ambos os substratos. Não foram verificados efeitos do tipo de substrato e tempo de armazenamento nos sólidos solúveis dos melões durante o armazenamento. Não houve diferença de perda de massa fresca dos frutos produzidos nos dois substratos, sendo de 7,1 ± 0,2%, durante os 42 dias de armazenamento. O tipo de substrato não interferiu na aparência geral, cor, textura e sabor dos melões. Aos 42 dias de armazenamento, os melões produzidos nos dois tipos de substrato apresentaram-se aceitáveis pelo consumidor. No entanto, os produzidos no substrato com areia apresentaram melhor aceitabilidade e decisão de compra ao longo do armazenamento.The objective of this work was to evaluate the storage period postharvest and acceptability by consumer of hybrid melon 'F1 Jangada' (Cucumis melo L., produced in hydroponic system, stored in atmosphere conditions (22 ± 2 ºC and 40 ± 5% relative humidity. The research was carried from June 21st to August 2nd, 2005. It was
Directory of Open Access Journals (Sweden)
Luiz V. E. Villela Jr.
2007-04-01
Full Text Available Buscando a sustentabilidade em uma pequena propriedade agrícola visou-se com o presente estudo, ao aproveitamento do efluente de biodigestor proveniente da fermentação anaeróbia de estrume bovino, no cultivo sem solo do meloeiro. O experimento foi conduzido em Jaboticabal, SP, Brasil, localizado na Latitude 21º 15- 22" S e Longitude 48º 18- 58" W. Cultivou-se o meloeiro (Cucumis melo L. cv. Bonus nº 2 em substrato, com semeadura realizada em outubro de 2003 e se utilizou delineamento experimental em blocos casualisados com 16 tratamentos e 5 repetições, em esquema fatorial 4 x 4 (4 substratos e 4 soluções nutritivas. Os 4 substratos se compunham de diferentes proporções da mistura entre a parte sólida do efluente de biodigestor e a areia grossa lavada; as 4 soluções nutritivas foram compostas pela parte líquida do efluente de biodigestor (biofertilizante em substituição a adubos minerais hidrossolúveis. A adição do efluente à areia proporcionou crescimento vegetativo mais rápido, maior precocidade na colheita, frutos mais pesados e maior produtividade à cultura do meloeiro. Adubos minerais hidrossolúveis utilizados no cultivo de plantas em substrato podem ser parcialmente substituídos pelo biofertilizante estudado.Looking for the sustainability of a small farming enterprise, the present study focused the benefit of the biodigestor effluent resulting from the anaerobic fermentation of the bovine manure in a soilless melon plant experiment. The research was conducted in Jaboticabal, in the State of Sao Paulo, Brazil, at latitude of 21° 15- 22-- S and a longitude of 48° 18- 58-- W. The melon plant (Cucumis melo L. cv Bonus n° 2 was grown with substrate, seedling obtained in 10/2003. An experimental design was adapted in a randomized block with 16 treatments and 5 replications in a factorial 4 x 4 (4 substrates and 4 nutrient solutions. The 4 substrates were made up of different proportions in volume of the blend
Directory of Open Access Journals (Sweden)
Flavia Paiva Coutinho
2011-12-01
Full Text Available Considering that little is known about the occurrence of phosphate-solubilizing fungi from areas cultivated with melon, the phosphate solubilization ability of filamentous fungi isolated in these areas was evaluated. Three hundred and eighteen filamentous fungal isolates belonging to 23 genera were evaluated, besides Aphyllophorales and Mycelia sterilia. From those, 52 were able to solubilize P: Aphyllophorales (2, Aspergillus (34, Penicillium (10 and Rhizopus (6. These results will contribute to subsidizing further research regarding the capacity of these fungi to solubilize other sources of phosphate applied to the melon crop, as well as indicate the need for a screening program to select those with higher capacity and potential for solubilization.Considerando que pouco se conhece sobre a ocorrência de fungos solubilizadores de fosfato de áreas cultivadas com melão, foi avaliada a habilidade de solubilização desse nutriente por fungos filamentosos isolados dessas áreas. Foram avaliadas 318 amostras de fungos filamentosos pertencentes a 23 gêneros, além de Aphyllophorales e Mycelia sterilia. Dessas amostras, 52 apresentaram habilidade para solubilizar o fosfato: Aphyllophorales (2, Aspergillus (34, Penicillium (10 e Rhizopus (6. Esses resultados contribuem para subsidiar pesquisas que testem a capacidade desses fungos em solubilizar outras fontes fosfatadas aplicadas na cultura do melão, assim como indicam a necessidade de selecionar isolados com maior capacidade e potencial para solubilização.
Directory of Open Access Journals (Sweden)
Mohammed M. A. Elbashier
2018-02-01
Full Text Available Despite the recent interest in biochar and digestate as soil amendments for improving soil quality and increasing crop production, there is inadequate knowledge of the effect of the combination of biochar and digestate, particularly under saline irrigation conditions. A pot experiment with Chinese melon was conducted in a greenhouse, biochar (5% and digestate (500 mL/pot were used with and without the recommended mineral NPK (Nitrogen, Phosphorus and Potassium fertilizer dose (120-150-150 Kg ha−1. The plants were irrigated with tap water (SL0 and 2 dS/m (SL1 NaCl solution. The growth, photosynthesis rate, water use efficiency (WUE and yield of Chinese melon were affected positively when biochar was combined with digestate amendment, particularly under saline irrigation water with and without mineral NPK fertilizer. The maximum yield under normal water was obtained by digestate (SL0: 218.87 t ha−1 and biochar amendment combined with digestate (SL1: 118.8 t ha−1 under saline water. The maximum WUE values were noticed with the biochar and digestate combination under all water treatments (SL0: 32.2 t ha−1 mm−1 and SL1: 19.6 t ha−1 mm−1. It was concluded that digestate alone was more effective than the use of biochar, particularly with normal water. The combination of biochar with digestate had a significant effect on the Chinese melon growth, photosynthesis rate, water use efficiency and yield under saline irrigation, and it can be used as an alternative fertilizer for mineral NPK fertilizer.
Cucurbits depicted in Byzantine mosaics from Israel, 350–600 ce
Avital, Anat; Paris, Harry S.
2014-01-01
Background and Aims Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Results and Conclusions Twenty-three mosaics dating from 350–600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round–pyriform and probably used as vessels. PMID:24948671
Andreya Kalyana de Oliveira; Salvador Barros Torres; Rui Sales Júnior
2008-01-01
This research was conducted to evaluate the physiological and sanity quality of melon (Cucumis melo L.) seeds used in agricultural region Assu-Baraúna-Mosssó in the Rio Grande do Norte. For seed lots each from the hybrids Goldex and Vereda were used. Research was conducted at the Seed Analysis Laboratory and Irrigation Agricultural of the Department of Crop Science of the UFERSA from August 2006 to July 2007. The physiological quality was evaluated by the germination, first count germination,...
SILVA, BÁRBARA KARINE DE ALBUQUERQUE; GODOY, MAURÍCIO SEKIGUCHI DE; LIMA, ALRICÉLIA GOMES DE; OLIVEIRA, ANNA KÉZIA SOARES DE; PASTORI, PATRIK LUIZ
2017-01-01
ABSTRACT Brazil is one of the world's largest producers of melon (Cucumis melo L.), and Rio Grande do Norte and Ceará are the largest producers states of the country (99% of exports). This crop had great socio- economic importance in the Brazilian Northeast, however, it is affected by insect pests and consequently, large amounts of pesticides are applied to it, which greatly affect beneficial organisms, such as Chrysopidae. This bioassay evaluated the toxicity of nine insecticides used in com...
Directory of Open Access Journals (Sweden)
Gil R dos Santos
2009-06-01
Full Text Available The gummy stem blight (Didymella bryoniae and the downy mildew (Pseudoperonospora cubensis are two foremost melon (Cucumis melo diseases, considering their effects on yield and fruit quality. Despite the importance of such diseases, relatively few studies have been done so far on the identification of resistance sources to D. bryoniae and P. cubensis in Brazil. This work aimed at evaluating the resistance of commercial melon genotypes to the gummy stem blight and the downy mildew. Firstly, the most aggressive and representative D. bryoniae isolate was selected. Subsequently, the resistance of 86 melon genotypes to stem infection was studied upon greenhouse conditions by inoculating with the previously selected isolate. Afterwards, the resistance to mildew and leaf infection by D. bryoniae of 28 melon genotypes was evaluated in the field, under natural infection. In the greenhouse, all 86 melon genotypes were infected and showed stem infection symptoms caused by D. bryoniae four days after inoculation. Nevertheless, a significant variation on the resistance levels of the melon genotypes was found. Under field conditions and natural inoculation, genotypes Taslaki and Sary Juliabi were the most susceptible to leaf infection by D. bryoniae, significantly differing from the other genotypes. The lowest levels of susceptibility were identified in genotypes Perlita Busle S1, Valenciano Elíptico, Glaver, MR1, and 2526. All genotypes were susceptible to the downy mildew, albeit differing in susceptibility levels.O crestamento gomoso do caule (Didymella bryoniae e o míldio (Pseudoperonospora cubensis estão entre as principais doenças do meloeiro (Cucumis melo ocasionando redução da produtividade e da qualidade dos frutos. Apesar da importância dessas doenças, são poucos os trabalhos envolvendo a identificação de fontes de resistência a D. bryoniae e a P. cubensis no Brasil. O objetivo deste trabalho foi avaliar a resistência de gen
Directory of Open Access Journals (Sweden)
Dauri José Tessmann
2012-07-01
Full Text Available The powdery mildew caused by Oidium spp. is an important disease for several crops of the Cucurbitaceae family. Although the teleomorphs, Podosphaera xanthii and Golovinomyces cichoracearum, currently have already been described as the causal agents of powdery mildew in Brazil, only P. xanthii is considered the main causal agent of powdery mildew field epidemics. The objective of this work was to identify and determine the prevalence of the species causing powdery mildew in cucumber (Cucumis sativus and melon (Cucumis melo var. reticulatus grown in greenhouses in the State of Paraná in Brazil. The morphological traits of the conidial stages, such as the presence of fibrosin bodies and a germinative tube, were used to identify the species. Leaves exhibiting high severity of powdery mildew were collected from plants of 13 plastic greenhouses during different seasons in 2003/2004 and in different regions of Paraná State. In all environments, a significant prevalence of P. xanthii (80-100% was observed affecting parthenocarpic or ordinary cucumber and melon. Golovinomyces cichoracearum was observed in six greenhouses, with up to 20% of conidia of this species on the samples.O oidio, causado por Oidium sp. é uma importante doença para espécies de plantas cultivadas da família das cucurbitáceas. Apesar das espécies teleomórficas Podosphaera xanthii e Golovinomyces cichoracearum já terem sido citadas como causadoras de oídio no Brasil, geralmente em trabalhos publicados atualmente tem-se referenciado somente a P. xanthii como agente causal dessa doença em cucurbitáceas em cultivo convencional. Por isso, este trabalho teve como objetivo identificar e quantificar a freqüência de ocorrência dessas duas espécies causadoras de oídio nas culturas de pepino (Cucumis sativus e melão nobre (Cucumis melo var. reticulatus conduzidas em estufas plásticas no Estado do Paraná. Para a identificação de P. xanthii e G. cichoracearum utilizaram
Directory of Open Access Journals (Sweden)
Qiusheng Kong
Full Text Available Melon (Cucumis melo. L is not only an economically important cucurbitaceous crop but also an attractive model for studying many biological characteristics. Screening appropriate reference genes is essential to reverse transcription quantitative real-time PCR (RT-qPCR, which is key to many studies involving gene expression analysis. In this study, 14 candidate reference genes were selected, and the variations in their expression in roots and leaves of plants subjected to biotic stress, abiotic stress, and plant growth regulator treatment were assessed by RT-qPCR. The stability of the expression of the selected genes was determined and ranked using geNorm and NormFinder. geNorm identified the two most stable genes for each set of conditions: CmADP and CmUBIep across all samples, CmUBIep and CmRPL in roots, CmRAN and CmACT in leaves, CmADP and CmRPL under abiotic stress conditions, CmTUA and CmACT under biotic stress conditions, and CmRAN and CmACT under plant growth regulator treatments. NormFinder determined CmRPL to be the best reference gene in roots and under biotic stress conditions and CmADP under the other experimental conditions. CmUBC2 and CmPP2A were not found to be suitable under many experimental conditions. The catalase family genes CmCAT1, CmCAT2, and CmCAT3 were identified in melon genome and used as target genes to validate the reliability of identified reference genes. The catalase family genes showed the most upregulation 3 days after inoculation with Fusarium wilt in roots, after which they were downregulated. Their levels of expression were significantly overestimated when the unsuitable reference gene was used for normalization. These results not only provide guidelines for the selection of reference genes for gene expression analyses in melons but may also provide valuable information for studying the functions of catalase family genes in stress responses.
Directory of Open Access Journals (Sweden)
Juan Pablo Fernández-Trujillo
2013-08-01
Full Text Available A climacteric aromatic near-isogenic line (NIL of melon (Cucumis melo L. SC3-5-1 contained an introgression of the non-climacteric Korean cultivar “Shongwan Charmi” accession PI 161375 (SC in the genetic background of the non-climacteric cultivar “Piel de Sapo” (PS. The aroma production was monitored during ripening at 21 °C in intact fruit using headspace sorptive bar extraction (HSSE. Bars were composed of polydimethylsiloxane (PDMS and aromas were desorbed and analyzed by gas-chromatography mass-spectrometry. The aromatic profile was composed of 70 aromatic compounds plus 21 alkanes with a predominance of esters, particularly acetate (2-methylbutyl acetate, 2-methylpropyl acetate, hexyl acetate, and phenylmethyl acetate. Some compounds were severely affected by postharvest time. The acetate esters (3-methylbutyl acetate, butan-2-yl acetate and phenylmethyl acetate decreased with ripening and sulfur-derived compounds (S-methyl butanethioate and S-methyl 3-methylbutanethioate increased gradually with ripening. A few compounds increased at the senescence phase (propyl ethanoate. Other compounds such as hexadecanoic acid showed a marked decrease after harvest, some decreasing from a relative maximum at harvest (2-methylpropyl hexanoate; n-hexanoic acid; nonanoic acid.
Application of water footprint in a fertirrigated melon crop under semiarid conditions: A review.
Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; María Tarquis Alfonso, Ana
2015-04-01
In recent times, there has been a major increase in the use of water and fertilizers in order to increase agricultural production, while at the same time there has increased evidence that aquifers are reducing their water level, enriched by nutrient and degraded as a result of pollution. So best management practices are needed for much of cropped, irrigated and fertirrigated land, to avoid contamination of fresh water and groundwater. The concept of "water footprint" (WF) was introduced as an indicator for the total volume of direct and indirect freshwater used, consumed and/or polluted [1]. The WF distinguishes between blue water (volume of surface and groundwater consumed), green water (rain-water consumed), and grey water (volume of freshwater that is required to assimilate the load of pollutants based on existing ambient water quality standards). This study is focused in calculating the crops WF using a real case of study in a fertirrigated melon crop under semiarid conditions which is principally cultivated in the centre of Spain declared vulnerable zone to nitrate pollution by applying the Directive 91/676/CEE. During successive years, a melon crop (Cucumis melo L.) was grown under field conditions applying mineral and organic fertilizers. Different doses of ammonium nitrate were used as well as compost derived from the wine-distillery industry which is relevant in this area. This application help us to review the different concepts in which is based WF. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03-01. Keywords: Water footprint, nitrogen, fertirrigation, inorganic fertilizers, organic amendments, winery waste, semiarid conditions. [1] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12, UNESCO-IHE, Delft, The Netherlands.
Directory of Open Access Journals (Sweden)
Marcelo T. Gurgel
2010-01-01
Full Text Available O Estado do Rio Grande do Norte, em destaque a região da Chapada do Apodi, se destaca na produção e exportação de melão no País, em regime de irrigação, devido à distribuição pluvial baixa e irregular. A Chapada do Apodi possui dois aqüíferos subterrâneos; a do lençol menos profundo de alta salinidade, porém com menor custo de bombeamento, ocorrendo o contrário com o de maior profundidade. Objetivou-se, ante o exposto, avaliar o efeito de duas águas de salinidades diferentes (0,52 e 2,41 dS m-1, combinadas com cinco doses de K2O (218, 273, 328, 383 e 438 kg ha-1 sobre o crescimento do meloeiro (Cucumis melo L., cultivar Goldex, utilizando-se do delineamento de blocos ao acaso, com parcelas subdivididas; amostras de planta foram coletadas aos 21, 28, 35, 49 e 63 dias após a semeadura, determinando-se a fitomassa seca das plantas, estas separadas em ramos (caule + folhas, flores e frutos; avaliou-se, também, a taxa de crescimento absoluto e relativo e a produção de frutos. Em geral, o crescimento do melão foi favorecido com o uso de água mais salina; a taxa de crescimento absoluto foi máxima entre 35 e 49 dias após a semeadura. Obteve-se maior produção de fitomassa total com 438 kg ha-1 de K2O e uso de água mais salina, ao final do ciclo.The region of 'Chapada do Apodi', in the State of Rio Grande do Norte, stands out in Brazilian production and exportation of melon. This region possesses two aquiffers, one of lower exploration cost, though of high salinity, another of low salinity, with higher cost and limited use. This work was carried out with the objective to evaluate the effect of waters of different salinities combined with five doses of K in the dry matter accumulation and productivity of the melon (Cucumis melo L. cultivar Goldex. The experimental design adopted was split plot in completely randomized blocks. The melon crop was irrigated with low (0.52 dS m-1 and high (2.41 dS m-1 salinity water combined with
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Alessandra A.Z. Cozzo de; Matraia, Clarice; Walder, Julio Marcos M. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Irradiacao de Alimentos e Radioentomologia]. E-mail: aazcozzo@cena.usp.br; Spoto, Marta H.F.; Silva, Paula P.M. da; Maretti, Marina S. [Escola Superior de Agricultura Luiz de Queiroz, Piracicaba, SP (Brazil). Dept. de Agroindustria, Alimentos e Nutricao
2005-07-01
The Brazilian fruit culture is an alternative to minimize the lack-of-food problem using management and post harvest appropriate techniques. Gamma radiation technology is a possible technique used for food, enlarging its shelf-life, eliminating pathogenic microorganisms and in the quarantine treatment. The irradiation with seven doses (150,300,450,600,750 and 900 Gy) was used in Cantaloupe melon (Cucumis melon var. Cantaloupensis) aiming to establish the minimum, maximum and ideal doses, according to Brazilian laws, analyzing weight, color, firmness, pulp and juice quantity and sensory aspects, using the Difference Control Test. The results indicate that storage influenced significantly the weight, color and pulp quantity parameters. Doses higher than 450 Gy however influenced the firmness, juice quantity and sensory aspects characteristics. These results are indicating that the minimum dose was 150 Gy, the maximum dose was 900 Gy and the ideal dose for the quarantine treatment and to increase shelf-life of the Cantaloupe melon was 450 Gy. The data obtained allowed us to conclude that the ionizing radiation can increase the shelf-life of the Cantaloupe melon using doses up to 450 Gy making it proper to exportation. (author)
Reação de genótipos de meloeiro a Myrothecium Reaction of melon genotypes to Myrothecium roridum
Directory of Open Access Journals (Sweden)
Marissônia A Noronha
2006-12-01
Full Text Available A expansão da cultura do meloeiro (Cucumis melo L. no Nordeste brasileiro tem favorecido a ocorrência de doenças como o cancro-de-mirotécio, causado pelo fungo Myrothecium roridum. Visando selecionar genótipos com potencial de utilização nos programas de melhoramento e/ou no manejo integrado da doença, foram avaliados 150 genótipos de meloeiro. Plantas com 22 dias de idade, desenvolvidas em casa de vegetação, foram feridas no colo e inoculadas com uma suspensão do patógeno (3x10(6 conídios/ml. As avaliações foram realizadas diariamente, até seis dias após a retirada da câmara úmida, com o auxílio de uma escala descritiva de notas de 0 a 4. Com os dados da última avaliação, os genótipos foram distribuídos em cinco classes de reação à doença. Nenhum genótipo foi imune ou altamente resistente ao patógeno, enquanto 26,7% foram medianamente resistentes (MR e 73,3% foram suscetíveis (S ou altamente suscetíveis (AS. Esses resultados evidenciam a dificuldade na obtenção de fontes com elevados níveis de resistência a M. roridum. Os grupos Cantaloupe, Charentais, Gália e 'Indefinido' apresentaram a maior freqüência de genótipos com a reação MR e a menor freqüência de genótipos AS. A maioria dos genótipos dos grupos Valenciano Verde (66,7%, Cantaloupe (57,4%, Gália (60,0% e 'Indefinido' (53,8% foram S. Os genótipos 'PI 420149', 'Caroline', 'A3', 'Chilton' e 'PS-1 Pele de Sapo' apresentaram os menores valores de severidade final da doença e mostraram-se promissoras fontes de resistência ao patógeno e devem ser preferidos sob condições favoráveis à doença.The expansion of the melon (Cucumis melo L. fields in the Brazilian Northeast favored the occurrence of diseases such as the Myrothecium stem canker caused by the fungus Myrothecium roridum. In order to select genotypes with potential use in genetic breeding programs and in integrated disease management, 150 melon genotypes were evaluated. Twenty
Directory of Open Access Journals (Sweden)
Nildo da Silva Dias
2011-09-01
Full Text Available No semiárido, a escassez de água de boa qualidade faz com que os produtores utilizem água salobra para preparar a solução nutritiva. Com o objetivo de investigar a utilização de água salobra na irrigação de meloeiro (Cucumis melo L., cv. AF 015 cultivado em substrato de fibra de coco em casa de vegetação, plantas foram nutridas com soluções salinas de condutividades elétricas (CEs 1,1 (testemunha; 2,5; 4,0 e 5,5 dS m-1 aplicadas durante as fases: crescimento vegetativo (10-30 dias após o transplantio-DAT; florescimento (31-50 DAT e frutificação e maturação (51-70 DAT. O delineamento experimental foi o inteiramente casualizado, com 12 tratamentos arranjados em um esquema fatorial 4x3 (níveis de salinidade x tempo de exposição dos sais, com três repetições. Houve correlação na perda relativa por incremento de CEs das variáveis de crescimento e de produção do meloeiro em função da salinidade da solução nutritiva para cada fase de exposição. As soluções nutritivas preparadas com água salobra podem ser utilizadas no cultivo do meloeiro em substrato de fibra de coco com o mínimo de perdas relativas de massa média de frutos por incremento de CEs, quando aplicadas na fase de florescimento.Scarcity of good water quality in semiarid region causes producers to use brackish water to prepare the nutrient solution. In order to investigate the use of brackish water in irrigation of greenhouse-melon (Cucumis melo L., cv. AF 015 grown in coconut fiber substrate, plants were irrigated with saltine nutrient solutions of electrical conductivities (ECs of 1.1 (control, 2.5, 4.0 and 5.5 dS m-1, applied during the phases of vegetative growth (10-30 days after transplanting, DAT, flowering (31-50 DAT and fruiting and ripening (51-70 DAT. The design was completely randomized, with 12 treatments arranged in a 4x3 factorial design (salinity levels x exposure time of the salts, with three replications. There was a correlation in
Cucurbits depicted in Byzantine mosaics from Israel, 350-600 ce.
Avital, Anat; Paris, Harry S
2014-08-01
Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Twenty-three mosaics dating from 350-600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round-pyriform and probably used as vessels. © The Author 2014. Published by Oxford University Press on behalf of
Energy Technology Data Exchange (ETDEWEB)
Castellanos, M. T.; Cabello, M. J.; Cartagena, M. C.; Tarquis, A. M.; Arce, A.; Ribas, F.
2012-11-01
The need to reduce nitrogen (N) fertilizer pollution strengthens the importance of improving the utilization efficiency of applied N to crops. This requires knowledge of crop N uptake characteristics and how fertilization management affects it. A three-year field experiment was conducted from May to September in central Spain to investigate the influence of different N rates, which ranged from 11 to 393 kg ha{sup -}1, applied through drip irrigation, on the dynamics of N uptake, nitrogen use efficiency (NUE), fruit yield and quality of a Piel de sapo melon crop (Cucumis melo L. cv. Sancho). Both N concentration and N content increased in different plant parts with the N rate. Leaves had the highest N concentration, which declined by 40-50% from 34-41 days after transplanting (DAT), while the highest N uptake rate was observed from 30-35 to 70-80 DAT, coinciding with fruit development. In each year, NUE declined with increasing N rate. With N fertilizer applications close to the optimum N rate of 90-100 kg ha -1, the fruits removed approximately 60 kg N ha -1, and the amount of N in the crop residue was about 80 kg N ha -1; this serves to replenish the organic nutrient pool in the soil and may be used by subsequent crops following mineralization. (Author) 36 refs.
Substrate and nutrient solution developed using a biodigestor effluent for melon cultivation
Villela Jr., Luiz V. E. [UNESP; De Araújo, Jairo A. C. [UNESP; Barbosa, José C. [UNESP; Perez, Luiz R.B.
2007-01-01
Buscando a sustentabilidade em uma pequena propriedade agrícola visou-se com o presente estudo, ao aproveitamento do efluente de biodigestor proveniente da fermentação anaeróbia de estrume bovino, no cultivo sem solo do meloeiro. O experimento foi conduzido em Jaboticabal, SP, Brasil, localizado na Latitude 21º 15- 22" S e Longitude 48º 18- 58" W. Cultivou-se o meloeiro (Cucumis melo L. cv. Bonus nº 2) em substrato, com semeadura realizada em outubro de 2003 e se utilizou delineamento experim...
Strobilurin and boscalid in the quality of net melon fruits
Directory of Open Access Journals (Sweden)
Ana Claudia Macedo
2017-05-01
Full Text Available Until recently, fungicides were used exclusively for disease control; however observations of physiological effects brought a new concept to the use of these products. Strobilurins have positive physiological effects on crop yield, due to the increase of liquid photosynthesis and better hormonal balance. However, boscalid complements the action of these fungicides, applied alternately or together. The aim of this study was to evaluate the effect of strobilurins (azoxystrobin and pyraclostrobin, boscalid and the mixture of these on the physical-chemical quality of net melon fruits (Cucumis melo var. Reticulatus. The experiment was conducted in the municipality of São Manuel (SP, using the hybrid of Cantaloupe M2-308 net melon, the experimental design was in randomized blocks with five replicates. The treatments used were: T1 - control; T2 - azoxystrobin 60g ha-1 of active principle (a.p.; T3 - boscalid 75g ha-1 of the a.p.; T4 - pyraclostrobin 50g ha-1 of the a.p.; T5 - boscalid (37,5g ha-1 of the a.p. + pyraclostrobin (25g ha-1 of the a.p. The first application of the treatments was carried out at fourteen days after the transplanting of the seedlings and the others at seven day intervals, totaling eight applications throughout the cycle. Two fruits of each plot were collected, which were identified for analysis in the laboratory. The following characteristics were evaluated: fresh fruit mass; mesocarp thickness, pulp texture, peel trajectory, pH, titratable acidity, soluble solids and the ratio. The results were submitted to analysis of variance and the averages compared by the Tukey test at 5% probability using the SISVAR program. The fruits of the plants treated with boscalid 75g ha-1 were the ones that showed higher concentration of soluble solids and low titratable acidity, resulting in a better ratio. Despite the lower value, the fruits of the plants treated with pyraclostrobin 50g ha-1 showed a high ratio value, besides presenting higher
Melão minimamente processado: um controle de qualidade Minimally processed melon: a quality control
Directory of Open Access Journals (Sweden)
Karla Suzanne Florentino da Silva Chaves Damasceno
2005-12-01
distribution of agricultural products, through procedures like selection, cleaning, washing, peeling and cutting, which do not affect their organoleptic characteristics and add value to them. The process results in natural and practical products, which require less time for preparation and consumption to fulfill the demands of modern life. The purpose of minimally processed and cooled food is to provide a product that is similar to the fresh one to guarantee safety, maintaining the nutritive and sensory quality. The process has attracted attention to research mainly regarding microbiological, physicochemical and sensory alterations that influence the shelf life of these products. The target of the research was to evaluate the effect of commercialization temperature (15ºC on the quality of the Spanish melon (Cucumis melo L. cv. inodorus minimally processed. Fruits packed in trays and involved in plastic film were randomly acquired in a local supermarket. Treatments were: temperatures (4 and 15ºC, storage periods (5, 10, 15 and 1, 2 and 3 days at 4 and 15ºC, respectively and a control treatment of minimally processed melon on day zero. Samples were analyzed as far as their physicochemical, microbiological and sensory characteristics are concerned. The melon quality was significantly affected during refrigerated storage. At commercialization temperature (15ºC, the product is only valid for 24 hours. Storage at 4°C allows conservation up to 5 days and it is necessary to display the adequate time of storage and temperature on the label of the product.
Directory of Open Access Journals (Sweden)
Eliana Janet Sanjinez Argandoña
2002-12-01
Full Text Available A desidratação osmótica associada à adição de ácidos fracos representa uma alternativa de processamento brando, resultando em um produto com características sensoriais praticamente inalteradas e apropriado para o consumo imediato. O objetivo deste estudo foi avaliar a influência dos ácidos cítrico e lático na obtenção de melão osmoticamente desidratado e na qualidade final do produto. Pedaços de melão (Cucumis melo inodorus, cultivar: Gold Mine, de 40x30x15 mm, foram imersos em três tipos de soluções (sacarose + ácido cítrico, sacarose + ácido lático e sacarose com diferentes concentrações de sacarose (50 a 70ºBrix. A desidratação osmótica foi realizada em temperatura controlada (30 a 50ºC por até três horas. A adição de ácidos não influenciou significativamente na variação da cromaticidade. No entanto, a concentração da solução desidratante e a temperatura tiveram efeitos significativos no aumento da luminosidade do produto. A tensão na ruptura foi menor nas amostras processadas em relação à fruta fresca, porém a deformação na ruptura foi significativamente mais alta nas amostras tratadas com ácido lático a 50ºC, fornecendo produtos mais viscoelásticos, porém mais firmes.The combination of osmotic dehydration and weak acids addition is a mild process that results in a final product with organoleptic characteristics very similar to fresh and "ready to eat" fruit, appropriate for immediate consumption. The purpose of this work was to evaluate the influence of citric and lactic acids on the production of osmotically dehydrated melon and on its final quality. Melon (Cucumis melo inodorus, cultivar Gold Mine pieces of 40x30x15 mm were immersed in three types of dehydrating solutions (sucrose + citric acid, sucrose + lactic acid and control of different concentrations (50 to 70ºBrix. Osmotic dehydration was carried out for up to three hours under controlled temperature (30 to 50ºC. The addition
Effect of gamma radiation on the content β-carotene and volatile compounds of cantaloupe melon
International Nuclear Information System (INIS)
Souza, Stefania P. de; Cardozo, Monique; Lima, Keila dos S.C.; Lima, Antonio L. dos S.
2011-01-01
The Japanese melon or cantaloupe (Cucumis melo L.) is characterized by fruits with almost 1.0 Kg, pulp usually salmon and musky scent. The fruits when ripe are sensitive to post harvest handling. This low transport resistance and reduced shelf-life makes it necessary to delay the ripening of fruit. In this way the use of irradiation technique is a good choice. Irradiation is the process of exposing food to high doses of gamma rays. The processing of fruits and vegetables with ionizing radiation has as main purpose to ensure its preservation. However, like other forms of food processing, irradiation may cause changes in chemical composition and nutritional value. This study aims to assess possible changes in carotene content and volatile compounds caused by exposure of cantaloupe melon fruit to gamma irradiation. Irradiation of the samples occurred in Centro Tecnologico do Exercito (Guaratiba-RJ), using Gamma irradiator (Cs 137 source, dose rate 1.8 kGy/h), being applied 0.5 and 1.0 kGy doses and separated a control group not irradiated. Carotenoids were extracted with acetone and then suffered partition to petroleum ether, solvent was removed under nitrogen flow and the remainder dissolved in acetone again. The chromatographic analysis was performed using a Shimadzu gas chromatograph, with C30 column. For volatile compounds, we used gas chromatography (GC) associated with mass (MS). As a result, it was verified in analysis of carotenoids that cantaloupe melon is rich in β-carotene. Both total content of carotenoids and specific β-carotene amount wasn't suffer significant reduction in irradiated fruits at two doses, demonstrating that the irradiation process under these conditions implies a small loss of nutrients. The major volatile compounds were: 2-methyl-1-butyl acetate, ethyl hexanoate, n-hexyl acetate, benzyl acetate, 6-nonenyl acetate and α -terpinyl acetate. For all compounds we observed an increase in the volatile content in 0.5 kGy ranging from 0.8 to 9
Effect of gamma radiation on the content {beta}-carotene and volatile compounds of cantaloupe melon
Energy Technology Data Exchange (ETDEWEB)
Souza, Stefania P. de; Cardozo, Monique; Lima, Keila dos S.C.; Lima, Antonio L. dos S., E-mail: keila@ime.eb.br, E-mail: santoslima@ime.eb.br [Departamento de Quimica - IME - Instituto Militar de Engenharia, RJ (Brazil)
2011-07-01
The Japanese melon or cantaloupe (Cucumis melo L.) is characterized by fruits with almost 1.0 Kg, pulp usually salmon and musky scent. The fruits when ripe are sensitive to post harvest handling. This low transport resistance and reduced shelf-life makes it necessary to delay the ripening of fruit. In this way the use of irradiation technique is a good choice. Irradiation is the process of exposing food to high doses of gamma rays. The processing of fruits and vegetables with ionizing radiation has as main purpose to ensure its preservation. However, like other forms of food processing, irradiation may cause changes in chemical composition and nutritional value. This study aims to assess possible changes in carotene content and volatile compounds caused by exposure of cantaloupe melon fruit to gamma irradiation. Irradiation of the samples occurred in Centro Tecnologico do Exercito (Guaratiba-RJ), using Gamma irradiator (Cs{sub 137} source, dose rate 1.8 kGy/h), being applied 0.5 and 1.0 kGy doses and separated a control group not irradiated. Carotenoids were extracted with acetone and then suffered partition to petroleum ether, solvent was removed under nitrogen flow and the remainder dissolved in acetone again. The chromatographic analysis was performed using a Shimadzu gas chromatograph, with C30 column. For volatile compounds, we used gas chromatography (GC) associated with mass (MS). As a result, it was verified in analysis of carotenoids that cantaloupe melon is rich in {beta}-carotene. Both total content of carotenoids and specific {beta}-carotene amount wasn't suffer significant reduction in irradiated fruits at two doses, demonstrating that the irradiation process under these conditions implies a small loss of nutrients. The major volatile compounds were: 2-methyl-1-butyl acetate, ethyl hexanoate, n-hexyl acetate, benzyl acetate, 6-nonenyl acetate and {alpha} -terpinyl acetate. For all compounds we observed an increase in the volatile content in 0.5 k
Maietti, Annalisa; Tedeschi, Paola; Stagno, Caterina; Bordiga, Matteo; Travaglia, Fabiano; Locatelli, Monica; Arlorio, Marco; Brandolini, Vincenzo
2012-06-01
Two morphologically different cultivars of Italian melons (Baggio and Giusto) were characterized considering samples harvested in different times, at the beginning (BPP) and at the end of the physiological plant production period (EPP). Proximate composition, protein, minerals, pH, phenolic content, antioxidant capacity, ascorbic acid, carotenoids, condensed tannins, and flavonoids were measured, showing a significant decrease in EPP samples (phenolics, antioxidant capacity, condensed tannins, and flavonoids); ascorbic acid decreased in Giusto cv, carotenoids in Baggio cv. Mineral content increased in either the cultivars (EPP samples). Year-to-year difference was significantly highlighted; the plant growing cycle significantly affected the chemotype. Despite these effects, the Principal Component Analysis (PCA) permitted the discrimination of Baggio from Giusto cv, and the discrimination of BPP from EPP samples as well. © 2012 Institute of Food Technologists®
Manjuladevi, M.; Anitha, R.; Manonmani, S.
2018-03-01
The adsorption of Cr(VI), Ni(II), Cd(II) and Pb(II), ions from aqueous solutions by Cucumis melo peel-activated carbon was investigated under laboratory conditions to assess its potential in removing metal ions. The adsorption behavior of metal ions onto CMAC was analyzed with Elovich, intra-particle diffusion rate equations and pseudo-first-order model. The rate constant of Elovich and intra-particle diffusion on CMAC increased in the sequence of Cr(VI) > Ni(II) > Cd(II) > Pb(II). According to the regression coefficients, it was observed that the kinetic adsorption data can fit better by the pseudo-first-order model compared to the second-order Lagergren's model with R 2 > 0.957. The maximum adsorption of metal ions onto the CMAC was found to be 97.95% for Chromium(VI), 98.78% for Ni(II), 98.55% for Pb(II) and 97.96% for Cd(II) at CMAC dose of 250 mg. The adsorption capacities followed the sequence Ni(II) ≈ Pb(II) > Cr(VI) ≈ Cd(II) and Ni(II) > Pb(II) > Cd(II) > Cr(VI). The optimum adsorption conditions selected were adsorbent dosage of 250 mg, pH of 3.0 for Cr(VI) and 6.0 for Ni(II), Cd(II) and Pb(II), adsorption concentration of 250 mg/L and contact time of 180.
Directory of Open Access Journals (Sweden)
Luiz V. E. Villela Junior
2003-04-01
Full Text Available Objetivando-se o aproveitamento do efluente de biodigestor no cultivo hidropônico do meloeiro, desenvolveu-se a presente pesquisa. O experimento foi conduzido no Departamento de Engenharia Rural da Faculdade de Ciências Agrárias e Veterinárias da UNESP, campus de Jaboticabal, cultivando-se o meloeiro (Cucumis melo L. cv. Bonus nº 2. O delineamento experimental utilizado foi em blocos casualisados, com 6 repetições, cujos tratamentos foram: 1 cultivo hidropônico em sistema fechado tipo NFT ("nutrient film technique" com uso de solução nutritiva organo-mineral (biofertilizante com complementação mineral; 2 cultivo hidropônico em sistema fechado tipo NFT, com uso de solução nutritiva 100% mineral; 3 cultivo hidropônico em sistema aberto, com substrato e solução nutritiva organo-mineral e 4 cultivo hidropônico em sistema aberto, com substrato e solução nutritiva 100% mineral. O biofertilizante e o substrato foram obtidos a partir do efluente de biodigestor, produzido com estrume bovino. As plantas cultivadas no tratamento 1 tiveram desenvolvimento prejudicado, devido ao acúmulo de partículas sólidas junto ao sistema radicular. O tratamento 2 proporcionou às plantas desenvolvimento vegetativo mais rápido e maior produtividade. Os frutos produzidos no tratamento 2 apresentaram maior peso, formato mais alongado e maior teor de sólidos solúveis totais. A substituição parcial de adubos minerais por biofertilizante mostrou-se possível em sistema hidropônico aberto com substrato.With the objective to use effluent of biodigestor in the hydroponic cultivation, an experiment was conducted in the Department of Rural Engineering Faculty of Agricultural and Veterenary Sciences of UNESP, campus of Jaboticabal where a melon crop (Cucumis melo L. cv. Bonus nº 2 was cultivated. The experimental design used was a randomized blocks, with 6 repetitions and the treatments studied were: 1 hydroponic cultivation in closed system type NFT
Directory of Open Access Journals (Sweden)
K. Arabsalmani
2013-06-01
Full Text Available To investigate the effect of ethephon on control of male flowers in melon, a split plot experiment, with randomized complete blocks design and three replications, was conducted in Agricultural and Natural Resources Research Center of Varamin, Iran, during 2005-2006. The main factor included three levels of plant growth stage (3-leaf, 6-leaf and early reproductive stage and sub-plots included four ethephon levels (0, 100, 200 and 300 mg/L. The appearance time of female flowers, number of male and female flowers (7 and 14 days after application of ethephon, total yield and female/male flowers ratio were evaluated. Results showed that plant response to increasing concentration of ethephon depends on plant growth stage. By using the ethephon concentrations of 100, 200 and 300 mg/L, the emergence of female flowers was delayed 6, 13 and 15 days, respectively, in comparison to control. The highest yield (26430 kg/ha was obtained with spraying of 200 mg/L ethephon in trifoliate plants. In this case, the ratio of female to male flowers was highest (81.5%. A high dose of ethephon (over 200 mg/L was associated with reduced yield and ratio of female to male flowers, at all stages of plant growth, especially in reproductive growth stage. The results this research showed that the beneficial effects of ethephon application is possible only if the right time is chosen with respect to plant growth.
Directory of Open Access Journals (Sweden)
Gökhan Baktemur
2013-01-01
Full Text Available Irradiated pollen technique is the most successful haploidization technique within Cucurbitaceae. After harvesting of fruits pollinated with irradiated pollen, classical method called as “inspecting the seeds one by one” is used to find haploid embryos in the seeds. In this study, different methods were used to extract the embryos more easily, quickly, economically, and effectively. “Inspecting the seeds one by one” was used as control treatment. Other four methods tested were “sowing seeds direct nutrient media,” “inspecting seeds in the light source,” “floating seeds on liquid media,” and “floating seeds on liquid media after surface sterilization.” Y2 and Y3 melon genotypes selected from the third backcross population of Yuva were used as plant material. Results of this study show that there is no statistically significant difference among methods “inspecting the seeds one by one,” “sowing seeds direct CP nutrient media,” and “inspecting seeds in the light source,” although the average number of embryos per fruit is slightly different. No embryo production was obtained from liquid culture because of infection. When considered together with labor costs and time required for embryo rescue, the best methods were “sowing seeds directly in the CP nutrient media“ and ”inspecting seeds in the light source.”
Directory of Open Access Journals (Sweden)
Luiz Di Souza
2016-07-01
Full Text Available The evaluation parameters such as heavy metals and pesticides molecules in aquatic environments, facilitates the determination of the level of pollution by subsidizing their identification and origin. The melon (Cucumis melo L. is one of the vegetable crops of greater economic importance in Brazil, especially in the Northeast, and the main factors contributing to its production, are associated with particular climatic conditions such as high temperatures, high luminosity and low soil moisture. The agricultural pole of the city of Mossoro is the largest melon producer in the region making it one of the largest consumers of imidacloprid (I of the country due to its use in pest control whitefly. Thus, in order to maintain the quality standards of water resources and due to deficiency of information on the presence of pesticides in the aquatic environment of the area surveyed and on the environmental liabilities generated by activity of melon for the rivers of the region, this work determined the concentration of I in the Carmo River water and sediment. The results found in water and sediments are high and influenced by human activities, especially monoculture melon and may be causing serious environmental problems of the river fauna. DOI: http://dx.doi.org/10.17807/orbital.v8i4.792
Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; Castellanos Serrano, María Teresa
2014-05-01
In Spain, large quantities of wine are produced every year (3,339,700 tonnes in 2011) (FAO, 2011) with the consequent waste generation. During the winemaking process, solid residues like grape stalks are generated, as well as grape marc and wine lees as by-products. According to the Council Regulation (EC) 1493/1999 on the common organization of the wine market, by-products coming from the winery industry must be sent to alcohol-distilleries to generate exhausted grape marc and vinasses. With an adequate composting treatment, these wastes can be applied to soils as a source of nutrients and organic matter. A three-year field experiment (2011, 2012 and 2013) was carried out in Ciudad Real (central Spain) to study the effects of wine-distillery waste compost application in a melon crop (Cucumis melo L.). Melon crop has been traditionally cultivated in this area with high inputs of water and fertilizers, but no antecedents of application of winery wastes are known. In a randomized complete block design, four treatments were compared: three compost doses consisted of 6.7 (D1), 13.3 (D2) and 20 t compost ha-1 (D3), and a control treatment without compost addition (D0). The soil was a shallow sandy-loam (Petrocalcic Palexeralfs) with a depth of 0.60 m and a discontinuous petrocalcic horizon between 0.60 and 0.70 m, slightly basic (pH 8.4), poor in organic matter (0.24%), rich in potassium (410 ppm) and with a medium level of phosphorus (22.1 ppm). During each growing period four harvests were carried out and total and marketable yield (fruits weighting cycle, four plants per treatment were sampled and the nutrient content (N, P and K) was determined. Soil samplings (0-30 cm depth) were carried before the application of compost and at the end of each growing season and available N and P, as well as exchangeable K content were analyzed. With this information, an integrated analysis was carried out with the aim to evaluate the suitability of this compost as organic
Directory of Open Access Journals (Sweden)
Patrícia Lígia Dantas de Morais
2004-12-01
Full Text Available Avaliou-se o potencial de vida útil pós-colheita de melões (Cucumis melo L. tipo Galia (genótipos Primal, Solarking, Total e Vicar. Utilizou-se o delineamento inteiramente casualizado em esquema fatorial 4 (genótipos x 4 (tempos de armazenamento: 0, 3, 6 e 9 dias, com três repetições. Os frutos foram colhidos no estádio de maturação IV (predominantemente amarelo e armazenados à temperatura de 20 ± 1ºC e umidade relativa de 50 ± 2%. O genótipo Solarking apresentou uma firmeza média de polpa superior aos demais, do inicio ao final do período de armazenamento. Em todos os genótipos, os valores de sólidos solúveis no início do armazenamento encontraram-se dentro da faixa aceitável para comercialização no mercado externo, havendo pouca variação com o decorrer do período de armazenamento. A aparência interna limitou o tempo de vida útil pós-colheita do genótipo Total em apenas seis dias. Os genótipos Solarking, Vicar e Primal apresentaram maior potencial na conservação pós-colheita, principalmente o híbrido Solarking, que chegou aos nove dias de armazenamento com boa aparência interna.The postharvest life span of Galia (genotypes Primal, Solarking, Total, and Vicar melons (Cucumis melo L. was evaluated by a four (genotypes x four (storage periods: 0, 3, 6, and 9 days factorial experiment, in a completely randomized design with three replications. The fruits were harvested at maturation stage IV (yellow color predominance, and stored under 20 ± 1ºC and HR 50 ± 2%. Solarking's average firmness was better than that of the other genotypes during the experimental period. At the beginning of the experiment all genotypes had soluble solids contents at the level (eight to ten percent required for exportation, with these levels varying slightly during storage. The internal aspect limited to six days the postharvest life span of genotype Total. Solarking, Vicar, and Primal showed great postharvest conservation potential
Oliveira, Frederico I C DE; Fiege, Leonardo B C; Celin, Elaine F; Innecco, Renato; Nunes, Glauber H S; Aragão, Fernando A S DE
2017-01-01
Melon is one of the most important vegetable crops in the world. With short cycle in a system of phased planting, phytosanitary control is compromised, and a great volume of agricultural chemicals is used to control vegetable leafminer. Genetic control is an ideal alternative to avoid the damage caused by this insect. Thus, the aim of this study was to evaluate Cucumis accessions in regard to resistance to leafminer and correlate the variables analyzed. Fifty-four accessions and four commercial hybrids of melon were tested. The study was divided into two experiments: with and with no choice. The following characteristics were evaluated: with choice, in field - subjective score based on the infestation and the number of mines per leaf; and with no choice, in cage - number of mines per leaf, chlorophyll content, and leaf colorimetry. The results showed variability among the accessions and some genotypes showed favorable results for resistance in both experiments. There was correlation between the two variables in the experiment in the field. The accessions CNPH 11-282, CNPH 06-1047, and CNPH 11-1077 are the most recommended for future breeding programs with aim on introgression of resistance to vegetable leafminer in melon.
International Nuclear Information System (INIS)
Siqueira, Alessandra A.Z. Cozzo de; Matraia, Clarice; Walder, Julio Marcos M.; Spoto, Marta H.F.; Silva, Paula P.M. da; Maretti, Marina S.
2005-01-01
The Brazilian fruit culture is an alternative to minimize the lack-of-food problem using management and post harvest appropriate techniques. Gamma radiation technology is a possible technique used for food, enlarging its shelf-life, eliminating pathogenic microorganisms and in the quarantine treatment. The irradiation with seven doses (150,300,450,600,750 and 900 Gy) was used in Cantaloupe melon (Cucumis melon var. Cantaloupensis) aiming to establish the minimum, maximum and ideal doses, according to Brazilian laws, analyzing weight, color, firmness, pulp and juice quantity and sensory aspects, using the Difference Control Test. The results indicate that storage influenced significantly the weight, color and pulp quantity parameters. Doses higher than 450 Gy however influenced the firmness, juice quantity and sensory aspects characteristics. These results are indicating that the minimum dose was 150 Gy, the maximum dose was 900 Gy and the ideal dose for the quarantine treatment and to increase shelf-life of the Cantaloupe melon was 450 Gy. The data obtained allowed us to conclude that the ionizing radiation can increase the shelf-life of the Cantaloupe melon using doses up to 450 Gy making it proper to exportation. (author)
Singh, Nidhi; Sudandiradoss, C; Abraham, Jayanthi
2016-12-01
The work presented here attempts to screen for the presence of 4-Hydroxy-2,5-dimethyl-3(2H)-furanone in fruits and also any bioactive potential present in the fruit extracts. Curcurbita melo was selected for the study, and the fruit was crushed, filtered and extracted with ethyl acetate as the solvent. The resulting extract was subjected to disk diffusion test using Kirby Bauer method for checking its antimicrobial potential. Melon extract showed promising results against different clinical pathogens, 19-mm zone being the largest against Klebsiella pneumoniae and 17 mm against Shigella dysenteriae. GC-MS data of the melon extract confirmed the existence of furanone derivative in the extract. To evaluate the antimicrobial activity, in silico studies were performed using AutoDock 4.0 software, and topoisomerase was used as the target protein molecule for the isolated compound and 3-methyl-2-(2-oxopropyl)furan as the ligand. Further, the results were interpreted using PyMol and Ligplot plus softwares. The results confirmed the presence of molecular interactions between the protein molecule and the ligand. It can be envisaged that these interactions are responsible for the inhibitory effects of the extract .
2011-01-01
Background Fusarium oxysporum f. sp. melonis Snyd. & Hans. (FOM) causes Fusarium wilt, the most important infectious disease of melon (Cucumis melo L.). The four known races of this pathogen can be distinguished only by infection on appropriate cultivars. No molecular tools are available that can discriminate among the races, and the molecular basis of compatibility and disease progression are poorly understood. Resistance to races 1 and 2 is controlled by a single dominant gene, whereas only partial polygenic resistance to race 1,2 has been described. We carried out a large-scale cDNA-AFLP analysis to identify host genes potentially related to resistance and susceptibility as well as fungal genes associated with the infection process. At the same time, a systematic reisolation procedure on infected stems allowed us to monitor fungal colonization in compatible and incompatible host-pathogen combinations. Results Melon plants (cv. Charentais Fom-2), which are susceptible to race 1,2 and resistant to race 1, were artificially infected with a race 1 strain of FOM or one of two race 1,2 w strains. Host colonization of stems was assessed at 1, 2, 4, 8, 14, 16, 18 and 21 days post inoculation (dpi), and the fungus was reisolated from infected plants. Markedly different colonization patterns were observed in compatible and incompatible host-pathogen combinations. Five time points from the symptomless early stage (2 dpi) to obvious wilting symptoms (21 dpi) were considered for cDNA-AFLP analysis. After successful sequencing of 627 transcript-derived fragments (TDFs) differentially expressed in infected plants, homology searching retrieved 305 melon transcripts, 195 FOM transcripts expressed in planta and 127 orphan TDFs. RNA samples from FOM colonies of the three strains grown in vitro were also included in the analysis to facilitate the detection of in planta-specific transcripts and to identify TDFs differentially expressed among races/strains. Conclusion Our data
International Nuclear Information System (INIS)
Asakura, T.
1998-01-01
Measurements of evapotranspiration taken in the summer and winter on netted melon crops grown under glass were taken to characterize seasonal and daily changes. The data were compared to meteorological and plant-related factors to seek some relationships. Evapotranspiration followed a sigmoid curve until one week after pollination, and then decreased gradually during fruit growth. Cumulative evapotranspirations after transplanting were about 116 kg and 60 kg, respectively, for the summer and winter crops, whereas the peak evapotranspirations were 3.O kg plant(-1) day(-1) and 1.3 kg plant(-1) day(-1). The rapid increase h the evapotranspiration during the early stage was associated with the increase in leaf area; its gradual decrease during fruit growth was associated with a decrease in the transpiration potential of leaves. Therefore, irrigation amounts should be increased with leaf development and decreased with fruit growth. The curve of solar radiation in sunny summer days peaked at noon, whereas vapor pressure deficit usually peaked in early or mid afternoon; evapotranspirations in the afternoon had higher values than had those in the morning. In winter, vapor pressure deficit was relatively high during late afternoon and early morning because of heating, whereas it was low during the remainder of the day on account of low ventilation. These fluctuations led to a weak correlation between evapotranspiration and vapor pressure deficit. Regression analyses indicated that solar radiation was a main meteorological factor affecting evapotranspiration
Polyphasic analysis of Acidovorax citrulli strains from northeastern Brazil
Directory of Open Access Journals (Sweden)
Kirley Michele Marques Silva
2016-06-01
Full Text Available ABSTRACT Bacterial fruit blotch (BFB of cucurbit plants is caused by Acidovorax citrulli and represents a serious concern to melon (Cucumis melo L. growers worldwide, including those in Brazil. Thirty-four A. citrulli strains from different melon production areas of northeastern Brazil were characterized for their virulence on melon fruits and their substrate utilization and molecular profiles. Based on the analysis of BFB severity on melon fruits, the A. citrulli strains were divided into three groups, classified as mildly, moderately or highly virulent. Although host-related groups were not observed, the watermelon and ‘melão-pepino’ strains exhibited only low or moderate virulence on melon fruit. Substrate utilization profiles revealed that 94 % of the 95 tested compounds were used by A. citrulli strains as a carbon source. Overall, based on substrate utilization, low variability was observed with no relationship to host of origin. The formation of one group of A. citrulli strains based on Repetitive Sequence-based PCR (rep-PCR analysis confirmed the low variability observed in the substrate utilization analyses. Bayesian inference based on the analysis of 23S rDNA partial sequence data resulted in one well-supported clade and clustered the strains with the A. citrulli-type species with high posterior probability support. Based on the markers used, the Brazilian A. citrulli strains belong to a single group, which corresponds to the previously described Group I for this bacterium in the United States.
Directory of Open Access Journals (Sweden)
Emma Fernández-Crespo
2017-10-01
Full Text Available Unlike fungal and bacterial diseases, no direct method is available to control viral diseases. The use of resistance-inducing compounds can be an alternative strategy for plant viruses. Here we studied the basal response of melon to Melon necrotic spot virus (MNSV and demonstrated the efficacy of hexanoic acid (Hx priming, which prevents the virus from systemically spreading. We analysed callose deposition and the hormonal profile and gene expression at the whole plant level. This allowed us to determine hormonal homeostasis in the melon roots, cotyledons, hypocotyls, stems and leaves involved in basal and hexanoic acid-induced resistance (Hx-IR to MNSV. Our data indicate important roles of salicylic acid (SA, 12-oxo-phytodienoic acid (OPDA, jasmonic-isoleucine, and ferulic acid in both responses to MNSV. The hormonal and metabolites balance, depending on the time and location associated with basal and Hx-IR, demonstrated the reprogramming of plant metabolism in MNSV-inoculated plants. The treatment with both SA and OPDA prior to virus infection significantly reduced MNSV systemic movement by inducing callose deposition. This demonstrates their relevance in Hx-IR against MNSV and a high correlation with callose deposition. Our data also provide valuable evidence to unravel priming mechanisms by natural compounds.
Directory of Open Access Journals (Sweden)
Andreya Kalyana de Oliveira
2008-01-01
Full Text Available This research was conducted to evaluate the physiological and sanity quality of melon (Cucumis melo L. seeds used in agricultural region Assu-Baraúna-Mosssó in the Rio Grande do Norte. For seed lots each from the hybrids Goldex and Vereda were used. Research was conducted at the Seed Analysis Laboratory and Irrigation Agricultural of the Department of Crop Science of the UFERSA from August 2006 to July 2007. The physiological quality was evaluated by the germination, first count germination, accelerated aging, emergence speed index, electrical conductivity and seedling emergence, beyond the seed moisture content. The sanity was determinated by the method of filter paper with freezer, in four replications with 100 seeds per lot and completly randomized design. From the results obtained, it was concluded that first count germination, accelerated aging, electrical conductivity and seedling emergence tests only identified low and high seed lot from the hybrids Goldex and Vereda. The electrical conductivity test is most indicated to estimation of melon seed physiological potential, it was also possible to reduce the imbibition period of seeds prior this test. The pathogens associated with melon seeds were Aspergillus spp., Fusarium sp. and Macrophomina sp. and the physiological quality of seeds was not affected with the microrganisms presence.
Directory of Open Access Journals (Sweden)
Luis Felipe Villani Purquerio
2005-07-01
Full Text Available O trabalho foi conduzido em ambiente protegido, na UNESP-FCAV, em Jaboticabal (SP, de junho a novembro de 2001, com o objetivo de avaliar a qualidade dos frutos do meloeiro (Cucumis melo var. reticulatus, híbrido Bônus nº2, cultivado em sistema hidropônico NFT, em função da concentração de nitrogênio na solução nutritiva (80; 140; 200 e 300 mg L-1 e do número de fruto por planta (2; 3; 4 e livre. O delineamento experimental foi de blocos ao acaso, em parcelas subdivididas, com seis repetições. O teor de sólidos solúveis totais e acidez total titulável foram maiores em frutos colhidos de plantas com menor número de frutos pré-estabelecidos. O aumento da concentração de N na solução nutritiva proporcionou aumento na acidez total titulável e nenhum efeito sobre o teor de sólidos solúveis totais. Houve redução nos diâmetros longitudinal, transversal e na espessura do mesocarpo com o aumento da concentração de N, bem como com o aumento do número de frutos por planta. O índice de formato de fruto manteve-se igual ou muito próximo a 1.The effect of nitrogen concentrations (80; 140; 200 and 300 mg L-1 and fruit number per plant (2; 3; 4 and free setting, on the quality of net melon fruits (Cucumis melo var. reticulatus, Bonus nº 2 hybrid was investigated. The experiment was carried out at UNESP-FCAV, Jaboticabal, Brazil, using a NFT hydroponic system, from June to November/2001. The experimental design was of randomized split plots, with six replications. Total soluble solids content and total acidity were higher in fruits harvested from plants with a smaller number of pre-set fruits. A slight increase was observed on total acidity due to the increase of nitrogen concentration in nutrient solution, without any significant effect on total soluble solids. An increase of the N concentration and the number of fruits per plant resulted in a reduction of fruit longitudinal and transversal diameters and pulp thickness. Fruit
Directory of Open Access Journals (Sweden)
Pahlevi A de Souza
2008-12-01
Full Text Available Objetivando avaliar a vida útil pós-colheita de melão tipo Charentais (Cucumis melo L. sob refrigeração, tratados com 1-MCP e associado ou não a atmosfera modificada (AM, foram conduzidos dois experimentos em laboratório da Embrapa Agroindústria Tropical, Fortaleza-CE. Os frutos foram provenientes da Agroindústria Nolem Comercial Importadora e Exportadora Ltda, localizada no Agropólo Mossoró Açu-RN. Os frutos foram tratados com 300 e 600 ppb de 1-MCP, em seguida, metade desses frutos foram embalados em filmes plásticos, mantendo-se frutos embalados sem aplicação de 1-MCP nas mesmas condições de armazenamento dos demais. Os melões foram armazenados por 21 dias sendo 14 dias (9±1ºC e 87±5% UR + 7 dias (22±2ºC e 70±5% UR. Em função da aparência externa, a vida útil pós-colheita dos frutos armazenados sob atmosfera modificada, com ou sem tratamento inicial de 1-MCP foi de 21 dias, enquanto que dos frutos tratados inicialmente apenas com 1-MCP foi de 19 dias. A aplicação do 1-MCP proporcionou redução na atividade respiratória e na produção de etileno, e maior retenção da firmeza da polpa, menor perda de massa e melhor aparência externa quando associado a atmosfera modificada. A atmosfera modificada, isoladamente, foi eficiente em reduzir a perda de massa e manter melhor aparência externa.Aiming to evaluate the postharvest shelf life of Charentais melon (Cucumis melo L. stored under refrigeration, the fruits were treated with 1-MCP, associated or not with modified atmosphere (MAP. Two experiments were carried out at the laboratory of Embrapa Agroindústria Tropical in Fortaleza, Brazil, analyzing the chemical and physic quality characteristics. The fruits were obtained at the Agroindústria Nolem Comercial Importadora e Exportadora Ltda, located in Mossoró Açu, Brazil. The fruits were treated with 300 and 600 nL L-1 of 1-MCP, half of those were wrapped in plastic films, which were wrapped without the use of 1
Directory of Open Access Journals (Sweden)
Ana Paula Matoso Teixeira
2008-01-01
Full Text Available Brazil produced 330,000 metric tons of melons in 2005, principally in the Northeast region where one of the most important melon pathogens is the powdery mildew fungus Podosphaera xanthii. The disease is controlled mainly by incorporating single dominant resistance genes into commercial hybrids. We report on linkage analysis of the Pm-1 resistance gene, introgressed from the AF125Pm-1 Cantalupensis Charentais-type breeding line into the yellow-fleshed melon (Group Inodorus breeding line AF426-S by backcrossing to produce the resistant line AF426-R, and the amplified fragment length polymorphism (AFLP marker M75/H35_155 reported to be polymorphic between AF426-S and AF426-R. Segregation analysis of M75/H35_155 using a backcross population of 143 plants derived from [AF426-R x AF426-S] x AF426-S and screened for resistance to P. xanthii race 1 produced a recombination frequency of 4.9%, indicating close linkage between M75/H35_155 and Pm-1. Using the same segregating population, the M75/H35_155 marker had previously been reported to be distantly linked to Prv¹, a gene conferring resistance to papaya ringspot virus-type W. Since M75/H35_155 is linked to Prv¹ at a distance of 40.9 cM it is possible that Pm-1 and Prv¹ are also linked.
Novel edible oil sources: Microwave heating and chemical properties.
Hashemi, Seyed Mohammad Bagher; Mousavi Khaneghah, Amin; Koubaa, Mohamed; Lopez-Cervantes, Jaime; Yousefabad, Seyed Hossein Asadi; Hosseini, Seyedeh Fatemeh; Karimi, Masoumeh; Motazedian, Azam; Asadifard, Samira
2017-02-01
The aim of this work was to investigate the effect of various microwave heating times (1, 3, 5, 10, and 15min) on the chemical properties of novel edible oil sources, including Mashhadi melon (Cucumis melo var. Iranians cv. Mashhadi), Iranian watermelon (Citrullus lanatus cv. Fire Fon), pumpkin (Cucurbita pepo subsp. pepo var. Styriaca), and yellow apple (Malus domestica cv. Golden Delicious) seed oils. The evaluated parameters were peroxide value (PV), conjugated diene (CD) and triene (CT) values, carbonyl value (CV), p-anisidine value (AnV), oil stability index (OSI), radical scavenging activity (RSA), total tocopherols, total phenolics, as well as chlorophyll and carotenoid contents. Results showed that extended microwave heating involves decreased quality of the seed oils, mainly due to the formation of primary and secondary oxidation products. Microwave heating time also affects the total contents of chlorophylls, carotenoids, phenolics and tocopherols, which clearly decrease by increasing the exposure time. The order of oxidative stability of the analyzed edible oils was pumpkin>Mashhadi melon>Iranian watermelon>yellow apple. The obtained results demonstrated the promising potential of these novel edible oils for different food applications. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Streck Nereu Augusto
2005-01-01
Full Text Available O meloeiro (Cucumis melo L. é uma hortaliça de alto valor econômico. A emissão de nós é um componente importante em modelos matemáticos de simulação do crescimento e desenvolvimento de culturas de hábito de crescimento decumbente como o meloeiro e outras cucurbitáceas. A emissão de nós pode ser calculada utilizando-se o conceito do plastocrono, que é o intervalo de tempo entre o aparecimento de nós sucessivos em uma haste de dicotiledôneas. Quando a soma térmica é usada como medida de tempo fisiológico em plantas, o plastocrono tem como unidades degreesC dia nó-1. Estudos anteriores mostraram que o plastocrono em meloeiro varia com o genótipo e a época de cultivo. Este trabalho teve por objetivo estimar o plastocrono em meloeiro transplantado em diferentes épocas de cultivo no interior de estufa plástica. Foram realizadas 12 épocas de semeadura e transplante no interior de uma estufa plástica de 10m X 25m, coberta com polietileno transparente de baixa densidade, localizada no Campo Experimental do Departamento de Fitotecnia da Universidade Federal de Santa Maria, RS. O híbrido utilizado foi o HY-MARK (grupo Cantaloupe. Em 12 plantas etiquetadas por época de transplante, contou-se o número de nós visíveis (NN na haste principal da planta duas vezes por semana. A soma térmica diária (STd, degreesC dia foi calculada levando-se em conta as temperaturas cardinais de aparecimento de nós em meloeiro (10, 34 e 45degreesC. A soma térmica acumulada (STa, degreesC dia, a partir da data de transplante das plântulas, foi calculada somando-se a STd. O plastocrono foi calculado como sendo o inverso do coeficiente angular da regressão linear entre NN e STa para cada época. O plastocrono calculado variou entre as épocas de cultivo de 13,4 a 21,8degreesC dia nó-1, com um valor médio de 18,6 (?2,3degreesC dia nó-1. Esta diferença de plastocrono entre as épocas de cultivo pode representar vários dias do calendário civil
African Journals Online (AJOL)
SAM
Pangalo with sericeous ovaries, and C. melo ssp. melo with pilose ones. At present, the most adopted classification of melon is that of Munger and Robinson. (1991) who divided the species into a single wild variety,. C. melo var. agrestis Naud., and six cultivated ones: var. cantalupensis Naud. also including former var.
International Nuclear Information System (INIS)
Flossdarf, A.
1988-01-01
This report is about of the Melo carboniferous basin which limits are: in the South the large and high Tupambae hill, in the west the Paraiso hill and the river mountains, in the North Yaguaron river basin to Candidata in Rio Grande del Sur in Brazil.
Agrobiodiversity Indices for Three Cucurbit Species in Khorasan- Razavi Province
Directory of Open Access Journals (Sweden)
Mehdi Nassiri Mahallati
2017-09-01
Full Text Available Introduction The deterioration of genetic resources of many field crops due to monoculture and other agricultural activities has been well documented. Estimates indicate that the introduction of new varieties has contributed at least 80% of the increase in crop production, yet, these gains have been offset by the loss of 90% of landraces. The importance of biodiversity in enhancing the sustainability of crop production in agroecosystems has been well acknowledged in the literature. This has been achieved by increasing the biodiversity at cropping systems, species, and variety levels, which corresponds to biodiversity at the ecosystem, species, and ecotype levels in natural ecosystems. Conservation of biodiversity is prerequisite for sustainable agroecosystems. In the past, diverse species, genotypes and varieties were used in agroecosystems that ensured their sustainability. At present, this approach has changed and new varieties have replaced old ones and on sustainability of systems has been negatively impacted. In the other word, agrobiodiversity or the variety of species in cropping systems has dropped rapidly. Materials and methods In this research, agrobiodiversity of melon (Cucumis.melo var. Inodorus, watermelon (Citrullus Vulgaris and cantaloupe (Cucumis.melo var. Cantaloupensis were evaluated at the genotype and variety levels. For this purpose necessary data including the number of cultivated genotypes or land races and cultivated area for each of them were collected from 25 counties of Khorasan Razavi province. Accurate data was gathered from the appropriate database and also by filling questionnaire for growing season of 2010-2011. Then spatial biodiversity indices of Simpson and Shannon, evenness, and similarity indices of Sorenson were calculated for three cucurbit crops. Results and discussion The results showed that from total cultivated area of cucurbit species in 2010-2011 growing season, 48, 30, 20 and 2 percent belonged to
Directory of Open Access Journals (Sweden)
Maria Cecília de Arruda
2003-04-01
Full Text Available O presente trabalho teve como objetivo determinar a temperatura de armazenamento e o tipo de corte que proporciona melhor manutenção da qualidade de melões minimamente processados. Melões rendilhados, híbrido Bonus II, foram processados em câmara fria a 12ºC. Os frutos foram cortados manualmente em 8 fatias longitudinais. Em um dos tratamentos, as fatias foram divididas em pedaços de aproximadamente 3 cm de base e, no outro tratamento, foram utilizadas fatias inteiras. O produto minimamente processado foi acondicionado em embalagem rígida de politereftalato de etileno e armazenado a 3; 6 e 9ºC. O delineamento experimental foi inteiramente casualizado em esquema fatorial. Foram realizadas análises físico-químicas e sensoriais a cada 3 dias, por um período de 9 dias. A coloração e o teor de sólidos solúveis totais não foram afetados pelos tratamentos. O produto armazenado a 3ºC manteve maiores valores de firmeza, independentemente do tipo de corte. A aparência foi considerada boa até o 9º dia de armazenamento e o aroma, até o 6º dia, para melões a 3ºC. Em todos os tratamentos, houve declínio das notas atribuídas ao sabor durante o armazenamento. Pelos resultados obtidos, conclui-se que a qualidade de melões minimamente processados pode ser mantida por 6 dias a 3ºC, independentemente do tipo de corte.The objective of this work was to determine the storage temperature and the cut type that provides the better maintenance of the quality of minimally processed melons (Cucumis melo L. var. reticulatus hybrid. Bonus II. Fruits were hand cut in 8 longitudinal slices in cold chamber at 12ºC. One of the slices was divided in 3cm pieces, in the other treatment whole slices were used. The product minimally processed was packed in rigid polyethylene terephthalate tray and stored at 3, 6 and 9ºC. The experimental design was completely randomized in factorial arrangement. The physical-chemical and sensorial characteristics were
Directory of Open Access Journals (Sweden)
Ma Concepción Reyes-Avalos
2017-01-01
Full Text Available Introducción : El melón es un fruto que tiene un corto periodo de almacenamiento. Una alternativa para extender este periodo es el uso de películas comestibles. En el presente estudio se evaluó el efecto de la aplicación de una película comestible de alginato de sodio - hidroxipropilmetilcelulosa - parafina (ALG - HPMC - PAR, sobre la calidad de melón Cantaloupe durante dos tipos de almacenamiento. Método : Frutos de melón Cantaloupe se cubrieron con una película comestible de alginato - hidroxipropilmetil celulosa - parafina (ALG - HPMC - PAR, y no cubiertos (CONTROL. Los melones se almacenaron por 21 días a 5ºC y 95% de humedad relativa (Hr. Cada siete días, los frutos se sometieron a análisis de índice de daños por frío, pérdida de peso, textura, y concentración de CO 2 y etileno d e la atmósfera interna del fruto. Además, para simular manejo comercial, al término de cada periodo de siete días en refrigeración, una muestra de melones era extraída del frigorífico y expuesta a condiciones ambientales de temperatura y humedad relativa ( 25ºC y 21 - 25% respectivamente durante tres días (almacenamiento combinado, y medidos los parámetros anteriormente mencionados. Resultados : La aplicación de la película comestible provocó que los frutos cubiertos tuvieran una mayor concentración de CO 2 y menor concentración de etileno en la atmósfera interna del fruto, contribuyendo a que los melones cubiertos mantuvieron su calidad por un mayor tiempo de almacenamiento, manteniéndose más firmes, con menor pérdida de peso y sufrir menor índice de daños por frío con respecto los frutos control. Discusión : Los resultados demuestran la factibilidad de la aplicación de películas comestibles para mantener la calidad del melón Cantaloupe almacenado en refrigeración y en almacenamiento combinado.
Cooling parameters for fruits and vegetables of different sizes in a hydrocooling system
Directory of Open Access Journals (Sweden)
Teruel Bárbara
2004-01-01
Full Text Available The cooling of fruits and vegetables in hydrocooling system can be a suitable technique. This work aimed to define cooling time for fruits and vegetables of different sizes, presenting practical indexes that could be used to estimate cooling time for produce with similar characteristics. Fruits (orange melon-Cucumis melo, mango-Mangifera indica, guava-Psidium guajava, orange-Citrus sinensis Osbeck, plum-Prunus domestica, lime-Citrus limon, and acerola-Prunus cerasus and vegetables (cucumber-Cucumis sativus, carrot-Daucus carota, and green bean-Phaseolus vulgaris, were cooled in a hydrocooling system at 1°C. The volume of fruits and vegetables ranged between 8.18 cm³ and 1,150.35 cm³, and between 13.06 cm³ and 438.4 cm³, respectively. Cooling time varied proportionally to produce volume (from 8.5 to 124 min for fruits, and from 1.5 to 55 min, for vegetables. The relationship between volume and time needed to cool fruits (from 1.03 min cm-3 to 0.107 min cm-3 and vegetables (from 0.06 min cm-3 to 0.12 min cm-3 is an index that could be used to estimate cooling time for fruits and vegetables with similar dimensions as those presented in this work.
Protein (Viridiplantae): 832567 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available NYNSMNASIEIKQQESCQTNINHESCMFSKCMGGMQRFAIPPLPSFEVEQLNVVQGSRHCLSPHFQNSLVTFISYQKEKES... ... 1003877:124 ... 3655:124 ... 3656:1142 ... PREDICTED: transcription factor bHLH143-like Cucumis melo MVGTDTWQLH
Protein (Viridiplantae): 128519 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 9:7 3650:7 ... 1003877:7 ... 3655:7 ... 3656:1095 ... PREDICTED: pectinesterase inhibitor-like Cucumis melo MANNSCLV...IVSLIGVLLFTIILNVASSNYVISTICSKSSNPPFCSSVLKSSGTTYLKGLAVYTLNLAHTNASKSLTLARSLATTTTNPQ
Directory of Open Access Journals (Sweden)
Luis Felipe V. Purquerio
2003-06-01
Full Text Available O trabalho foi conduzido em casa de vegetação, na UNESP em Jaboticabal (SP, de junho a novembro de 2001, com o objetivo de avaliar a produção do melão (Cucumis melo var. reticulatus, híbrido Bônus nº2, cultivado em sistema hidropônico NFT, em função da concentração de nitrogênio na solução nutritiva (80, 140, 200 e 300 mg L-1 e número de frutos por planta (2, 3, 4 e livre. O delineamento experimental utilizado foi o de blocos ao acaso, em parcelas subdivididas, com seis repetições. Aos 80 dias após o transplantio, foram observados 2, 3, 4 e 5,1 frutos por planta e, posteriormente na colheita, 2, 2,9, 3,0 e 3,4 frutos por planta, respectivamente para os tratamentos com 2, 3, 4 e fixação livre, sendo esta redução atribuída ao abortamento de frutos. Houve redução no peso médio do 1º, 2º e 3º fruto colhido, com o aumento da concentração de nitrogênio. Plantas com o menor número de frutos, apresentaram maior peso médio dos mesmos, porém com menor produção por planta. A maior produção (2.474 g/planta foi obtida com 80 mg L-1 de nitrogênio na solução nutritiva.The effects of different nitrogen concentrations (80; 140; 200 and 300 mg L-1 and fruit number per plant (2; 3; 4 and free setting, were investigated on net melon production (Cucumis melo var. reticulatus, Bonus nº 2 hybrid. The experiment was carried out in Jaboticabal, São Paulo State, Brazil, in NFT hydroponic system, from June to November, 2001. The experimental design was of randomized split plots, replicated six times. At 80 days after seedling transplant 2; 3; 4 and 5.1 fruits per plant were found. However, at harvest there were 2; 2.9; 3.0 and 3.4 fruits per plant, relative to 2; 3; 4 and free setting per plant treatment. This observed fruit reduction was attributed to fruit abortion. With the increase of nitrogen concentrations a reduction in first, second and third fruit weight was found. Plants with fewer fruits, produced higher average
Recovery of surface bacteria from and surface sanitization of cantaloupes.
Barak, Jeri D; Chue, Bryan; Mills, Daniel C
2003-10-01
Practical, effective methods that could be implemented in a food service establishment (restaurant or delicatessen) for the surface sanitization of cantaloupes were microbiologically evaluated. Cantaloupes (Cucumis melo L. var. reticulates) were immersed in an inoculum containing Salmonella enterica serovar Poona or Pantoea agglomerans at ca. 10(4) to 10(5) CFU/ml. An efficient method for the recovery of bacteria from the cantaloupe surface was developed and validated. The method consisted of washing the entire melon with Butterfield's buffer containing 1% Tween 80 in a plastic bag placed inside a plastic pail affixed to an orbital shaker. Levels of S. enterica Poona recovered by washing the entire melon were significantly higher than those recovered by the more common laboratory method of blending the rind. P. agglomerans can be used as a non-pathogenic proxy for S. enterica Poona. A three-compartment surface sanitization method consisting of washing with an antimicrobial soap solution, scrubbing with a brush in tap water, and immersion in 150 ppm of sodium hypochlorite reduced the initial level of recoverable viable bacteria by 99.8%. When examined separately, scrubbing with a vegetable brush in tap water, washing with soap, and dipping in chlorine were found to reduce the bacterial load by 70, 80, and 90%, respectively.
Directory of Open Access Journals (Sweden)
Francesco Giovanni Ceglie
Full Text Available Peat replacement is an increasing demand in containerized and transplant production, due to the environmental constraints associated to peat use. However, despite the wide information concerning the use of alternative materials as substrates, it is very complex to establish the best materials and mixtures. This work evaluates the use of mixture design and surface response methodology in a peat substitution experiment using two alternative materials (green compost and palm fibre trunk waste for transplant production of tomato (Lycopersicon esculentum Mill.; melon, (Cucumis melo L.; and lettuce (Lactuca sativa L. in organic farming conditions. In general, the substrates showed suitable properties for their use in seedling production, showing the best plant response the mixture of 20% green compost, 39% palm fibre and 31% peat. The mixture design and applied response surface methodology has shown to be an useful approach to optimize substrate formulations in peat substitution experiments to standardize plant responses.
Directory of Open Access Journals (Sweden)
Manuel A. N. Vásquez
2005-04-01
Full Text Available O objetivo deste trabalho foi estudar o efeito do ambiente protegido cultivado com melão (Cucumis melo L. sobre os elementos meteorológicos e sua relação com as condições externas. O experimento foi conduzido no período de 5-10-2001 a 7-1-2002, em estufa plástica de 420 m², construída com estrutura metálica galvanizada, com dois vãos de altura central de 4,6 m e lateral de 3,0 m, composto de quatro janelas frontais, cobertas com filme de polietileno transparente de alta densidade, com aditivo ultravioleta e espessura de 150 µm. A irrigação foi efetuada por gotejamento, com lâmina total de 279,6 mm, manejada utilizando um minitanque instalado no interior do ambiente. Os elementos meteorológicos foram obtidos por sistema de aquisição automático instalado no interior do ambiente protegido e, externamente, com medidas da radiação global, temperatura e umidade relativa do ar. Verificou-se que a radiação solar global e a umidade relativa no ambiente protegido foram, em média, inferiores às condições externas, enquanto a temperatura foi superior no período analisado. A relação entre os elementos meteorológicos medidos externamente e no interior do ambiente protegido foi expressa por meio de equações de regressão linear e quadrática.The objective of this research was to study the effect of greenhouse cultivated with melon (Cucumis melo L. under meteorological elements and its relationship with external conditions. The study was carried out during the period of October 5, 2001 to January 7, 2002. The greenhouse had 420 m², constructed in galvanized metallic structure with two voids, height in the central part of 4.6 m and lateral of 3.0 m, having four front windows covered with a film of transparent polyethylene of high density with addictive ultraviolet and thickness of 150 µm. A drip irrigation system was used with a total water depth of 279.6 mm applied. The irrigation management was done through a small
Directory of Open Access Journals (Sweden)
Ariane Cordeiro de Oliveira
2007-08-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito de dois tipos de cortes (manual e mecânico nas características físico-químicas e microbiológicas do melão 'Cantaloupe' minimamente processado e refrigerado. Frutos com grau de maturação adequado foram selecionados, lavados, sanificados (200 ppm de cloro ativo/2 minutos e processados de acordo com o tipo de corte. Os frutos utilizados para o corte mecânico foram descascados em máquina descascadora e após a retirada das sementes, submetidos ao corte com auxílio de máquina de corte. Os destinados ao corte manual foram descascados e cortados com auxílio facas, colocados em imersão em solução de hipoclorito de sódio (20 ppm de cloro ativo por 30 segundos e acondicionados em embalagens flexíveis PET, armazenados a 4°C ± 1°C e avaliados a cada três dias por um período de 15 dias. Ao final dos experimentos, concluiu-se que para o processamento mínimo de melão 'Cantaloupe', o corte manual foi o mais indicado, por apresentar melhor estabilidade das características de cor, textura, pH, umidade e contagens microbiológicas durante o armazenamento.The purpose of this work was to evaluate the effect of two types of cutting (manual and mechanic on the physical-chemical and microbiological characteristics of processed and refrigerated 'Cantaloupe' melon. The fruits in the appropriate stage of ripening were selected, washed, sanitized (200ppm of active chlorine/2 minutes and processed in agreement with types of cutting. The fruits used for the mechanical cutting were cutting in peeling machine and after at retreat of the seeds, submitted to the cutting with aid of cutting machine. The fruits destined at manual cutting were peeled and cut with aid of knives, immerged in chlorinated water (20 mg.L-1 of active chlorine for 30 seconds and conditioned in PET flexible packing, stored at 4°C ± 1°C and were carried out each three days during 15 days. At the end of the experiments it was
International Nuclear Information System (INIS)
2009-01-01
Fusarium wilt is a vascular disease of the Cucurbitaceae family caused by the soil fungus Fusarium oxysporum f. sp. melonis (FOM), which is very detrimental to muskmelons (Cucumis melo L.). Fusarium wilt of melon is prevalent in temperate and tropical regions and causes a worldwide problem. FOM can survive in the soil for extended periods of time as chlamydospores, and is capable of colonizing crop residues and roots of most crops grown in rotation with melon. The only effective control is the use of resistant varieties. Four races of FOM have been identified, namely 0, 1, 2 and 1.2. Race 1.2 was further subdivided into race 1.2y and 1.2w, which cause yellowing and wilt symptoms, respectively. Two resistance genes (Fom-1 and Fom-2) have been identified in melons. Fom-1 confers resistance to FOM races 0 and 2, and Fom-2 confers resistance to races 0 and 1. These two genes are extensively used in breeding programmes, which can be assisted by marker assisted selection using markers linked to these resistance genes. No genes have been identified that confer resistance to race 1.2. However, polygenic recessive genes have been found to confer resistance to race 1.2 in Piboule genotypes. Melon production in Turkey is 1,700,000 tons and it is declining the year after year because of Fusarium wilt. Therefore, Fusarium wilt has a high economic importance in the cultivation of muskmelon in Turkey. In some parts of Turkey the prevalent races of this pathogen were determined. FOM has caused severe losses for farmers as our native cultivars are not resistant to this disease. It is believed our native cultivars will disappear if resistance to FOM is not introduced into the cultivated material. For this reason, many scientists in Turkey are focusing on research to develop new resistant cultivars via conventional and biotechnological breeding methods. In vitro techniques became widely spread during the 20th century, and their potential to make important contributions to plant
Xanthopoulou, Aliki; Ganopoulos, Ioannis; Psomopoulos, Fotis; Manioudaki, Maria; Moysiadis, Theodoros; Kapazoglou, Aliki; Osathanunkul, Maslin; Michailidou, Sofia; Kalivas, Apostolos; Tsaftaris, Athanasios; Nianiou-Obeidat, Irini; Madesis, Panagiotis
2017-07-30
The genetic basis of fruit size and shape was investigated for the first time in Cucurbita species and genetic loci associated with fruit morphology have been identified. Although extensive genomic resources are available at present for tomato (Solanum lycopersicum), cucumber (Cucumis sativus), melon (Cucumis melo) and watermelon (Citrullus lanatus), genomic databases for Cucurbita species are limited. Recently, our group reported the generation of pumpkin (Cucurbita pepo) transcriptome databases from two contrasting cultivars with extreme fruit sizes. In the current study we used these databases to perform comparative transcriptome analysis in order to identify genes with potential roles in fruit morphology and fruit size. Differential Gene Expression (DGE) analysis between cv. 'Munchkin' (small-fruit) and cv. 'Big Moose' (large-fruit) revealed a variety of candidate genes associated with fruit morphology with significant differences in gene expression between the two cultivars. In addition, we have set the framework for generating EST-SSR markers, which discriminate different C. pepo cultivars and show transferability to related Cucurbitaceae species. The results of the present study will contribute to both further understanding the molecular mechanisms regulating fruit morphology and furthermore identifying the factors that determine fruit size. Moreover, they may lead to the development of molecular marker tools for selecting genotypes with desired morphological traits. Copyright © 2017. Published by Elsevier B.V.
Technical Efficiency of Wet Season Melon Farming
Directory of Open Access Journals (Sweden)
Ananti Yekti
2017-03-01
Full Text Available Melon is one of high-value horticulture commodity which is cultivated widely in Kulon Progo regency. The nature of agricultural products is heavily dependent on the season, so it causes the prices of agricultural products always fluctuated every time. In wet season the price of agricultural products tends to be more expensive. Melon cultivation in wet season provide an opportunity to earn higher profits than in the dry season. The price of agricultural products tends to be more expensive in wet season, thus melon cultivation in wet season prospectively generate high profits. In order to achieve high profitability, melon farming has to be done efficiently. Objective of this study was to 1 determined the factors that influence melon production in wet season 2 measured technical efficiency of melon farming and 3 identified the factors that influanced technical efficiency. Data collected during April – June 2014. Location determined by multistage cluster sampling. 45 samples of farmers who cultivated melon during wet season obtained based on quota sampling technique. Technical efficiency was measured using Cobb-Douglas Stochastic Frontier. The result reveals that 1 land use, quantity of seed, K fertilizer contributed significantly increasing melon production, while N fertilizer decreased melon production significantly 2 technical efficiency indeces ranged from 0.40 to 0.99, with a mean of 0.77; 3 farmer’s experience gave significant influence to technical efficiency of melon farming in wet season.
Directory of Open Access Journals (Sweden)
C. Padín
2012-12-01
Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter
Directory of Open Access Journals (Sweden)
C. Padín
2012-01-01
Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter
Lifescience Database Archive (English)
Full Text Available QT98650 Cucumis sativus Cucurbitaceae Swf-1 resistance to Melon yellow spot virus ...resistance to Melon yellow spot virus MYSV-FuCu05P 3 SSR13109 Chr01 ... 29.0-55.6 10.5 ... 10.1007/s10681-015-1444-x ...
Lifescience Database Archive (English)
Full Text Available QT98651 Cucumis sativus Cucurbitaceae Swf-2 resistance to Melon yellow spot virus ...resistance to Melon yellow spot virus MYSV-FuCu05P 3 CSN251 Chr03 ... 34.0-56.0 11 ... 10.1007/s10681-015-1444-x ...
Lifescience Database Archive (English)
Full Text Available QT98652 Cucumis sativus Cucurbitaceae Swf-3 resistance to Melon yellow spot virus ...resistance to Melon yellow spot virus MYSV-FuCu05P 3 SSR6225 Chr04 ... 61.9-80.4 4.4 ... 10.1007/s10681-015-1444-x ...
Forney, Charles F; Fan, Lihua; Bezanson, Gregory S; Ells, Timothy C; LeBlanc, Denyse I; Fillmore, Sherry
2018-04-01
Rapid methods to detect bacterial pathogens on food and strategies to control them are needed to mitigate consumer risk. This study assessed volatile emissions from whole cantaloupe melons (Cucumis melo) as an indicator of Listeria contamination and in response to steam vapor decontamination. Cantaloupe were inoculated with Listeria innocua, a nonpathogenic surrogate for L. monocytogenes, then exposed to 85 °C steam for 240 s (4 min) followed by rapid chilling and storage for 0, 7, 10, or 14 days at 4, 7, or 10 °C. Volatile emissions from whole melons were collected on Carbopack B/Carboxen 1000 headspace collection tubes and analyzed by gas chromatography-mass spectroscopy following thermal desorption. Introduction of L. innocua to cantaloupe rind resulted in a reduction of aromatic compound emission. However, this response was not unique to Listeria contamination in that steam vapor treatment also reduced emission of these compounds. As well, steam vapor treatment diminished the number of viable Listeria and indigenous microflora while causing physiological injury to melon rind. Heat treatment had no significant effects on flesh firmness, color, titratable acidity, or soluble solids, but the production of typical aroma volatiles during postharvest ripening was inhibited. No unique volatile compounds were detected in Listeria contaminated melons. While changes in volatile emissions were associated with Listeria inoculation, they could not be differentiated from heat treatment effects. Results indicate that volatile emissions cannot be used as a diagnostic tool to identify Listeria contamination in whole cantaloupe melons. The detection of pathogen contamination on fresh produce is a continuing challenge. Using a nondestructive screening method, the presence of surrogate Listeria innocua on fresh whole cantaloupes was shown to alter the emissions of aromatic volatiles from whole cantaloupes. However, these altered emissions were not found to be unique to Listeria
Directory of Open Access Journals (Sweden)
Azusa Sasaki
2017-03-01
Conclusion: This demonstrated a new strategy to protect this heirloom vegetable from extinction by adding a new function that could increase its demand as a low-calorie fruit in the present diet habit for human health.
Tan, Sing P; Vuong, Quan V; Stathopoulos, Costas E; Parks, Sophie E; Roach, Paul D
2014-07-01
Bitter melon, Momordica charantia L. (Cucurbitaceae), aqueous extracts are proposed to have health-promoting properties due to their content of saponins and their antioxidant activity. However, the optimal conditions for the aqueous extraction of saponins from bitter melon and the effects of spray drying have not been established. Therefore, this study aimed to optimize the aqueous extraction of the saponins from bitter melon, using response surface methodology, prepare a powder using spray drying, and compare the powder's physical properties, components, and antioxidant capacity with aqueous and ethanol freeze-dried bitter melon powders and a commercial powder. The optimal aqueous extraction conditions were determined to be 40 °C for 15 min and the water-to-sample ratio was chosen to be 20:1 mL/g. For many of its physical properties, components, and antioxidant capacity, the aqueous spray-dried powder was comparable to the aqueous and ethanol freeze-dried bitter melon powders and the commercial powder. The optimal conditions for the aqueous extraction of saponins from bitter melon followed by spray drying gave a high quality powder in terms of saponins and antioxidant activity. This study highlights that bitter melon is a rich source of saponin compounds and their associated antioxidant activities, which may provide health benefits. The findings of the current study will help with the development of extraction and drying technologies for the preparation of a saponin-enriched powdered extract from bitter melon. The powdered extract may have potential as a nutraceutical supplement or as a value-added ingredient for incorporation into functional foods. © 2014 Institute of Food Technologists®
Geological map of Uruguay Esc 1,100,000. Melo Sheet D-15
International Nuclear Information System (INIS)
Ferrando, L.; Andreis, R.
1990-01-01
This work is about the geological map of Uruguay Esc.1.100.000 (Melo) and the explanatory memoranda which describes the geological , lithological and sedimentological characteristics soils belong to the pre devonian period in Melo, Buena Vista Yaguari and Tres islas formations. These metamorphic rocks would be compared with the orogenic cycle of the east and southeast groups
Genome-Wide Analysis of Simple Sequence Repeats in Bitter Gourd (Momordica charantia
Directory of Open Access Journals (Sweden)
Junjie Cui
2017-06-01
Full Text Available Bitter gourd (Momordica charantia is widely cultivated as a vegetable and medicinal herb in many Asian and African countries. After the sequencing of the cucumber (Cucumis sativus, watermelon (Citrullus lanatus, and melon (Cucumis melo genomes, bitter gourd became the fourth cucurbit species whose whole genome was sequenced. However, a comprehensive analysis of simple sequence repeats (SSRs in bitter gourd, including a comparison with the three aforementioned cucurbit species has not yet been published. Here, we identified a total of 188,091 and 167,160 SSR motifs in the genomes of the bitter gourd lines ‘Dali-11’ and ‘OHB3-1,’ respectively. Subsequently, the SSR content, motif lengths, and classified motif types were characterized for the bitter gourd genomes and compared among all the cucurbit genomes. Lastly, a large set of 138,727 unique in silico SSR primer pairs were designed for bitter gourd. Among these, 71 primers were selected, all of which successfully amplified SSRs from the two bitter gourd lines ‘Dali-11’ and ‘K44’. To further examine the utilization of unique SSR primers, 21 SSR markers were used to genotype a collection of 211 bitter gourd lines from all over the world. A model-based clustering method and phylogenetic analysis indicated a clear separation among the geographic groups. The genomic SSR markers developed in this study have considerable potential value in advancing bitter gourd research.
Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.
Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani
2015-06-01
Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Macronutrient composition of three cucurbit species cultivated for ...
African Journals Online (AJOL)
.) Matsum. & Nakai., Cucumeropsis mannii Naudin, and Cucumis melo var. agrestis L.] largely cultivated in Côte d'Ivoire and consumed as sauce thickeners were analyzed for their proximate composition and compared to a local landrace of ...
The effect of insecticide applications to melon crop on melon aphid and its natural enemies
International Nuclear Information System (INIS)
Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.
1999-01-01
Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less
Directory of Open Access Journals (Sweden)
Francisco de Q. Porto Filho
2011-11-01
Full Text Available Com o presente trabalho objetivou-se estudar os efeitos da irrigação com águas salinas em um solo cultivado com melão a evolução da salinidade e reação do solo. O experimento foi conduzido na Fazenda Santa Júlia, município de Mossoró, RN, em dois plantios consecutivos, no período de 2001 a 2002. As plantas de melão (Cucumis melo L. cv. AF646 foram irrigadas com água de salinidade 0,6 (testemunha; 1,9; 3,2 e 4,5 dS m-1 durante todo o ciclo (70 dias e de forma incremental, em três fases de desenvolvimento do meloeiro (1-30, 31-50, 51-70 dias após a semeadura - DAS. O delineamento experimental adotado foi em blocos ao acaso, com 15 tratamentos e quatro repetições. A salinidade e o pH do solo foram medidos no início e aos 30, 50 e 70 DAS, em amostras de solo coletadas nas camadas de 0-15, 15-30 e 30-45 cm. Observou-se maior acúmulo de sais no solo na camada superficial (até 15 cm em todos os níveis de salinidade e que a utilização de águas de maior salinidade aumentou a salinidade média no perfil do solo. Os valores médios de pH estiveram dentro da faixa ótima de absorção de nutrientes requerida para a cultura do melão, com pequena variação entre os tratamentos estudados.This work aimed to study the effects of irrigation with saline waters in an area cultivated with melon on soil salinity and pH. The experiment was conducted in the Santa Julia Farm, Mossoró city, Rio Grande do Norte State, Brazil, during the years 2001 to 2002. Water with different salinity levels (0.6; 1.9; 3.2 and 4.5 dS m-1 was used throughout the cycle and in incremental way in three periods of melon development, forming 15 treatments, arranged in randomized blocks with four replications. The salinity was measured at 0, 30, 50 and 70 days after sowing in soil samples collected in layers of 0-15, 15-30 and 30-45 cm. There was greater accumulation of salts in the surface layer (up to 15 cm in all salinity levels and the use of more saline water
Directory of Open Access Journals (Sweden)
Luiza Teixeira de Lima Brito
1999-10-01
Full Text Available Em Petrolina, PE, foi realizado um estudo com a cultura do melão (Cucumis melo L., cultivar Valenciano Amarelo, num Latossolo Vermelho-Amarelo, com o objetivo de avaliar o efeito de fontes de fósforo aplicadas convencionalmente (em fundação e via água de irrigação. O experimento consistiu de cinco tratamentos: 1. superfosfato simples; 2. MAP (fosfato monoamônico, aplicados pelo método convencional (em fundação; 3. MAP aplicado até 15 dias após a germinação; 4. MAP aplicado até 30 dias após a germinação e 5. MAP aplicado até 42 dias após a germinação. Nos tratamentos 3, 4 e 5 o MAP foi aplicado via água de irrigação. Os tratamentos receberam a mesma dosagem de fósforo (120 kg/ha de P2O5, conforme recomendado pela análise do solo. O delineamento experimental foi o de blocos casualizados, com quatro repetições. Constatou-se que as maiores produtividades de frutos comerciais foram obtidas com MAP (27,42 t/ha e com superfosfato simples (25,96 t/ha aplicados pelo método convencional, não diferindo do MAP aplicado via água de irrigação até 30 e 42 dias após a germinação, mas superando a produtividade de 19,47 t/ha obtida com o MAP aplicado via água de irrigação até 15 dias após a germinação. Verificou-se que as fontes de fósforo e os modos de aplicação não influenciaram no peso médio dos frutos (1,86 kg/fruto -- 89,40% dos frutos obtidos enquadraram-se nos tipos 6 e 8 -- e no teor de sólidos solúveis nos frutos por ocasião da colheita, cujos valores oscilaram entre 12,75 e 13,17º Brix.This study was carried out at Petrolina, PE, Brazil, with the objective of evaluating the effect of two sources of phosphorus applied conventionally and through trickle water irrigation on melon (Cucumis melo L., cv. Valenciano Amarelo. The experiment was run in a randomized complete blocks design, with four replications and five treatments: 1. simple superphosphate; 2. monoammonium phosphate (MAP applied
EFFECT OF BAP AND IAA ON SHOOT REGENERATION IN COTYLEDONARY EXPLANTS OF COSTA RICAN MELON GENOTYPES
Directory of Open Access Journals (Sweden)
Marta Valdez Melara
2009-01-01
Full Text Available Para establecer una metodología para la regeneración del melón criollo (Cucumis melo L, se investigó la influencia del genotipo (OSO-1, OSO-2, OSO- 3, PQRG-1, PQRG-2, PQRG-3, y EM-1 y la interacción de N6-bencilaminopurina (BAP (0,1, 0,5 y 1,0 mg.l-1 con ácido indolacético (AIA (0, 0,05 y 0,5 mg.l-1 en la inducción de brotes y regeneración de plantas. Independientemente de la concentración de BAP y AIA, el mayor porcentaje de formación de brotes se obtuvo en EM-1>OSO-1>PQRG-3>OSO-2>PQRG-2>PQRG-1>OSO-3. Por otra parte, independientemente del genotipo, el mayor porcentaje de formación de brotes se obtuvo con 0,5 mg.l-1 BAP y 0,05 mg.l-1 AIA o 1 mg.l-1 BAP y 0 mg.l-1 AIA. El protocolo de cultivo in vitro establecido puede ser utilizado para la micropropagación de genotipos "criollos" de melón.
International Nuclear Information System (INIS)
Gyamena, A. E
2013-07-01
Cucurbits are susceptible to over 35 plant viruses; each of these viruses is capable of causing total crop failure in a poorly managed virus pathosystem. The objectives of this study were to detect the viruses that infect six cucurbit species in the coastal savannah zone of Ghana and to describe the spatial and temporal spread patterns of virus epidemics in zucchini squash (Cucurbita pepo L.) by the use of mathematical and geostatistical models. Cucumber (Cucumis sativus L.), watermelon (Citrullus lanatus Thunb.), zucchini squash (Cucurbita pepo L.), butternut squash (Cucurbita moschata Duchesne), egushi (Citrullus colocynthis L. Schrad.) and melon (Cucumis melo L.) were grown on an experimental field in the coastal savannah zone of Ghana and were monitored for the expression of virus and virus-like symptoms. The observed symptoms were further confirmed by Double Antibody Sandwich Enzyme-Linked Immunosorbent Assay (DAS ELISA) and mechanical inoculation of indicator plants. The temporal spread patterns of virus disease in zucchini squash were analyzed by exponential logistic, monomolecular and gompertz mechanistic models. The spatial patterns of virus disease spread in zucchini squash field were analyzed by semivariograms and inverse distance weighing (IDW) methods. Cucumber, zucchini squash, melon and butternut squash were infected by both Cucumber mosaic virus (CMW) and Papaya ringspot virus (PRSV-W). Egushi was infected by CMW but not PRSV-W. None of the six cucurbit species were infected by Watermelon mosaic virus (WMV) or Zucchini yellow mosaic virus (ZYMV). The temporal pattern of disease incidence in the zucchini squash field followed the gompertz function with an average apparent infection rate of 0.026 per day. The temporal pattern of disease severity was best described by the exponential model with coefficient of determination of 94.38 % and rate of progress disease severity of 0.114 per day. As at 49 days after planting (DAP), disease incidence and
Bitter melon (Momordica charantia): a review of efficacy and safety.
Basch, Ethan; Gabardi, Steven; Ulbricht, Catherine
2003-02-15
The pharmacology, clinical efficacy, adverse effects, drug interactions, and place in therapy of bitter melon are described. Bitter melon (Momordica charantia) is an alternative therapy that has primarily been used for lowering blood glucose levels in patients with diabetes mellitus. Components of bitter melon extract appear to have structural similarities to animal insulin. Antiviral and antineoplastic activities have also been reported in vitro. Four clinical trials found bitter melon juice, fruit, and dried powder to have a moderate hypoglycemic effect. These studies were small and were not randomized or double-blind, however. Reported adverse effects of bitter melon include hypoglycemic coma and convulsions in children, reduced fertility in mice, a favism-like syndrome, increases in gamma-glutamyltransferase and alkaline phosphatase levels in animals, and headaches. Bitter melon may have additive effects when taken with other glucose-lowering agents. Adequately powered, randomized, placebo-controlled trials are needed to properly assess safety and efficacy before bitter melon can be routinely recommended. Bitter melon may have hypoglycemic effects, but data are not sufficient to recommend its use in the absence of careful supervision and monitoring.
Comparative physico-chemical and proximate analysis of oils of ...
African Journals Online (AJOL)
shyn
2015-08-05
Aug 5, 2015 ... of oils of Shea nut, Sesamum indicum, Cucurbita pepo,. Cucumis melo ..... 1.62 mgKOH/g) which is lower than that of olive oil 17. mgKOH/g (Oyedele ..... Oyedele AO (2002). The Skin Tolerance of Shea Fat Employed as.
ECHR Melo Tadeu: A Tax Case Which Should Bring on More Carefully Selected Criminal Procedures
Poelmann, E.
2016-01-01
The European Court of Human Rights (ECHR) judged in the Melo Tadeu case that the refusal of the authorities to undo the seizure of assets after a criminal acquittal, is disproportional, regardless whether the appeal was too late. The Melo Tadeu judgment implies mainly that the presumption of
Iovieno, Paolo; Andolfo, Giuseppe; Schiavulli, Adalgisa; Catalano, Domenico; Ricciardi, Luigi; Frusciante, Luigi; Ercolano, Maria Raffaella; Pavan, Stefano
2015-12-29
The powdery mildew disease affects thousands of plant species and arguably represents the major fungal threat for many Cucurbitaceae crops, including melon (Cucumis melo L.), watermelon (Citrullus lanatus L.) and zucchini (Cucurbita pepo L.). Several studies revealed that specific members of the Mildew Locus O (MLO) gene family act as powdery mildew susceptibility factors. Indeed, their inactivation, as the result of gene knock-out or knock-down, is associated with a peculiar form of resistance, referred to as mlo resistance. We exploited recently available genomic information to provide a comprehensive overview of the MLO gene family in Cucurbitaceae. We report the identification of 16 MLO homologs in C. melo, 14 in C. lanatus and 18 in C. pepo genomes. Bioinformatic treatment of data allowed phylogenetic inference and the prediction of several ortholog pairs and groups. Comparison with functionally characterized MLO genes and, in C. lanatus, gene expression analysis, resulted in the detection of candidate powdery mildew susceptibility factors. We identified a series of conserved amino acid residues and motifs that are likely to play a major role for the function of MLO proteins. Finally, we performed a codon-based evolutionary analysis indicating a general high level of purifying selection in the three Cucurbitaceae MLO gene families, and the occurrence of regions under diversifying selection in candidate susceptibility factors. Results of this study may help to address further biological questions concerning the evolution and function of MLO genes. Moreover, data reported here could be conveniently used by breeding research, aiming to select powdery mildew resistant cultivars in Cucurbitaceae.
Díaz, Aurora; Zarouri, Belkacem; Fergany, Mohamed; Eduardo, Iban; Álvarez, José M.; Picó, Belén; Monforte, Antonio J.
2014-01-01
A mapping F2 population from the cross ‘Piel de Sapo’ × PI124112 was selectively genotyped to study the genetic control of morphological fruit traits by QTL (Quantitative Trait Loci) analysis. Ten QTL were identified, five for FL (Fruit Length), two for FD (Fruit Diameter) and three for FS (Fruit Shape). At least one robust QTL per character was found, flqs8.1 (LOD = 16.85, R2 = 34%), fdqs12.1 (LOD = 3.47, R2 = 11%) and fsqs8.1 (LOD = 14.85, R2 = 41%). flqs2.1 and fsqs2.1 cosegregate with gene a (andromonoecious), responsible for flower sex determination and with pleiotropic effects on FS. They display a positive additive effect (a) value, so the PI124112 allele causes an increase in FL and FS, producing more elongated fruits. Conversely, the negative a value for flqs8.1 and fsqs8.1 indicates a decrease in FL and FS, what results in rounder fruits, even if PI124112 produces very elongated melons. This is explained by a significant epistatic interaction between fsqs2.1 and fsqs8.1, where the effects of the alleles at locus a are attenuated by the additive PI124112 allele at fsqs8.1. Roundest fruits are produced by homozygous for PI124112 at fsqs8.1 that do not carry any dominant A allele at locus a (PiPiaa). A significant interaction between fsqs8.1 and fsqs12.1 was also detected, with the alleles at fsqs12.1 producing more elongated fruits. fsqs8.1 seems to be allelic to QTL discovered in other populations where the exotic alleles produce elongated fruits. This model has been validated in assays with backcross lines along 3 years and ultimately obtaining a fsqs8.1-NIL (Near Isogenic Line) in ‘Piel de Sapo’ background which yields round melons. PMID:25126852
Genetic quality control in mass-reared melon flies
International Nuclear Information System (INIS)
Miyatake, T.
2002-01-01
Quality control in mass-reared melon flies, Bactrocera cucurbitae, after eradication is discussed, based on the results of artificial selection experiments. First, a brief history of quality control in mass-rearing of insects is described. In practical mass- rearing of melon fly, many traits have already been differentiated between mass-reared and wild flies. These differing traits are reviewed and the factors which caused these differences are considered. It was considered that the differences between wild and mass-reared melon flies depended on the selection pressures from the mass-rearing method. Next, the results of several artificial selection experiments using the melon fly are reviewed. Finally, consideration is given to some correlated responses to artificial selection in mass-rearing. Longevity that is correlated to early fecundity was successfully controlled by artificial selection for reproduction in the mass-rearing system. On the basis of these results, an improved method for quality control in mass-reared melon fly with considerations for quantitative genetics is discussed
Comparative physico-chemical and proximate analysis of oils of ...
African Journals Online (AJOL)
In rural areas of developing countries like Burkina Faso, nutritive elements are mainly composed of vegetable source. Shea nut, seeds of Sesamum indicum, Cucumis melo and Cucurbita pepo, four species widely consumed were studied. The proximate parameters: moisture, proteins and fat were analysed. Saponification ...
Cucumis sativus L, Nasim variety
African Journals Online (AJOL)
... practice for reducing water consumption and improving product quality. ... Since cucumbers (Cucumis sativus L, Nasim variety) is considered as the main and ... to a significant yield increase (P<0.001), while MAD of 50% had the least yield.
An insight into the sequential, structural and phylogenetic properties ...
Indian Academy of Sciences (India)
Prakash
composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.
Effects of foliar potassium fertilization on muskmelon fruit quality and yield
Consumer preference of many fruits and vegetables such as muskmelon [Cucumis melo L. (Reticulatus Group)] is determined by a few key quality traits such as sugar content, aroma and texture. These quality traits are directly related to adequate potassium (K) content in plant tissues. However, soil-...
Energy Technology Data Exchange (ETDEWEB)
Garcia, Victor O; Iriarte, Adolfo A [INENCO, Universidad Nacional de Catamarca, Catamarca (Argentina); Carabajal, Dante; Sabadzija, Gabriela; Tomalino, Luis [E.E.A. INTA, Catamarca, Catamarca (Argentina)
2000-07-01
Due to poor yielding capacity in the province of Catamarca, Argentina, it is necessary to improve solar drying systems in order to have a better quality final product. It is also essential to divide the costs of infrastructure with other complementary activities because of the need to make drying methods profitable. The system proposed in this work is a dryer-greenhouse with a double purposed macrotunnel greenhouse: during Winter it is used as a yielding system, and in Summer it is prepared to fulfill the functions of a solar dryer. The crops evaluated in winter were: small vegetable marrow (Curcubita maxima L), melon (Cucumis melo), ad cucumber (Cucuis sativus). Crop cycle, harvest time and tield in Kg/m were determined for each species. The assessment of the dryer was made using pepper for paprika observation of the thermal behavior of the product during drying and its final quality. The product obtained had a very good quality in color, taste and aroma with a classification of extra quality according to the Argentine Nutritional Code and the 7541 ISO Standard. Drying time decreased considerably compared to that observed in open air drying, 1995, 1996 and 1997 campaigns were economically assessed, and an evaluation of investments in five years was also conducted obtaining a positive VAN and a TIR above the cost of the best alternative for money expenditure. This integrated system is valid alternative in a sustainable production for small growers. [Spanish] Debido a las caracteristicas productivas de la Provincia de Catamarca Argentina, es necesario optimizar los procesos del secado solar teniendo en cuenta la calidad final del producto. Ademas, debido a la necesidad de rentabilizar los metodos de secado, imprescindible repartir los costos de infraestructura con otro tipo de actividad complementaria. El sistema propuesto en este trabajo es un invernadero secadero que utiliza un invernadero macrotunel que cumple una doble funcion, durante el invierno se usa como
Directory of Open Access Journals (Sweden)
Juan Antonio Martínez
2009-12-01
Full Text Available Postharvest disorders and rots can produce important economic losses in fruits stored for long time for exportation. The genetic and physiological basis of some disorders in melon (Cucumis melo L. are unknown and particularly the possible relation with climacteric behavior. A collection of melon near-isogenic lines (NILs (SC3-5 and seven more showing climacteric and two non-climacteric ripening pattern were analyzed to study genetic and physiological aspects of fruit disorders and rots. Two non-climacteric (Nicolás; Inodorus Group; and Shongwan Charmi PI161375, Conomon Group and two climacteric cultivars (Fado, Reticulatus Group; Védrantais, Cantaloupensis Group were used as reference. The field was divided in eight blocks containing one three-plant replication for each NIL, two for the parental cultivar Piel de Sapo and one or two for the reference cultivars. Replications evaluated were more than six in the cultivars studied. Plant problems included aphids, powdery mildew, and leaf wind injury. Preharvest fruit disorders included whole fruit cracking in cultivar Védrantais and NIL 5M2, and stylar-end cracking in cultivar Fado. Climacteric NILs with yellow skin were particularly affected by over-ripening, stylar-end cracking, and sunburn during cultivation. At harvest, two NILs showed slight placental tissue necrosis which was inherited from SC and were also detected after storage. Other uncommon disorders seen at harvest or 30 days after storage at 8ºC included warted skin (scarring, flesh discoloration (light brown or translucent areas, hollow flesh disorder, and deep furrow netting inherited from SC. Less common rots included grey mould, bacterial soft rot, Penicillium rot, cottony leak and internal Cladosporium rot. Stylar-end hardness below 20 N·mm-1 was associated with cracking and softening. The incidence of the disorders and rots was too low to confirm that the genetic component played a role in their development
African Journal of Biotechnology - Vol 14, No 31 (2015)
African Journals Online (AJOL)
Comparative physico-chemical and proximate analysis of oils of Shea nut, Sesamum indicum, Cucurbita pepo, Cucumis melo seeds commonly cultivated in West Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CAT Ouattara, MK Somda, R Moyen, AS Traore ...
Storage and irradiation of Cucumis pollen and their influence on pollen vitality
International Nuclear Information System (INIS)
Oost, E.H.; Nijs, A.P.M. den
1979-01-01
In connection with an interspecific hybridization programme and a mentor pollen experiment in Cucumis, the optimal storage conditions and in vitro germination medium for both fresh and irradiated pollen of the cultivated cucumber and two wild African Cucumis species have been searched for. (Auth.)
Directory of Open Access Journals (Sweden)
Silvana da Silva Cardoso
2010-02-01
Full Text Available For presenting more commercial value, the net melon (Cucumis melo L. var reticulatus Naud. has been an option of greenhouse planting for the horticulturists. This work was carried out in Piracicaba, Brazil with the aim of evaluating the nutrient uptake from this melon cultivated in greenhouse. To obtain the nutrients accumulation in the different stages of the plant development, plants were collected in the transplant day (seedling, in the vegetative stage, in the beginning of the flowering stage, in the beginning and in the middle of fruit production period and in the harvest period. It was verified that the greatest increase of nutrient uptake happened between the beginning of the flowering and the beginning of the fruit production. The greatest dry matter accumulation happened between the beginning of the fruit production and the middle of fruit production period. The decrescent order of nutrients accumulated in the above ground part of the plant was: potassium > nitrogen > calcium > magnesium > sulphur > phosphorus > iron > manganese > zinc > copper ~ boron. O objetivo do trabalho foi avaliar o acúmulo de nutrientes e o rendimento de óleo dos aquênios em plantas de girassol produzidas sob a influência do vigor dos aquênios e da densidade de semeadura. Para isto, foi instalado um experimento no campo experimental no município de Seropédica/RJ, em outubro de 2006, com três distintos lotes de aquênios de girassol cv Embrapa 122 V2000, classificados como de baixo, de médio e de alto vigor, sob duas densidades de semeadura (45.000 e 75.000 sementes ha-1. Aos 20, 60 e 100 dias após a semeadura (DAS, foram coletadas as plantas para avaliação da massa de matéria seca e do acúmulo de nitrogênio, de fósforo, de potássio e de cálcio, no caule, nas folhas e nos capítulos. Nas plantas coletadas aos 100 DAS, foi feita também a avaliação do rendimento de aquênios (kg ha-1, do teor de óleo e do rendimento de óleo (kg ha-1. Observou
Directory of Open Access Journals (Sweden)
Gilda Jiménez Montejo
2014-01-01
L. var. Poinsett and pumpkin (Cucurbita moschata Duch. var. INIVIT C-88 and melon (Cucumis melo L. var. Hale’s Best seeds were treated. The biological treatment showed decreasing diseases incidence and increasing root and leaves weighs and stem height, in the plant-pathogen-antagonist interactions tested; root colonization reached a range from 8,9- 8,0 and from 7,8-7, 0 log (ufc cm-1 root at 4 and 15 days after sowing. These results characterize the applied strains as Plant Growth Promoting Rhizobacteria (PGPR and make advisable the development of field trials.
Directory of Open Access Journals (Sweden)
M.V. Sánchez
2001-03-01
palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia y Corchorus orinocensis.Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families and 72 plant species (40 families were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families were colonized by A. gossypii and 16 (10 families are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.
Physicochemical Pro~rti~ of Curd Prepared from Melon Seeds
African Journals Online (AJOL)
Key~~;ds~ Mel6n curd, coagulati'an, protein, calcium, sulphate, acceptabilit:" . ' .' ~ I[. ,.} ..... from where they were prepared, Fat contents,~ar ied among ... Table 1: Chemical compositio'o ~f' Melon Seed Milk (IWSM) Raw Melon Curd RMC' .' -'.
Promise of bitter melon (Momordica charantia) bioactives in cancer prevention and therapy.
Raina, Komal; Kumar, Dileep; Agarwal, Rajesh
2016-10-01
Recently, there is a paradigm shift that the whole food-derived components are not 'idle bystanders' but actively participate in modulating aberrant metabolic and signaling pathways in both healthy and diseased individuals. One such whole food from Cucurbitaceae family is 'bitter melon' (Momordica charantia, also called bitter gourd, balsam apple, etc.), which has gained an enormous attention in recent years as an alternative medicine in developed countries. The increased focus on bitter melon consumption could in part be due to several recent pre-clinical efficacy studies demonstrating bitter melon potential to target obesity/type II diabetes-associated metabolic aberrations as well as its pre-clinical anti-cancer efficacy against various malignancies. The bioassay-guided fractionations have also classified the bitter melon chemical constituents based on their anti-diabetic or cytotoxic effects. Thus, by definition, these bitter melon constituents are at cross roads on the bioactivity parameters; they either have selective efficacy for correcting metabolic aberrations or targeting cancer cells, or have beneficial effects in both conditions. However, given the vast, though dispersed, literature reports on the bioactivity and beneficial attributes of bitter melon constituents, a comprehensive review on the bitter melon components and the overlapping beneficial attributes is lacking; our review attempts to fulfill these unmet needs. Importantly, the recent realization that there are common risk factors associated with obesity/type II diabetes-associated metabolic aberrations and cancer, this timely review focuses on the dual efficacy of bitter melon against the risk factors associated with both diseases that could potentially impact the course of malignancy to advanced stages. Furthermore, this review also addresses a significant gap in our knowledge regarding the bitter melon drug-drug interactions which can be predicted from the available reports on bitter melon
Hsieh, En-Jung; Waters, Brian M
2016-10-01
Iron (Fe) is an essential mineral that has low solubility in alkaline soils, where its deficiency results in chlorosis. Whether low Fe supply and alkaline pH stress are equivalent is unclear, as they have not been treated as separate variables in molecular physiological studies. Additionally, molecular responses to these stresses have not been studied in leaf and root tissues simultaneously. We tested how plants with the Strategy I Fe uptake system respond to Fe deficiency at mildly acidic and alkaline pH by measuring root ferric chelate reductase (FCR) activity and expression of selected Fe uptake genes and riboflavin synthesis genes. Alkaline pH increased cucumber (Cucumis sativus L.) root FCR activity at full Fe supply, but alkaline stress abolished FCR response to low Fe supply. Alkaline pH or low Fe supply resulted in increased expression of Fe uptake genes, but riboflavin synthesis genes responded to Fe deficiency but not alkalinity. Iron deficiency increased expression of some common genes in roots and leaves, but alkaline stress blocked up-regulation of these genes in Fe-deficient leaves. In roots of the melon (Cucumis melo L.) fefe mutant, in which Fe uptake responses are blocked upstream of Fe uptake genes, alkaline stress or Fe deficiency up-regulation of certain Fe uptake and riboflavin synthesis genes was inhibited, indicating a central role for the FeFe protein. These results suggest a model implicating shoot-to-root signaling of Fe status to induce Fe uptake gene expression in roots. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
PRELIMINARY NUTRITIONAL EVALUATION OF FIVE SPECIES OF ...
African Journals Online (AJOL)
pumpkin or squash gourd), Cucurbita moschata (musk melon), Lagenaria siceraria (bottle gourd or calabash) and Cucumis sativus (“Ibo” egusi). The moisture content was determined by drying in an oven to constant weight, crude protein content by ...
Directory of Open Access Journals (Sweden)
reihane Mesgari
2017-02-01
Full Text Available Introduction: Cucumber is one of the most important vegetable crops for the local consumption and exportation. The use of grafted vegetable seedlings has been popular in many countries during recent years. Growing fruit-bearing vegetables, chiefly tomato, cucumber and watermelon through grafted seedlings become a widespread practice worldwide. Grafting is a valuable technique to avoid soil-borne diseases, provide biotic and abiotic stress tolerance, enhance nutrient uptake, optimize water use, and increase fruit yield and quality. Vegetable grafting is a new topic in Iran and there are a limited number of studies on grafted vegetable production. However, attention to grafting by researchers has recently increased. Suitable rootstocks should be identified and characterized for the effective utilization of grafting. The rootstock's vigorous root system increases the efficiency of water and nutrient absorption, and may also serve as a source of endogenous plant hormones, thus leading to increased growth and yield in addition to disease control. In the present study, we investigated the response of two Cucurbita sp. and an Iranian melon as rootstocks for cucumber. Materials and methods: In order to study the effect of cucurbit rootstocks and grafting method on growth, yield and fruit quality of cucumber (Cucumis sativus cv. Super Dominus, an experiment was conducted as a factorial design in the base of RCBD with three replications in the greenhouse and research farm, University of Zanjan. Treatments were included three rootstocks (Cucurbita moschata L., Lagenaria siceraria and Cucumis melo L. and ungrafted plants (control and two grafting method (hole insertion and splice grafting. Seeds were sown simultaneously in plastic pots. For obtaining the same stem diameter of scion and rootstocks, cucumber seeds were planted four days earlier than rootstocks seeds. The seedlings were grown in an environment-controlled greenhouse with 25/20 day
SHRINKAGE AND MOISTURE LOSS OF DRIED MELON SEEDS ...
African Journals Online (AJOL)
Samples of 100g clean, mature, freshly washed melon seeds were dried at intervals of 1/4, 1/2, 1 and 2h in an air-oven at 60O C. The experiments were carried out with five different bulk samples of melon seeds. The moisture content of the seeds at each drying stage was determined. The moisture loss in grams per ...
Urasaki, Naoya; Takagi, Hiroki; Natsume, Satoshi; Uemura, Aiko; Taniai, Naoki; Miyagi, Norimichi; Fukushima, Mai; Suzuki, Shouta; Tarora, Kazuhiko; Tamaki, Moritoshi; Sakamoto, Moriaki; Terauchi, Ryohei; Matsumura, Hideo
2017-02-01
Bitter gourd (Momordica charantia) is an important vegetable and medicinal plant in tropical and subtropical regions globally. In this study, the draft genome sequence of a monoecious bitter gourd inbred line, OHB3-1, was analyzed. Through Illumina sequencing and de novo assembly, scaffolds of 285.5 Mb in length were generated, corresponding to ∼84% of the estimated genome size of bitter gourd (339 Mb). In this draft genome sequence, 45,859 protein-coding gene loci were identified, and transposable elements accounted for 15.3% of the whole genome. According to synteny mapping and phylogenetic analysis of conserved genes, bitter gourd was more related to watermelon (Citrullus lanatus) than to cucumber (Cucumis sativus) or melon (C. melo). Using RAD-seq analysis, 1507 marker loci were genotyped in an F2 progeny of two bitter gourd lines, resulting in an improved linkage map, comprising 11 linkage groups. By anchoring RAD tag markers, 255 scaffolds were assigned to the linkage map. Comparative analysis of genome sequences and predicted genes determined that putative trypsin-inhibitor and ribosome-inactivating genes were distinctive in the bitter gourd genome. These genes could characterize the bitter gourd as a medicinal plant. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
An immunoblotting analysis of cross-reactivity between melon, and plantago and grass pollens.
García Ortiz, J C; Ventas, P; Cosmes, P; López-Asunsolo, A
1996-01-01
It is known that most patients with type I allergy to pollens also suffer intolerance to fruits. Recently, an epidemiological and CAP-inhibition study has shown a new clustering of allergy between melon and Plantago and grass pollens. The aim of the present study was to confirm these results by immunoblotting analysis and inhibition of immunoblotting. Sera from 3 patients with confirmed allergy to melon, and Dactylis glomerata and Plantago lanceolata pollens were used for the in vitro studies. SDS-PAGE and immunoblotting analysis with a pool of sera revealed that several distinct protein bands were shared by the three extracts at 14, 31, and a spectrum between 40 and 70 kDa, approximately. Immunoblotting inhibition experiments, performed with extracts of melon, Plantago and Dactylis, showed that all allergens of melon blotting were almost completely inhibited by grass and Plantago pollen extracts. Inversely, the melon extract was capable of inhibiting IgE-binding to various allergens of Dactylis at high mol mass and partially to the band at 14 kDa. Moreover, the melon almost totally inhibited the IgE-binding capacity to the proteins of Plantago extract. Taken together, the results support the presence of structurally similar allergens in melon, Plantago and grass pollens, and that all allergenic epitopes of the melon are present in these pollens.
Studies on mating competition of irradiated melon flies
International Nuclear Information System (INIS)
Limohpasmanee, W.
1994-01-01
Mating competition is the key factor for fruit flies control by using sterile insect technique project. Mass rearing and irradiation can reduce the mating competition of fruit flies. This experiment has purpose to evaluate the mating competition of the irradiated melon fly. The results show that mating competition values of irradiated melon flies were 0.36 and 0.24 when they mated with normal and irradiated females. Both normal male and female can mate more frequency than irradiated flies. (Z=1.322, P<0.05; Z=1.851, P<0.05). The results show that quality of mass rearing and irradiated melon fly was lower than the normal flies. So that quality of irradiated fly must be improved and the number of released flies as less must be higher than natural flies 6 time
International Nuclear Information System (INIS)
Teruya, T.
1990-01-01
In a laboratory condition, the visiting and the puncturing frequencies of gamma-irradiated Dacus cucurbitae females on cucumber Cucumis sativus fruits were examined. In the non-irradiated females, the frequencies reached equilibrium ca. 1 week after adult emergence. The frequencies of the irradrated females decreased with irradiation dosage, but gradually resumed frequency with age. A similar trend was found in the relationship between the irradiation dose and the rates of the puncturing frequency to the visiting frequency. As the irradiation dose increased, the rate of under-developed ovaries increased. The ratio of cumulative puncturing frequency in the 70 Gy irradiated (completely sterile) females to that of the non-irradiated females was estimated as 1/200 when daily survival rate in the field was assumed to be 0.85. The completely sterile adult females (40 days old) made punctures on all sizes of cucumber cultivated in a greenhouse. However, these punctures do not significantly damage the fruit. The sting of the sterile melon fly would not be a serious problem in eradication programs based on the Sterile Insect Technique
Self-Nanoemulsifying Drug Delivery Systems Based on Melon Oil ...
African Journals Online (AJOL)
Method: Melon oil and cow fat were extracted by standard methods and used in the formulation of SNEDDS based on either melon oil alone, or its admixture with cow fat by utilizing varying ratios of oil(s), surfactants and co-surfactants, with or without carbosil, a glidant. The formulations were encapsulated in hard gelatin ...
Hidrogeologic and geophysical studies into Agro school Melo UTU Cerro Largo province
International Nuclear Information System (INIS)
Heinzen, W.; Santana, I.; Mari, C.
1986-01-01
The technical University UTU of Uruguay requested and Hidrogeologic study with the aim to analyze the factibility to discover underground stream waters which supply groundwaters into agro school Ing Agr. Alcides E Pintos Melo, Cerro Largo province.
Radiation sterilization facility for melon fly
International Nuclear Information System (INIS)
Danno, A.
1985-01-01
The melon fly (Dacus cucurbitae Coquillett) has been observed in Amami Island since l975. Kagoshima Prefecture has had a melon fly eradication project underway since 1979. A mass-fearing facility and a radiation sterilization facility were constructed in Naze in March of l98l. In the early stages of the project, sterile insects were produced at the rate of 4 x l0/sup 6/ pupae/week. In the later stages, the activity of the project was enlarged by tenfold. The conditions for design of the radiation sterilization facility, which has been developed with a central control system for automated irradiation, are examined from an engineering standpoint
Mei, Jianfeng; Li, Sha; Jin, Hang; Tang, Lan; Yi, Yu; Wang, Hong; Ying, Guoqing
2016-09-01
Cucurbitacin B (CuB) and its glycoside, cucurbitacin B 2-o-β-D-glucoside (CuBg), abundantly occur in the pedicels of Cucumis melo. Compared with CuB, CuBg is not efficiently extracted from the pedicels. Furthermore, the anticancer activity of CuBg is lower than that of the aglycone. A process for CuBg biotransformation to CuB was developed for the first time. A strain of Streptomyces species that converts CuBg into CuB was isolated from an enrichment culture of C. melo pedicels. After optimization of conditions for enzyme production and biotransformation, a maximum conversion rate of 92.6 % was obtained at a CuBg concentration of 0.25 g/L. When biotransformation was performed on C. melo pedicel extracts, the CuB concentration in the extracts increased from 1.50 to 3.27 g/L. The conversion rate was almost 100 %. The developed process may be an effective biotransformation method for industrial production CuB from C. melo pedicels for pharmaceuticals.
Quality improvement of oriental melon and watermelon using bioceramics
International Nuclear Information System (INIS)
Song, H.K.; Lee, K.J.; Ryou, Y.S.
1996-01-01
Oriental melon and watermelon plants were cultivated in the soil treated with bioceramics in a greenhouse during summer season from June 1st to August 20th, 1995. Two application methods were employed, one was a mixed treatment of soil and bioceramics, and the other was a spray treatment of bioceramic solution on the stems and leaves. And two types of bioceramics were also stopped by five levels. In order to analyze the bioceramic effect on oriental melon and watermelon, the growth rate of stems, leaves and fruits were measured in the greenhouse. After harvest, the sweetness of fruits was measured and the freshness of fruits based on the storage period was tested by human taste and smell sense. The results are summarized as follows. 1. The growth rates of stems, leaves and fruits of oriental melon and watermelon were the largest in the bioceramic treatment of No. 3. 2. The density of oriental melon and watermelon was the largest in the bioceramic treatment of No. 3 and No. 2 respectively. 3. The Brix number of watermelon was 10.6 in non-bioceramic treatment and 11.5 in the bioceramic treatment of No. 2, and that of oriental melon was 8.6 in non-bioceramic treatment and 12.3 in the bioceramic treatment of No. 2. 4. The storage duration of watermelon treated with bioceramics was about 50 days in the condition of the ambient temperature of 25∼30°C. (author)
Directory of Open Access Journals (Sweden)
CLEMENTINO MARCOS BATISTA DE FARIA
2000-03-01
Full Text Available O trabalho constou de um experimento com melão (Cucumis melo L., conduzido em um Vertissolo, em Juazeiro, BA, em 1995, com o objetivo de avaliar o efeito de níveis de N por fertirrigação e de densidades de plantio na produtividade e qualidade de fruto. Os níveis de N foram 0, 80, 130 e 180 kg/ha, combinados com os espaçamentos 2,00 e 1,80 m entre linhas e 0,20 m entre plantas, com uma ou duas plantas por cova. A fonte de N foi a uréia, aplicada diariamente até 42 dias após a germinação, por meio da irrigação por gotejamento. Todos os tratamentos receberam uma adubação uniforme de 120 kg/ha de P2O5 e 120 kg/ha de K2O. Os espaçamentos entre linhas não causaram diferenças significativas em nenhuma variável estudada. O nível de 80 kg/ha de N combinado com uma planta por cova proporcionou uma produtividade de 34,07 t/ha, com 55,7% de frutos próprios para o mercado interno, não-significativamente (P £ 0,05 inferior à produtividade obtida com os níveis mais elevados de N em qualquer combinação. Com este mesmo nível, obtiveram-se frutos com 10,22º Brix significativamente (P£ 0,05 superior ao do tratamento sem N e não-significativamente inferior ao dos outros níveis. Para se obter uma maior parte de frutos próprios para o mercado externo, foi necessário elevar a densidade para duas plantas por cova e o nível de N para 130 ou 180 kg/ha. O peso médio dos frutos aumentou de 1,008 para 1,705 kg, à medida que foram aumentados os níveis de N ou se diminuiu a densidade de plantio de duas para uma planta por cova.This study consisted of one experiment with melon (Cucumis melo L., carried out in a Vertisol in Juazeiro, BA, Brazil, in 1995, with the objective of evaluating the effects of nitrogen levels through fertirrigation and plant density on fruit yield and quality. The N levels were 0, 80, 130 and 180 kg/ha, combined with row spacings of 2.0 and 1.8 m and 0.20 m between plants within the row, with one or two plants
Study on the sterilization of canned water melon by gamma irradiation
International Nuclear Information System (INIS)
Kim, B.M.
1978-01-01
In order to study the effects of gamma-irradiations on the storage life of canned water melon, the contents of canning water melon were controlled pH to 4.0 and 5.0 by adding some kinds of organic acids such as citric acid, tartaric acid, and ascorbic acid, respectively. The pH controlled water melons were canned, followed by being exposed to 0.25, 0.5, and 1.0 Mrads of gamma-ray, respectively. The results were as follows: In non-acid canned water melon, the higher doses of radiation induced the more efficiency on the extension of storage life of it even if the efficiency was mot so great. By irradiations of 1.0 Mrads, it could be kept for 15 days without any deterioration. By means of the addition of organic acids, the radiation effect on the extension of the storage life of the above food increased remarkably. In particular, the water melon cans with ascorbic acid (pH 4.0) could be kept for 60 days without any deterioration by gamma-irradiation of 0.5 and 1.0 Mrads. (Author)
Dehydrated melon containing antioxidants and calcium from grape juice
Directory of Open Access Journals (Sweden)
Hulda N. M. Chambi
2016-11-01
Full Text Available Background: Grape juice has a high antioxidant potential, capable of fighting oxidative processes in the body. The juice is mainly marketed in its concentrated form, which has a high content of glucose and fructose. The juice concentrate may then be used as an osmotic agent to dehydrated fruit with a relatively short shelf-life at room temperature, such as melon. The osmotic dehydration process can also be combined with conventional drying in order to further reduce the water activity (a w of the product. Finally, the antioxidant-rich melon meets the consumers’ demand for foods which contain ingredients that may impart health benefits. Results: Melon dehydrated by osmotic process at 200, 400 and 600 mbar, using grape juice concentrate (GJC, showed no significant differences in physical characteristics (a w , °Brix, and moisture content. Higher efficiency was observed when dehydration was performed at 200 mbar. After osmotic dehydration with GJC, both plasmolysis of the melon cells and an increase in intercellular spaces were observed by optical microscopy, with no negative impact on the mechanical properties (True stress, Hencky’s strain and deformability modulus. Calcium present in GJC was impregnated into the melon matrix, thus contributing with the mineral composition and mechanical properties of the final product. No significant differences were observed for the antioxidant capacity of melon dehydrated both with GJC and GJC followed by air-drying at 50 and 70°C. This demonstrates that it is possible to combine the two processes to obtain a product with intermediate moisture without decreasing its antioxidant capacity. The samples scored above the acceptable limit (>5 varying between like slightly to like moderately, resulting in a purchase intent with average scores between 3 (maybe/maybe not buy and 4 (probably would buy. Conclusions: A product with intermediate water activity, acidic, firm, high antioxidant capacity, rich in calcium
Effects of sudden melon intake on ruminal parameters of non-adapted sheep
Directory of Open Access Journals (Sweden)
Francisco L.C. Oliveira
2016-05-01
Full Text Available Abstract: This study evaluated the effects of varying amounts of melon with high sugar content offered to sheep without prior melon experience and that were not adapted to consuming it. We used 12 eight-month-old, rumen-cannulated crossbred sheep weighing 25 kg each. The animals received a base diet of roughage, and then half were randomly selected to have 25% of their diet replaced with melon (G25% and the other half had 75% of their diet replaced with melon (75%. Ruminal fluid was collected before administration of melon and at 0, 3, 6, 12, 18, and 24 h after the administration of the fruit. Sheep from the G25% group presented volatile fatty acid ruminal acidosis (sub-acute between 3 and 6 h after consumption. This acidosis was characterized by a rumen pH slightly lower than 5.6, increased discrete L-lactic acid content, and increased redox potential (RP and methylene blue redox (MBR time of the ruminal fluid. The G75% group presented lactic ruminal acidosis at T6h, characterized by a rumen pH lower than 5.0, high lactate-L content, increased RP and MBR time, and increased ruminal fluid osmolarity. Therefore, offering large amounts of melon (75% of dry matter (DM is not recommended but 25% of DM of this fruit can be used safely.
Efficacy of primextra gold in controlling weeds of melon ( Citrillus ...
African Journals Online (AJOL)
A field experiment was conducted in the Center of Ecological Studies, University of Port Harcourt, Rivers State to evaluate the efficacy of Primextra Gold (290g /l S – Metalochlor and 370g/l Atrazine) herbicide in controlling weeds in melon and to determine its safety for use in melon. The experiment was carried out between ...
Ancient Greek Legend in Modern Japanese Literature: “Run, Melos!” by Dazai Osamu
Directory of Open Access Journals (Sweden)
Lija GANTAR
2017-12-01
Full Text Available Dazai Osamu (1909-1948, a modern Japanese writer, wrote “Run, Melos!” in 1940. The short story is a rework of an Ancient Greek legend of Damon and Pythias from the 4th century B.C., which was introduced to Dazai through Schiller’s version of the legend, “The Hostage”. The legend, based on a true event, represents the perfect friendship and was reworked a number of times by different antique writers. After having been forgotten for a while, it reappeared in the Middle Ages as a fictional story and has gotten many new adaptations from then on. One of them was Schiller’s ballad in 1798, which – alongside an anecdote from Dazai’s own life – represented the basis for Dazai’s story. Even though “Run, Melos!” is not an autobiographical work, Dazai managed to pass his own feelings onto the characters, add some biblical elements, and included a never-before-employed dark twist in the story, thus making his version more realistic than the preceding ones. Despite the distance in time and place between him and the legend, with “Run, Melos!”, Dazai managed to retell a Western literature story, making it a part of the Japanese literature as well, adding motifs and themes influenced by his own life, time, and place.
'Egusi' Melon, Citrullus lanatus
African Journals Online (AJOL)
Prof. Ogunji
seeds are not only edible but also used to produce fuel (An Ku, 2007). ... Nigeria, ''Egusi'' is cultivated over an area of 320,800 ha with a production figure of ... production of somatic embryos from melon cell suspension cultures (Oridate and ... (V/V) alcohol for 30 seconds, then 4% sodium hypochlorite (NaClO) for 8 minutes.
Fertilizer use efficiency by maize ( Zea mays ) and egusi-melon ...
African Journals Online (AJOL)
Three separate field studies were conducted in a rainforest area to determine efficient use of applied fertilizers by maize and egusi-melon in various ratios of mixtures in an ultisol in Nigeria. The experiment was a factorial combination of seven cropping ratios of maize and egusi-melon (MA:EM 1:0, 1:1, 2:1, 3:1, 1:2, and 1:3, ...
African Journals Online (AJOL)
SARAH
30 sept. 2015 ... In vivo, 600 ppm of calcium silicate, calcium hydroxide and calcium oxide inhibited ... En 2013, la production du melon au Maroc a été .... Ca(OH)2, l'oxyde de calcium CaO, le sulfate de calcium ...... rot disease complex.
The genome of the cucumber, Cucumis sativus L
DEFF Research Database (Denmark)
Huang, Sanwen; Li, Ruiqiang; Zhang, Zhonghua
2009-01-01
Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA seq...
The genome of the cucumber, Cucumis sativus L.
Huang, S.W.; Li, R.Q.; Vossen, van der E.A.G.
2009-01-01
Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA
The transgenosis main directions in vegetable and melon production: theory and practice
Directory of Open Access Journals (Sweden)
Н. В. Лещук
2013-08-01
Full Text Available The article deals with priority directions of vegetable and melon plants selection. The wide varieties of alien genetic information transferring methods during the transgenic plants creation of vegetable and melon species are grounded. The essence of the new hybrids identification method as genetic engineering products: kind of cabbage, tomatoes, carrots, zucchini, lettuce seed, pea Pisum sativum, common bean, eggplant and capsicum is revealed. The transgenosis main directions of botanical taxa varieties of vegetable and melon plants on condition of the international and national practice holding are proved. The international practice of the state approbation and registration of genetically engineered structures in biological objects (plant varieties and in their processed products are studied. A monitoring about food and pharmaceutical substances based on genetically modified varieties and hybrids structures of vegetable and melon plants have been held.
Directory of Open Access Journals (Sweden)
A. Ketabi
2017-11-01
Full Text Available Background and objectives: Melasma is one of the most common pigmentary disorders. It has a considerable impact on quality of life. The treatment of melasma has still remained a challenge because the efficient treatment has not been proven until now and there is still a need to find new depigmenting products.Allium cepa L. and Cucumis melo L. seeds as well as tragacanth have been introduced in Iranian traditional medicine (ITM as depigmenting agents. Moreover, modern studies have shown their antioxidant and inhibitory mushroom tyrosinase effect.In this study, a topical gel containing Allium cepa L. and Cucumis melo L. seeds extract was prepared with tragacanth and quality control evaluations have been accomplished. Method: After performing quality control of plants seeds and tragacanth according to pharmacopoeia, the ethanol extract of A. cepa and hydroalcoholic extract of C. melo seeds were prepared. An appropriate gel formulation was selected on the base of suitable viscosity. The gel product was formulated using 5% of each plant extracts in tragacanth gel base. In addition, the herbal gel was evaluated using pharmaceutical behavior such as physical appearance, pH, viscosity, spreadability as well as phenolics content. Results: The herbal gel product showed acceptable pharmaceutical behavior as well as considerable phenolic content (1.43±0.01 mg/g. Conclusion: The prepared topical gel product could be a good natural formulation candidate for clinical studies in the field of hyperpigmentation. Moreover, phenolic content of the product could be considered as an indicator for its quality control.
Zhu, Huayu; Song, Pengyao; Koo, Dal-Hoe; Guo, Luqin; Li, Yanman; Sun, Shouru; Weng, Yiqun; Yang, Luming
2016-08-05
Microsatellite markers are one of the most informative and versatile DNA-based markers used in plant genetic research, but their development has traditionally been difficult and costly. The whole genome sequencing with next-generation sequencing (NGS) technologies provides large amounts of sequence data to develop numerous microsatellite markers at whole genome scale. SSR markers have great advantage in cross-species comparisons and allow investigation of karyotype and genome evolution through highly efficient computation approaches such as in silico PCR. Here we described genome wide development and characterization of SSR markers in the watermelon (Citrullus lanatus) genome, which were then use in comparative analysis with two other important crop species in the Cucurbitaceae family: cucumber (Cucumis sativus L.) and melon (Cucumis melo L.). We further applied these markers in evaluating the genetic diversity and population structure in watermelon germplasm collections. A total of 39,523 microsatellite loci were identified from the watermelon draft genome with an overall density of 111 SSRs/Mbp, and 32,869 SSR primers were designed with suitable flanking sequences. The dinucleotide SSRs were the most common type representing 34.09 % of the total SSR loci and the AT-rich motifs were the most abundant in all nucleotide repeat types. In silico PCR analysis identified 832 and 925 SSR markers with each having a single amplicon in the cucumber and melon draft genome, respectively. Comparative analysis with these cross-species SSR markers revealed complicated mosaic patterns of syntenic blocks among the genomes of three species. In addition, genetic diversity analysis of 134 watermelon accessions with 32 highly informative SSR loci placed these lines into two groups with all accessions of C.lanatus var. citorides and three accessions of C. colocynthis clustered in one group and all accessions of C. lanatus var. lanatus and the remaining accessions of C. colocynthis
A single recessive gene controls fragrance in cucumber (Cucumis ...
Indian Academy of Sciences (India)
2013-04-10
Apr 10, 2013 ... Genetic studies in rice (Sood and Siddiq 1978), soybean. (AVRDC .... difficulty, marker-assisted selection (MAS) is an alternative for breeding ... 31, 823–826. de Wilde W. J. J. O and Duyfjes B. E. E. 2010 Cucumis sativus.
(cucumis sativus l.) in spent engine oil contaminated soil amended
African Journals Online (AJOL)
compost treatment recorded the highest number of leaves while the number of leaves for 0% ... KEYWORDS: Growth, Cucumis sativus, Urena lobata, spent engine oil, contamination, .... sawdust, peat, waste cotton and organic manures are.
Temas de Historia: El golpe de Melo
Directory of Open Access Journals (Sweden)
Fernando Serpa Flórez
1965-07-01
Full Text Available El 16 de abril de 1854, en las horas de la noche, el general José María Melo, comandante general del ejército, se apoderó de los cuarteles de Bogotá. Al día siguiente, por la mañana, envió una comisión ante el Presidente de la República, José María Obando, a ofrecerle la dictadura. El presidente rechazó tal propuesta y convocó al Consejo de Gobierno, al vicepresidente José de Obaldía, al Procurador General de la Nación y al designado, general Tomás Herrera, para estudiar la situación.
FERTILIZER RECOMMENDATION SYSTEM FOR MELON BASED ON NUTRITIONAL BALANCE
Directory of Open Access Journals (Sweden)
José Aridiano Lima de Deus
2015-04-01
Full Text Available Melon is one of the most demanding cucurbits regarding fertilization, requiring knowledge of soils, crop nutritional requirements, time of application, and nutrient use efficiency for proper fertilization. Developing support systems for decision-making for fertilization that considers these variables in nutrient requirement and supply is necessary. The objective of this study was parameterization of a fertilizer recommendation system for melon (Ferticalc-melon based on nutritional balance. To estimate fertilizer recommendation, the system considers the requirement subsystem (REQ, which includes the demand for nutrients by the plant, and the supply subsystem (SUP, which corresponds to the supply of nutrients through the soil and irrigation water. After determining the REQtotal and SUPtotal, the system calculates the nutrient balances for N, P, K, Ca, Mg, and S, recommending fertilizer application if the balance is negative (SUP < REQ, but not if the balance is positive or zero (SUP ≥ REQ. Simulations were made for different melon types (Yellow, Cantaloupe, Galia and Piel-de-sapo, with expected yield of 45 t ha-1. The system estimated that Galia type was the least demanding in P, while Piel-de-sapo was the most demanding. Cantaloupe was the least demanding for N and Ca, while the Yellow type required less K, Mg, and S. As compared to other fertilizer recommendation methods adopted in Brazil, the Ferticalc system was more dynamic and flexible. Although the system has shown satisfactory results, it needs to be evaluated under field conditions to improve its recommendations.
Directory of Open Access Journals (Sweden)
Ruiz, José L.
2015-06-01
Full Text Available The scientific collections of the Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid hold an extense set of entomological materials collected in Morocco along the first decades of the XXth century by the preeminent naturalist M. Martínez de la Escalera. Morphological studies of the specimens of the genus Meloe Linnaeus, 1758 (Coleoptera: Meloidae reveals the existence of populations morphologically differentiated along the coastal regions of Essaouira and Ifni. These populations are included within the Meloe rugosus Marsham, 1802 species group in the subgenus Eurymeloe Reitter, 1911. Their differential traits with respect to all other North African and European species of the Meloe rugosus species group are constant, and permit considering these populations as a taxonomic independent unit described herein, Meloe baamarani n. sp. This new species is characterized by having a black, opaque, general coloration all over the body and appendages; black short vestiture; broad head with broadly rounded temples, without median longitudinal groove; long antennae, with segments III to VIII subcylindrical and longer than wide; pronotum transverse, with convergent sides toward the base, without median groove; head and pronotum punctuation dense; aedeagus narrow, median lobe wide and strong, dorsally sinuous, with ventral hooks close to the apex. Meloe baamarani can be only confused on the western regions of northern Africa with Meloe mediterraneus Müller, 1925. This species shares a general appearance with M. baamarani, but differs in many morphological traits. Among those, tegument micro-reticulation, absence of median groove along the head, pronotum morphology and macrosculpture, and configuration of the male genitalia, are included.Las colecciones científicas del Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid albergan un extenso material entomológico recogido en Marruecos a principios del siglo XX por el insigne naturalista M. Mart
Melos: a Rhetoric Proof in Songs in Semiotic Perspective
Directory of Open Access Journals (Sweden)
Adriano Dantas de Oliveira
2016-12-01
Full Text Available We will have, in this work, the exposure of an approach to cancional text as a specific rhetorical situation. We assimilated the melos as all musical aspects of the song as a rhetorical proof that articulates the traditional trilogy: ethos, logos and pathos. We will use an interdisciplinary theoretical framework, articulating the classical rhetoric to semiotics applied to the song, exploring, from this model, discursive aspects of cancional text. As corpus, we have the analysis of a buarquiana song sample sociopolitical theme composed and recorded during the period of dictatorship.
Towards a TILLING platform for functional genomics in Piel de Sapo melons
Directory of Open Access Journals (Sweden)
Pujol Marta
2011-08-01
Full Text Available Abstract Background The availability of genetic and genomic resources for melon has increased significantly, but functional genomics resources are still limited for this crop. TILLING is a powerful reverse genetics approach that can be utilized to generate novel mutations in candidate genes. A TILLING resource is available for cantalupensis melons, but not for inodorus melons, the other main commercial group. Results A new ethyl methanesulfonate-mutagenized (EMS melon population was generated for the first time in an andromonoecious non-climacteric inodorus Piel de Sapo genetic background. Diverse mutant phenotypes in seedlings, vines and fruits were observed, some of which were of possible commercial interest. The population was first screened for mutations in three target genes involved in disease resistance and fruit quality (Cm-PDS, Cm-eIF4E and Cm-eIFI(iso4E. The same genes were also tilled in the available monoecious and climacteric cantalupensis EMS melon population. The overall mutation density in this first Piel de Sapo TILLING platform was estimated to be 1 mutation/1.5 Mb by screening four additional genes (Cm-ACO1, Cm-NOR, Cm-DET1 and Cm-DHS. Thirty-three point mutations were found for the seven gene targets, six of which were predicted to have an impact on the function of the protein. The genotype/phenotype correlation was demonstrated for a loss-of-function mutation in the Phytoene desaturase gene, which is involved in carotenoid biosynthesis. Conclusions The TILLING approach was successful at providing new mutations in the genetic background of Piel de Sapo in most of the analyzed genes, even in genes for which natural variation is extremely low. This new resource will facilitate reverse genetics studies in non-climacteric melons, contributing materially to future genomic and breeding studies.
Microstructural and thermal study of Al-Si-Mg/melon shell ash particulate composite
Directory of Open Access Journals (Sweden)
M. Abdulwahab
Full Text Available The microstructural study via scanning electron microscope (SEM and thermal study via differential scanning calorimetric (DSC study of Al-7%Si-0.3Mg/melon shell ash particulate composite has been carried out. The melon shell ash was used in the production of MMC ranging from 5% to 20% at interval of 5% addition using stir casting method. The melon shell ash was characterized using X-ray fluorescent (XRF that reveal the presence of CaO, SiO2, Al2O3, MgO, and TiO2 as major compounds. The composite was machined and subjected to heat treatment. Microstructural analyses of the composite produced were done using scanning electron microscope (SEM. The microstructure obtained reveals a dark ceramic (reinforcer and white metallic phase. Equally, the 5 wt% DSC result gives better thermal conductivity than other proportions (10 wt%, 15 wt%, and 20 wt%. These results showed that an improved property of Al-Si-Mg alloy was achieved using melon shell ash particles as reinforcement up to a maximum of 20 wt% for microstructural and 5% wt DSC respectively. Keywords: Microstructural analysis, Melon shell ash, Stir casting, X-ray fluorescent, Reinforcement, Composite
Genetic identification of a dwarf mutant in cucumber ( Cucumis ...
African Journals Online (AJOL)
The dwarf (compact) plant architecture is an important trait in cucumber (Cucumis sativus L.) breeding. A dwarf type mutant was selected from the cucumbers. The morphological and reproductive characteristics of the dwarf were compared with the vine plants. The dwarf type of cucumbers is characterized by its short ...
Directory of Open Access Journals (Sweden)
Júlio Gomes Júnior
2001-11-01
Full Text Available Objetivou-se avaliar a conservação pós-colheita de frutos de melão tipo cantaloupe (Cucumis melo L var. Cantaloupensis , genótipo Nun 3984, colhido nos estádios de maturação II ( frutos imaturos em início de descoloração e pedúnculo totalmente preso e IV (frutos com pedúnculo totalmente rachado, em seis períodos de armazenamento: 0; 5; 10;15; 20 e 25 dias. Os frutos foram provenientes do Agropolo Mossoró-Assu (RN, cujo clima é caracterizado como quente e seco, com temperaturas máxima e mínima de 33ºC e 29ºC, respectivamente. O armazenamento foi realizado a 20ºC e 50% UR. Utilizou-se um fatorial 2 x 6 (dois estádios de maturação e seis períodos de armazenamento, em delineamento inteiramente casualizado, com três repetições, sendo utilizados dois frutos por parcela. Os frutos foram avaliados individualmente quanto à firmeza da polpa, perda de peso, teor de sólidos solúveis, aparências externa e interna. Houve efeito significativo da interação entre os fatores estudados apenas para variável firmeza da polpa. A firmeza da polpa foi de 30,07 N e 18,75 N por ocasião da colheita e 5,32 N e 3,50 N aos 25 dias de armazenamento, respectivamente, para os estádios II e IV de maturação. O teor de sólidos solúveis apresentado por esse genótipo (7% a 9%, nos estádios II e IV de maturação respectivamente, não estabelece um padrão mínimo para a aceitação no mercado externo. A perda de peso atingiu valores médios de 6,26% e 6,67% aos 20 e 25 dias de armazenamento, respectivamente. Os frutos chegaram aos 20 dias de armazenamento com nota média 3,1 (deterioração mediana e 4,0 (deterioração leve para as aparências interna e externa, respectivamente, nos dois estádios de maturação, sendo portanto, considerados próprios para o consumo, por terem notas acima de 3,0This work aimed to evaluate the postharvest shelf life of cantaloupe melons type (Cucumis melo L. var Cantaloupensis, genotype Nun 3984, harvested
Cuong, Do Manh; Jeon, Jin; Morgan, Abubaker M A; Kim, Changsoo; Kim, Jae Kwang; Lee, Sook Young; Park, Sang Un
2017-08-23
Charantin, a natural cucurbitane type triterpenoid, has been reported to have beneficial pharmacological functions such as anticancer, antidiabetic, and antibacterial activities. However, accumulation of charantin in bitter melon has been little studied. Here, we performed a transcriptome analysis to identify genes involved in the triterpenoid biosynthesis pathway in bitter melon seedlings. A total of 88,703 transcripts with an average length of 898 bp were identified in bitter melon seedlings. On the basis of a functional annotation, we identified 15 candidate genes encoding enzymes related to triterpenoid biosynthesis and analyzed their expression in different organs of mature plants. Most genes were highly expressed in flowers and/or fruit from the ripening stages. An HPLC analysis confirmed that the accumulation of charantin was highest in fruits from the ripening stage, followed by male flowers. The accumulation patterns of charantin coincide with the expression pattern of McSE and McCAS1, indicating that these genes play important roles in charantin biosynthesis in bitter melon. We also investigated optimum light conditions for enhancing charantin biosynthesis in bitter melon and found that red light was the most effective wavelength.
Cahyari, K.; Sarto; Syamsiah, S.; Prasetya, A.
2016-11-01
This research was meant to investigate performance of continuous stirred tank reactor (CSTR) as bioreactor for producing biohydrogen from melon waste through dark fermentation method. Melon waste are commonly generated from agricultural processing stages i.e. cultivation, post-harvesting, industrial processing, and transportation. It accounted for more than 50% of total harvested fruit. Feedstock of melon waste was fed regularly to CSTR according to organic loading rate at value 1.2 - 3.6 g VS/ (l.d). Optimum condition was achieved at OLR 2.4 g VS/ (l.d) with the highest total gas volume 196 ml STP. Implication of higher OLR value is reduction of total gas volume due to accumulation of acids (pH 4.0), and lower substrate volatile solid removal. In summary, application of this method might valorize melon waste and generates renewable energy sources.
DEVELOPMENT OF MELON F1 SEEDS BASED ON LINES WITH GENIC MALE STERILITY
Directory of Open Access Journals (Sweden)
A. S. Sokolov
2014-01-01
Full Text Available The perspective technology of development of melon of F1hybrids seeds by use maternal lines with an original form of genic mail sterility and marker trait (lobed leaves was studied. Elements of technology allow developing hybrid seeds of melon with hybridity of 90-95%.
Ezekiel, Chibundu N; Sulyok, Michael; Somorin, Yinka; Odutayo, Foluke I; Nwabekee, Stella U; Balogun, Afeez T; Krska, Rudolf
2016-11-21
An examination of the mould and fungal metabolite pattern in melon and bush mango seeds locally produced in Nigeria was undertaken in order to understand the mycotoxicological risk posed to consumers of both of these important and commonly consumed soup thickeners. The variation in mycotoxin levels in graded categories of both foodstuffs were also determined. Aspergillus, Fusarium, Penicillium, Mucorales and Trichoderma were the recovered fungi from the foodstuffs with Aspergillus species dominating (melon=97.8%; bush mango=89.9%). Among the Aspergillus species identified Aspergillus section Flavi dominated (melon: 72%; bush mango: 57%) and A. flavus, A. parasiticus, A. parvisclerotigenus and A. tamarii were the recovered species. About 56% and 73% of the A. flavus isolates from melon and bush mango seed samples, respectively were aflatoxigenic. Thirty-four and 59 metabolites including notable mycotoxins were found in the melon and bush mango seeds respectively. Mean aflatoxin levels (μg/kg) in melon (aflatoxin B 1 (AFB 1 )=37.5 and total aflatoxins=142) and bush mango seeds (AFB 1 =68.1 and total aflatoxins=61.7) were higher than other mycotoxins, suggesting potential higher exposure for consumer populations. Significantly (p<0.05) higher levels of mycotoxins were found in hand-peeled melon and discoloured bush mango seeds than in machine-peeled melon and non-discoloured seeds except for HT-2 and T-2 toxins which occurred conversely. All melon and bush mango seeds exceeded the 2μg/kg AFB 1 limit whereas all melon and 55% of bush mango seeds exceeded the 4μg/kg total aflatoxin EU limit adopted in Nigeria. This is the first report of (1) mycotoxin co-occurrence in bush mango seeds, (2) cyclopiazonic acid, HT-2 toxin, moniliformin, mycophenolic acid, T-2 toxin and tenuazonic acid occurrence, and (3) mycotoxin exposure assessment of both foodstuffs. Copyright © 2016 Elsevier B.V. All rights reserved.
Disease Incidence of Melon Leaf Curl in East Java and Special Province of Yogyakarta
Directory of Open Access Journals (Sweden)
Ignatius Julijantono
2010-12-01
Infeksi penyebab penyakit yang disebabkan oleh geminivirus telah menyebabkan kerugian secara ekonomi berbagai jenis tanaman penting yang dibudidayakan. Kejadian penyakit pada tanaman melon telah diamati sejak tahun 2004, dan tersebar secara luas di pusat penanaman melon di Jawa Timur maupun Daerah Istimewa Yogyakarta (DIY. Di Jawa Timur dan Daerah Istimewa Yogyakarta (DIY, pada tahun 2008 kejadian penyakit daun keriting melon mencapai 100% dan 14,3%. Penyebab penyakit telah dideteksi menggunakan teknik polymerase chain reaction. Amplifikasi Fragmen DNA virus dari tanaman yang terinfeksi dihasilkan dengan ukuran 770 bp menggunakan sepasang primer CPA5 dan CPA2.
Grafting of Romanian Melons and Watermelons for Culture from South Area of Romania
Directory of Open Access Journals (Sweden)
Dorin Sora
2016-11-01
Full Text Available The vegetable grafting is useful in Romania; it is more difficult in watermelons and melons and it is continuously developing. The research was aimed the establishing of the technological stages for seedling producing of scions (Romanian melons and watermelons and rootstocks (F1 hybrids of Lagenaria siceraria and Cucurbita maxima x C. moschata for obtaining of grafted plant seedlings. The experience was realized out on a collection consisting from two Romanian scions, melon (‘Fondant’ variety and watermelon (‘Dochiţa’ variety obtained at Research and Development Station for Vegetable Growing Buzău and two rootstocks, bottle gourd - L. siceraria (‘Emphasis’ F1 and interspecific hybrid squash - C. maxima x C. moschata (‘Cobalt’ F1. The obtaining of scion and rootstock plants was made according to the ecological requirements of the species. The grafting was made by annexation (splice grafting. The plants had optimal diameters for splice grafting. Between scions (‘Fondant’ and ‘Dochiţa’ are no diference, statistical analysis could not be performed. Technological stages for producing grafted seedlings of Romanian melon and watermelon were established. The grafting was performed successfully for cucurbit symbiotes (scions and rootstocks. These technological stages for grafting by annexation of Romanian melons and watermelons are recommended for cultures in the south area of Romania.
JUICE EXTRACTION FOR TOTAL SOLUBLE SOLIDS CONTENT DETERMINATION IN MELON
Directory of Open Access Journals (Sweden)
Paulo Sérgio Lima e Silva
2006-01-01
Full Text Available The total soluble solids content (TSSC shows high positive correlation with sugars content, and therefore is generally accepted as an important quality trait of fruits. In melon, this evaluation is usually done by grinding a slice of the fruit's pulp in a household food processor, straining the ground material and then proceeding the TSSC determination in the resulting juice. This evaluation is labor-intensive and takes a long time to complete. An alternative process was delineated for obtaining the juice: the pulp of the fruit slice would be transversally cut one or more times, and longitudinally pressed by hand to obtain the juice. The objective of this work was to compare processes for obtaining juice to evaluate TSSC in melons. Fifty, 15, and 15 fruits of the Galia, Yellow, and Cantaloupe type melons were evaluated, respectively. Each fruit was considered as a block, and was longitudinally split into six fractions with similar sizes, which corresponded to the plots. The following treatments were evaluated: fraction without cuts, fractions with one, three, five, or seven transversal cuts, and the fraction treated by the conventional process. It was concluded that the procedure by which the melon slices of Galia, Yellow and Cantaloupe types are pressed for obtaining the juice to evaluate TSSC can overestimate this content. This would probably be due to the fact that the most internal section of the mesocarp presents greater TSSC than the portions closer to the epicarp.
Worldwide, more than fifty viruses have been reported in cucurbit crops. In Ecuador, approximately 3000 Ha of watermelon, melon and cucumbers are cultivated annually. However, very few studies have been conducted to identify viruses responsible for important epidemics in this crop in Ecuador. During...
Sterilization of the melon fly, dacus cucurbitae coquillett, with gamma radiation
International Nuclear Information System (INIS)
Teruya, Tadashi; Zukeyama, Hiroshi
1979-01-01
The relationships between radiation dose and mating competitiveness of gamma irradiated melon fly males were studied with two methods; those being FRIED's method and the method of the direct counting of normal and irradiated flies in copula under the coexistence of normal females, normal males and irradiated males. In the former method, the mating competitiveness of irradiated males did not reduced significantly with doses from 1 to 10 kR, but at 30 kR, reduced significantly. In the latter method, the mating competitiveness values of males irradiated with 7 and 12 kR were less than unity, but not significant. At 30 kR, the mating competitiveness reduced significantly. It can be said that the harmful effect of irradiation on the mating competitiveness of the melon flies was negligible with a dose of 7 kR, which was used in the eradication project of melon fly from Kume Island. (author)
Eco-Friendly (Water Melon Peels: Alternatives to Wood-based Particleboard Composites
Directory of Open Access Journals (Sweden)
U. D. Idris
2011-12-01
Full Text Available The aim of this study was to investigate the suitability of using water melon peels as alternatives to wood-based particleboard composites. The water melon peels composite boards were produced by compressive moulding using recycled low density polyethylene (RLDPE as a binder. The RLDPE was varies from 30 to 70wt% with interval of 10wt%. The microstructure, water absorption(WA, thickness swelling index(TS, modulus of rupture (MOR, modulus of elasticity (MOE, internal bonding strength(IB, impact strength and wear properties of the boards were determined. The results showed that high modulus of rupture of 11.45N/mm2, MOE of 1678N/mm2, IB of 0.58N/mm2, wear rate of 0.31g were obtained from particleboard produced at 60wt%RLDPE. The uniform distribution of the water melon particles and the RLDPE in the microstructure of the composites board is the major factor responsible for the improvement in the mechanical properties. The results showed that the MOE, MOR and IB meet the minimum requirements of the European standards, for general purpose like panelling, ceiling, partitioning. Hence, water melon particles can be used as a substitute to wood-based particleboard for general purpose applications also besides being environmental friendly of using watermelon and RLDPE in production of particleboard, this alternative to wood-based particleboard is very cost-effective.
O "desenho de arquiteto" de João Cabral de Melo Neto
Directory of Open Access Journals (Sweden)
Rafaela Cardeal
2015-12-01
Full Text Available Tomando como ponto de partida a metáfora “desenho de arquiteto”, este ensaio aborda os aspectos arquitetônicos da poesia de João Cabral de Melo Neto. Para tal, propõe uma leitura retrospectiva da obra até o livro A educação pela pedra (1966, considerado pela crítica o mais arquitetônico da produção cabralina.
Occidental diffusion of cucumber (Cucumis sativus) 500–1300 CE: two routes to Europe
Paris, Harry S.; Daunay, Marie-Christine; Janick, Jules
2012-01-01
Background The cucumber, Cucumis sativus, is one of the most widely consumed fruit vegetables the world over. The history of its dispersal to the Occident from its centre of origin, the Indian subcontinent, has been incorrectly understood for some time, due to the confusion of cucumbers with vegetable melons. Iconographic and literary evidence has shown that cucumber was absent in Roman times, up to 500 CE, but present in Europe by late medieval times, 1300. The objective of the present investigation was to determine more accurately when the cucumber arrived in Europe and by what route. Findings and Conclusions The evidence for the movement of C. sativus westward is entirely lexicographical until the 10th century. Syriac, Persian and Byzantine Greek sources suggest the presence of cucumbers, to the east and north-east of the Mediterranean Sea (modern Iran, Iraq and Turkey), by the 6th or 7th century. Arabic medical writings suggest the presence of cucumbers in Spain as early as the mid-9th century and in Tunisia by the early 10th century. Descriptive evidence in Arabic establishes the presence of cucumbers in Andalusia by the second half of the 10th century. Latin translations from Arabic sources indicate the presence of cucumbers in southern Italy by the second half of the 11th century. These writings, together with lexicographical discrepancies in names of cucurbits in late medieval Latin writings, suggest that cucumber was introduced to Europe by two independent diffusions. One diffusion appears to have been overland from Persia into eastern and northern Europe and preceded the Islamic conquests. The other, subsequent diffusion into western and southern Europe, was probably by a mostly maritime route from Persia or the Indian subcontinent into Andalusia. PMID:22104164
Directory of Open Access Journals (Sweden)
BÁRBARA KARINE DE ALBUQUERQUE SILVA
2017-01-01
Full Text Available Brazil is one of the world's largest producers of melon (Cucumis melo L., and Rio Grande do Norte and Ceará are the largest producers states of the country (99% of exports. This crop had great socio- economic importance in the Brazilian Northeast, however, it is affected by insect pests and consequently, large amounts of pesticides are applied to it, which greatly affect beneficial organisms, such as Chrysopidae. This bioassay evaluated the toxicity of nine insecticides used in commercial crops of muskmelon, applied to first- instar larvae of Chrysoperla genanigra of up to 24-hour-old, from mass rearing cultures. Sublethal effects were evaluated, classifying the insecticides into the toxicity classes recommended by the IOBC. A completely randomized design was used, consisting of ten treatments (clothianidin, pymetrozine, lambda-cyhalothrin, chlorantraniliprole, indoxacarb, pyriproxyfen, beta-cyfluthrin+imidacloprid, imidacloprid, beta-cypermethrin and a control consisted of distilled water. The treatments consisted of exposure of thirty larvae to dry residues of each product in Petri dishes, assessing their mortality, duration of instars, sex ratio, fecundity and viability of eggs from adults of the insects evaluated. The products were classified in toxicity classes as harmful (Class 4 (clothianidin, pymetrozine, indoxacarb, lambda-cyhalothrin, beta-cyfluthrin+imidacloprid, imidacloprid, beta- cypermethrin and pyriproxyfen and innocuous (Class 1 (chlorantraniliprole to first -instar larvae of C. genanigra, by calculate their total effect. Based on this work, chlorantraniliprole is the only recommended insecticide for use in integrated pest management (IPM programs in muskmelon crops.
Sterilization of DACUS CUCUMIS FRENCH (DIPTERA: TEPHRITDAE) by gamma radiation
International Nuclear Information System (INIS)
Hooper, G.H.S.
1976-01-01
When newly emerged adult Dacus cucumis French were irradiated in nitrogen, following a 15 min exposure to an atmosphere of pure nitrogen, the degree of sterility induced by a given dose was less than that obtained with the same dose in air. To achieve sterility in males of approximately 98 per cent doses of 7 krad in air and 13 krad in nitrogen were required. With females, total sterility through infecundity was achieved by 6 krad in air and 13 krad in nitrogen. Based on the hatch of eggs from competitive mating tests, males receiving 14 krad in nitrogen were significantly more competitive than males given 9 krad in air. The optimal light intensity for mating of D. cucumis under artificial conditions was 16.2, 1x. With this light intensity the mating propensity of males irradiated with 9 and 11 krad in air was significantly less than that of untreated males. The mating propensity of males given 14 krad in nitrogen approximated that of untreated males. (author)
Papshop: Not a 'melon'choly Pap smear workshop!
African Journals Online (AJOL)
of cervical cancer will take several decades to be apparent. There are more effective ways of screening, such as HPV DNA testing,[2] ... ARTICLE. Papshop: Not a 'melon'choly Pap smear workshop! C Gordon, MB ChB, Diploma in HIV ...
The Nudo, Rollo, Melon codes and nodal correlations
International Nuclear Information System (INIS)
Perlado, J.M.; Aragones, J.M.; Minguez, E.; Pena, J.
1975-01-01
Analysis of nodal calculation and checking results by the reference reactor experimental data. Nudo code description, adapting experimental data to nodal calculations. Rollo, Melon codes as improvement in the cycle life calculations of albedos, mixing parameters and nodal correlations. (author)
Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; María Tarquis Alfonso, Ana
2016-04-01
The concept of "water footprint" (WF) was introduced as an indicator for the total volume of direct and indirect freshwater used, consumed and/or polluted [1]. The WF distinguishes between blue water (volume of surface and groundwater consumed), green water (rain-water consumed), and grey water (volume of freshwater that is required to assimilate the load of pollutants based on existing ambient water quality standards). In semiarid scenarios with low water quality, where the irrigation is necessary to maintain production, green WF is zero because the effective rainfall is negligible. As well as blue WF includes: i) extra consumption or irrigation water that the farmer has to apply to compensate the fail of uniformity on discharge of drips, ii) percolation out of control or salts leaching, which depends on the salt tolerance of the crop, soil and quality of irrigation water, to ensure the fruit yield. The major concern is grey WF, because the irrigation and nitrogen dose have to be adjusted to the crop needs in order to minimize nitrate pollution. This study is focused in assessment mineral and organic fertilization on grey WF in a fertirrigated melon crop under semiarid conditions, which is principally cultivated in the centre of Spain declared vulnerable zone to nitrate pollution by applying the Directive 91/676/CEE. During successive years, a melon crop (Cucumis melo L.) was grown under field conditions. Different doses of ammonium nitrate were used as well as compost derived from the wine-distillery industry which is relevant in this area. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03. Keywords: Water footprint, nitrogen, fertirrigation, inorganic fertilizers, organic amendments, semiarid conditions. [1] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12
Estimatation of evapotranspiration and crop coefficient of melon cultivated in protected environment
Directory of Open Access Journals (Sweden)
Cláudia S. Lozano
Full Text Available ABSTRACT The objective of this work was to determine the water consumption and the crop coefficient of melon in a protected environment. The experiment was conducted in a greenhouse at the Technical Center of Irrigation of the State University of Maringá, in Maringá, PR. The melon hybrid used was Sunrise and the irrigations were performed daily by drip irrigation. Crop water requirement was quantified based on its evapotranspiration directly measured through constant water table lysimeters. Weather information was collected in an automatic weather station, installed inside the protected environment, which allowed to calculate the reference evapotranspiration by the Penman-Monteith method. The total water consumption of the melon crop was 295 mm, reaching maximum crop evapotranspiration of 5.16 mm d-1. The phenological stages were shorter in the initial, growth and intermediate phases, compared with the data from FAO. The determined crop coefficients were 0.87, 1.15 and 0.64 for the initial, intermediate and final stages, respectively
Directory of Open Access Journals (Sweden)
Laure Egoumenides
2018-03-01
Full Text Available Skin is the largest body organ and the first barrier to exogenous threats. This organ is constantly exposed to external factors such as ultraviolet radiation, which induces many adverse effects including sunburn, depigmentation, photo aging, photo immune suppression, and even skin cancer. Antioxidants seem to be good candidates in order to reduce ultraviolet-mediated damages and to prevent the health consequences of ultraviolet exposure. The present investigation aims to further characterize the potential skin photoprotective effects of a food supplementation and a topical administration of a melon concentrate alone or in combination. A clinical study assessing the Minimal Erythema Dose (MED was first set up to evaluate photoprotection. Afterward, an independent in vitro study was performed on human skin explants from a donor to evaluate the effect of the melon concentrate at different levels including on the sunburn cells formation and on the endogenous antioxidant enzymes and its influence on melanin. Clinical study results demonstrate that melon concentrate application and/or supplementation increased MED. It also increased the endogenous antioxidant enzymes and reduced sunburn cells and melanin level on irradiated skin explants. Therefore, it is suggested that melon concentrate administration (oral and/or topical could be a useful strategy for photoprotection due to its antioxidant properties.
Directory of Open Access Journals (Sweden)
Aireza sobhany
2017-08-01
Full Text Available Introduction: Melon is a tropical species that originates from Iran or Africa and Iran, Afghanistan, Turkey, Russia, Saudi Arabia, India and China are the most important centers of genetic diversity of cultivated varieties (1. The original area for cantaloupe and melon is Iran. Dry and warm climate is the best condition for Melon. This plant needs heat and light for good grows. Cloudy and rainy weather at the time of fruit ripening may affect melon taste and quality(2. According to the FAO statistics in 2012, the total area devoted to melon was 1,339,006 hectares with an average yield of 23.8 tons per hectare and 31,925,787 tons production. The highest production belonged to China (55% of world production. Iran produces about 5.4 percent of world production which is about 1450000 tons from 80,000 hectares (2. Recently, a great number of studies have studied the correlation between melon yield and its components. The first branch (5, the number of primary branches, the number of fruits per plant and fruit weight per plant (6, length and width of fruit and fruit shape index were the most important melons traits which have been evaluated by other studies (4. Fruit yield has significant positive correlation with the length of the stem, primary branches, the date of the first appearance of female flowers and fruit weight. Studies revealed that there is a negative correlation between the number of fruits per plant and the average fruit weight. Materials and Methods: This study was conducted in 2008 with 17 landrace seeds collected from different locations of Khorasan provinces included Kashmar, sarakhs, Boshruye, Sabzevar, Dargaz and Bajestan. Experiment was designed based on randomized complete block design with three replications at agricultural Research Station of Khorasan Razavi. Results and Discussion: The cultivars did not show any different in the time of emergence as all of them emerged 4 to 7 days after the first irrigation. The comparison
The carbon footprint of exported Brazilian yellow melon
Brito de Figueirêdo, M.C.; Kroeze, C.; Potting, J.; Silva Barros, da V.; Sousa de Aragão, A.; Sonsol Gondim, R.; Boer, de I.J.M.
2013-01-01
The carbon footprint of food has become important for producers worldwide as consumers and retail companies increasingly base their purchase decisions on carbon footprint labels. In this context, our objectives is to assess the carbon footprint (CF) of Brazilian yellow melon exported from the Low
Land Use Cover Mapping of Water Melon and Cereals in Southern Italy
Directory of Open Access Journals (Sweden)
Costanza Fiorentino
2010-06-01
Full Text Available The new high-resolution images from the satellites as IKONOS, SPOT5, Quickbird2 give us the opportunity to map ground features, which were not detectable in the past, by using medium resolution remote sensed data (LANDSAT. More accurate and reliable maps of land cover can then be produced. However, classification procedure with these images is more complex than with the medium resolution remote sensing data for two main reasons: firstly, because of their exiguous number of spectral bands, secondly, owing to high spatial resolution, the assumption of pixel independence does not generally hold. It is then necessary to have a multi-temporal series of images or to use classifiers taking into account also proximal information. The data in this study were (i a remote sensing image taken by SPOT5 satellite in July 2007 and used to discriminate the water melon cover class and, (ii three multi-temporal remote sensing images taken by SPOT5 satellite in May, June and July 2008 used to discriminate water melon and cereal crop cover classes. For water melon recognition, providing a single image in 2007, an object-oriented technique was applied instead of a traditional, per pixel technique obtaining an increase of overall accuracy of 15%. In 2008, since it was available a multi-temporal data set, a traditional ‘Maximum Likelihood’ technique was applied for both water melon and cereal crop cover class. The overall accuracy is greater than 95%.
In this study, we developed a nondestructive method for discriminating viable cucumber (Cucumis sativus) seeds based on hyperspectral fluorescence imaging. The fluorescence spectra of cucumber seeds in the 420–700 nm range were extracted from hyperspectral fluorescence images obtained using 365 nm u...
Characterization of Melon necrotic spot virus Occurring on Watermelon in Korea
Directory of Open Access Journals (Sweden)
Hae-Ryun Kwak
2015-12-01
Full Text Available Melon necrotic spot virus (MNSV was recently identified on watermelon (Citrullus vulgaris in Korea, displaying as large necrotic spots and vein necrosis on the leaves and stems. The average occurrence of MNSV on watermelon was found to be 30–65% in Hapcheon and Andong City, respectively. Four isolates of the virus (MNSV-HW, MNSV-AW, MNSV-YW, and MNSV-SW obtained from watermelon plants in different areas were non-pathogenic on ten general indicator plants, including Chenopodium quinoa, while they infected systemically six varieties of Cucurbitaceae. The virus particles purified by 10–40% sucrose density gradient centrifugation had a typical ultraviolet spectrum, with a minimum at 245 nm and a maximum at 260 nm. The morphology of the virus was spherical with a diameter of 28–30 nm. Virus particles were observed scattered throughout the cytoplasm of watermelon cells, but no crystals were detected. An ELISA was conducted using antiserum against MNSV-HW; the optimum concentrations of IgG and conjugated IgG for the assay were 1 μl/ml and a 1:8,000–1:10,000 dilutions, respectively. Antiserum against MNSV-HW could capture specifically both MNSV-MN from melon and MNSV-HW from watermelon by IC/RT-PCR, and they were effectively detected with the same specific primer to produce product of 1,172 bp. The dsRNA of MNSV-HW had the same profile (4.5, 1.8, and 1.6 kb as that of MNSV-MN from melon. The nucleotide sequence of the coat protein of MNSV-HW gave a different phylogenetic tree, having 17.2% difference in nucleotide sequence compared with MNSV isolates from melon.
Identification of gamma-irradiated papaya, melon and watermelon
Marín-Huachaca, Nélida S.; Mancini-Filho, Jorge; Delincée, Henry; Villavicencio, Anna Lúcia C. H.
2004-09-01
Ionizing radiation can be used to control spoilage microorganisms and to increase the shelf life of fresh fruits and vegetables in replacement for the treatment with chemical fumigants. In order to enforce labelling regulations, methods for detecting the irradiation treatment directly in the produce are required. Recently, a number of detection methods for irradiated food have been adopted by the Codex Comission. A rapid screening method for qualitative detection of irradiation is the DNA Comet Assay. The applicability of the DNA Comet Assay for distinguishing irradiated papaya, melon, and watermelon was evaluated. The samples were treated in a 60Co facility at dose levels of 0.0, 0.5, 0.75, and 1.0kGy. The irradiated samples showed typical DNA fragmentation whereas cells from non-irradiated ones appeared intact. In addition to the DNA Comet Assay also the half-embryo test was applied in melon and watermelon to detect the irradiation treatment.
Identification of gamma-irradiated papaya, melon and watermelon
International Nuclear Information System (INIS)
Marin-Huachaca, N.S.; Mancini-Filho, Jorge; Delincee, Henry; Villavicencio, A.L.C.H.
2004-01-01
Ionizing radiation can be used to control spoilage microorganisms and to increase the shelf life of fresh fruits and vegetables in replacement for the treatment with chemical fumigants. In order to enforce labelling regulations, methods for detecting the irradiation treatment directly in the produce are required. Recently, a number of detection methods for irradiated food have been adopted by the Codex Comission. A rapid screening method for qualitative detection of irradiation is the DNA Comet Assay. The applicability of the DNA Comet Assay for distinguishing irradiated papaya, melon, and watermelon was evaluated. The samples were treated in a 60 Co facility at dose levels of 0.0, 0.5, 0.75, and 1.0 kGy. The irradiated samples showed typical DNA fragmentation whereas cells from non-irradiated ones appeared intact. In addition to the DNA Comet Assay also the half-embryo test was applied in melon and watermelon to detect the irradiation treatment
Identification of gamma-irradiated papaya, melon and watermelon
Energy Technology Data Exchange (ETDEWEB)
Marin-Huachaca, N.S.; Mancini-Filho, Jorge E-mail: jmancini@usp.br; Delincee, Henry E-mail: henry.delincee@bfe.uni-karlsruhe.de; Villavicencio, A.L.C.H. E-mail: villavic@net.ipen.br
2004-10-01
Ionizing radiation can be used to control spoilage microorganisms and to increase the shelf life of fresh fruits and vegetables in replacement for the treatment with chemical fumigants. In order to enforce labelling regulations, methods for detecting the irradiation treatment directly in the produce are required. Recently, a number of detection methods for irradiated food have been adopted by the Codex Comission. A rapid screening method for qualitative detection of irradiation is the DNA Comet Assay. The applicability of the DNA Comet Assay for distinguishing irradiated papaya, melon, and watermelon was evaluated. The samples were treated in a {sup 60}Co facility at dose levels of 0.0, 0.5, 0.75, and 1.0 kGy. The irradiated samples showed typical DNA fragmentation whereas cells from non-irradiated ones appeared intact. In addition to the DNA Comet Assay also the half-embryo test was applied in melon and watermelon to detect the irradiation treatment.
Purification and MIC analysis of antimicrobial proteins from Cucumis sativus L. seeds.
Al Akeel, Raid; Mateen, Ayesha; Alharbi, Khalid K; Alyousef, Abdullah A; Al-Mandeel, Hazem M; Syed, Rabbani
2018-04-03
Cucumis sativus L. (cucumber), from the family Cucurbitaceae, is a therapeutic plant with various pharmacological benefits, broadly utilized as a part of complementary medicine (e.g., Unani, Ayurveda, Siddha, and Traditional Chinese). In light of past research discoveries, this plant had been chosen to consider its potential antibacterial action. Extracts were purified by dialysis and ion exchange chromatography strategy and then assayed for antibacterial activity against four standard pathogenic bacterial strains known to cause foodborne infections and spoilage of food and herbal drugs. Antimicrobial peptides were extracted from seeds using a sodium phosphate citrate (pH 7.2) - CTAB cradle (pH 6.0). The highest protein concentration was seen with elute fractions 1 and 3 (370 mg/mL) compared with elute fractions 2 and 4 (340 mg/mL). Among the bacteria utilized, E. coli was clearly the most sensitive out of selected four strains. Our results suggest that Cucumis sativus L seeds extracts have significant potentials as new antimicrobial agents.
Directory of Open Access Journals (Sweden)
Navam S. Hettiarachchy
2011-02-01
Full Text Available Background: Bitter Melon (Momordica charantia L is one of the most popular cooked vegetables in many Asian countries. Its experimental use in mice has indicated improvement in glucose tolerance against Type II diabetes and reduction in blood cholesterol. However, it has not been proven which alkaloids, polypeptides, or their combinations in the Bitter Melon extract are responsible for the medicinal effects. Green and white varieties of Bitter Melon differ strikingly in their bitter tastes, green being much more bitter than white. It is not yet known whether they are different in their special nutritional and hypoglycemic properties. Nutritional qualities of Bitter Melons such as protein, amino acids, minerals, and polyphenolics contents were determined using four selected varieties such as Indian Green [IG], Indian White [IW], Chinese Green [CG], and Chinese White [CW] grown at the University of Arkansas at Pine Bluff [UAPB] Agricultural Research Center. Results indicated that protein levels of IW were significantly higher than IG in both flesh and seed. Methods: Four Bitter Melon varieties, Indian Green [IG], Indian White [IW], Chinese Green [CG] and Chinese White [CW] were used for phytochemical analyses to determine protein contents, protein hydrolysis, amino acids contents, and their antioxidant and antimutagenic activities. All analyses were conducted following standard methods. Statistical analyses wereconducted using JMP 5 software package [SAS]. The Tukey’s HSD procedure was used for the significance of differences at the 5% level. Results: Moisture contents across the four varieties of Bitter Melon flesh ranged between 92.4 and 93.5%, and that of seed ranged between 53.3 and 75.9%. Protein contents of the flesh were highest in IW [9.8%] and lowest in CG [8.4%]. Seed protein contents were the highest in IW [31.3%] and lowest in IG [27.0%]. Overall, white varieties had higher protein contents than the green varieties. Compared with soy
Directory of Open Access Journals (Sweden)
Y. B. Medvedkov
2016-01-01
Full Text Available Research and innovation activity to create energy-efficient processes in the melon processing, is a significant task. Separation skin from the melon flesh with their subsequent destination application in the creation of new food products is one of the time-consuming operations in this technology. Lack of scientific and experimental base of this operation holding back the development of high-performance machines for its implementation. In this connection, the technique of the experiment on the separation of the skins of melons in the pilot plant and the search for optimal regimes of its work methods by statistical modeling is offered. The late-ripening species of melon: Kalaysan, Thorlami, Gulab-sary are objects of study. Interaction of factors influencing on separating the melon skins process is carried out. A central composite rotatable design and fractional factorial experiment was used. Using the method of experimental design with treatment planning template in Design Expert v.10 software yielded a regression equations that adequately describe the actual process. Rational intervals input factors values are established: the ratio of the rotational speed of the drum to the abrasive supply roll rotational frequency; the gap between the supply drum and the shearing knife; shearing blade sharpening angle; the number of feed drum spikes; abrading drum orifices diameter. The mean square error does not exceed 12.4%. Regression equations graphic interpretation is presented by scatter plots and engineering nomograms that can be predictive of a choice of rational values of the input factors for three optimization criteria: minimal specific energy consumption in the process of cutting values, maximal specific performance by the pulp and pulp extraction ratio values. Obtained data can be used for the operational management of the process technological parameters, taking into account the geometrical dimensions of the melon and its inhomogeneous structure.
Celik Altunoglu, Yasemin; Baloglu, Mehmet Cengiz; Baloglu, Pinar; Yer, Esra Nurten; Kara, Sibel
2017-01-01
Late embryogenesis abundant (LEA) proteins are large and diverse group of polypeptides which were first identified during seed dehydration and then in vegetative plant tissues during different stress responses. Now, gene family members of LEA proteins have been detected in various organisms. However, there is no report for this protein family in watermelon and melon until this study. A total of 73 LEA genes from watermelon ( ClLEA ) and 61 LEA genes from melon ( CmLEA ) were identified in this comprehensive study. They were classified into four and three distinct clusters in watermelon and melon, respectively. There was a correlation between gene structure and motif composition among each LEA groups. Segmental duplication played an important role for LEA gene expansion in watermelon. Maximum gene ontology of LEA genes was observed with poplar LEA genes. For evaluation of tissue specific expression patterns of ClLEA and CmLEA genes, publicly available RNA-seq data were analyzed. The expression analysis of selected LEA genes in root and leaf tissues of drought-stressed watermelon and melon were examined using qRT-PCR. Among them, ClLEA - 12 - 17 - 46 genes were quickly induced after drought application. Therefore, they might be considered as early response genes for water limitation conditions in watermelon. In addition, CmLEA - 42 - 43 genes were found to be up-regulated in both tissues of melon under drought stress. Our results can open up new frontiers about understanding of functions of these important family members under normal developmental stages and stress conditions by bioinformatics and transcriptomic approaches.
Wide hybridization is an important tool for crop improvement. Recently, we successfully developed a synthetic allotetraploid from interspecific cross between cucumber and its relative Cucumis hystrix-(2n = 2x =24) followed by chemical induction of chromosome doubling. The resulting allotetraploid wa...
Cucumber (Cucumis sativus L.) seed performance as influenced by ovary and ovule position
Jing, H.C.; Jalink, H.; Bergervoet, J.W.; Klooster, M.; Du, S.L.; Bino, R.J.; Hilhorst, H.W.M.; Groot, S.P.C.
2000-01-01
The performance of cucumber (Cucumis sativus L.) seeds in relation to ovary and ovule position was monitored during seed production. Seeds from three (first, seventh and tenth nodes) fruit positions and three (stylar, intermediate and peduncular) ovule positions were harvested serially during
Directory of Open Access Journals (Sweden)
Alejandro Moreno-Reséndez
2014-04-01
Full Text Available Se determinó el efecto del vermicompost (VC sobre el desarrollo del melón en invernadero utilizando como sustratos cuatro tipos de VC mezclados con arena de río (AR, con relaciones 25 : 75, 30 : 70, 35 : 65 y 40 : 60 (% en volumen. Los VC se prepararon a partir de estiércoles de caballo, cabra, conejo y bovino. Los sustratos se colocaron en bolsas de polietileno negro, de 20 kg de capacidad, en donde se sembraron semillas del melón Cantaloupe. Las plantas se condujeron a un solo tallo, tutorando con rafia y la demanda hídrica se cubrió con riego por goteo. Las bolsas, utilizadas como macetas, se colocaron en fila a doble hilera, con arreglo a tresbolillo. Se utilizó un diseño de bloques completos al azar en arreglo factorial 4x4 con cuatro repeticiones. El factor A fueron las mezclas VC : AR y el B los diferentes VC. El análisis de varianza mostró que con 40 % de VC, independientemente del VC usado, se registraron diferencias altamente significativas (P ≤ 0.01 para rendimiento, peso de fruto, diámetros ecuatorial y polar, espesor de pulpa, cavidad de la placenta y días a cosecha, con 96.386 t ha-1, 1.688 kg fruto-1, 14.55 cm, 16.73 cm, 3.77 cm, 5.57 cm y 89 d respectivamente, sin importar el tipo de estiércol utilizado en las mezclas con VC. El contenido promedio de sólidos solubles en los frutos resultó estadísticamente igual en cualquier nivel y tipo de VC empleado.
Ramírez Barraza, Brenda Aracely
2014-01-01
Actualmente los productores de melón (Cucumis melo L.) y sandía (Citrullus lanatus), productos que compiten por el uso de los recursos en la Comarca Lagunera, enfrentan el problema de bajos precios en los meses de junio, julio y agosto como consecuencia de la existencia de excesos de oferta temporales. Los excesos de oferta se originan por la concentración de la producción en algunos meses, o bien por dedicar una mayor superficie a alguno de los dos cultivos. Para analizar cómo cambios en l...
Effect of mulching on melon (cv. Campero) crop coefficient
DEFF Research Database (Denmark)
Cerekovic, Natasa; Todorovic, Mladen; Snyder, Richard L.
2011-01-01
. This improvement is particularly important because midseason Kc refers to the peak Kc values and relies on the period of growing season that is usually the most important for irrigation and the most sensitive to water stress, thus when an accurate scheduling should be applied. Overall results indicate...... depend mainly on water management practices during the end of the season. A review of Kc for melon grown under mulch and the results of investigations on Policoro data confirmed relevant difference in the length of the growing period in respect to the data presented in FAO 56. Therefore, careful....... The Kc mid values determined with equations are average adjustments for the mid-season period for the melon crop in Policoro, taking in consideration relevant weather data for wind speed and relative humidity as averages for these period. High Kc values were related to irrigation events. Kc end values...
Directory of Open Access Journals (Sweden)
Shovic Anne C
2011-07-01
Full Text Available Abstract Background Although beneficial to health, dietary phytonutrients are bitter, acid and/or astringent in taste and therefore reduce consumer choice and acceptance during food selection. Momordica charantia, commonly known as bitter melon has been traditionally used in Ayurvedic and Chinese medicine to treat diabetes and its complications. The aim of this study was to develop bitter melon-containing recipes and test their palatability and acceptability in healthy individuals for future clinical studies. Methods A cross-sectional sensory evaluation of bitter melon-containing ethnic recipes was conducted among 50 healthy individuals. The primary endpoints assessed in this analysis were current consumption information and future intentions to consume bitter melon, before and after provision of attribute- and health-specific information. A convenience sample of 50, self-reported non-diabetic adults were recruited from the University of Hawaii. Sensory evaluations were compared using two-way ANOVA, while differences in stage of change (SOC before and after receiving health information were analyzed by Chi-square (χ2 analyses. Results Our studies indicate that tomato-based recipes were acceptable to most of the participants and readily acceptable, as compared with recipes containing spices such as curry powder. Health information did not have a significant effect on willingness to consume bitter melon, but positively affected the classification of SOC. Conclusions This study suggests that incorporating bitter foods in commonly consumed food dishes can mask bitter taste of bitter melon. Furthermore, providing positive health information can elicit a change in the intent to consume bitter melon-containing dishes despite mixed palatability results.
2011-01-01
Background Although beneficial to health, dietary phytonutrients are bitter, acid and/or astringent in taste and therefore reduce consumer choice and acceptance during food selection. Momordica charantia, commonly known as bitter melon has been traditionally used in Ayurvedic and Chinese medicine to treat diabetes and its complications. The aim of this study was to develop bitter melon-containing recipes and test their palatability and acceptability in healthy individuals for future clinical studies. Methods A cross-sectional sensory evaluation of bitter melon-containing ethnic recipes was conducted among 50 healthy individuals. The primary endpoints assessed in this analysis were current consumption information and future intentions to consume bitter melon, before and after provision of attribute- and health-specific information. A convenience sample of 50, self-reported non-diabetic adults were recruited from the University of Hawaii. Sensory evaluations were compared using two-way ANOVA, while differences in stage of change (SOC) before and after receiving health information were analyzed by Chi-square (χ2) analyses. Results Our studies indicate that tomato-based recipes were acceptable to most of the participants and readily acceptable, as compared with recipes containing spices such as curry powder. Health information did not have a significant effect on willingness to consume bitter melon, but positively affected the classification of SOC. Conclusions This study suggests that incorporating bitter foods in commonly consumed food dishes can mask bitter taste of bitter melon. Furthermore, providing positive health information can elicit a change in the intent to consume bitter melon-containing dishes despite mixed palatability results. PMID:21794176
Biopesticide effect of green compost against fusarium wilt on melon plants.
Ros, M; Hernandez, M T; Garcia, C; Bernal, A; Pascual, J A
2005-01-01
The biopesticide effect of four green composts against fusarium wilt in melon plants and the effect of soil quality in soils amended with composts were assayed. The composts consisted of pruning wastes, with or without addition of coffee wastes (3/1 and 4/1, dry wt/dry wt) or urea (1000/1, dry wt/dry wt). In vitro experiments suggested the biopesticide effect of the composts against Fusarium oxysporum, while only the compost of pine bark and urea (1000/1dry wt/dry wt) had an abiotic effect. Melon plant growth with composts and F. oxysporum was one to four times greater than in the non-amended soil, although there was no significant decrease in the level of the F. oxysporum in the soil. The addition of composts to the soil also improved its biological quality, as assessed by microbiological and biochemical parameters: ATP and hydrolases involved in the P (phosphatase), C (beta-glucosidase) and N (urease) cycles. Green composts had greater beneficial characteristics, improved plant growth and controlled fusarium wilt in melon plants. These composts improve the soil quality of semi-arid agricultural soils. Biotic and abiotic factors from composts have been tested as responsible of their biopesticide activity against fusarium wilt.
Directory of Open Access Journals (Sweden)
Ernesto Hartmann
2013-06-01
Full Text Available O Melos e Harmonia Acústica de César GUERRA-PEIXE (1988 apresenta um compêndio da atividade didática deste compositor expresso em forma de apostila. O presente trabalho busca traçar as possíveis influências comparando-o ao Caderno de Estudos com Koellreutter do próprio GUERRA-PEIXE (1944 e ao The Craft of Musical Composition de Paul HINDEMITH (1937, visando compreender melhor os pressupostos técnicos e teóricos.The Melos e Harmonia Acústica by César GUERRA-PEIXE (1988, presented a survey of the didactical activity of this composer expressed in a textbook form. This research attempts to trace possible influences, comparing it to The Craft of Musical Composition by Paul HINDEMITH (1937 and Caderno de Estudos com Koellreutter by GUERRA-PEIXE (1944 in order to better understand the technical and theoretical approaches embodied in it.
Directory of Open Access Journals (Sweden)
Márcio Sampaio Pimentel
2012-04-01
Full Text Available Soil macrofauna is responsible for soil fertility through cycling of nutrients, tillage and fragmentation of organic matter, as well as through the association between groups of fauna with conserved and/or degraded pedoenvironments. Nevertheless, under the conditions of the Brazilian semi-arid region, there is little information about this resource. The objective of this study was to evaluate the epigeous macrofauna in successive cropping using previous green manure and subsequent planting of melon (Cucumis melo L. in Juazeiro county, Bahia, Brazil. Sampling dates were undertaken in November 2007 and February, April and July 2008, using traps containing 4 % formaldehyde for seven days in plots of 64 m2. Results obtained indicate that there is no difference among the treatments with mixed cover crops, and epigeous macrofauna is influenced by the time of collection. Diversity and uniformity are inversely correlated with total density of epigeous macrofauna. Diversification of plant species favors the increase of diversity and uniformity of epigeous macrofauna. Formicidae, followed by Isopoda, Coleoptera and Oligochaeta are the groups of fauna most numerous in the areas. A macrofauna do solo é responsável pela melhoria da fertilidade do solo através da ciclagem de nutrientes, revolvimento e fragmentação da matéria orgânica, como também, pela associação entre grupos de fauna com pedoambientes conservados e/ou degradados. No entanto, nas condições de semi-árido brasileiro pouca informação se tem a respeito deste recurso. Neste sentido, na região do sub-médio do Rio São Francisco, pólo de desenvolvimento da agricultura irrigada objetivou-se avaliar a macrofauna epígea em sucessão cultural utilizando prévia adubação verde e subseqüente plantio de melão (Cucumis melo L.. As coletas foram realizadas em novembro de 2007 e fevereiro, abril e julho de 2008 no município de Juazeiro, BA, utilizando armadilhas contendo formol 4
Ramachandran, C.; Brandenburg, W.A.; Nijs, de S.A.P.M.
1985-01-01
Infraspecific cytogenetical variation was studied in a diverse collection of five non-cultivated and cultivatedCucumis sativus accessions. The individual chromosomes of different accessions could be identified by the C-banding pattern and chromosome measurements. About 40–50% of the genomic area are
Review of Scientific Evidence of Medicinal Convoy Plants in Traditional Persian Medicine
Sadati, Seyede Nargess; Ardekani, Mohammad Reza Shams; Ebadi, Nastaran; Yakhchali, Maryam; Dana, Azadeh Raees; Masoomi, Fatemeh; Khanavi, Mahnaz; Ramezany, Farid
2016-01-01
One concept used in traditional Persian medicine (TPM) for multidrug therapy is that of the convoy drug (Mobadregh). According to TPM texts, convoy drugs are substances (or drugs), which facilitate the access of drugs or foods to the whole body or to specific organs. This study reviewed some convoy drugs presented in TPM, their biological effects, and their probable interactions with main drugs, considering the increased absorption through inhibition of P-glycoprotein (P-gp) efflux function, bioavailability-enhancing effects, and decreased metabolism of the main drug using electronic databases including PubMed, Scopus, ScienceDirect, and Google Scholar in November and December, 2013. Recent studies have proven the beneficial effects of Crocus sativus L. (saffron) and camphor on the heart and brain, the cerebral therapeutic effects of Asarum europaeum (hazelwort), the hepatoprotective effects of Cichorium intybus (chicory), and Apium graveolens (celery) seeds, and the diuretic effects of Cinnamomum zeylanicum (cinnamon), and Cucumis melo (melon) seeds. The effects of vinegar in targeting the liver and brain have also been demonstrated. An evaluation of the results demonstrated that the suggested convoy drugs, including Piper nigrum (black pepper), Piper longum (long pepper), red wine, Camellia sinensis (tea), hazelwort, Mentha longifolia (pennyroyal), Anethum graveolens (dill), Foeniculum vulgare (fennel), cinnamon, and Sassafras albidum (sassafras) can increase the bioavailability of coadministered drugs by inhibition of P-gp or cytochrome P450s (CYP450s) or both of them. This evidence could be a good basis for the use of these agents as convoys in TPM. PMID:27041871
Monitoring Resistance to Spinosad in the Melon Fly (Bactrocera cucurbitae in Hawaii and Taiwan
Directory of Open Access Journals (Sweden)
Ju-Chun Hsu
2012-01-01
Full Text Available Spinosad is a natural insecticide with desirable qualities, and it is widely used as an alternative to organophosphates for control of pests such as the melon fly, Bactrocera cucurbitae (Coquillett. To monitor the potential for development of resistance, information about the current levels of tolerance to spinosad in melon fly populations were established in this study. Spinosad tolerance bioassays were conducted using both topical applications and feeding methods on flies from field populations with extensive exposure to spinosad as well as from collections with little or no prior exposure. Increased levels of resistance were observed in flies from the field populations. Also, higher dosages were generally required to achieve specific levels of mortality using topical applications compared to the feeding method, but these levels were all lower than those used for many organophosphate-based food lures. Our information is important for maintaining effective programs for melon fly management using spinosad.
Monitoring Resistance to Spinosad in the Melon Fly (Bactrocera cucurbitae) in Hawaii and Taiwan
Hsu, Ju-Chun; Haymer, David S.; Chou, Ming-Yi; Feng, Hai-Tung; Chen, Hsaio-Han; Huang, Yu-Bing; Mau, Ronald F. L.
2012-01-01
Spinosad is a natural insecticide with desirable qualities, and it is widely used as an alternative to organophosphates for control of pests such as the melon fly, Bactrocera cucurbitae (Coquillett). To monitor the potential for development of resistance, information about the current levels of tolerance to spinosad in melon fly populations were established in this study. Spinosad tolerance bioassays were conducted using both topical applications and feeding methods on flies from field populations with extensive exposure to spinosad as well as from collections with little or no prior exposure. Increased levels of resistance were observed in flies from the field populations. Also, higher dosages were generally required to achieve specific levels of mortality using topical applications compared to the feeding method, but these levels were all lower than those used for many organophosphate-based food lures. Our information is important for maintaining effective programs for melon fly management using spinosad. PMID:22629193
Directory of Open Access Journals (Sweden)
Sandor Christiano Buys
2002-09-01
Full Text Available The last instar larva of Microstigmus nigrophthalmus Melo, 1992 is described. It markedly differs from that of M. comes Krombein, 1967 the only other species in the genus whose mature larva have been described, for features as follows: presence of spinnerets; setae on the labrum, maxillae and labium; mandibles with tridentate apex and a bidentate lateral projection; lack of the conical supranal processo Notes on habitat, structure, and content of nests are also presented.
Cytoprotection mediated antiulcer effect of aqueous fruit pulp extract of Cucumis sativus
Directory of Open Access Journals (Sweden)
Swapnil Sharma
2012-05-01
Full Text Available Objective: The study was aimed to evaluate the gastroprotective potential of Cucumis Sativus fruit pulp aqueous extract (CSE in gastric ulcerated rats. Methods: Cytoprotective potential was evaluated via oral administration of CSE at the doses of 250, 500 &1000 mg/kg three times in a day, for 5 days before the induction of ulcers in indomethacin and pyloric ligation induced ulcer model. Further, its effects were studied on various parameters volume of gastric juice, pH, free and total acidity, protein concentration, acid output in gastric juice, lipid peroxide (LPO, and activities of enzymic antioxidants-super oxide dismutase (SOD and catalase (CAT in gastric mucosa. The levels of hexose, hexosamine, sialic acid, fucose in gastric mucosa and gastric juice were also examined. The extent of healing was also determined with post administration of CSE at the same doses & dosage schedule in acetic acid induced model. Results: In indomethacin and pyloric ligation model, the pretreatment with CSE and ranitidine significantly reduced the lesion index, in comparison with control treated group (P< 0.05. The percentages of protection of ulcers were 25.8, 65.7, 80.6 & 93.8 for the treated groups of CSE and ranitidine whereas in pyloric ligation it was 31.26, 55.18, 93.26 & 95.51 respectively. In pyloric ligation model, CSE resulted in significant increase in pH, enzymic antioxidants i.e. SOD & CAT, with a significant decrease in volume of gastric juice, free and total acidity, protein & carbohydrate concentration and LPO levels. In acetic acid inducer model, treatment with Cucumis sativus (CSE caused significant reduction in lesion index in when compared to control treated group, providing evidence for ulcer healing capacity of it. The presence of the flavonoids and polyphenols may be responsible for the gastroprotective effect of CSE. Conclusions: The aqueous fruit pulp extract of Cucumis sativus (CSE has a gastroprotective property.
Jing, Xin; Wang, Hui; Gong, Biao; Liu, Shiqi; Wei, Min; Ai, Xizhen; Li, Yan; Shi, Qinghua
2018-03-01
We evaluated the effect of different light combinations on powdery mildew resistance and growth of melon seedlings. Light-emitting diodes were used as the light source and there were five light combinations: white light (420-680 nm); blue light (460 nm); red light (635 nm); RB31 (ratio of red and blue light, 3: 1); and RB71 (ratio of red and blue light, 7: 1). Compared with other treatments, blue light significantly decreased the incidence of powdery mildew in leaves of melon seedlings. Under blue light, H 2 O 2 showed higher accumulation, and the content of phenolics, flavonoid and tannins, as well as expression of the genes involved in synthesis of these substances, significantly increased compared with other treatments before and after infection. Lignin content and expression of the genes related to its synthesis were also induced by blue light before infection. Melon irradiated with RB31 light showed the best growth parameters. Compared with white light, red light and RB71, RB31 showed higher accumulation of lignin and lower incidence of powdery mildew. We conclude that blue light increases melon resistance to powdery mildew, which is dependent on the induction of secondary metabolism that may be related to H 2 O 2 accumulation before infection. Induction of tolerance of melon seeds to powdery mildew by RB31 is due to higher levels of sucrose metabolism and accumulation of lignin. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
Kakinohana, H.; Kuba, H.; Kohama, T.; Kinjo, K.; Taniguchi, M.; Nakamori, H.; Tanahara, A.; Sokei, Y.
1997-01-01
In 1972, MAFF, Japan and the Okinawa Prefectural Government initiated an experimental eradication project of the melon fly from Kume Island, Okinawa Prefecture, Japan using the sterile insect technique (SIT). Following the successful eradication on Kume Island in 1978, large scale SIT was started to eradicate the melon fly on the 3 groups of islands, Miyako, Okinawa and Yaeyama of Okinawa Prefecture, Japan in 1984, 1986 and 1989, and eradication was achieved in 1987, 1990 and 1993, respectively. For the successful eradication on Miyako, Okinawa and Yaeyama groups of islands, about 6,340, 30,940 and 15,440 million sterile melon flies were released, respectively
Fertilizer use efficiency by maize (Zea mays) and egusi- melon ...
African Journals Online (AJOL)
DBOY
fertilizers by maize and egusi-melon in various ratios of mixtures in an ultisol in ... fertilizers replicated three timesfor two years as experiments 2009 and 2010, .... design. In 2011, the fertilizer rates were increased to six to further determine the ...
A new frontier of Okinawa's agriculture: An economic evaluation of the melon fly eradication project
International Nuclear Information System (INIS)
Kakazu, H.
2006-01-01
During the post-reversion period (1972-2002), Okinawa's GDP has grown on average by 6.40% annually. In the growth process, agricultural activities have been rapidly replaced by construction and services activities such as public works and tourism. Okinawa's agriculture has been diversifying from traditional sugarcane and pineapple cultivation to flowers, tropical fruits and various healthy foods such as bitter melon or ''goya'' and turmeric. This paper attempts to post-evaluate the area-wide melon fly eradication project in Okinawa which was successfully completed in 1993. The melon flies affected more than 40 important vegetables and fruits in Okinawa. The sterile insect technique (SIT), an environmentally friendly method, was adopted to eradicate the flies. Based on conventional cost-benefit analysis, the project produced net accumulated benefits after 6 years of the eradication. The study shows that the project is viable even on commercial basis
Characterization of a soluble phosphatidic acid phosphatase in bitter melon (Momordica charantia).
Cao, Heping; Sethumadhavan, Kandan; Grimm, Casey C; Ullah, Abul H J
2014-01-01
Momordica charantia is often called bitter melon, bitter gourd or bitter squash because its fruit has a bitter taste. The fruit has been widely used as vegetable and herbal medicine. Alpha-eleostearic acid is the major fatty acid in the seeds, but little is known about its biosynthesis. As an initial step towards understanding the biochemical mechanism of fatty acid accumulation in bitter melon seeds, this study focused on a soluble phosphatidic acid phosphatase (PAP, 3-sn-phosphatidate phosphohydrolase, EC 3.1.3.4) that hydrolyzes the phosphomonoester bond in phosphatidate yielding diacylglycerol and P(i). PAPs are typically categorized into two subfamilies: Mg(2+)-dependent soluble PAP and Mg(2+)-independent membrane-associated PAP. We report here the partial purification and characterization of an Mg(2+)-independent PAP activity from developing cotyledons of bitter melon. PAP protein was partially purified by successive centrifugation and UNOsphere Q and S columns from the soluble extract. PAP activity was optimized at pH 6.5 and 53-60 °C and unaffected by up to 0.3 mM MgCl2. The K(m) and Vmax values for dioleoyl-phosphatidic acid were 595.4 µM and 104.9 ηkat/mg of protein, respectively. PAP activity was inhibited by NaF, Na(3)VO(4), Triton X-100, FeSO4 and CuSO4, but stimulated by MnSO4, ZnSO4 and Co(NO3)2. In-gel activity assay and mass spectrometry showed that PAP activity was copurified with a number of other proteins. This study suggests that PAP protein is probably associated with other proteins in bitter melon seeds and that a new class of PAP exists as a soluble and Mg(2+)-independent enzyme in plants.
International Nuclear Information System (INIS)
Dong, H.; Li, Z.; Zhang, D.; Li, W.; Tang, W.
2004-01-01
Cresotic acid (3-hydroxy-4-methylbenzoic acid) was proved be active in controlling wilt diseases of melon and cotton plants grown in the house. Soil drench with 200-1000 ppm cresotic acid induced 62-77 %, 69-79 % and 50-60 % protection against Fusarium oxysporum f.sp melonis (FOM) in melon, Fusarium oxysporum f.sp vasinfectum (FOV) and Verticillium dahliae in cotton, respectively. Since no inhibitory effect of cresotic acid on mycelial growth of these three fungual pathogens was observed in vitro, it is suggested that control of these wilt diseases with cresotic acid resulted from induced resistance. Cresotic acid induced resistance in melon plants not only against race 0, race 1, race 2 and race 1,2, but also against a mixture of these four races of FOM, suggesting a non-race- specific resistance. Level of induced resistance by cresotic acid against FOM depended on inoculum pressure applied to melon plants. At 25 day after inoculation with FOM, percentage protection induced by cresotic acid under low inoculum pressure retained a level of 51 %, while under high inoculum pressure percentage protection decreased to only 10 %. High concentrations of cresotic acid significantly reduced plant growth. Reduction in fresh weight of melon (36-51%) and cotton (42-71%) was obtained with 500-1000 ppm cresotic acid, while only less than 8% reduction occurred with 100-200 ppm. (author)
Botondi, Rinaldo; Moscetti, Roberto; Massantini, Riccardo
2016-05-01
Ozonated water and peracetic acid were tested as sanitizers to enhance the storability of fresh-cut melon cubes. Sanitizers were also combined with suitable packaging materials (polypropylene and polylactic acid based plastic films). Fresh-cut melon cubes were stored at 4 °C for up to 7 days. Ozonated water and peracetic acid treatments were given by dipping cubes into 0.8 ppm O3 and 100 ppm Tsunami 100™ solutions, respectively, for 3 min. Both sanitizers exhibited efficiency in reducing the total microbial counts on melon cubes (acid treatment in combination with polypropylene film packaging, consequently developing off-odors starting from day 3. Strong color changes were noted in cubes stored in polylactic acid packaging after 7 days of storage, affecting the sensory quality of the melon cubes. Sensory evaluation (overall visual quality) indicated loss in flavor in the polypropylene packaging. The overall visual quality started to decline on 3rd day because of the development of translucency.Overall, the use of ozone in combination with polypropylene packaging provided the best solution to maintain the quality of melon cubes for up to 5 days of storage at 4 °C.
Preliminary Study on the Use of Urea Activated Melon ( Citrullus ...
African Journals Online (AJOL)
Adsorption studies were carried out using urea activated melon (Citrullus colocynthis) husks as a low-cost potential adsorbent to remove cadmium from industrial effluents. Bioabsorption parameters considered were as contact time, adsorbent dosage and adsorbate concentration. Cadmium removal was found to be ...
Colás-Medà, Pilar; Viñas, Inmaculada; Oliveira, Márcia; Anguera, Marina; Serrano, Jose C E; Abadias, Maribel
2017-04-01
Survival and virulence of foodborne pathogens can be influenced by environmental factors such as the intrinsic properties of food as well as the extrinsic properties that contribute to food shelf life (e.g., temperature and gas atmosphere). The direct contribution of food matrix characteristics on the survival of L. monocytogenes during fresh-cut fruit shelf life is not very well understood. In addition, the gastrointestinal tract is the primary route of listeriosis infection and penetration of the intestinal epithelial cell barrier is the first step in the infection process. Hence, the pathogenic potential of L. monocytogenes, measured as the capability for the organism to survive a simulated gastrointestinal tract and the proportion of cells able to subsequently adhere to and invade differentiated Caco-2 cells, subjected to fresh-cut pear and melon shelf life, was investigated. Samples were inoculated, stored at 10 °C for 7 days and evaluated after inoculation and again after 2 and 7 days of storage. A decrease in L. monocytogenes' capacity to survive a simulated gastrointestinal tract was observed with increasing storage time, regardless of the fruit matrix evaluated. Furthermore, L. monocytogenes placed on fresh-cut pear and melon was subjected to an attachment and invasion assay after crossing the simulated gastrointestinal tract. After inoculation, pathogen on fresh-cut pear showed 5-fold more capacity to adhere to Caco-2 cells than pathogen on fresh-cut melon. After 2 days of storage, L. monocytogenes grown on fresh-cut melon showed similar adhesive capacity (1.11%) than cells grown on pear (1.83%), but cells grown on melon had the higher invasive capacity (0.0093%). We can conclude that minimally processed melon could represent a more important hazard than pear under the studied shelf life. Copyright © 2016 Elsevier Ltd. All rights reserved.
Celik Altunoglu, Yasemin; Baloglu, Mehmet Cengiz; Baloglu, Pinar; Yer, Esra Nurten; Kara, Sibel
2017-01-01
Late embryogenesis abundant (LEA) proteins are large and diverse group of polypeptides which were first identified during seed dehydration and then in vegetative plant tissues during different stress responses. Now, gene family members of LEA proteins have been detected in various organisms. However, there is no report for this protein family in watermelon and melon until this study. A total of 73 LEA genes from watermelon (ClLEA) and 61 LEA genes from melon (CmLEA) were identified in this co...
Cucurbits powdery mildew race identity and reaction of melon genotypes
Genetic resistance is one of the most suitable strategies to control cucurbit powdery mildew (CPM) on melon, incited by Podosphaera xanthii or Golovinomyces orontii. However, many races of these pathogens have been reported worldwide in recent years, what may compromise the effectiveness of this met...
Directory of Open Access Journals (Sweden)
Melcion Mateu
2009-12-01
Full Text Available In 1951, the book Em va fer Joan Brossa [Joan Brossa Made me] was published in Barcelona, with a preface by João Cabral de Melo Neto. It is a useful text to better understand Brossa as well as Cabral; it is a significant text in order to grasp the individual response of these poets to the problem of returning to realism for the early post-war period. A translation of João Cabral de Melo Neto's preface, previously unpublished in Portuguese, is presented here.
Influence of Potassium Installment (K on Melon Features Using System Tutoring in Sinop-Mt
Directory of Open Access Journals (Sweden)
João de Andrade Bonetti
2011-06-01
Full Text Available Potassium is an extremely important nutrient for the production of melon. To produce with quality is a necessity in today's market. The aim of this study was to evaluate the differences in productivity, length, diameter and oBrix content and acidity due to the fragmentation of fertilization. The research was developed in the city of Sinop-MT, in 2010. In the experience, randomized blocks (RBD with 2 treatments (DBC and 11 plots, totaling 22 repetitions, were used. Treatment (T1 consisted of the application of the total recommendation of potassium at planting (240 kg ha-¹. In treatment two (T2, 20% of the recommendation were applied at sowing, 20%, 30 days after sowing (DAS, 40%, 45 DAS and 20%, 60 DAS. Each plot consisted of 8 melon plants. 8 melons were harvested by repetition when they reached the point of physiological maturity. Productivity (kg-1, length and diameter (cm-1, sugar content and acidity were the parameters for evaluation. Data were subjected to analysis of variance and the obtained means were compared by Tukey test with p <(0.05. The analysis of variance showed significant results for treatment. Regarding the means, T1 was lower when compared to T2 °Brix values of 8.775 and 10.15 respectively differing among themselves. The same was true for the acidity, (T1 8,6 and T2 11.1. As for productivity, length and diameter there was no statistical difference. The results showed that potassium fertilizer management is important for obtaining high-quality melons.
Physical and chemical characteristics of melon in organic farming
Directory of Open Access Journals (Sweden)
Rosete A. G. Kohn
2015-07-01
Full Text Available Melon farming is characterized as an important family agriculture activity and the organic production of fruits and vegetables has shown a large growth in terms of areas in Brazil and around the world. This work aimed to study the postharvest quality of melon cultivated in an organic system. The organic treatments constituted of base fertilizer with cattle manure vermicompost (recommended dose, ½ dose and double dose plus the use of biofertilizer (sprayed or sprayed + irrigated, and an additional treatment with chemical fertilization. The postharvest quality was evaluated through physico-chemical and phytochemical attributes. The organic management with half the recommended dose of vermicompost plus the sprayed biofertilizer and the chemical fertilization management produced fruits with higher levels of sugar, total carotenoids, ascorbic acid and folates, obtaining more balanced fruits, with a better phytochemical quality. The antioxidant capacity was defined mainly by the presence of the phenolic compounds, which were influenced by the type and the dose of the evaluated fertilizers, with superiority in the organic treatments with double the dose of cattle manure vermicompost.
Alvarado-Sánchez, Tania; Monge-Pérez, José Eladio
2015-01-01
Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el nú...
First attempts of linking modelling, Postharvest behaviour and Melon Genetics
Tijskens, L.M.M.; Santos, Don N.; Obando-Ulloa, J.M.; Moreno, E.; Schouten, R.E.
2008-01-01
The onset of climacteric is associated with the end of melon fruit shelf-life. The aim of this research was to develop practical and applicable models of fruit ripening changes (hardness, moisture loss) also able to discriminate between climacteric and non-climacteric behaviour. The decrease in
Hu, Jian; Zhang, Jun L; Nardi, Francesco; Zhang, Run J
2008-11-01
The melon fly, Bactrocera cucurbitae Coquillett, is a species of fruit flies of significant agricultural interest. Of supposed Indian origin, the melon fly is now widely distributed throughout South East Asia up to China, while it has been recently eradicated from Japan. The population structure of seven geographic populations from coastal China, as well as samples from other regions of South East Asia and Japan, including lab colonies, have been studied using a 782 bp fragment of mitochondrial cytochrome oxidase I (COI) gene sequence. The observed genetic diversity was exceedingly low, considering the geographic scale of the sampling, and one single haplotype was found to be predominant from Sri Lanka to China. We confirm that Bactrocera cucurbitae exists in South East Asia as a single phyletic lineage, that Chinese populations are genetically uniform, and that no apparent genetic differentiation exists between these and three available Japanese melon fly sequences.
Nogueira, Carlos Henrique Feitosa
2012-01-01
Os estados do Rio Grande do Norte e Ceará são os principais produtores de melão do Brasil. São responsáveis por cerca de 90% da produção nacional, o que faz do cultivo do meloeiro Cucumis melo L. um dos principais segmentos da cadeia do agronegócio nesses estados. Apesar da alta tecnologia empregada para o cultivo desta olerícola, essa cultura vem sofrendo sérios danos devido ao ataque da mosca minadora Liriomyza sativae (Diptera: Agromyzidae). O método de controle utilizado pelos produtores ...
Directory of Open Access Journals (Sweden)
Rodrigo Otávio Câmara Monteiro
2014-01-01
Full Text Available Cropping intensification and technical, economic and environmental issues require efficient application of production factors to maintain the soil productive capacity and produce good quality fruits and vegetables. The production factors, water and NPK nutrients, are the most frequent limiting factors to higher melon yields. The objective of the present study was to identify the influence of subsurface drip irrigation and mulching in a protected environment on the water and NPK nutrients productivity in melon cropped in two soil types: sandy loam and clay. The melon crop cultivated under environmental conditions with underground drip irrigation at 0.20m depth, with mulching on sandy loam soil increased water and N, P2O5 and K use efficiency.
Carillon, Julie; Notin, Claire; Schmitt, Karine; Simoneau, Guy; Lacan, Dominique
2014-06-19
We aimed to investigate effects of superoxide dismutase (SOD)-melon concentrate supplementation on psychological stress, physical and mental fatigue in healthy people. A randomized, double-blind, placebo-controlled trial was performed on 61 people divided in two groups: active supplement (n = 32) and placebo (n = 29) for 12 weeks. Volunteers were given one small hard capsule per day. One capsule contained 10 mg of SOD-melon concentrate (140 U of SOD) and starch for the active supplement and starch only for the placebo. Stress and fatigue were evaluated using four psychometric scales: PSS-14; SF-36; Stroop tests and Prevost scale. The supplementation with SOD-melon concentrate significantly decreased perceived stress, compared to placebo. Moreover, quality of life was improved and physical and mental fatigue were reduced with SOD-melon concentrate supplementation. SOD-melon concentrate supplementation appears to be an effective and natural way to reduce stress and fatigue. trial approved by the ethical committee of Poitiers (France), and the ClinicalTrials.gov Identifier is NCT01767922.
Shi, Y; Wang, B L; Shui, D J; Cao, L L; Wang, C; Yang, T; Wang, X Y; Ye, H X
2015-04-01
The effects of 1-methylcyclopropene (1-MCP) on shelf life, fruit visual quality and nutritional quality were investigated. Netted melons were treated with air (control) and 0.6 µl l(-1) 1-MCP at 25 ℃ for 24 h, and then stored at 25 ℃ or 10 ℃ for 10 days. 1-MCP significantly extended the shelf life, inhibited weight loss and delayed firmness decline of melon fruits. Ethylene production was also inhibited and respiration rate was declined. 1-MCP retarded 1-aminocyclopropane-1-carboxylic acid (ACC) increases and inhibited ACC synthase and ACC oxidase activity. Moreover, 1-MCP treatment reduced the decrease in total soluble solids and titratable acidity, as well as the decrease of the content of sugars (sucrose, fructose and glucose). These results indicated that 1-MCP treatment is a good method to extend melon shelf life and maintain fruit quality, and the combination of 1-MCP and low temperature storage resulted in more acceptable fruit quality. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
Directory of Open Access Journals (Sweden)
Stuart Alan Walters
2018-03-01
Full Text Available Crop domestication and breeding efforts during the last half-century in developed countries has significantly reduced the genetic diversity in all major vegetable crops grown throughout the world. This includes developing countries such as Morocco, in which more than 90% of all farms are less than 10 ha in size, which are generally maintained by subsistence farmers who try to maximize crop and animal productivity on a limited land area. Near Agadir, in the remote Anti-Atlas mountain areas of the Souss-Massa region, many small landowner vegetable growers are known to still utilize crop populations (landraces. Thus, an assessment of the current status of vegetable landraces was made in this mountainous region of Southwestern Morocco during 2014. This assessment indicated that a significant loss of vegetable crop landraces has occurred in the last 30 years in this region of Morocco. Although many vegetable crops are still maintained as landrace populations by small subsistence farmers in remote areas in the Souss-Massa region, only 31% of these farmers cultivated landraces and saved seed in the villages assessed, with the average farmer age cultivating landraces being 52 years old. Moreover, the approximated loss of vegetable crop landraces over the last 30 years was an astounding 80 to 90%. Vegetable crops notably lost during this time period included carrot (Daucus carota, fava beans (Vicia faba, melon (Cucumis melo, pea (Pisum sativum, watermelon (Citrullus lanatus, and tomato (Solanum lycopersicon. The most significant loss was tomato as no landraces of this crop were found in this region. The vegetable crop landraces that are still widely grown included carrot, melon, onion (Allium cepa, turnip (Brassica rapa var. rapa, and watermelon, while limited amounts of eggplant (Solanum melongea, fava bean, pea, pepper (Capsicum annuum, and pumpkin (Cucurbita moshata and C. maxima were found. This recent genetic deterioration will have a profound
The effect of ethylene on transgenic melon ripening and fruit quality ...
African Journals Online (AJOL)
In cell wall expression analysis, MPG1 increased when fruits of transgenic melons were exposed to ethylene; showing they are ethylene- dependent. MPG2 decreased ... Ethylene productions in transgenic fruits were reestablished when ethylene was applied, exhibiting the same behavior as transgenic fruits. Antioxidant ...
FUNCTIONAL MALE STERILITY AND ITS USE IN BREEDING OF VEGETABLE AND MELON CROPS
A. N. Bocharnikov
2014-01-01
The article describes the manifestation of functional male sterility and its importance in the breeding of melons. Utilization of functional male sterility allows solving the problem effective hybrid seed production.
Bankole, S A; Joda, A O; Ashidi, J S
2005-01-01
Experiments were carried out to determine the potential of using the powder and essential oil from dried ground leaves of Cymbopogon citratus (lemon grass) to control storage deterioration and aflatoxin contamination of melon seeds. Four mould species: Aspergillus flavus, A. niger, A. tamarii and Penicillium citrinum were inoculated in the form of conidia suspension (approx. 10(6) conidia per ml) unto shelled melon seeds. The powdered dry leaves and essential oil from lemon grass were mixed with the inoculated seeds at levels ranging from 1-10 g/100 g seeds and 0.1 to 1.0 ml/100 g seeds respectively. The ground leaves significantly reduced the extent of deterioration in melon seeds inoculated with different fungi compared to the untreated inoculated seeds. The essential oil at 0.1 and 0.25 ml/100 g seeds and ground leaves at 10 g/100 g seeds significantly reduced deterioration and aflatoxin production in shelled melon seeds inoculated with toxigenic A. flavus. At higher dosages (0.5 and 1.0 ml/100 g seeds), the essential oil completely prevented aflatoxin production. After 6 months in farmers' stores, unshelled melon seeds treated with 0.5 ml/ 100 g seeds of essential oil and 10 g/100 g seeds of powdered leaves of C. citratus had significantly lower proportion of visibly diseased seeds and Aspergillus spp. infestation levels and significantly higher seed germination compared to the untreated seeds. The oil content, free fatty acid and peroxide values in seeds protected with essential oil after 6 months did not significantly differ from the values in seeds before storage. The efficacy of the essential oil in preserving the quality of melon seeds in stores was statistically at par with that of fungicide (iprodione) treatment. ((c) 2005 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim).
Directory of Open Access Journals (Sweden)
Julie Carillon
2014-06-01
Full Text Available Background: We aimed to investigate effects of superoxide dismutase (SOD-melon concentrate supplementation on psychological stress, physical and mental fatigue in healthy people. Methods: A randomized, double-blind, placebo-controlled trial was performed on 61 people divided in two groups: active supplement (n = 32 and placebo (n = 29 for 12 weeks. Volunteers were given one small hard capsule per day. One capsule contained 10 mg of SOD-melon concentrate (140 U of SOD and starch for the active supplement and starch only for the placebo. Stress and fatigue were evaluated using four psychometric scales: PSS-14; SF-36; Stroop tests and Prevost scale. Results: The supplementation with SOD-melon concentrate significantly decreased perceived stress, compared to placebo. Moreover, quality of life was improved and physical and mental fatigue were reduced with SOD-melon concentrate supplementation. Conclusion: SOD-melon concentrate supplementation appears to be an effective and natural way to reduce stress and fatigue. Trial registration: trial approved by the ethical committee of Poitiers (France, and the ClinicalTrials.gov Identifier is NCT01767922.
Screening of Turkish Melon Accessions for Resistance to ZYMV, WMV and CMV
Directory of Open Access Journals (Sweden)
Ercan EKBIC
2010-03-01
Full Text Available In the Çukurova University Department of Horticulture more than 350 melon accessions were collected from different ecological parts of Turkey which is located on the secondary genetic diversification center of this crop, and their characterization studies are near completion. Furthermore, evaluation studies of these materials have started. In the present study 67 melon accessions, sampled from this germplasm, were tested for resistance to zucchini yellow mosaic virus (ZYMV, Cucumber mosaic virus (CMV and watermelon mosaic virus (WMV. After resistance tests made by mechanical inoculation, four accessions (‘CU 100’, ‘CU 287’, ‘CU 305’ and ‘CU 328’ were found resistant to ZYMV and three accessions (‘CU 305’, ‘C 264’, and ‘C 276’ to WMV. No resistant genotype was found to CMV.
an evalution of some mechanical methods for shelling melon seeds ...
African Journals Online (AJOL)
Dr Obe
When the pressure was increased, more seeds were broken and there was a lot of heat generated between the drum and the belt due to friction. In general the results of the tests on the two devices indicate that the application of pressure coupled .... The static bending properties of melon seeds show that both the shells and.
Directory of Open Access Journals (Sweden)
Luiza Teixeira de Lima Brito
2000-04-01
Full Text Available Este estudo teve por objetivo avaliar o efeito de fontes de fósforo aplicadas via água de irrigação e, de modo convencional, na cultura do melão (Cucumis melo L., híbrido AF-682, em um Latossolo Vermelho-Amarelo. As fontes analisadas foram superfosfato simples, fosfato monoamônico (MAP e ácido fosfórico, aplicadas até 30 e 42 dias após o plantio. Todos os tratamentos receberam a mesma dosagem (120 kg ha-1 de P2O5, conforme recomendado pela análise do solo. O delineamento experimental foi de blocos casualizados, com quatro repetições. Constatou-se que as maiores produtividades de frutos comerciais foram obtidas com ácido fosfórico (32,20 e 28,90 t ha-1 aplicado via água de irrigação até 42 e 30 dias após a germinação, respectivamente, não diferindo das produtividades com o MAP aplicado via água de irrigação até 42 dias após a germinação (27,95 t ha-1 e pelo modo convencional (26,92 t ha-1. Verificou-se que as fontes de fósforo e os modos de aplicação não influenciaram no peso médio dos frutos (1,43 kg, sendo que 65% dos frutos obtidos se enquadraram nos tipos 8 a 10; entretanto, observou-se diferença significativa para o teor de sólidos solúveis totais (SST nos frutos, por ocasião da colheita, com o maior valor obtido com o ácido fosfórico (12,53º brix.This study was carried out with the objective of evaluating the effect of three phosphorus sources applied conventionally and through trickle irrigation on melon crop (Cucumis melo L., hybrid AF-682. The sources of phosphorus were simple superphosphate, monoammonium phosphate (MAP and phosphoric acid applied up to 30 and 42 days after germination through trickle irrigation and conventionally. The experiment was conducted in a completely randomized block design, with four replications. All the treatments had the same amount of phosphorus (120 kg ha-1 of P2O5 according to soil analysis. The highest commercial fruit yields were obtained with phosphoric acid
FUNCTIONAL MALE STERILITY AND ITS USE IN BREEDING OF VEGETABLE AND MELON CROPS
Directory of Open Access Journals (Sweden)
A. N. Bocharnikov
2014-01-01
Full Text Available The article describes the manifestation of functional male sterility and its importance in the breeding of melons. Utilization of functional male sterility allows solving the problem effective hybrid seed production.
May, Thomas W.; Brumbaugh, William G.
2007-01-01
This report presents the results of a study by the U.S. Geological Survey, done in cooperation with the U.S. Bureau of Reclamation, to determine mercury concentrations in selected sport fishes from Folsom and New Melones Reservoirs in California. Fillets were collected from each fish sample, and after homogenization and lyophilization of fish fillets, mercury concentrations were determined with a direct mercury analyzer utilizing the process of thermal combustion-gold amalgamation atomic absorption spectroscopy. Mercury concentrations in fish fillets from Folsom Reservoir ranged from 0.09 to 1.16 micrograms per gram wet weight, and from New Melones Reservoir ranged from 0.03 to 0.94 microgram per gram wet weight. Most of the fish fillets from Folsom Reservoir (87 percent) and 27 percent of the fillets from New Melones Reservoir exceeded the U.S. Environmental Protection Agency's fish consumption advisory of 0.30 microgram per gram wet weight.
Duyck, P F; Rousse, P; Ryckewaert, P; Fabre, F; Quilici, S
2004-06-01
The melon fly, Bactrocera cucurbitae (Coquillett) (Diptera: Tephritidae), is the most damaging pest of cucurbits in Reunion Island. The influence of adding borax and modifying pH on the effectiveness of different food attractants for both sexes of the melon fly is analyzed by a release-recapture method in field cages. Adding borax to protein hydrolysates Nulure and Buminal strongly reduced their attractiveness for B. cucurbitae. Acidification of 5% Buminal solution (from pH 6 to pH 3) doubled its attractiveness for melon fly. Conversely, Torula yeast at pH 10.5 was significantly more attractive than the standard Torula yeast at pH 9 (28% of captured flies compared with 17%). However, a further pH increase of the yeast solution does not improve its attractiveness. The results are discussed in relation to other studies on pH modification of various baits for Tephritidae.
Clinical evaluation of unadapted sheep submited to sudden intake of melon with high levels of sugar
Directory of Open Access Journals (Sweden)
Francisco Leonardo Costa Oliveira
2015-12-01
Full Text Available This study evaluated the clinical effects of two different amounts of melon, with a high sugar content, suddenly offered to unadapted sheep. Twelve rumem cannulated crossbred 8-months-old sheep , weighing 25 kg each, were used. These sheep had never been fed with food concentrated with sugar or fruits. The animals were kept in collective pens with a basal diet of roughage and then randomly divided into two equal groups. The sheep in the two groups received 25% and 75% of dry matter (DM of the diet the crushed melon, administered by the rumen cannula. Physical examination and measurement of rumen fluid pH was performed at the following times: 0, 3, 6, 12, 18 and 24 h. The animals of G25% did not present clinical signs despite subacute acidosis expected after administration of the melon. However, in the G75%, sheep developed clinical manifestation indicative of lactic acidosis with rumen fluid pH lower than 5.0 from T6h, but did not present with dehydration. In sheep from G75 %, tachycardia was observed at 3 h and continued until the end of the study; tachypnea was also observed at 3 h, which was caused by increased abdominal circumference. Based on the results obtained, the supplementation of high amounts of melon (75% DM in the diet is not recommended for sheep, although the use of 25% DM is safe. However, greater amounts of this fruit could be used in the diet of sheep with gradual adaptation to the substrate.
Differential Colonization Dynamics of Cucurbit Hosts by Erwinia tracheiphila.
Vrisman, Cláudio M; Deblais, Loïc; Rajashekara, Gireesh; Miller, Sally A
2016-07-01
Bacterial wilt is one of the most destructive diseases of cucurbits in the Midwestern and Northeastern United States. Although the disease has been studied since 1900, host colonization dynamics remain unclear. Cucumis- and Cucurbita-derived strains exhibit host preference for the cucurbit genus from which they were isolated. We constructed a bioluminescent strain of Erwinia tracheiphila (TedCu10-BL#9) and colonization of different cucurbit hosts was monitored. At the second-true-leaf stage, Cucumis melo plants were inoculated with TedCu10-BL#9 via wounded leaves, stems, and roots. Daily monitoring of colonization showed bioluminescent bacteria in the inoculated leaf and petiole beginning 1 day postinoculation (DPI). The bacteria spread to roots via the stem by 2 DPI, reached the plant extremities 4 DPI, and the plant wilted 6 DPI. However, Cucurbita plants inoculated with TedCu10-BL#9 did not wilt, even at 35 DPI. Bioluminescent bacteria were detected 6 DPI in the main stem of squash and pumpkin plants, which harbored approximately 10(4) and 10(1) CFU/g, respectively, of TedCu10-BL#9 without symptoms. Although significantly less systemic plant colonization was observed in nonpreferred host Cucurbita plants compared with preferred hosts, the mechanism of tolerance of Cucurbita plants to E. tracheiphila strains from Cucumis remains unknown.
Directory of Open Access Journals (Sweden)
José Gilson Lousada Regadas Filho
2010-06-01
Full Text Available It was aimed to estimate the intestinal digestibility (ID of rumen-undegradable protein (RUDP of several feeds by a three-steps procedure. The evaluated forages were algaroba (Prosopis juliflora, canafístula (Pithecellobium multiflorum, flor-de-seda (Calotropis procera, jitirana (Ipomea sp., juazeiro (Ziziphus joazeiro, mata-pasto (Senna obtusifolia, sabiá (Mimosa caesalpiniaefolia Benth, palma gigante (Opuntia ficus indica and xique-xique (Cereus gounellei, and the agroindustry byproducts were pineapple (Ananas comosus L., barbados cherry (Malpighia emarginata, cashew (Anacardium occidentale, coconut (Cocos nucifera L., melon (Cucumis melo, passion fruit (Passiflora eduli, grape (Vitis labrusca and anatto seeds (Bixa orellana L.. The feeds were incubated in rumen during 16 hours to determine the RUDP, and the residue was submitted to the digestion with pepsin solution during one hour, and pancreatic solution during 24 hours at 38ºC, those residues were analyzed for total nitrogen. The estimative of RUDP forage ranged from 13.37 to 83.6%, and the RUDP by-product ranged from 39.14 to 89.06%. The intestinal digestion of RUDP of the forages ranged from 26.09 to 80.68%, while for by-products varied from 22.26 to 76.82%. The sabiá was the forage that presented the highest intestinal digestibility and digestive rumen-undegradable protein (RUDPd, and the flor-de-seda, the lowest digestibility; while for by-products, melon and cashew presented, respectively, the highest values for DI and RUDP. The coconut presented the lowest values for ID and RUDPd. Although, some formulation systems of diets for ruminant consider that the RUDP present constant ID, the data obtained in this work suggest variation among the different feeds.A pesquisa objetivou estimar a digestibilidade intestinal (DI da proteína não-degradada no rúmen (PNDR de alimentos por intermédio da técnica de três estágios. As forragens avaliadas foram algaroba (Prosopis juliflora
javad baghani; A. Alizadeh; H. Ansari; M. Azizi
2016-01-01
Introduction: Production and growth of plants in many parts of the world due to degradation and water scarcity have been limited and particularly, in recent decades, agriculture is faced with stress. In the most parts of Iran, especially in the Khorasan Razavi province, drought is a fact and water is very important. Due to melon cultivation in this province, and the conditions of quality and quantity of water resources and water used to produce the melon product in this province, any researc...
The melon fly, Bactrocera cucurbitae (Coquillett), is a widespread, economically important tephritid fruit fly (Diptera: Tephritidae) species. Bactrocera cucurbitae infests fruits and vegetables of a number of different plant species, with many host plants in the plant family Cucurbitaceae, but with...
Directory of Open Access Journals (Sweden)
C. S. Ibeh
2017-06-01
Full Text Available A qualitative and comparative study was carried out on some locally sourced oils melon oil Africa elemi oil and Africa locust bean oil to evaluate suitability as substitute quenching media to mineral-based oil. The cooling ability of the oils was investigated using AISI 1034 medium carbon steel. The effect of heat transfer coefficient on quench severity mechanical properties of the quenched specimens were investigated in the course of the study. Results showed that the peak rate of heat extraction of melon oil Africa locust bean and Africa elemi oil were higher than that of mineral oil. Higher heat transfer coefficient of 1463 1023 Wm2k were obtained for melon oil and Africa locust bean Africa elemi and SAE 40 oil have heat transfer coefficient of 982 and 469 Wm2k respectively. The selected oils can be used as quenchants for medium carbon steel since the oils exhibits better cooling properties and mechanical properties than mineral-based oil.
Improving the quality of fresh-cut apples, pears, and melons using natural additives.
Alandes, L; Quiles, A; Pérez-Munuera, I; Hernando, I
2009-03-01
Improving the quality of different fresh-cut fruits by adding natural substances was studied. "Fuji" apples, "Flor de Invierno" pears, and "Piel de Sapo" melons were treated with calcium lactate, N-acetyl-L-cysteine, glutathione, and malic acid and stored for 4 wk at 4 degrees C. Instrumental texture (penetration), microstructure (light microscopy), acidity, soluble solids, color, pectinmethylesterase activity, and microflora were studied. The results showed that the combined treatment reinforced the cell walls strengthening the structure and texture of these fruits and maintained the L* and a* values throughout 4 wk of storage at 4 degrees C. The combination of additives provided low microbial counts in apples until the 4th week and in melons until the 2nd week. So, this combined treatment could be used to extend the shelf life of some fresh-cut fruits while preserving their quality.
Cucumis hystrix (2n = 2x = 24, genome HH) is a wild relative of cucumber (C. sativus L., 2n = 2x = 14) that possesses multiple disease resistances and has a great potential for cucumber improvement. Despite its importance, there is no genomic resource currently available for C. hystrix. To expedite ...
An Optimised Aqueous Extract of Phenolic Compounds from Bitter Melon with High Antioxidant Capacity
Directory of Open Access Journals (Sweden)
Sing Pei Tan
2014-12-01
Full Text Available Bitter melon (Momordica charantia L. is a tropical fruit claimed to have medicinal properties associated with its content of phenolic compounds (TPC. The aim of the study was to compare water with several organic solvents (acetone, butanol, methanol and 80% ethanol for its efficiency at extracting the TPC from freeze-dried bitter melon powder. The TPC of the extracts was measured using the Folin-Ciocalteu reagent and their antioxidant capacity (AC was evaluated using three assays. Before optimisation, the TPC and AC of the aqueous extract were 63% and 20% lower, respectively, than for the best organic solvent, 80% ethanol. However, after optimising for temperature (80 °C, time (5 min, water-to-powder ratio (40:1 mL/g, particle size (1 mm and the number of extractions of the same sample (1×, the TPC and the AC of the aqueous extract were equal or higher than for 80% ethanol. Furthermore, less solvent (40 mL water/g and less time (5 min were needed than was used for the 80% ethanol extract (100 mL/g for 1 h. Therefore, this study provides evidence to recommend the use of water as the solvent of choice for the extraction of the phenolic compounds and their associated antioxidant activities from bitter melon.
Marcas da violência e jogos do poder no romance urbano de Patrícia Melo
Directory of Open Access Journals (Sweden)
Cláudia Castanheira
2010-01-01
Full Text Available This work analyzes the romance O Matador (The Killer by Patrícia Melo. Its thematic universe and discursive strategies break not only with the prospects of the more contemporary feminist literary criticism, but also with the bourgeois ideological system, more broadly. The object is to highlight how the use of the male voice and masculine cultural experiences, taken to its ultimate consequences, may be converted into a subliminal criticism regarding the ways of how the discriminating speeches are built, through sexual, economic and social criteria in our society.
Requejo, María Isabel; Sánchez-Palomo, Eva; González, Miguel Angel; Castellanos, Maria Teresa; Villena, Raquel; Cartagena, Maria Carmen; Ribas, Francisco
2015-04-01
The interest in developing sustainable agriculture is becoming more important day by day. A large quantity of wastes from the wine and distillery industry are produced and constitute a serious problem not only environmental but also economic. The use of exhausted grape marc compost as organic amendment is a management option of the fertility of soils. On the other hand, consumers are increasingly concerned about the type, quality and origin of food production. Flavor and aroma are most often the true indicators of shelf-life from the consumer's point of view. The aim of this study was to relate the nutritional status of melon fertilized with exhausted grape marc compost with the sensory profile of fresh-cut fruits. A field experiment was established with three doses of compost (1, 2 and 3 kg per linear meter) and a control. Melons were harvested at maturity and the sensory evaluation was carried out by an expert panel of melon tasters to describe odour, flavour and texture. Nitrogen, phosphorus and potassium concentration was determined in the fruits to calculate nutrient absorption. Acknowledgements: This project has been supported by INIA-RTA2010-00110-C03-01
International Nuclear Information System (INIS)
Hamada, Ryoichi
1980-01-01
The distribution of released male adults of the melon fly, Dacus cucurbitae, was not the same in three directions from the release point. This bias seemed to depend on the habitat selection of melon flies because these was a linear relationship between the number of released flies caught and that of wild flies caught. The mean dispersal distance ranged from 50 m to 90 m and there were no remarkable differences in the values among groups which were allowed to disperse for different periods. Flies released at one point reached a stable distribution pattern in two or three days after their release. Another group of flies released at a different point, where the environment was less favourable to melon flies, showed a wider range of dispersal. It was concluded that in planning the arrangement of release points for the sterile male technique, a preliminary survey is needed to determine whether habitats favorable to the insect, that is, areas of high population density, exist continuously or not. A preliminary test to assess the influence of γ-irradiation on dispersal showed that the dosage of 10000 R reduced the dispersing ability of male adults of the melon fly. (author)
Sterilization of DACUS CUCUMIS FRENCH (DIPTERA:TEPHRITIDAE) by gamma radiation
International Nuclear Information System (INIS)
Hooper, G.H.S.
1975-01-01
The effect of gamma radiation administered to newly emerged adults of Dacus cucumis French on sterility and competitiveness was evaluated. A dose of 11 krad caused almost complete sterility in males while females given 6 krad were totally sterile, through infecundity. Sterilized males showed reduced competitiveness. In competitive mating tests a dose of 7 krad gave the lowest egg hatch and this hatch was significantly lower than that given by 9 and 11 krad. In a paired comparison mating test, 7 and 9 krad treated males mated significantly less frequently than untreated males, but the ability of 6 krad treated males was unimpared. (author)
THE USE OF GENETIC RESOURCES IN BREEDING OF VEGETABLE AND MELON CROPS
Directory of Open Access Journals (Sweden)
V. I. Burenin
2013-01-01
Full Text Available The analysis of the modern homeland assortment of vegetable crops is given. The donors of the most important traits and the accessions of vegetable and melon crops perspective for breeding from the VIR collection are shown. The short characteristic of the varieties is given.
Effect of irradiation on color of minimally processed melon and papaya
Energy Technology Data Exchange (ETDEWEB)
Fabbri, Adriana D.T.; Sagretti, Juliana M.A.; Hirashima, Fabiana K.; Rogovschi, Vladimir D.; Nunes, Thaise C.F.; Sabato, Susy F., E-mail: adriana.fabbri@yahoo.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Lab. de Irradiacao de Alimentos
2013-07-01
The access to nutritious food is an essential dimension of food meal. High potential for fresh-cut industry exists and ready-to-eat fruit market has grown rapidly in recent years due to the health benefits associated. Although there is many concerns to food safety other parameters like texture, taste, color and sensory acceptance are fundamental principles of acceptance to any food. Actually the use of instrumental measurements has proven to be a major predictor of sensory responses. According to many authors, the addition of different techniques should always be considered to provide additional information of the sensory aspects. Therefore the objective of this study was to evaluate the influence of irradiation on color of minimally processed melon and papaya. The fruits were purchased in a market of Sao Paulo, at the same point of ripeness and sent to the IPEN/CNEN-SP. The fruits were sanitized and manually cut into cubes of approximately 2 x 2 cm with the aid of stainless steel knives and packed in polyethylene bags. Melons and papaya were irradiated in a Multipurpose Gamma Source (IPEN - Sao Paulo - Brazil) and were divided in six groups for color analysis: Control; 0.5 kGy; 1.0 kGy, 1.5kGy, 2.0 kGy and 3.0kGy. After the treatment, the MP fruits were kept in a refrigerator at 4 deg C ± 1 deg C until the end of the analysis. The color of the samples was determined using a Minolta colorimeter CR-400 Chromameter. The parameters L{sup *}, a{sup *} and b{sup *} were evaluated. The results were statistically analyzed by analysis of variance One-Dimensional Analysis of Variance (One-Way-ANOVA) followed by Tukey test. All statistical analysis was performed using the program Graph Pad Prism 5 and adopting a significance level of 5 % (p<0.05), expressed as the mean results ± standard deviation. Samples of papaya and melons showed no statistical difference for the L{sup *} parameter of any dose despite the tendency to darkening observed for the group of 3.0 kGy. This
The structure of melon necrotic spot virus determined at 2.8 Å resolution
International Nuclear Information System (INIS)
Wada, Yasunobu; Tanaka, Hideaki; Yamashita, Eiki; Kubo, Chikako; Ichiki-Uehara, Tamaki; Nakazono-Nagaoka, Eiko; Omura, Toshihiro; Tsukihara, Tomitake
2007-01-01
The structure of melon necrotic spot virus is reported. The structure of melon necrotic spot virus (MNSV) was determined at 2.8 Å resolution. Although MNSV is classified into the genus Carmovirus of the family Tombusviridae, the three-dimensional structure of MNSV showed a higher degree of similarity to tomato bushy stunt virus (TBSV), which belongs to the genus Tombusvirus, than to carnation mottle virus (CMtV), turnip crinkle virus (TCV) or cowpea mottle virus (CPMtV) from the genus Carmovirus. Thus, the classification of the family Tombusviridae at the genus level conflicts with the patterns of similarity among coat-protein structures. MNSV is one of the viruses belonging to the genera Tombusvirus or Carmovirus that are naturally transmitted in the soil by zoospores of fungal vectors. The X-ray structure of MNSV provides us with a representative structure of viruses transmitted by fungi
Qin, Hua; Brookes, Philip C; Xu, Jianming
2014-01-01
A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%-42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G(-)) bacteria were significantly correlated with PCB degradation rates (R(2) = 0.719, p Cucurbita related soil microorganisms could play an important role in remediation of PCB contaminated soils. Copyright © 2013 Elsevier Ltd. All rights reserved.
Ilyas, Syafruddin; Hutahaean, Salomo; Nursal
2018-03-01
The discovery of male contraceptive drugs continues to be pursued, due to the few participation of men associated with the lack of contraceptive options for men. The combination of bitter melon seed methanol extract and DMPA are the options that currently apply to men. Therefore, the use of guinea pigs as experimental animals conducted research using experimental methods with complete randomized design (CRD). There are 4 control groups and 4 treatment groups. The first group, control group of dimethyl sulphoxide (DMSO) for 0 week (K0), The second one, bitter melon seed extract of 50 mg/100g Body Weight/day for 0 week (P0), the third one, control group of dimethyl sulfoxide (DMSO) for 4 weeks (K1), the fourth one, bitter melon seed extract of 50 mg/100g BW/day for 4 weeks + Depot medroxy Progesterone Acetate (P1), the fifth one, control group of dimethyl sulfoxide (DMSO) for 8 weeks (K2), the sixth one, bitter melon seed extract of 50 mg/100g BW/day for 8 weeks + DMPA (P2), the seventh one, control group of dimethyl sulfoxide (DMSO) for 12 weeks (K3), the eighth one, bitter melon seed extract of 50 mg/100g BW/day for 12 weeks + DMPA (P3). Methanol extract of bitter melon seed to decrease the quantity and quality of guinea pig spermatozoa decreased significantly, i.e. viability and normal morphology of spermatozoa (p<0.05).
Powdery mildew is a serious disease of cucurbit crops worldwide. In the fall of 2016, symptoms of powdery mildew were observed on 2-month old plants of Cucumis zambianus, Cucurbita digitata and Zehneria scabra in research plots in Charleston, SC. Incidence on 28 plants of C. zambianus was 64.3%. On ...
Economic analysis of irrigated melon cultivated in greenhouse with and without soil plastic mulching
Directory of Open Access Journals (Sweden)
Elvis M. de C. Lima
Full Text Available ABSTRACT The objective of this study was to analyze technically and economically the irrigated ‘Gália’ melon (Hybrid Nectar, cultivated in greenhouse with and without using plastic mulch covering on the soil. Simultaneously, two experiments were conducted using a completely randomized design (CRD, in which melon plants were submitted to five water availability levels, defined by 50, 75, 100, 125, and 150% of crop evapotranspiration, with four replicates. The difference between experiments were only about the soil covering with plastic mulch: with (CC or without (SC plastic mulch. The economically optimal irrigation depths were 208.83 and 186.88 mm, resulting in yields of 50.85 and 44.51 t ha-1 for the experiments with and without mulching, respectively. The results showing the economically optimal irrigation depths were very close to those that produced the highest yield.
Wear behavior of Al-7%Si-0.3%Mg/melon shell ash particulate composites.
Abdulwahab, M; Dodo, R M; Suleiman, I Y; Gebi, A I; Umar, I
2017-08-01
The present study examined wear characteristics of A356/melon shell ash particulate composites. Dry-sliding the stainless steel ball against specimen disc revealed the abrasive wear behavior of the composites under loads of 2 and 5N. The composite showed lower wear rate of 2.182 × 10 -4 mm 3 /Nm at 20 wt% reinforced material under load of 5N. Results showed that wear rate decreased significantly with increasing weight percentage of melon shell ash particles. Microstructural analyses of worn surfaces of the composites reveal evidence of plastic deformation of matrix phase. The wear resistance of A356 increased considerably with percentage reinforcement. In other words, the abrasive mass loss decreased with increasing percentage of reinforcement addition at the both applied loads. The control sample suffered a highest mass loss at 5 N applied load.
Use of Non-Normalized, Non-Amplified cDNA for 454-Based RNA Sequencing of Fleshy Melon Fruit
Directory of Open Access Journals (Sweden)
Vitaly Portnoy
2011-03-01
Full Text Available The melon ( L. fruit is an important crop and model system for the genomic study of both fleshy fruit development and the Cucurbitaceae family. To obtain an accurate representation of the melon fruit transcriptome based on expressed sequence tag (EST abundance in 454-pyrosequencing data, we prepared double-stranded complementary DNA (cDNA of melon without the usual amplification and normalization steps. A purification step was also included to eliminate small fragments. Complementary DNAs were obtained from 14 individual fruit libraries derived from two genotypes, separated into flesh and peel tissues, and sampled throughout fruit development. Pyrosequencing was performed using Genome Sequencer FLX (GS FLX technology, resulting in 1,215,359 reads, with mean length of >200 nucleotides. The global digital expression data was validated by comparative reverse transcription quantitative real-time polymerase chain reaction (RT-qPCR of 40 selected genes and expression patterns were similar for the two methods. The results indicate that high-quality, nonbiased cDNA for next-generation sequencing can be prepared from mature, fleshy fruit, which are notorious for difficulties in ribonucleic acid (RNA preparation.
El-Nahhal, Yasser; Hamdona, Nisreen
2015-01-01
This study investigated the phytotoxicity of herbicides applied singly or as mixtures to different crops under greenhouse conditions. Growth inhibition of the crops was taken as an indicator of phytotoxicity. Phytotoxicity of mixtures was estimated by calculating EC50 value in toxic units. EC50 (mg/kg soil) of Alachlor, Bromacil and/or Diuron were: 11.37, 4.77, 1.64, respectively, on melon; 0.11, 0.08, 0.24, respectively, on molokhia, and 3.91, 3.08, 1.83, respectively, on wheat. EC50 values of binary mixture tests of (Alachlor + Bromacil), (Alachlor + Diuron), and (Bromacil + Diuron) were 12.21, 5.84, 10.22 on melon, 0.982, 925.4, 38.1 on molokhia, and 0.673, 1.34, 0.644 on wheat. Tertiary mixture tests showed EC50 values (TU/kg soil) of (Alachlor + Bromacil + Diuron) was 633.9 on melon, 3.02 on molokhia and 32.174 on wheat. Diuron was more toxic than Alachlor and Bromacil to the tested crops based on individual tests. Molokhia was the most sensitive crop to herbicides. Binary mixtures showed a synergistic effect as compared to the tertiary mixtures.
Bernal-Vicente, Agustina; Pascual, José A; Tittarelli, Fabio; Hernández, José A; Diaz-Vivancos, Pedro
2015-08-30
Compost is emerging as an alternative plant growing medium in efforts to achieve more sustainable agriculture. The addition of specific microorganisms such as Trichoderma harzianum to plant growth substrates increases yields and reduces plant diseases, but the mechanisms of such biostimulants and the biocontrol effects are not yet fully understood. In this work we investigated how the addition of citrus and vineyard composts, either alone or in combination with T. harzianum T-78, affects the antioxidant defence system in melon plants under nursery conditions. Compost application and/or Trichoderma inoculation modulated the antioxidant defence system in melon plants. The combination of citrus compost and Trichoderma showed a biostimulant effect that correlated with an increase in ascorbate recycling enzymes (monodehydroascorbate reductase, dehydroascorbate reductase) and peroxidase. Moreover, the inoculation of both composts with Trichoderma increased the activity of antioxidant enzymes, especially those involved in ascorbate recycling. Based on the long-established relationship between ascorbic acid and plant defence responses as well as plant growth and development, it can be suggested that ascorbate recycling activities play a major role in the protection provided by Trichoderma and its biostimulant effect and that these outcomes are linked to increases in antioxidant enzymes. We can conclude that the combination of citrus compost and T. harzianum T-78 constitutes a viable, environmentally friendly strategy for improving melon plant production. © 2014 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Ngo, AT.
2016-01-01
Full Text Available Embedded in a package of climate change adaptation, researchers and farmers tested the melon hybrid variety, Kim Hoang Hau (KHH, for yield and disease resistance during the spring-summer season from March to June 2015 in Giao Thuy district, Nam Dinh province. The results were analysed and subsequently discussed with local farmers in focused groups. Analysis showed that the KHH was suitable to local soil conditions. The farmers preferred this new variety over the local melon, because not only did KHH give higher yield and pest resistance, it also showed less vulnerability to climatic stressors. Farmers decided to grow KHH based on the prevailing good market price at that time. However, farmers only shifted away from the old melon when they could anticipate the possibility of selling the new product. Those who did not continue with the KHH had difficulty in actively accessing the market for this new product. This study suggests that the market information does not solely drive the process of the adaptation itself, but it also provides relevant stimuli to farmers enabling them to successfully shift to new crop varieties. This study also implies that such process-based understanding is crucial in formulating strategies that increase the farmer's capacity to adapt to climate change.
Odor-Active Compounds in the Special Flavor Hops Huell Melon and Polaris.
Neiens, Silva D; Steinhaus, Martin
2018-02-14
The volatiles isolated from samples of the special flavor hop varieties, Huell Melon and Polaris, and from the aroma hop variety, Hallertau Tradition, by solvent extraction and solvent-assisted flavor evaporation (SAFE) were subjected to a comparative aroma extract dilution analysis (cAEDA), which resulted in 46 odor-active compounds in the flavor dilution (FD) factor range of 16 to 2048. On the basis of high FD factors, myrcene, (3R)-linalool, and 2- and 3-methylbutanoic acid were confirmed as important variety-independent hop odorants. (1R,4S)-Calamenene was identified for the first time as an odor-active compound in hops. Clear differences in the FD factors and their subsequent objectification by stable isotope dilution quantitation suggested that high concentrations of the esters ethyl 2-methylbutanoate, ethyl 2-methylpropanoate, and propyl 2-methylbutanoate cause the characteristic fruity, cantaloupe-like odor note in Huell Melon hops, whereas the fruity and minty odor notes in Polaris are associated with high amounts of 3-methylbutyl acetate and 1,8-cineole.
DEFF Research Database (Denmark)
Hald, Tine; Baggesen, Dorte Lau
and 2012. Risk factors for melon and watermelon contamination by Salmonella were considered in the context of the whole food chain, together with available estimates of Salmonella occurrence and mitigation options relating to prevention of contamination and the relevance of microbiological criteria......Melons and watermelons are ready-to-eat foods, with an internal pH of 5.1 to 6.7 and can be consumed whole, as fresh-cut products or as fresh juices. Epidemiological data from the EU identified one salmonellosis outbreak associated with consumption of both pre-cut and whole melon between 2007....... It was concluded that each farm environment represents a unique combination of risk factors that can influence occurrence and persistence of Salmonella in melon and watermelon production. Appropriate implementation of food safety management systems including Good Agricultural Practices (GAP), Good Hygiene...
Kappers, I.F.; Hoogerbrugge, H.; Bouwmeester, H.J.; Dicke, M.
2011-01-01
In response to herbivory by arthropods, plants emit herbivory-induced volatiles that attract carnivorous enemies of the inducing herbivores. Here, we compared the attractiveness of eight cucumber varieties (Cucumis sativus L.) to Phytoseiulus persimilis predatory mites after infestation of the
The wide phenotypic diversity, in melon fruits, is the result of consumer preferences combined with genotype fitness to the different agro-climatic zones. There is no sufficient information with respect to the extent of genetic divergence, population structure and linkage disequilibrium (LD) in mel...
Seeds of Momordica charantia (bitter melon) produce high levels of eleostearic acid, an unusual conjugated fatty acid with industrial value. Deep sequencing of non-normalized and normalized cDNAs from developing bitter melon seeds was conducted to uncover key genes required for biotechnological tran...
Ruangnam, Saowalak; Wanchana, Samart; Phoka, Nongnat; Saeansuk, Chatree; Mahatheeranont, Sugunya; de Hoop, Simon Jan; Toojinda, Theerayut; Vanavichit, Apichart; Arikit, Siwaret
2017-12-01
The gene conferring a "pandan-like" aroma of winter melon was identified. The sequence variation (804-bp deletion) found in the gene was used as the target for functional marker development. Winter melon (Benincasa hispida), a member of the Cucurbitaceae family, is a commonly consumed vegetable in Asian countries that is popular for its nutritional and medicinal value. A "pandan-like" aroma, which is economically important in crops including rice and soybean, is rarely found in most commercial varieties of winter melon, but is present in some landraces. This aroma is a value-added potential trait in breeding winter melon with a higher economic value. In this study, we confirmed that the aroma of winter melon is due to the potent volatile compound 2-acetyl-1-pyrroline (2AP) as previously identified in other plants. Based on an analysis of public transcriptome data, BhAMADH encoding an aminoaldehyde dehydrogenase (AMADH) was identified as a candidate gene conferring aroma of winter melon. A sequence comparison of BhAMADH between the aromatic and non-aromatic accessions revealed an 804-bp deletion encompassing exons 11-13 in the aromatic accession. The deletion caused several premature stop codons and could result in a truncated protein with a length of only 208 amino acids compared with 503 amino acids in the normal protein. A functional marker was successfully developed based on the 804-bp deletion and validated in 237 F 2 progenies. A perfect association of the marker genotypes and aroma phenotypes indicates that BhAMADH is the major gene conferring the aroma. The recently developed functional marker could be efficiently used in breeding programs for the aroma trait in winter melon.
Subhan, Nusrat; Rahman, Md Mahbubur; Jain, Preeti; Reza, Hasan Mahmud
2015-01-01
Diabetes, obesity, and metabolic syndrome are becoming epidemic both in developed and developing countries in recent years. Complementary and alternative medicines have been used since ancient era for the treatment of diabetes and cardiovascular diseases. Bitter melon is widely used as vegetables in daily food in Bangladesh and several other countries in Asia. The fruits extract of bitter melon showed strong antioxidant and hypoglycemic activities in experimental condition both in vivo and in vitro. Recent scientific evaluation of this plant extracts also showed potential therapeutic benefit in diabetes and obesity related metabolic dysfunction in experimental animals and clinical studies. These beneficial effects are mediated probably by inducing lipid and fat metabolizing gene expression and increasing the function of AMPK and PPARs, and so forth. This review will thus focus on the recent findings on beneficial effect of Momordica charantia extracts on metabolic syndrome and discuss its potential mechanism of actions. PMID:25650336
The melon fly, Bactrocera cucurbitae(Coquillett), is a widespread, economically important tephritid fruit fly (Diptera: Tephritidae) species. Bactrocera cucurbitae infests fruits and vegetables of a number of different plant species, with many host plants in the plant family Cucurbitaceae, but with ...
Brito de Figueirêdo, M.C.; Boer, de I.J.M.; Kroeze, C.; Silva Barros, da V.; Sousa, de J.A.; Souza de Aragão, F.A.; Sonsol Gondim, R.; Potting, J.
2014-01-01
Purpose This study quantifies freshwater consumption throughout the life cycle of Brazilian exported yellow melons and assesses the resulting impact on freshwater availability. Results are used to identify improvement options. Moreover, the study explores the further impact of variations in
International Nuclear Information System (INIS)
McCombs, S.D.; Lee, S.G.; Saul, S.H.
1993-01-01
The autosomal recessive bubble wing (bw) mutant was used to construct a translocation-based genetic sex sorting system in the melon fly, Bactrocera cucurbitae (Coquillett). The translocation stock has females with the bubble wing phenotype that are unable to fly, but the males are wild-type and fly normally. The bubble wing translocation strain has lower egg hatch, larval viability, and eclosion rates than the wild-type strain. Expression of the bubble wing trait is temperature-dependent, with high expression of the trait in 92% of adults at 23°C but in only 15% of adults at 28°C. This translocation-based sex sorting system is the only method available for automatic separation of male and female melon flies in sterile insect release programs
International Nuclear Information System (INIS)
Qin, Hua; Brookes, Philip C.; Xu, Jianming
2014-01-01
A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%–42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G − ) bacteria were significantly correlated with PCB degradation rates (R 2 = 0.719, p − bacteria were correlated with dissipation of the penta homologue group (R 2 = 0.590, p − bacteria contributed significantly to soil PCB dissipation. • Fungi have a great potential in the dissipation of high chlorinated biphenyls. -- Cucurbita associated fungi and G − bacteria have important influence on soil PCB dissipation rate and congener profile
Paudel, Sumit Kumar
Listeria and Salmonella related recalls and outbreaks are of major concern to the melon industry. Cinnamon oil has shown its usefulness in food treatment due to strong antifungal, antiviral, and antibacterial activities. However, its applications are limited due to poor solubility of cinnamon oil in water. Utilization of Cinnamon oil nanoemulsion may offer effective antimicrobial washing treatment to melon industry. The purpose of this study was to test the antimicrobial efficacy of cinnamon oil nanoemulsion on melons against major food borne pathogens such as Listeria monocytogenes and Salmonella enterica. Different formulations of cinnamon oil nanoemulsion were made by ultrasonication using Tween 80 as an emulsifier. Nanoemulsion exhibiting the smallest oil droplets was applied. Oil droplets were characterized for particle size by dynamic light scattering. Microbroth dilution assay was performed on three strains each of Listeria monocytogenes and Salmonella enterica to find out the antimicrobial efficacy of cinnamon oil nanoemulsion. Honeydew and cantaloupe were artificially inoculated with the strains mentioned above followed by treatment in nanoemulsion (control, 0.1%, 0.25%, and 0.5%) for one minute. Samples were dried and enumerated after one hour of treatment on selective media (PALCAM and XLD agar). The average diameter of nanoemulsion was 9.63+/-0.3nm. Minimum inhibitory concentration (MIC) of cinnamon oil nanoemulsion for both Listeria and Salmonella strains was 0.078% v/v and 0.039% v/v, respectively and the minimum bactericidal concentration was 0.078125% v/v for both. Compared to the water control, 0.5% nanoemulsion showed up to 7.7 and 5.5 log CFU/gm reductions in L. monocytogenes and S. enterica, respectively. The data suggests that cinnamon oil nanoemulsion can be used as an effective natural microbial control agent for melons. Keywords: Nanoemulsion, ultrasonication, antimicrobial.
Ma, Jun; Krynitsky, Alexander J; Grundel, Erich; Rader, Jeanne I
2012-01-01
Momordica charantia L. (Cucurbitaceae), commonly known as bitter melon, is widely cultivated in many tropical and subtropical areas of the world. It is a common food staple; its fruits, leaves, seeds, stems, and roots also have a long history of use in traditional medicine. In the United States, dietary supplements labeled as containing bitter melon can be purchased over-the-counter and from Internet suppliers. Currently, no quantitative analytical method is available for monitoring the content of cucurbitane-type triterpenes and triterpene glycosides, the major constituents of bitter melon, in such supplements. We investigated the use of HPLC-electrospray ionization (ESI)-MS/MS for the quantitative determination of such compounds in dietary supplements containing bitter melon. Values for each compound obtained from external calibration were compared with those obtained from the method of standard additions to address matrix effects associated with ESI. In addition, the cucurbitane-type triterpene and triterpene glycoside contents of two dietary supplements determined by the HPLC-ESI-MS/MS method with standard additions were compared with those measured by an HPLC method with evaporative light scattering detection, which was recently developed for quantification of such compounds in dried fruits of M. charantia. The contents of five cucurbitane-type triterpenes and triterpene glycosides in 10 dietary supplements were measured using the HPLC-ESI-MS/MS method with standard additions. The total contents of the five compounds ranged from 17 to 3464 microg/serving.
Engineering melon plants with improved fruit shelf life using the TILLING approach.
Directory of Open Access Journals (Sweden)
Fatima Dahmani-Mardas
2010-12-01
Full Text Available Fruit ripening and softening are key traits that have an effect on food supply, fruit nutritional value and consequently, human health. Since ethylene induces ripening of climacteric fruit, it is one of the main targets to control fruit over ripening that leads to fruit softening and deterioration. The characterization of the ethylene pathway in Arabidopsis and tomato identified key genes that control fruit ripening.To engineer melon fruit with improved shelf-life, we conducted a translational research experiment. We set up a TILLING platform in a monoecious and climacteric melon line, cloned genes that control ethylene production and screened for induced mutations that lead to fruits with enhanced shelf life. Two missense mutations, L124F and G194D, of the ethylene biosynthetic enzyme, ACC oxidase 1, were identified and the mutant plants were characterized with respect to fruit maturation. The L124F mutation is a conservative mutation occurring away from the enzyme active site and thus was predicted to not affect ethylene production and thus fruit ripening. In contrast, G194D modification occurs in a highly conserved amino acid position predicted, by crystallographic analysis, to affect the enzymatic activity. Phenotypic analysis of the G194D mutant fruit showed complete delayed ripening and yellowing with improved shelf life and, as predicted, the L124F mutation did not have an effect.We constructed a mutant collection of 4023 melon M2 families. Based on the TILLING of 11 genes, we calculated the overall mutation rate of one mutation every 573 kb and identified 8 alleles per tilled kilobase. We also identified a TILLING mutant with enhanced fruit shelf life. This work demonstrates the effectiveness of TILLING as a reverse genetics tool to improve crop species. As cucurbits are model species in different areas of plant biology, we anticipate that the developed tool will be widely exploited by the scientific community.
Cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch).
Nanasato, Yoshihiko; Tabei, Yutaka
2015-01-01
We established improved methods for Agrobacterium-mediated transformation of cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch). Vacuum infiltration of cotyledonary explants with Agrobacterium suspension enhanced the Agrobacterium infection efficiency in the proximal regions of explants. Wounding treatment was also essential for kabocha squash. Cocultivation on filter paper wicks suppressed necrosis of explants, keeping regeneration efficacy. Putative transgenic plants were screened by kanamycin resistance and green fluorescent protein (GFP) fluorescence. These putative transgenic plants grew normally and T1 seeds were obtained, and stable integration and transmission of the transgene in T1 generations were confirmed by Southern hybridization and PCR. The average transgenic efficiency for cucumber and kabocha squash was 11.9 ± 3.5 and 9.2 ± 2.9 %, respectively.
Melon oil methyl ester: an environmentally friendly fuel
Directory of Open Access Journals (Sweden)
S.K. Fasogbon
2015-06-01
Full Text Available Demand for energy is growing across the globe due to the direct relationship between the well-being and prosperity of people and energy usage. However, meeting this growing energy demand in a safe and environmentally friendly manner is a key challenge. To this end, methyl esters (biodiesels have been and are being widely investigated as alternatives to fossil fuels in compression ignition engines. In this study, melon (Colocynthis Citrullus Lanatus oil was used to synthesize biodiesel (methyl ester using the transesterification method in the presence of a sodium hydroxide promoter. The emissions profile of the biodiesel was investigated by setting up a single-cylinder four-stroke air-cooled CI engine connected to a TD115-hydraulic dynamometer and an Eclipse Flue Gas Analyzer (FGA with model number EGA4 flue gas analyzer. The engine was run at engine speeds of 675, 1200 and 1900rpm for biodiesel/diesel blends at 21°C on a volume basis of 0/100(B0, 10/90(B10, 20/80(B20, 30/70(B30, 40/60(B40 and 50/50(B50. The test showed a downward trend in the emissions profile of the biodiesel, with remarkable reductions of about 55% in the dangerous-carbon monoxide exhaust gas pollutant and 33.3% in the unfriendly SOX from 100% diesel to B30-biodiesel concentration. Increasing the speed from 675 to 1200 and then to 1900 rpm also afforded further reductions in CO and SOX exhaust emissions. NOX however increased marginally by 2.1% from the same 100% diesel to the B30-biodiesel composition. Based on the remarkable reduction in CO and SOX and the marginal increase in NOX as the concentration of the biodiesel increased in the blends, the study concludes that melon oil methyl ester is an environmentally friendly fuel.
Beit Alpha cucumber (Cucumis sativus L.) is a Mediterranean fresh-market type with a relatively narrow genetic base. To broaden its base for plant improvement, 42 diverse accessions were compared employing a previously defined standard marker array to choose wide-based parental lines for use in bac...
Directory of Open Access Journals (Sweden)
Mariangela Diacono
2018-05-01
Full Text Available In organic horticultural systems, cover crops could provide several ecological services, therefore, they can be defined agroecological service crops (ASCs. The objective of this two-year research was to study the suitability on melon production of different ASC termination strategies, in combination with organic fertilisers application. In a split-block design, the main-plot was the ASC management, comparing: i green manure, in which the vetch was chopped and plowed into the soil; and ii roller-crimper (RC, in which the vetch was flattened by a roller-crimper; with iii fallow control, without vetch. The subplot consisted of offfarm organic inputs: i commercial humified fertiliser; ii anaerobic digestate fertiliser; iii composted municipal solid wastes; which were compared to iv unfertilised control (N0. At vetch termination, above soil biomass and nitrogen (N content were determined. At harvesting, crop yield performance and quality, N status and N efficiency were investigated. Also, main soil characteristics were assessed at the end of the trial. Among the ASC managements, the slightly reduced yield in the RC plots particularly in combination with N0 might have been the result of less N supplied by the vetch during the melon cycle. Anyway, no negative effects were observed for yield quality. The use of the RC showed a great potential in enhancing soil fertility. Our study suggests the suitability in organic farming of properly matching management of ASC and fertilisation strategies on melon crop.
Rainbow tensor model with enhanced symmetry and extreme melonic dominance
Directory of Open Access Journals (Sweden)
H. Itoyama
2017-08-01
Full Text Available We introduce and briefly analyze the rainbow tensor model where all planar diagrams are melonic. This leads to considerable simplification of the large N limit as compared to that of the matrix model: in particular, what are dressed in this limit are propagators only, which leads to an oversimplified closed set of Schwinger–Dyson equations for multi-point correlators. We briefly touch upon the Ward identities, the substitute of the spectral curve and the AMM/EO topological recursion and their possible connections to Connes–Kreimer theory and forest formulas.
Rainbow tensor model with enhanced symmetry and extreme melonic dominance
Itoyama, H.; Mironov, A.; Morozov, A.
2017-08-01
We introduce and briefly analyze the rainbow tensor model where all planar diagrams are melonic. This leads to considerable simplification of the large N limit as compared to that of the matrix model: in particular, what are dressed in this limit are propagators only, which leads to an oversimplified closed set of Schwinger-Dyson equations for multi-point correlators. We briefly touch upon the Ward identities, the substitute of the spectral curve and the AMM/EO topological recursion and their possible connections to Connes-Kreimer theory and forest formulas.
Yung, Mingo M H; Ross, Fiona A; Hardie, D Grahame; Leung, Thomas H Y; Zhan, Jinbiao; Ngan, Hextan Y S; Chan, David W
2016-09-01
Objective Acquired chemoresistance is a major obstacle in the clinical management of ovarian cancer. Therefore, searching for alternative therapeutic modalities is urgently needed. Bitter melon (Momordica charantia) is a traditional dietary fruit, but its extract also shows potential medicinal values in human diabetes and cancers. Here, we sought to investigate the extract of bitter melon (BME) in antitumorigenic and cisplatin-induced cytotoxicity in ovarian cancer cells. Three varieties of bitter melon were used to prepare the BME. Ovarian cancer cell lines, human immortalized epithelial ovarian cells (HOSEs), and nude mice were used to evaluate the cell cytotoxicity, cisplatin resistance, and tumor inhibitory effect of BME. The molecular mechanism of BME was examined by Western blotting. Cotreatment with BME and cisplatin markedly attenuated tumor growth in vitro and in vivo in a mouse xenograft model, whereas there was no observable toxicity in HOSEs or in nude mice in vivo Interestingly, the antitumorigenic effects of BME varied with different varieties of bitter melon, suggesting that the amount of antitumorigenic substances may vary. Studies of the molecular mechanism demonstrated that BME activates AMP-activated protein kinase (AMPK) in an AMP-independent but CaMKK (Ca(2+)/calmodulin-dependent protein kinase)-dependent manner, exerting anticancer effects through activation of AMPK and suppression of the mTOR/p70S6K and/or the AKT/ERK/FOXM1 (Forkhead Box M1) signaling cascade. BME functions as a natural AMPK activator in the inhibition of ovarian cancer cell growth and might be useful as a supplement to improve the efficacy of cisplatin-based chemotherapy in ovarian cancer. © The Author(s) 2015.
Expression analysis of fusarium wilt resistance gene in melon by real-time quantitative pcr
International Nuclear Information System (INIS)
Wang, X.; Xu, B.; Zhao, L.; Gao, P.; Luan, F.
2014-01-01
Melon Actin gene was used as a reference gene, to explore the gene expression profiles of the Fom-2 gene in roots, stems, and leaves of melon MR-1 under induction by Fusarium oxysporum f. sp. melonis. Monitoring using real-time quantitative PCR showed similar accumulation patterns of Fom-2 in roots, stems, and leaves over the observation period of 1 to 11 days; the expression level in stems was the highest. The expression of the Fom-2 gene was strengthened by the prolongation of induction time. In stems, the expression of Fom-2 was 5.737 times higher than in the control at three days; in roots, expression of Fom-2 was 5.617 times higher than in the control at five days. Similarly, the expression of Fom-2 in leaves obviously increased. It was 4.441 times higher than in the control at 5 days. The expression of Fom-2 was non-tissue specific, up-regulated under induction by Fusarium, and related to early resistance to Fusarium wilt. (author)
International Nuclear Information System (INIS)
Roksana Huque and Sharmina Ahmed
2006-01-01
Application of gamma radiation as a physical method of disinfestations against melon flies was recognized as a potential quarantine treatment. At 50 Gy, oocytes showed degeneration one day after treatment whereas seven-day-old oocytes did not differ greatly in appearance from control groups. Abnormal enlargement of trophocyte cells and vacuolization of oocytes occurred predominantly following the treatment with 100 and 150 Gy. One day after treatment with 150 Gy trophocytes underwent hypertrophy and hyperplasia. Irradiation at 100 and 150 Gy reduced the fertility to almost zero percent in the female melon flies.(authors)
Butler, Lynsey R.; Edwards, Michael R.; Farmer, Russell; Greenly, Kathryn J.; Hensler, Sherri; Jenkins, Scott E.; Joyce, J. Michael; Mann, Jason A.; Prentice, Boone M.; Puckette, Andrew E.; Shuford, Christopher M.; Porter, Sarah E. G.; Rhoten, Melissa C.
2009-01-01
An interdisciplinary, semester-long project is presented in which students grow Cucumis sativus (cucumber) plants from seeds and study the ability of the plants to remediate a heavy metal from contaminated soil or water or both. Phytoremediation strategies for environmental cleanup are presented as possible alternatives to chemical based clean-up…
Stabilisation of Clay Soil with Lime and Melon Husk Ash for use in Farm Structures
Directory of Open Access Journals (Sweden)
I. S. Mohammed
2014-08-01
Full Text Available The rising cost of traditional stabilising agents and the need for economical utilisation of industrial and agricultural waste for beneficial engineering purposes has encouraged an investigation into the stabilization of clay soil with lime and melon husk ash. The chemical composition of the melon husk ash that was used in stabilising clay soil was determined. The clay soil was divided into two parts, one part was used to determine the index properties while the other part was treated at British Standard Light (BSL compaction energy with 0 %, 2 %, 4 %, 6 % and 8 % melon husk ash by dry weight of the soil and each was admixed with 2 %, 4 %, 6 % and 8 % lime. The stabilised clay soil was cured for 7, 14 and 28 days before the unconfined compressive strength were determined while the coefficients of permeability of the stabilised clay soil were also determined at 28 days of curing. The data obtained from the experiment was subjected to analysis of variance to examine the significance at 5% level. Results showed that the natural clay soil belong to A-7-6 or CH (clay of high plasticity in the American Association of State Highway Transportation Official (AASHTO and Unified Soil Classification System (1986. The chemical composition of the ash had aluminum oxide, iron oxide and silicon dioxide values of 18.5%, 2.82% and 51.24% respectively. The unconfined compressive strength and coefficient of permeability of the natural clay soil was determined to be 285 kN/m2 and 1.45 x 10-5 cm/s, respectively. Increase in melon husk ash and lime percent increases the unconfined compressive strength (UCS of the stabilised clay soil significantly (p < 0.05 and decrease the coefficient of permeability when compared with the natural clay soil. The peak values of unconfined compressive strength for 7, 14 and 28 days of curing are 1200 kN/m2, 1598 kN/m2 and 1695 kN/m2 respectively at 6% MHA and 8% lime content while the lowest value for coefficient of permeability was 0
Effect of irradiation on color of minimally processed melon and papaya
International Nuclear Information System (INIS)
Fabbri, Adriana D.T.; Sagretti, Juliana M.A.; Hirashima, Fabiana K.; Rogovschi, Vladimir D.; Nunes, Thaise C.F.; Sabato, Susy F.
2013-01-01
The access to nutritious food is an essential dimension of food meal. High potential for fresh-cut industry exists and ready-to-eat fruit market has grown rapidly in recent years due to the health benefits associated. Although there is many concerns to food safety other parameters like texture, taste, color and sensory acceptance are fundamental principles of acceptance to any food. Actually the use of instrumental measurements has proven to be a major predictor of sensory responses. According to many authors, the addition of different techniques should always be considered to provide additional information of the sensory aspects. Therefore the objective of this study was to evaluate the influence of irradiation on color of minimally processed melon and papaya. The fruits were purchased in a market of Sao Paulo, at the same point of ripeness and sent to the IPEN/CNEN-SP. The fruits were sanitized and manually cut into cubes of approximately 2 x 2 cm with the aid of stainless steel knives and packed in polyethylene bags. Melons and papaya were irradiated in a Multipurpose Gamma Source (IPEN - Sao Paulo - Brazil) and were divided in six groups for color analysis: Control; 0.5 kGy; 1.0 kGy, 1.5kGy, 2.0 kGy and 3.0kGy. After the treatment, the MP fruits were kept in a refrigerator at 4 deg C ± 1 deg C until the end of the analysis. The color of the samples was determined using a Minolta colorimeter CR-400 Chromameter. The parameters L * , a * and b * were evaluated. The results were statistically analyzed by analysis of variance One-Dimensional Analysis of Variance (One-Way-ANOVA) followed by Tukey test. All statistical analysis was performed using the program Graph Pad Prism 5 and adopting a significance level of 5 % (p * parameter of any dose despite the tendency to darkening observed for the group of 3.0 kGy. This fact also occurred for the chromatographic coordinates a * and b * which remained in the same tonality for all treatments (p<0.05). Current results
International Nuclear Information System (INIS)
Kajiwara, Natsuko; Kamikawa, Satoko; Amano, Masao; Hayano, Azusa; Yamada, Tadasu K.; Miyazaki, Nobuyuki; Tanabe, Shinsuke
2008-01-01
Polybrominated diphenyl ethers (PBDEs) and organochlorine compounds (OCs) were determined in the blubber of 55 melon-headed whales (Peponocephala electra) mass stranded along the Japanese coasts since 1982. DDTs and PCBs were predominant in all the specimens investigated. In whales that died during the latest event in 2006, concentrations of PBDEs (190-510 ng/g lipid wt) were approximately two orders of magnitude lower than DDTs and PCBs, but comparable with HCHs and HCB. Maternal transfer of PBDEs to offspring through the whole reproductive process was estimated to be 85% of the mother's body burden, while that occurring during gestation was much lower (2.6-3.5%). Concentrations of PCBs, DDTs, and HCB were lower in melon-headed whales stranded after the year 2000 than those stranded in 1982, whereas PBDE and CHL levels showed a temporal increase during the past 20 years, suggesting that the peak of their usage and contamination occurred after the year 1982. - PBDE levels in melon-headed whales increased during the past two decades
Energy Technology Data Exchange (ETDEWEB)
Kajiwara, Natsuko; Kamikawa, Satoko [Center for Marine Environmental Studies (CMES), Ehime University, 2-5 Bunkyo-cho, Matsuyama 790-8577 (Japan); Amano, Masao [Department of Animal Sciences, Teikyo University of Science and Technology, 2525 Yatsusawa, Uenohara, Yamanashi 409-0193 (Japan); Hayano, Azusa [Graduate School of Science, Kyoto University, Sakyo, Kyoto 606-8502 (Japan); Yamada, Tadasu K. [National Museum of Nature and Science, 3-23-1 Hyakunin-cho, Shinjuku-ku, Tokyo 169-0073 (Japan); Miyazaki, Nobuyuki [Center for International Cooperation, Ocean Research Institute, University of Tokyo, Minamidai 1-15-1, Nakano-ku, Tokyo 164-8639 (Japan); Tanabe, Shinsuke [Center for Marine Environmental Studies (CMES), Ehime University, 2-5 Bunkyo-cho, Matsuyama 790-8577 (Japan)], E-mail: shinsuke@agr.ehime-u.ac.jp
2008-11-15
Polybrominated diphenyl ethers (PBDEs) and organochlorine compounds (OCs) were determined in the blubber of 55 melon-headed whales (Peponocephala electra) mass stranded along the Japanese coasts since 1982. DDTs and PCBs were predominant in all the specimens investigated. In whales that died during the latest event in 2006, concentrations of PBDEs (190-510 ng/g lipid wt) were approximately two orders of magnitude lower than DDTs and PCBs, but comparable with HCHs and HCB. Maternal transfer of PBDEs to offspring through the whole reproductive process was estimated to be 85% of the mother's body burden, while that occurring during gestation was much lower (2.6-3.5%). Concentrations of PCBs, DDTs, and HCB were lower in melon-headed whales stranded after the year 2000 than those stranded in 1982, whereas PBDE and CHL levels showed a temporal increase during the past 20 years, suggesting that the peak of their usage and contamination occurred after the year 1982. - PBDE levels in melon-headed whales increased during the past two decades.
Shofian, Norshahida Mohamad; Hamid, Azizah Abdul; Osman, Azizah; Saari, Nazamid; Anwar, Farooq; Dek, Mohd Sabri Pak; Hairuddin, Muhammad Redzuan
2011-01-01
The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L.), mango (Mangifera indica L.), papaya (Carica papaya L.), muskmelon (Cucumis melo L.), and watermelon Citruluss lanatus (Thunb.) were investigated. Significant (p dried fruit samples, except muskmelon. There was no significant (p > 0.05) change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested.
Directory of Open Access Journals (Sweden)
Guylaine Miotello
2017-10-01
Full Text Available Frankia coriariae BMG5.1 cells were incubated with root exudates derived from compatible (Coriaria myrtifolia, incompatible (Alnus glutinosa and non-actinorhizal (Cucumis melo host plants. Bacteria cells and their exoproteomes were analyzed by high-throughput proteomics using a Q-Exactive HF high resolution tandem mass spectrometer incorporating an ultra-high-field orbitrap analyzer. MS/MS spectra were assigned with two protein sequence databases derived from the closely-related genomes from strains BMG5.1 andDg1, the Frankia symbiont of Datisca glomerata. The tandem mass spectrometry data accompanying the manuscript describing the database searches and comparative analysis (Ktari et al., 2017, doi.org/10.3389/fmicb.2017.00720 [1] have been deposited to the ProteomeXchange with identifiers PXD005979 (whole cell proteomes and PXD005980 (exoproteome data.
Haegi, Anita; Catalano, Valentina; Luongo, Laura; Vitale, Salvatore; Scotton, Michele; Ficcadenti, Nadia; Belisario, Alessandra
2013-08-01
A reliable and species-specific real-time quantitative polymerase chain reaction (qPCR) assay was developed for detection of the complex soilborne anamorphic fungus Fusarium oxysporum. The new primer pair, designed on the translation elongation factor 1-α gene with an amplicon of 142 bp, was highly specific to F. oxysporum without cross reactions with other Fusarium spp. The protocol was applied to grafted melon plants for the detection and quantification of F. oxysporum f. sp. melonis, a devastating pathogen of this cucurbit. Grafting technologies are widely used in melon to confer resistance against new virulent races of F. oxysporum f. sp. melonis, while maintaining the properties of valuable commercial varieties. However, the effects on the vascular pathogen colonization have not been fully investigated. Analyses were performed on 'Charentais-T' (susceptible) and 'Nad-1' (resistant) melon cultivars, both used either as rootstock and scion, and inoculated with F. oxysporum f. sp. melonis race 1 and race 1,2. Pathogen development was compared using qPCR and isolations from stem tissues. Early asymptomatic melon infections were detected with a quantification limit of 1 pg of fungal DNA. The qPCR protocol clearly showed that fungal development was highly affected by host-pathogen interaction (compatible or incompatible) and time (days postinoculation). The principal significant effect (P ≤ 0.01) on fungal development was due to the melon genotype used as rootstock, and this effect had a significant interaction with time and F. oxysporum f. sp. melonis race. In particular, the amount of race 1,2 DNA was significantly higher compared with that estimated for race 1 in the incompatible interaction at 18 days postinoculation. The two fungal races were always present in both the rootstock and scion of grafted plants in either the compatible or incompatible interaction.
International Nuclear Information System (INIS)
Yarsi, G.; Sivaci, A.; Dasgan, H.Y.; Altuntas, O.
2017-01-01
Salinity is known as the most important abiotic stress that decreases crop production and plant growth, and changes the anatomy and morphology of plants. In this study, the growth rate of grafted and ungrafted melon plants were studied under salinity stress. Maximus F1, Shintoza F-90 F1 and Nun 9075 F1 (Cucurbita maxima x Cucurbita moschata) were used as a rootstock and Galia C8 melon cultivar was used as a scion. In this study, the stomata size and chlorophyll and carotenoid contents were investigated. According to the results, chlorophyll and carotenoid contents and stomata length and width of upper and lower surface of leaf were generally reduced under salinity stress. (author)
Minimally processed fresh-cut fruits have a limited shelf-life because of deterioration caused by spoilage microflora and changes in physiological processes. Whole melons were inoculated with 7 log CFU/ml of each bacterium (Salmonella, Escherichia coli O157:H7 and Listeria monocytogenes) and then t...
O Sol Laranja e Negro de João Cabral de Melo Neto
Directory of Open Access Journals (Sweden)
Luciana Tiscoski
2011-12-01
Full Text Available O poeta pernambucano João Cabral de Melo Neto publica Sevilha andando em 1990, já aposentado da carreira diplomática que lhe possibilitou o contato com a cidade e o povo sevilhano, desde 1956, quando trabalha em pesquisas históricas no Arquivo das Índias de Sevilha. Após ter morado em cidades como Londres, Marselha e Barcelona, é transferido para a andaluza Cadiz, e novamente reside em Sevilha em 1962. Tendo ainda passado no decorrer de sua carreira diplomática por Berna, Senegal e Honduras, é a Andaluzia que se estabelece como lugar da linguagem poética e concreta, eleita Sevilha a cidade onde os elementos de sua poesia se realizam em lâmina, pedra, o sol laranja e negro, a mulher que anda. Sevilha andando e Andando Sevilha finalizam sua produção poética e reproduzem em serena e bruta semelhança o homem da terra que lhe remete ao sertanejo, a Pernambuco, a Recife.
CROSS-TOLERANCE MECHANISM INDUCTION IN MELON SEEDS BY PRIMING PRIOR DRYING
Directory of Open Access Journals (Sweden)
Jean Marcel Sousa Lira
2015-04-01
Full Text Available The loss of benefits after re-drying is one of the drawbacks of the seed priming technique. Different types of stresses have been used before re-drying to preserve the priming benefits. This process may be seen as promoting cross tolerance to increase the defense mechanisms that prevent loss of viability in seeds primed after drying. We tested the effect of some stresses to induce cross-tolerance and different drying conditions with the aim of maintaining priming benefits in melon seeds. The seeds were primed in an aerated KNO3 solution (0.35M, -1.7MPa, 25 °C, in the dark for six days. The primed seeds were then submitted to slow drying, fast drying, cold shock + slow drying, cold shock + fast drying, heat shock + slow drying, heat shock + fast drying, PEG + slow drying, PEG + fast drying, ABA + slow drying, ABA + fast drying and no drying (planted directly after priming. We evaluated antioxidant enzyme activities (SOD, CAT and APX, germinability, mean time of germination (MTG and mean rate of germination (MRG. A completely randomized design was used with three repetitions of 50 seeds in each treatment. Data were analyzed by ANOVA and means were compared by the Scott-Knott test (p ≤ 0.05. ABA increased SOD activity after drying and CAT activity was reduced by priming. APX activity was not observed. The stress submission prior to re-drying improved the MRG and reduced MTG. Therefore, the induction of the cross-tolerance mechanism could be effective to maintain priming benefits in melon seeds.
The utilization of alkali-treated melon husk by broilers.
Abiola, S S; Amalime, A C; Akadiri, K C
2002-09-01
The effects of alkali treatment on chemical constituents of melon husk (MH) and performance characteristics of broilers fed alkali-treated MH (ATMH) diets were investigated. The chemical analysis showed that alkali treatment increased the ash content of MH (from 15.70% to 16.86%) and reduced the crude fibre content (from 29.00% to 14.00%). Result of feed intake was superior on 30% alkali diet with a value of 100.14 g/bird/day. Body weight gain decreased with increase in the level of ATMH in the diet. Highest dressing percentage of 66.33% and best meat/bone ratio of 2.57 were obtained on 10% and 20% alkali diets, respectively. Dietary treatments had significant effect (P poultry carcases and chicken meat with favourable shelf life.
The Diet Composition of Beaked Whales and Melon-Headed Whales from the North Pacific
2015-09-30
description and comparison of diet composition as well as provide insight into the foraging behavior and ecology of these whales in the North...activities. Assessing diet for many species of cetaceans is difficult, given that most foraging occurs far below the surface and that stomach...furthering our understanding of the foraging behavior of this species. Such an examination of food habits from Hawaiian melon-headed whales would be
Cucurbit yellow stunting disorder virus (CYSDV), emerged in the Southwest USA in 2006, where it is transmitted by the MEAM1 cryptic species of Bemisia tabaci. The virus results in late-season infection of spring melon crops with limited economic impact; however, all summer and fall cucurbits become ...
Directory of Open Access Journals (Sweden)
Ângelo Shigueyuki Morita
2005-06-01
Full Text Available Este trabalho foi conduzido no laboratório de Tecnologia de Alimentos da Escola Superior de Agricultura de Mossoró (ESAM. Avaliou-se a possibilidade de processar o melão como fruta cristalizada. Foram testadas as variedades Gália, Pele de Sapo e Orange Fresh, utilizando-se o processo lento de açucaramento, retirando-se as polpas em formas de bolas e colocando-as sucessivamente em soluções de sacarose a 20, 30, 40, 50, 60 e 70º Brix até abrir a fervura, mantendo-se a polpa em repouso por 24 horas a cada solução de sacarose. Em seguida, os frutos foram colocados em uma estufa a 50ºC durante 6 horas, atingindo-se assim, a umidade final entre 26,16 a 27,53%. Foram determinados teor de umidade, pH, sólidos solúveis totais, e os produtos submetidos a uma análise sensorial. Constatou-se que a cristalização em melão foi tecnicamente viável, que a variedade Pele de Sapo foi a melhor aceita, e que não houve mudança na coloração da polpa das variedades.The experiment was carried out in the Food Technology Laboratory of the Escola Superior de Agricultura de Mossoró (ESAM, Mossoró-RN, Brazil to evaluate the possibility of processing the melon pulp as a crystallized fruit by using the us following melon varieties: Gália, Pele de Sapo, and Orange Flesh, utilizing the slow sugary process. The pulps were withdrawn in little ball form and put successively into sucrose solutions at 20, 30, 40, 50, 60 and 70°Brix, until boiling, keeping them in inactivity for 24 hours in each solution. After that, the fruits were placed in a stove at 50°C during 6 hours, reaching final humidity between 26.16 and 27.53%. Evaluations for humidity content, pH and total soluble solids were made. In addition a sensorial analysis was made. It was observed that the melon crystallization was technically feasible. Pele de Sapo melon was the best in comparison to the other types. Changing in the melon pulp colouring was not observed.
Directory of Open Access Journals (Sweden)
Salvatore Siciliano
2015-12-01
Full Text Available Abstract Melon-headed whale (Peponocephala electra and Pygmy killer whale (Feresa attenuata are very poorly known species and are often confused with each other. We examined in detail Figure 3 in MARIGO and GIFFONI (2010 who reported that two melon-headed whales were taken in a surface driftnet about 90 nm off Santos, Brazil. We concluded they were in fact pygmy killer whales and explain our reasoning. To aid in future identifications, we illustrate and describe some of the main differences between these two species of small cetaceans. The incident reported by MARIGO and GIFFONI (2010 might represent the 'tip of the iceberg' regarding the incidental catches of cetaceans by pelagic drift nets off Brazil. Offshore driftnetting operating along the south-southeastern coast of Brazil may threaten pygmy killer whales.
International Nuclear Information System (INIS)
Ashraf, M.; Keiser, I.; Harris, E.J.
1976-01-01
Male melon flies, Dacus cucurbitae Coquillett, treated with a single dose of the chemosterilant tepa (tris(l-aziridinyl) phosphine oxide), or with gamma irradiation, either single or fractionated doses, did not differ significantly in sexual competitiveness as determined by percentage hatch of eggs. Mating competitiveness of males treated by either method ranged from 53 to 66 percent of that of untreated males. In another study, melon flies (males and females) sterilized with 0.0125 percent tepa, the threshold dose for both sexes, completely suppressed a population when the ratio was 16:16:1:1 (sterile males-sterile females-untreated males-untreated females) as determined by no egg hatch
Consumers are eating more fresh vegetable and fruit due to nutritional and health-related benefits. Whole melons (cantaloupes, honeydew and watermelons) are of particular interest because of their nutrient contents. However, they are frequently contaminated with foodborne pathogens. Conditions neces...
Directory of Open Access Journals (Sweden)
Anaí Peter Batista
2013-05-01
Full Text Available O objetivo desta revisão é apresentar alguns métodos de conservação que podem ser utilizados para prolongar a vida útil do melão minimamente processado. Dentre os métodos, serão abordados revestimento comestível, irradiação, antimicrobianos naturais, antioxidantes, agentes de firmeza, atmosfera modificada, branqueamento, luz ultravioleta e alta pressão. Dependendo do método pode haver redução das alterações associadas ao processo mínimo do melão, como a perda de água, alteração da cor e firmeza, alteração do metabolismo e crescimento de micro-organismos, sendo o resultado muitas vezes dependente da cultivar do melão utilizado.The objective of this review is to present some conservation methods that can be used to prolong the life of fresh-cut melon. Among the methods, edible coating, irradiation, natural antimicrobials, antioxidants, firmness agent, modified atmosphere, whitening, ultraviolet light and high pressure will be discussed. Depending on the method, the changes associated to minimum process of melon, such as water loss, change in color and firmness, change in the metabolism and growth of micro-organisms can be reduced and the result is often dependent on the melon cultivar used.
Directory of Open Access Journals (Sweden)
Luigi Lucini
2018-04-01
Full Text Available Plant biostimulants are receiving great interest for boosting root growth during the first phenological stages of vegetable crops. The present study aimed at elucidating the morphological, physiological, and metabolomic changes occurring in greenhouse melon treated with the biopolymer-based biostimulant Quik-link, containing lateral root promoting peptides, and lignosulphonates. The vegetal-based biopolymer was applied at five rates (0, 0.06, 0.12, 0.24, or 0.48 mL plant-1 as substrate drench. The application of biopolymer-based biostimulant at 0.12 and 0.24 mL plant-1 enhanced dry weight of melon leaves and total biomass by 30.5 and 27.7%, respectively, compared to biopolymer applications at 0.06 mL plant-1 and untreated plants. The root dry biomass, total root length, and surface in biostimulant-treated plants were significantly higher at 0.24 mL plant-1 and to a lesser extent at 0.12 and 0.48 mL plant-1, in comparison to 0.06 mL plant-1 and untreated melon plants. A convoluted biochemical response to the biostimulant treatment was highlighted through UHPLC/QTOF-MS metabolomics, in which brassinosteroids and their interaction with other hormones appeared to play a pivotal role. Root metabolic profile was more markedly altered than leaves, following application of the biopolymer-based biostimulant. Brassinosteroids triggered in roots could have been involved in changes of root development observed after biostimulant application. These hormones, once transported to shoots, could have caused an hormonal imbalance. Indeed, the involvement of abscisic acid, cytokinins, and gibberellin related compounds was observed in leaves following root application of the biopolymer-based biostimulant. Nonetheless, the treatment triggered an accumulation of several metabolites involved in defense mechanisms against biotic and abiotic stresses, such as flavonoids, carotenoids, and glucosinolates, thus potentially improving resistance toward plant stresses.
Tappi, Silvia; Tylewicz, Urszula; Romani, Santina; Siroli, Lorenzo; Patrignani, Francesca; Dalla Rosa, Marco; Rocculi, Pietro
2016-10-05
Vacuum impregnation (VI) is a processing operation that permits the impregnation of fruit and vegetable porous tissues with a fast and more homogeneous penetration of active compounds compared to the classical diffusion processes. The objective of this research was to investigate the impact on VI treatment with the addition of calcium lactate on qualitative parameters of minimally processed melon during storage. For this aim, this work was divided in 2 parts. Initially, the optimization of process parameters was carried out in order to choose the optimal VI conditions for improving texture characteristics of minimally processed melon that were then used to impregnate melons for a shelf-life study in real storage conditions. On the basis of a 2 3 factorial design, the effect of Calcium lactate (CaLac) concentration between 0% and 5% and of minimum pressure (P) between 20 and 60 MPa were evaluated on color and texture. Processing parameters corresponding to 5% CaLac concentration and 60 MPa of minimum pressure were chosen for the storage study, during which the modifications of main qualitative parameters were evaluated. Despite of the high variability of the raw material, results showed that VI allowed a better maintenance of texture during storage. Nevertheless, other quality traits were negatively affected by the application of vacuum. Impregnated products showed a darker and more translucent appearance on the account of the alteration of the structural properties. Moreover microbial shelf-life was reduced to 4 d compared to the 7 obtained for control and dipped samples. © 2016 Institute of Food Technologists®.
Garzo, E.; Fernández-Pascual, Mercedes; Morcillo, Cesar; Fereres, Alberto; Gómez-Guillamón, M.L.; Tjallingii, W.F.
2017-01-01
Resistance of the melon line TGR-1551 to the aphid Aphis gossypii is based on preventing aphids from ingesting phloem sap. In electrical penetration graphs (EPGs), this resistance has been characterized with A. gossypii showing unusually long phloem salivation periods (waveform E1) mostly
International Nuclear Information System (INIS)
Atrooz, O.; Harb, M.; Al-Qato, M.
2007-01-01
Results of the this study which were carried out on yhe ethanol and acetone extracts of Prunus armeniaca, Cerasus vulgare, Nespole, Opuntia ficus-indica, Cucumis melo, and Vitis vinifera proved that theses extracts contain bioctive substances such as polyohenols and flavonids. The UV-VIS spectropgotometric assays showed that the extracted materials posses strong band in the range between 250-300 nm which confirm the presence of polyphenols and flavonoids. The concentration of these materials were different depending on the type pf plant seeds and the solvents used for extraction. The antioxidant and antihaemolytic activities of the extracts were determined by 1, 1-dipheny1-2picry1-hydeazy1 (DPPH) method, and red blood cells (RBCs) haemolysis test. Results of these extracts showed remarkable antioxidant activities depending on the origin of plant extracts. (Author's) 23 refs., 4 Tabs., 1fig
Arsenic speciation in xylem sap of cucumber (Cucumis sativus L.)
Energy Technology Data Exchange (ETDEWEB)
Mihucz, Victor G. [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); Tatar, Eniko [Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Virag, Istvan [L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Cseh, Edit; Fodor, Ferenc [L. Eoetvoes University, Department of Plant Physiology, Budapest (Hungary); Zaray, Gyula [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary)
2005-10-01
Flow injection analysis (FIA) and high-performance liquid chromatography double-focusing sector field inductively coupled plasma mass spectrometry (HPLC-DF-ICP-MS) were used for total arsenic determination and arsenic speciation of xylem sap of cucumber plants (Cucumis sativus L.) grown in hydroponics containing 2 {mu}mol dm{sup -3} arsenate or arsenite, respectively. Arsenite [As(III)], arsenate [As(V)] and dimethylarsinic acid (DMA) were identified in the sap of the plants. Arsenite was the predominant arsenic species in the xylem saps regardless of the type of arsenic treatment, and the following concentration order was determined: As(III) > As(V) > DMA. The amount of total As, calculated taking into consideration the mass of xylem sap collected, was almost equal for both treatments. Arsenite was taken up more easily by cucumber than arsenate. Partial oxidation of arsenite to arsenate (<10% in 48 h) was observed in the case of arsenite-containing nutrient solutions, which may explain the detection of arsenate in the saps of plants treated with arsenite. (orig.)
Directory of Open Access Journals (Sweden)
Maria Luisa Amodio
2013-06-01
Full Text Available The shelf life of fresh-cut produce is mostly determined by evaluating the external appearance since this is the major factor affecting consumer choice at the moment of purchase. The aim of this study was to investigate the degradation kinetics of the major quality attributes in order to better define the shelf life of fresh-cut melons. Melon pieces were stored for eight days in air at 5°C. Sensorial and physical attributes including colour, external appearance, aroma, translucency, firmness, and chemical constituents, such as soluble solids, fructose, vitamin C, and phenolic content, along with antioxidant activity were monitored. Attributes showing significant changes over time were used to test conventional kinetic models of zero and first order, and Weibullian models. The Weibullian model was the most accurate to describe changes in appearance score, translucency, aroma, firmness and vitamin C (with a regression coefficient always higher than 0.956, while the other parameters could not be predicted with such accuracy by any of the tested models. Vitamin C showed the lowest kinetic rate among the model parameters, even though at the limit of marketability (appearance score 3, estimated at five days, a loss of 37% of its initial content was observed compared to the fresh-cut product, indicating a much lower nutritional value. After five days, the aroma score was already 2.2, suggesting that this quality attribute, together with the vitamin C content, should be taken into account when assessing shelf life of fresh-cut melons. In addition, logistical models were used to fit the percentage of rejected samples on the basis of non-marketability and non-edibility (appearance score <3 and <2, respectively. For both parameters, correlations higher than 0.999 were found at P<0.0001; for each mean score this model helps to understand the distribution of the samples among marketable, nonmarketable, and non-edible products.
LOLA SYSTEM: A code block for nodal PWR simulation. Part. II - MELON-3, CONCON and CONAXI Codes
International Nuclear Information System (INIS)
Aragones, J. M.; Ahnert, C.; Gomez Santamaria, J.; Rodriguez Olabarria, I.
1985-01-01
Description of the theory and users manual of the MELON-3, CONCON and CONAXI codes, which are part of the core calculation system by nodal theory in one group, called LOLA SYSTEM. These auxiliary codes, provide some of the input data for the main module SIMULA-3; these are, the reactivity correlations constants, the albe does and the transport factors. (Author) 7 refs
LOLA SYSTEM: A code block for nodal PWR simulation. Part. II - MELON-3, CONCON and CONAXI Codes
Energy Technology Data Exchange (ETDEWEB)
Aragones, J M; Ahnert, C; Gomez Santamaria, J; Rodriguez Olabarria, I
1985-07-01
Description of the theory and users manual of the MELON-3, CONCON and CONAXI codes, which are part of the core calculation system by nodal theory in one group, called LOLA SYSTEM. These auxiliary codes, provide some of the input data for the main module SIMULA-3; these are, the reactivity correlations constants, the albe does and the transport factors. (Author) 7 refs.
Aragão, F A S; Torres Filho, J; Nunes, G H S; Queiróz, M A; Bordallo, P N; Buso, G S C; Ferreira, M A; Costa, Z P; Bezerra Neto, F
2013-12-06
The genetic divergence of 38 melon accessions from traditional agriculture of the Brazilian Northeast and three commercial hybrids were evaluated using fruit descriptors and microsatellite markers. The melon germplasm belongs to the botanic varieties cantalupensis (19), momordica (7), conomon (4), and inodorus (3), and to eight genotypes that were identified only at the species level. The fruit descriptors evaluated were: number of fruits per plant (NPF), fruit mass (FM; kg), fruit longitudinal diameter (LD; cm), fruit transversal diameter (TD; cm), shape index based on the LD/TD ratio, flesh pulp thickness, cavity thickness (CT; cm), firmness fruit pulp (N), and soluble solids (SS; °Brix). The results showed high variability for all descriptors, especially for NPF, LD, and FM. The grouping analysis based on fruit descriptors produced eight groups without taxonomic criteria. The LD (22.52%), NPF (19.70%), CT (16.13%), and SS (9.57%) characteristics were the descriptors that contributed the most to genotype dissimilarity. The 17 simple sequence repeat polymorphic markers amplified 41 alleles with an average of 2.41 alleles and three genotypes per locus. Some markers presented a high frequency for the main allele. The genetic diversity ranged from 0.07 to 0.60, the observed heterozygosity had very low values, and the mean polymorphism information content was 0.32. Molecular genetic similarity analyses clustered the accessions in 13 groups, also not following taxonomic ranks. There was no association between morphoagronomic and molecular groupings. In conclusion, there was great variability among the accessions and among and within botanic groups.
Anti diabetic effect of Momordica charantia (bitter melone on alloxan induced diabetic rabbits.
Directory of Open Access Journals (Sweden)
Yakaiah Vangoori, Mishra SS, Ambudas B, Ramesh P, Meghavani G, Deepika K, Prathibha A
2013-02-01
Full Text Available Objective: to investigate the anti diabetic effect of the bitter melon on Alloxan induced diabetes in experimental animals (rabbits. Materials and Methods: the alcohol extract of whole fruit was tested for its efficacy in Alloxan (150mg/kg induced diabetic rabbit. The diabetic rabbits were divided into 5groups. Group I (control received 2% gumacasia, groupie (positive control received standard drug Metformin (62.5mg+2%GA, group III, IV, V (T1 T2 T3 were treated orally with a daily dose of 0.5(gm 1gm, 1.5gm respectively for 35 days, for all diabetic rabbits after giving TEST,NC,PC preparations, the blood samples were collected and determined the blood glucose level 0,1,3,24hrs intervals. 0hr reading is before drug giving and remaining 3 readings after drugs giving. 24th her reading is considered as 0hr reading for the next day. Results: administration of alcohol of an extract of bitter melon produced a dose dependent decrease in blood glucose levels in Alloxan induced rabbits. There was a significant fall in blood sugar level in High dose (1.5GM/kg in comparison to low dose (0.5gm/kg and median dose (1gm/kg shown by LSD test. This is comparable to the effect of Metformin. Conclusion: the results of this study show that chronic oral administration of an extract of Momordica charantia fruit at an appropriate dosage may be good alternative anti diabetic agent.
Effect of main stem pruning and fruit thinning on the postharvest conservation of melon
Directory of Open Access Journals (Sweden)
Rafaella M. de A. Ferreira
Full Text Available ABSTRACT Main stem pruning and fruit thinning are cultivation practices that can influence the yield and quality of the fruit. This study aimed to evaluate the effects of main stem pruning and fruit thinning on the postharvest conservation of Charentais Banzai melons. In the field, the plants were subjected to main stem pruning and fruit thinning, with harvesting done 74 days after sowing (DAS. The fruits were transported to the laboratory where they were cleaned, characterized, and stored in a cold chamber (5 °C and 90 ± 2% RH. In the field, the experiment was designed as a split-plot using a 2 × 4 + 1 factorial design, with two levels of main stem pruning (pruned and unpruned, four levels of thinning times (42, 45, 48, and 51 DAS, and a control (unpruned and unthinned. The sub-plot consisted of storage times (0, 7, 14, 21, and 28 days, with four blocks. The preharvest treatments did not significantly influence the production characteristics of the Banzai hybrid. The treatment without pruning increased the titratable acidity of fruit, and the thinning at 51 days after sowing (DAS reduced soluble sugars. There was a decline in pulp firmness, titratable acidity, reducing sugars, and an increase in soluble solids, total soluble sugar, and non-reducing sugars during storage. Pruning the main melon stem reduced the weight loss of the fruit after 28 days of storage.
Effects of UV-B irradiation on photomovement in the desmid, Cosmarium cucumis
International Nuclear Information System (INIS)
Haeder, D.-P.
1987-01-01
Monochromatic UV-B irradiation affects neither the absorption nor the fluorescence of the bulk pigments in the desmid Cosmarium cucumis but it impairs photomovement of these organisms at fluence rates which are not higher than the ambient level of solar UV-B irradiation. Photoaccumulations and phototaxis are strongly inhibited especially at wavelengths <= 300 nm while photodispersal at higher white light fluence rates is hardly affected by supplementary UV-B. This effect has important consequences for the growth and survival of populations in their natural environment: these photosynthetic organisms utilize photomovement to find and stay in areas of suitable visible light fluence rates. The UV-B component of solar irradiation both impairs the strategy of the organisms to find a suitable position and the escape mechanism by which the cells move out of areas with too strong white illuminances which photooxidize the bulk pigments and bleach the population within a few days. (author)
International Nuclear Information System (INIS)
Cuny, F.; Grotte, M.; Dumas de Vaulx, R.; Rieu, A.
1993-01-01
The effects of increasing gamma ray exposures on muskmelon pollen of the Védrantais genotype were evaluated after autofertilization and hybridization with the F1.G1 genotype. Regardless of doses of between 0.15 and 1.6 kGy, fruit set and number of seeds per fruit were comparable to those of the control. The pollen tube from pollen irradiated with up to 2.5 kGy grew in styles and reached the ovules. When pollen was cultivated in vitro, relatively high doses of irradiation (1.6 kGy) were needed to reduce the level of germination. Radiation-induced changes in the generative nucleus led to the formation of two chromosomally unbalanced sperm cells (as indicated by the appearance of morphological dimorphism) which induced parthenogenetic development of the egg to form a haploid embryo. Haploid embryo production by gamma-irradiated pollen was genotype dependent. For exposures of between 0.15 and 2.5 kGy, the production of embryos was the same, about 3.4%; a maximum of 70% of these embryos placed in a specific culture medium produced haploid plants. The ploidy of the plantlets in vitro was determined by flow cytometry. No aneuploidy was detected. All resulting plants exhibited normal phenotypes. (author) [fr
The study was conducted to investigate the optimal hormone treatment for rooting in bitter melon and the effect of defoliation on rooting and polyamine levels. Commercial preparation (diluted 1:10 and 1: 20) gave extensive rooting within five days after treatment. The presence of leaf with the stem ...
Directory of Open Access Journals (Sweden)
T. Smitha
2012-01-01
Full Text Available The use of low-cost, locally available, high efficiency and eco-friendly adsorbents has been investigated as an ideal alternative to the current expensive methods of removing dyes from wastewater. This study investigates the potential use of the peel of Cucumis sativa fruit for the removal of crystal violet (CV dye from simulated wastewater. The effects of different system variables, adsorbent dosage, initial dye concentration, pH and contact time were investigated and optimal experimental conditions were ascertained. The results showed that as the amount of the adsorbent increased, the percentage of dye removal increased accordingly. Optimum pH value for dye adsorption was determined as 7.0. The adsorption of crystal violet followed pseudo-second order rate equation and fit well Langmuir and Freundlich equations. The maximum removal of CV was obtained at pH 7 as 92.15% for adsorbent dose of 0.2 g/50 mL and 25 mg L-1 initial dye concentration at room temperature. The maximum adsorption capacity obtained from Langmuir equation was 34.24 mg g-1. Furthermore, adsorption kinetics of (CV was studied and the rate of adsorption was found to conform to pseudo-second order kinetics with a good correlation (R2 > 0.9739. The peel of Cucumis sativa fruit can be attractive options for dye removal from diluted industrial effluents since test reaction made on simulated dyeing wastewater show better removal percentage of (CV.
Brown, J.K.
2011-06-01
The genome of a new bipartite begomovirus Melon chlorotic leaf curl virus from Guatemala (MCLCuV-GT) was cloned and the genome sequence was determined. The virus causes distinct symptoms on melons that were not previously observed in melon crops in Guatemala or elsewhere. Phylogenetic analysis of MCLCuV-GT and begomoviruses infecting cucurbits and other host plant species indicated that its closest relative was MCLCuV from Costa Rica (MCLCuV-CR). The DNA-A components of two isolates shared 88.8% nucleotide identity, making them strains of the same species. Further, both MCLCuV-GT and MCLCuV-CR grouped with other Western Hemisphere cucurbit-infecting species in the SLCV-clade making them the most southerly cucurbit-infecting members of the clade to date. Although the common region of the cognate components of MCLCuV-GT and MCLCuV-CR, shared similar to 96.3% nucleotide identity. While DNA-A and DNA-B components of MCLCuV-GT were less than 86% nucleotide identity with the respective DNAA and DNA-B common regions of MCLCuV-CR. The late viral genes of the two strains shared the least nt identity (<88%) while their early genes shared the highest nt identity (>90%). The collective evidence suggests that these two strains of MCLCuV are evolutionarily divergent owing in part to recombination, but also due to the accumulation of a substantial number of mutations. In addition they are differentially host-adapted, as has been documented for other cucurbit-infecting, bean-adapted, species in the SLCV clade. (C) 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Luiz Hernrique Barbosa
2013-12-01
Full Text Available Partindo da hipótese de que as poéticas de João Cabral de Melo Neto e Manoel de Barros são guiadas por um traço comum, o da convergência entre poesia e crítica, este estudo mostra as especificidades de cada poeta ao produzir poesia crítica e textos críticos sobre poesia. Chega-se à conclusão de que essa convergência tem por objetivo apresentar a matéria de poesia dos poetas: a eleição do elemento prosaico. É ressaltado que os dois poetas, ao elevarem ao estatuto de poesia elementos pouco nobres, ao fazerem da crítica a matéria fundamental de sua poesia, estariam renovando uma poesia que não se vale de tais elementos.Palavras-chave: Crítica. Poesia. João Cabral de Melo Neto. Manoel de Barros.
Zhang, Zhen-Tao; Yang, Shu-Qiong; Li, Zi-Ang; Zhang, Yun-Xia; Wang, Yun-Zhu; Cheng, Chun-Yan; Li, Ji; Chen, Jin-Feng; Lou, Qun-Feng
2016-07-01
Ribosomal DNAs are useful cytogenetic markers for chromosome analysis. Studies investigating site numbers and distributions of rDNAs have provided important information for elucidating genome organization and chromosomal relationships of many species by fluorescence in situ hybridization. But relevant studies are scarce for species of the genus Cucumis, especially in wild species. In the present study, FISH was conducted to investigate the organization of 45S and 5S rDNA among 20 Cucumis accessions, including cultivars and wild accessions. Our results showed that the number of 45S rDNA sites varied from one to five pairs in different accessions, and most of these sites are located at the terminal regions of chromosomes. Interestingly, up to five pairs of 45S rDNA sites were observed in C. sativus var. sativus, the species which has the lowest chromosome number, i.e., 2n = 14. Only one pair of 5S rDNA sites was detected in all accessions, except for C. heptadactylus, C. sp, and C. spp that had two pairs of 5S rDNA sites. The distributions of 5S rDNA sites showed more variation than 45S rDNA sites. The phylogenetic analysis in this study showed that 45S and 5S rDNA have contrasting evolutionary patterns. We find that 5S rDNA has a polyploidization-related tendency towards the terminal location from an interstitial location but maintains a conserved site number, whereas the 45S rDNA showed a trend of increasing site number but a relatively conserved location.
Analysis of Powdery Mildew Resistance in Wild Melon MLO Mutants
Directory of Open Access Journals (Sweden)
Cheng Hong
2015-11-01
Full Text Available Wild species have a potential value in crop breeding. Explore MLO gene which related with powdery mildew natural resistance is very important for improving the quality of melon. Resistance to powdery mildew was examined in cultivar and wild species by leaf inoculation. The wild germplasms showed resistance to powdery mildew Race1. Cloning and sequence analysis of the CmMLO2 gene identified an 85 bp difference between the wild and cultivated species. The CmMLO2 gene was expressed in the wild germplasm after fluorescence-labeled Agrobacterium-mediated transformation. A positive transgenic plant showed successful invasion by powdery mildew Race1. These results suggested that the wild species might have failed to encode the MLO protein, thereby resulting in the MLO-negative regulation of powdery mildew, which in turn resulted in the broad-spectrum resistance of the wild species to powdery mildew.
Wóycicki, Rafał; Witkowicz, Justyna; Gawroński, Piotr; Dąbrowska, Joanna; Lomsadze, Alexandre; Pawełkowicz, Magdalena; Siedlecka, Ewa; Yagi, Kohei; Pląder, Wojciech; Seroczyńska, Anna; Śmiech, Mieczysław; Gutman, Wojciech; Niemirowicz-Szczytt, Katarzyna; Bartoszewski, Grzegorz; Tagashira, Norikazu; Hoshi, Yoshikazu; Borodovsky, Mark; Karpiński, Stanisław; Malepszy, Stefan; Przybecki, Zbigniew
2011-01-01
Cucumber (Cucumis sativus L.), a widely cultivated crop, has originated from Eastern Himalayas and secondary domestication regions includes highly divergent climate conditions e.g. temperate and subtropical. We wanted to uncover adaptive genome differences between the cucumber cultivars and what sort of evolutionary molecular mechanisms regulate genetic adaptation of plants to different ecosystems and organism biodiversity. Here we present the draft genome sequence of the Cucumis sativus genome of the North-European Borszczagowski cultivar (line B10) and comparative genomics studies with the known genomes of: C. sativus (Chinese cultivar--Chinese Long (line 9930)), Arabidopsis thaliana, Populus trichocarpa and Oryza sativa. Cucumber genomes show extensive chromosomal rearrangements, distinct differences in quantity of the particular genes (e.g. involved in photosynthesis, respiration, sugar metabolism, chlorophyll degradation, regulation of gene expression, photooxidative stress tolerance, higher non-optimal temperatures tolerance and ammonium ion assimilation) as well as in distributions of abscisic acid-, dehydration- and ethylene-responsive cis-regulatory elements (CREs) in promoters of orthologous group of genes, which lead to the specific adaptation features. Abscisic acid treatment of non-acclimated Arabidopsis and C. sativus seedlings induced moderate freezing tolerance in Arabidopsis but not in C. sativus. This experiment together with analysis of abscisic acid-specific CRE distributions give a clue why C. sativus is much more susceptible to moderate freezing stresses than A. thaliana. Comparative analysis of all the five genomes showed that, each species and/or cultivars has a specific profile of CRE content in promoters of orthologous genes. Our results constitute the substantial and original resource for the basic and applied research on environmental adaptations of plants, which could facilitate creation of new crops with improved growth and yield in
Yaldız, Gülsüm; Sekeroglu, Nazım; Kulak, Muhittin; Demirkol, Gürkan
2015-01-01
This study was designed to determine the adaptation capability of bitter melon (Momordica charantia L.), which is widely grown in tropical and subtropical climates, in northern parts of Turkey. In this study, plant height, number of fruits, fruit length, fruit width, number of seeds and fruit weight of bitter melon grown in field conditions were determined. The antimicrobial effect of the ethanol extract of fruit and seeds against Pseudomonas aeruginosa, Escherichia coli, Staphylococcus aureus, Salmonella typhi, Aspergillus niger and Candida albicans microorganisms was tested in vitro by the disc diffusion method. In conclusion, plant height (260 cm), number of fruits (16 per plant), number of seeds (30.2 per fruit), fruit width (3.8 cm), fruit length (10.6 cm) and fruit weight (117.28 g fruit(- 1)) were determined; fruits were found to have antimicrobial activity against A. niger; oil and seeds were found to have antimicrobial activity against A. niger and E. coli.
Raman Imaging of Plant Cell Walls in Sections of Cucumis sativus.
Zeise, Ingrid; Heiner, Zsuzsanna; Holz, Sabine; Joester, Maike; Büttner, Carmen; Kneipp, Janina
2018-01-25
Raman microspectra combine information on chemical composition of plant tissues with spatial information. The contributions from the building blocks of the cell walls in the Raman spectra of plant tissues can vary in the microscopic sub-structures of the tissue. Here, we discuss the analysis of 55 Raman maps of root, stem, and leaf tissues of Cucumis sativus , using different spectral contributions from cellulose and lignin in both univariate and multivariate imaging methods. Imaging based on hierarchical cluster analysis (HCA) and principal component analysis (PCA) indicates different substructures in the xylem cell walls of the different tissues. Using specific signals from the cell wall spectra, analysis of the whole set of different tissue sections based on the Raman images reveals differences in xylem tissue morphology. Due to the specifics of excitation of the Raman spectra in the visible wavelength range (532 nm), which is, e.g., in resonance with carotenoid species, effects of photobleaching and the possibility of exploiting depletion difference spectra for molecular characterization in Raman imaging of plants are discussed. The reported results provide both, specific information on the molecular composition of cucumber tissue Raman spectra, and general directions for future imaging studies in plant tissues.
Directory of Open Access Journals (Sweden)
Kelen Cristina dos Reis
2006-06-01
Full Text Available Com o presente trabalho objetivou-se avaliar a qualidade e a vida útil do pepino (Cucumis sativus L., utilizando recobrimento com película de fécula de mandioca. Após seleção, amostras de pepino japonês foram mergulhadas em suspensões de fécula de mandioca a 0, 2, 3 e 4%, secos ao ar e armazenados em câmara fria a 5ºC e 95% de UR por 8 dias. As análises realizadas foram perda de massa, pH, sólidos solúveis (SS , acidez titulável (AT, Cor L*a*b e firmeza. O delineamento utilizado foi o DIC com 3 repetições, com os tratamentos dispostos em esquema fatorial 4 x 5. O valor encontrado para firmeza nas amostras tratadas com película a 4% foram menores em comparação aos outros tratamentos, isto, provavelmente se deve à plasticidade do tecido que estas amostras apresentaram. A película reduziu significativamente a perda de massa das amostras mantidas sob refrigeração. A aplicação de película de fécula de mandioca na concentração mais elevada (4%, proporcionou ao pepino um aspecto melhor de conservação, tornando o produto mais atraente.This work was made to evaluate the properties and postharvest life of cucumber (Cucumis sativus L. coated with cassava starch film. After the selection the fruits were dipped in suspensions 0, 2, 3 and 4% starch, dried naturally and stored in chamber cold (5ºC ± 1ºC and 90% ± 5% HR during 8 days and the analyses were done in the time zero and in intervals of 2 days. The analyses done were loss mass, titratable acidity (TA, pH, soluble solids (SS, color L*a*b and firmness. The test was conducted in completely randomized design, with three repetitions, with the treatments disposed in factory layout 4x5. The value found for firmness in the samples treated with biofilm at 4% was smaller in comparison to the other treatments, this, is probably due to the plasticity of the tissue that these samples presented. The film reduced the loss of mass of the samples maintained under refrigeration
Mat, Sumaiyah; Jaafar, Mohamad Hasif; Sockalingam, Sargunan; Raja, Jasmin; Kamaruzzaman, Shahrul Bahyah; Chin, Ai-Vyrn; Abbas, Azlina Amir; Chan, Chee Ken; Hairi, Noran Naqiah; Othman, Sajaratulnisah; Cumming, Robert; Tan, Maw Pin
2018-05-01
To determine the association between vitamin D and knee pain among participants of the Malaysian Elders Longitudinal Research (MELoR) study. This was a cross-sectional study from the MELoR study consisting of a representative group of 1011 community-dwelling older persons (57% female), mean age 86.5 (54-94) years; 313 were Malays, 367 Chinese and 330 Indians. Participants were asked if they had knee pain. Levels of serum 25-hydroxy cholecalciferol (25-[OH]D), an indicator of vitamin D status, were measured using routine laboratory techniques. In unadjusted analysis, presence of knee pain was significantly associated with vitamin D deficiency (odds ratio [OR] 1.42; 95% confidence interval (CI) 1.08-1.85, P 0.011). Vitamin D levels were significantly associated with ethnicity differences where Malays (OR 7.08; 95% CI 4.94-10.15) and Indians (OR 6.10; 95% CI 4.28-9.71) have lower levels of vitamin D compared to Chinese. Subsequent multivariate analysis revealed that the association between vitamin D deficiency and knee pain was confounded by ethnic differences. A previous study suggested that vitamin D deficiency was associated with knee pain. This relationship was reproduced in our study, but we further established that the association was explained by ethnic variations. As vitamin D status is dependent on skin tone, diet and sunlight exposure, which are all effected by ethnicity, future studies are now required to determine whether a true relationship exists between vitamin D and knee pain. © 2018 Asia Pacific League of Associations for Rheumatology and John Wiley & Sons Australia, Ltd.
Directory of Open Access Journals (Sweden)
Raphael Miller de Souza Caldas
2016-04-01
Full Text Available A região Nordeste é a principal produtora de melão do Brasil. O Semiárido brasileiro é uma região caracterizada por apresentar fatores climáticos favoráveis ao desenvolvimento da cultura do meloeiro. No presente estudo foi realizada a modelagem digital do terreno (MDT da microrregião Sertão do Moxotó para os parâmetros de precipitação, temperatura, PIB e IDH, afim de verificar a relação entre a cultura do meloeiro e a apicultura. Os municípios analisados foram Arcoverde, Betânia, Custódia, Ibimirim, Inajá, Sertânia e Manari. O cultivo do meloeiro tem potencial para ser implantado nos municípios do Sertão do Moxotó e está diretamente ligado a apicultura, pois a Apis mellifera é seu principal polinizador. Seu cultivo pode desempenhar papel vital no aumento ou manutenção da produção apícola. The Northeast region is the main melon producer of Brazil. The Brazilian semiarid region is characterized by climatic conditions favorable to the development of melon crop. In the present study, the digital terrain modeling (DTM of Sertão do Moxotó was performed to precipitation parameters, temperature, GDP, HDI and population in order to verifythe relationship between melon crop and apiculture. The districts analyzed were Arcoverde, Betânia, Custódia, Ibimirim, Inajá, Sertânia and Manari. Apis mellifera is the main pollinator of melon crop. Melon crop can support the bees during the shortage of bee flora and increase in bee production.
Wang, Chun-Yan; Li, Jing-Rui; Xia, Qing-Ping; Wu, Xiao-Lei; Gao, Hong-Bo
2014-07-01
This paper investigated the influence of gamma-aminobutyric acid (GABA) on GABA metabolism and amino acid content under hypoxia stress by accurately controlling the level of dissolved oxygen in hydroponics, using the roots of melon 'Xiyu 1' seedlings as the test material. The results showed that compared with the control, the growth of roots was inhibited seriously under hypoxia stress. Meanwhile, the hypoxia-treated roots had significantly higher activities of glutamate decarboxylase (GAD), glutamate dehydrogenase (GDH), glutamate synthase (GOGAT), glutamine synthetase (GS), alanine aminotransferase (ALT), aspartate aminotransferase (AST) as well as the contents of GABA, pyruvic acid, alanine (Ala) and aspartic acid (Asp). But the contents of glutamic acid (Glu) and alpha-keto glutaric acid in roots under hypoxia stress was obviously lower than those of the control. Exogenous treatment with GABA alleviated the inhibition effect of hypoxia stress on root growth, which was accompanied by an increase in the contents of endogenous GABA, Glu, alpha-keto glutaric acid and Asp. Furthermore, under hypoxia stress, the activities of GAD, GDH, GOGAT, GS, ALT, AST as well as the contents of pyruvic acid and Ala significantly decreased in roots treated with GABA. However, adding GABA and viny-gamma-aminobutyric acid (VGB) reduced the alleviation effect of GABA on melon seedlings under hypoxia stress. The results suggested that absorption of GABA by roots could alleviate the injury of hypoxia stress to melon seedlings. This meant that GABA treatment allows the normal physiological metabolism under hypoxia by inhibiting the GAD activity through feedback and maintaining higher Glu content as well as the bal- ance of carbon and nitrogen.
Requejo Mariscal, María Isabel; Cartagena, María Carmen; Villena Gordo, Raquel; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; Castellanos Serrano, María Teresa
2016-04-01
In Spain, drip irrigation systems are widely used for horticultural crop production. In drip irrigation systems, emitter clogging has been identified as one of the most important concerns. Clogging is closely related to the quality of the irrigation water and the structure of the emitter flow path, and occurs as a result of multiple physical, biological and chemical factors. So, the use of acid fertilizers (e.g. phosphoric acid) in these systems is common to avoid the emitter clogging. Moreover, in this country the use of exhausted grape marc compost as source of nutrients and organic matter has been identified as a good management option of soil fertility, especially in grape-growing areas with a large generation of wastes from the wine and distillery industries. The purpose of this work was to study the effect of the time of application of phosphorus fertilizer with fertirrigation in a melon crop amended with winery waste compost on yield and quality parameters. During two years, the melon crop was grown under field conditions and beside the control treatment, three doses of compost were applied: 6.7, 13.3 and 20.0 t ha-1. All the compost treatments received 120 kg ha-1 of phosphorus fertilizer (phosphoric acid) for the season varying the time of application: The first year phosphorus application started after male and female flowering, and the second year the application started before flowering. Yield and quality parameters were evaluated to assess the suitability of these practices. Acknowledgements: This project has been supported by INIA-RTA2010-00110-C03. Keywords: Phosphorus fertilizer, exhausted grape marc compost, melon crop, yield and quality parameters.
Chemical signature of two Permian volcanic ash deposits within a bentonite bed from Melo, Uruguay
Directory of Open Access Journals (Sweden)
Liane M. Calarge
2006-09-01
Full Text Available A Permian bentonite deposit at Melo, Uruguay is composed of a calcite-cemented sandstone containing clay pseudomorphs of glass shards (0-0.50 m overlying a pink massive clay deposit (0.50-2.10m. The massive bed is composed of two layers containing quartz and smectite or pure smectite respectively. The smectite is remarkably homogeneous throughout the profile: it is a complex mixed layer composed of three layer types whose expandability with ethylene glycol (2EG 1EG or 0EG sheets in the interlayer zone which correspond to low-, medium- and high-charge layers respectively varies with the cation saturating the interlayer zone. The smectite homogeneity through the profile is the signature of an early alteration process in a lagoonal water which was over saturated with respect to calcite. Compaction during burial has made the bentonite bed a K-depleted closed system in which diagenetic illitization was inhibited. Variations in major, REE and minor element abundances throughout the massive clay deposit suggest that it originated from two successive ash falls. The incompatible element abundances are consistent with that of a volcanic glass fractionated from a rhyolite magma formed in a subduction/collision geological context.Um depósito Permiano de bentonita em Melo, Uruguai,é composto por um arenito com cimento calcítico contendo pseudomorfos de argila sobre detritos vítreos(0-0.50 m superpostos a um deposito maciço de argila rosado (0.50-2.10 m. A camada maciça é composta por dois níveis contendo quartzo e esmectita ou esmectita pura, respectivamente. A homogeneidade de esmectita ao longo do perfil é notável: trata-se de um interestratificado composto de três tipos de camadas, cuja expansibilidade com etileno-glicol (folhas 2EG, 1EG ou 0EG na zona interfoliar correspondentes a camadas com baixa, média e alta carga, respectivamente variam com o tipo de cátion que satura a zona interfoliar. A homogeneidade da esmectita ao longo do perfil
Biological and molecular characterization of Brazilian isolates of Zucchini yellow mosaic virus
Directory of Open Access Journals (Sweden)
David Marques de Almeida Spadotti
2015-02-01
Full Text Available Zucchini yellow mosaic virus (ZYMV causes substantial economic losses in cucurbit crops. Although ZYMV has been present in Brazil for more than 20 years, there is little information about the biological and molecular characteristics of the isolates found in the country. This study aimed to characterize the experimental hosts, pathotypes and genetic diversity of a collection of eleven Brazilian ZYMV isolates within the coat protein gene. For biological analysis, plant species from Amaranthaceae, Chenopodiaceae, Cucurbitaceae, Fabaceae, Solanaceae, and Pedaliaceae were mechanically inoculated and pathotypes were identified based on the reaction of a resistant Cucumis melo, accession PI414723. All of the cucurbit species/varieties and Sesamum indicum were systemically infected with all isolates. The nucleotide sequence variability of the coat protein gene ranged from 82 % to 99 % compared to the corresponding sequences of ZYMV isolates from different geographical locations. No recombination event was detected in the coat protein gene of the isolates.
Directory of Open Access Journals (Sweden)
MISAEL CORTÉS
2011-06-01
Full Text Available El objetivo de este trabajo fue desarrollar un producto mínimamente procesado fortificado con vitamina E, a partir de pepino (Cucumis sativus L, utilizando la ingeniería de matrices. Rodajas impregnadas al vacío (IV con DL-α-tocoferol acetato emulsificado en una fase acuosa isotónica al pepino (NaCl al 1%, son evaluadas en cuanto a propiedades fisicoquímicas, color, textura, estabilidad de la vitamina E y sensorialmente, por influencia del proceso, tiempo de almacenamiento y envasado (con y sin vacío. La vitamina E se cuantifica por HPLC (% del valor diario recomendado (VDR/100 g de pepino fresco, según la norma Colombiana. La respuesta IV alcanza niveles de 6.05±1.49%, correspondiente a 33.3±5.8 mg vitamina E y 110.5±19.1% VDR en 100 g de pepino fresco. Durante el almacenamiento en 9 días se presenta una pérdida aproximadamente del 50%, debido a la poca retención de la emulsión en el interior de la matriz. Los parámetros fisicoquímicos, el color y la textura son afectados por la IV, el tiempo y el envasado, siendo durante el almacenamiento más oscuras y más resistentes que el producto fresco. La ingeniería de matrices representa una metodología efectiva para fortificar el pepino con vitamina E.O objetivo deste estudo foi desenvolver um produto mínimamente processado fortificado com vitamina E, a partir de pepino (Cucumis sativus L, utilizando a engenharia de matrizes. Fatias de pepino foram impregnadas a vácuo (IV com DL-α- acetato de tocoferol emulsificado numa fase aquosa isotónica (NaCl a 1%, e foram avaliadas quanto às propiedades fisico-químicas, cor, textura, estabilidade da vitamina E e sensorialmente, tendo em consideração os factores: processo, tempo de armazenamento e envasado (com e sem vácuo. A vitamina E quantificou-se por HPLC (% do Valor Diario Recomendado (VDR/100 g de pepino fresco, de acordo com a norma Colombiana. A resposta à IV alcanzou niveis de 6.05±1.49%, correspondente a 33.3±5.8 mg
Directory of Open Access Journals (Sweden)
Evando Luiz Coelho
2003-01-01
Full Text Available Foram realizados dois experimentos com meloeiro, (Cucumis melo L. Grupo Cantalupensis, no verão, em condições de campo e de ambiente protegido com o objetivo de avaliar o efeito de doses de nitrogênio sobre características físicas (massa, diâmetro, espessura da polpa e diâmetro da cavidade e químicas (teor de sólidos solúveis, acidez titulável e pH do fruto. Cada experimento constou de quatro blocos ao acaso, contendo cinco tratamentos que foram as doses de nitrogênio (0, 75, 150, 300 e 450 kg ha-1de N. Utilizou-se uréia, sendo 30% colocada nos sulcos, antes do transplante, e 70% remanescente aplicada via água de irrigação, por gotejamento, durante o ciclo da cultura. Nos dois ambientes, os valores das características físicas elevaram-se com o aumento da dose de N. Sob ambiente protegido, associados à dose de 312 kg.ha-1de N, que propiciou a produção comercial máxima de frutos (PCM, os valores de massa, diâmetro, espessura da polpa e cavidade do fruto foram: 1.280 g, 12,6 cm, 3,1 cm e 6,1 cm respectivamente. No campo, com dose de 344 kg.ha-1de N, que propiciou a PCM, os valores correspondentes foram de 1.390 g, 13,1 cm, 3,4 cm e 5,9 cm respectivamente. O teor de sólidos solúveis não foi influenciado por doses de N, alcançando 9% e 9,5%, respectivamente, nos frutos produzidos no ambiente protegido e no campo. Nos dois ambientes, a acidez titulável da polpa elevou-se com as doses de N, atingindo 0,13 e 0,14 % de ácido cítrico com as doses de N para a PCM. O pH do fruto produzido em ambiente protegido não foi influenciado pelo aumento da dose de N, atingindo 6,83, enquanto o pH daquele produzido no campo elevou-se com as doses de N, atingindo 6,99 com a dose de N para a PCM.Two experiments with melon plants (Cucumis melo L. Cantalupensis Group were carried out in the summer, in the field and in an unheated greenhouse, aiming to evaluate the effect of nitrogen rates on fruit physical (weight, diameter, flesh pulp
Energy Technology Data Exchange (ETDEWEB)
Abalos, Diego, E-mail: diego.abalos@upm.es [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain); Sanchez-Martin, Laura; Garcia-Torres, Lourdes [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain); Groenigen, Jan Willem van [Department of Soil Quality, Wageningen University, PO Box 47, 6700 AA Wageningen (Netherlands); Vallejo, Antonio [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain)
2014-08-15
Drip irrigation combined with split application of fertilizer nitrogen (N) dissolved in the irrigation water (i.e. drip fertigation) is commonly considered best management practice for water and nutrient efficiency. As a consequence, its use is becoming widespread. Some of the main factors (water-filled pore space, NH{sub 4}{sup +} and NO{sub 3}{sup −}) regulating the emissions of greenhouse gases (i.e. N{sub 2}O, CO{sub 2} and CH{sub 4}) and NO from agroecosystems can easily be manipulated by drip fertigation without yield penalties. In this study, we tested management options to reduce these emissions in a field experiment with a melon (Cucumis melo L.) crop. Treatments included drip irrigation frequency (weekly/daily) and type of N fertilizer (urea/calcium nitrate) applied by fertigation. Crop yield, environmental parameters, soil mineral N concentrations and fluxes of N{sub 2}O, NO, CH{sub 4} and CO{sub 2} were measured during 85 days. Fertigation with urea instead of calcium nitrate increased N{sub 2}O and NO emissions by a factor of 2.4 and 2.9, respectively (P < 0.005). Daily irrigation reduced NO emissions by 42% (P < 0.005) but increased CO{sub 2} emissions by 21% (P < 0.05) compared with weekly irrigation. We found no relation between irrigation frequency and N{sub 2}O emissions. Based on yield-scaled Global Warming Potential as well as NO cumulative emissions, we conclude that weekly fertigation with a NO{sub 3}{sup −}-based fertilizer is the best option to combine agronomic productivity with environmental sustainability. Our study shows that adequate management of drip fertigation, while contributing to the attainment of water and food security, may provide an opportunity for climate change mitigation. - Highlights: • The effect of fertigation management techniques on GHG and NO emissions was studied. • Fertigation with urea instead of calcium nitrate increased N{sub 2}O by a factor of 2.4. • Daily irrigation reduced NO (42%) but increased CO
Directory of Open Access Journals (Sweden)
E. V. Inochkina
2017-01-01
Full Text Available The extension of periods of storage of fruits of gourds is an urgent task processing industry. The most developed and available for injection is a method of dehydration of raw materials due to supply of heat transfer fluids. In addition to solid dry frame in raw materials is 80–90% water. In the period of moisture removal from raw material changes of thermal-physical and structural-mechanical and physicochemical characteristics. The ratio of water and dry matter in vegetative raw materials largely determines the modes of drying and storage conditions of the finished product. During drying, there are a number of limitations: the drying temperature should not exceed the degradation temperature of vitamins and proteins, and the magnitude of course, the moisture content of the product depends on the reaction prevention malonodinitrile sugars at the critical moisture content. An important problem of the drying of production is quality control stages of drying, the dynamics of which is quite difficult to describe using mathematical models. The main factors of optimization of industrial drying processes is preservation of valuable components of the feedstock, the drying time, energy and resource conservation. Development of effective control algorithm for the process of dehydration of raw materials described in the article on the example of drying of slices of melon. Experimental approach a two-stage process of drying of melon varieties Taman, the proposed regression model with the relaxation-based on humidity and content of vitamin C from the variable in time temperature and pressure, based on the available literature and own experimental data. According to the optimal control of the drying process to search for the thermobaric regime that maximizes the vitamin C content at the end of the drying, under specified conditions, the humidity. The main findings are the solution of the problem for the case of piecewise constant temperature and pressure in
Senturk Parreidt, Tugce; Schmid, Markus; Müller, Kajetan
2018-04-01
Edible coating based on sodium alginate solution was applied to fresh-cut cantaloupe melon by dipping and vacuum impregnation coating methods. One aim of this work is to produce more technical information concerning these conventional and novel coating processes. For this purpose, the effect of various coating parameters (dipping time, draining time, time length of the vacuum period, vacuum pressure, atmospheric restoration time) with several levels on physical quality parameters (percentage of weight gain, color, and texture) of noncoated and coated samples were determined in order to define adequate coating process parameters to achieve a successful coating application. Additionally, the effects of dipping and vacuum impregnation processes were compared. Both processes improved the firmness of the melon pieces. However, vacuum impregnation application had higher firmness and weight gain results, and had significant effect (P coating technique and the parameters used significantly affect the physical quality characteristics of coated food products. The work presented produced more technical information concerning dipping and vacuum impregnation coating techniques, along with evaluating the effects of various coating parameters with several levels. The results revealed that vacuum impregnation technique is a successful coating method; however the effects should be carefully assessed for each product. © 2018 Institute of Food Technologists®.
El-Nahhal, Yasser; Hamdona, Nisreen
2015-01-01
This study investigated the phytotoxicity of herbicides applied singly or as mixtures to different crops under greenhouse conditions. Growth inhibition of the crops was taken as an indicator of phytotoxicity. Phytotoxicity of mixtures was estimated by calculating EC50 value in toxic units. EC50 (mg/kg soil) of Alachlor, Bromacil and/or Diuron were: 11.37, 4.77, 1.64, respectively, on melon; 0.11, 0.08, 0.24, respectively, on molokhia, and 3.91, 3.08, 1.83, respectively, on wheat. EC50 values ...
Water Footprint in Nitrate Vulnerable Zones: Mineral vs. Organic Fertilization.
Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; María Tarquis Alfonso, Ana
2017-04-01
(Cucumis melo L.) was grown under field conditions. Different doses of ammonium nitrate were used as well as waste compost derived from the wine-distillery industry, which is relevant in this area. Grey WF was estimated in both type of fertilizers using Castellanos et al. [3] methodology. The results showed that in the case of inorganic fertilization gray WF experiment a huge increase when the optimum dose were exceeded. Meanwhile, in the case of organic fertilization, even the doses exceeded the optimum, the increase gray WF was significantly lower. The discussion of these results will be presented based on the mineralization rate and N content of irrigation water. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03. [1] ITAP, 2011. Protocolo para el seguimiento y control de los programas de actuación en las zonas vulnerables a la contaminación por nitratos de Castilla-La Mancha. Available in: www.itap.es. [2] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12, UNESCO-IHE, Delft, The Netherlands. [3] Castellanos, M.T., Cartagena, M.C., Requejo, M.I. Arce, A., Cabello, M.J., Ribas, F., Tarquis, A.M. 2016. Agronomic concepts in water footprint assessment: A case of study in a fertirrigated melon crop under semiarid conditions. Agricultural Water Management 170: 81-90.
Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L.
Chee, P P; Tricoli, D M
1988-06-01
A procedure for the regeneration of whole cucumber plants (Cucumis sativus L. cv. Poinsett 76) by embryogenesis from cell suspension cultures is described. Embryogenic callus was initiated from the primary leaves of 14-17 day old plants. Suspension cultures of embryogenic cells were grown in liquid Murashige and Skoog basal medium containing 5 uM 2,4,5-trichlorophenoxyacetic acid and 4 uM 6-benzylaminopurine. Suspension cultures were composed of a population of cells that were densely cytoplasmic and potentially embryogenic. Differentiation of embryos was enhanced by washing the suspension culture cells with MS basal medium containing 0.5% activated charcoal and twice with MS basal medium followed by liquid shake cultures in MS basal medium. Sixty to 70 percent of the embryos prewashed with activated charcoal germinated into plantlets with normal morphology. Embryos obtained from suspension cultured cells without prewashing with activated charcoal organized into plantlets with abnormal primary leaves. Morphologically normal plantlets were obtained by excising the shoot tips and transferring them to fresh medium.
International Nuclear Information System (INIS)
Giwa, S.O.; Chuah, L.A.; Nor Mariah Adam
2009-01-01
Full text: In the present work, the response surface methodology (RSM), based on a central composite design (CCD), was used to determine the optimum conditions for the transesterification of crude egusi melon (Colocynthis citrullus L.) seed oil. Three process factors were evaluated at three levels (2 3 experimental design): the oil/ methanol molar ratio, the amount of catalyst in relation to the oil mass, and the reaction temperature. The amounts of catalyst and reaction temperature were the most significant (P 2 = 0.98). Using multiple regression analysis a quadratic polynomial equation was obtained for predicting methyl ester yield of the transesterification reaction. The squared terms of catalyst amount (P < 0.0001) and oil/ methanol molar ratio (P < 0.0072) showed significant effects on esters yield. The optimum reaction conditions for synthesis of EMOME were 1:6.55 oil-to-methanol molar ratio, 1.22 % catalyst amounts, and 65 degree Celsius reaction temperature resulting in a yield of 84.01 %. Using these optimal factor values under experimental conditions a methyl esters yield of 84.04 % was obtained on an average, and this value was well within the range predicted by the model. RSM was found to be a suitable technique for optimizing transesterification of egusi melon seed oil. Fuel properties of EMOME measured according to accepted methods were found to satisfy all prescribed ASTM (D 6751) and EN 14214 specifications. (author)
Directory of Open Access Journals (Sweden)
Li Xu
2016-12-01
Full Text Available Bitter melon (Momordica charantia is a species of edible plant known for its medicinal value towards diabetes and obesity. Due to the various compositions of bitter melon extracts (BME, the comprehensive knowledge concerning their anti-obesity effects was insufficient. Here we first introduced supercritical extraction to BME's preparation, (supercritical extraction is a relatively advanced extraction method with a better efficiency and selectivity and expected to be extensively used in future applications and the resultants were subjected to HPLC analysis, validating the presence of 42.60% of conjugated linolenic acid (CLnA, cis9, trans11, trans13-18:3 and 13.17% of conjugated linoleic acid (CLA, cis9, trans11-18:2. The BMSO (bitter melon seed oil was then administered to the HFD mice, an obesity model established by feeding C57BL/6J mice a high fat diet. Consequently, due to the BMSO's supplementation, the HFD mice showed a significantly decreased body-weight, Lee's index, fat index and adipose size, whereas the liver weight stayed unchanged. Meanwhile, the serum FFA (free fatty acids levels returned to normal at the dosage of 10 g/kg, and the elevated serum leptin levels were also recovered by BMSO's supplementation with moderate and high dose. These findings suggested that BMSO restored the balance between lipid intake and metabolism, which was probably mediated by leptin's variation. In summary, a detailed anti-obesity effect was described with regard to a potent CFA's (conjugated fatty acid combination offered by BME. A potential mechanism underlying BME's beneficial effects was proposed, paving the way for the better use of BME's pharmaceutical function to serve the obesity's treatment.
Directory of Open Access Journals (Sweden)
Hossein MARDANI
2012-02-01
Full Text Available Impacts of various concentrations of salicylic acid (SA on cucumber (Cucumis sativus L. seedling characteristic were evaluated under different water stress levels by using a factorial arrangement based on completely randomized design with three replications at experimental greenhouse of Ferdowsi University of Mashhad, Iran. The studied factors included three water deficit levels (100% FC, 80% FC, and 60% FC considered as first factor and five levels of SA concentrations (0, 0.25, 0.5, 0.75, and 1 mM as second factor. Results showed that foliar application of SA at the highest concentration enhanced leaf area, leaf and dry weight while decreased stomatal conductance under high level of water deficit stress. Though, severe water deficit stress sharply raised the SPAD reading values. In general, exogenous SA application could develop cucumber seedling characteristic and improve water stress tolerance.
Directory of Open Access Journals (Sweden)
Adriana Antonieta do Nascimento Rizzo
2002-06-01
Full Text Available Estimou-se a divergência genética entre cinco genótipos de melão rendilhado (Cucumis melo var. reticulatus Naud. (JAB-20, JAB-21, JAB-22, JAB-23 e 'Bônus nº 2' e determinou-se qual a contribuição relativa das 16 características avaliadas [nº médio de flores masculinas, hermafroditas/planta; produção total de frutos/m², peso médio dos frutos comerciáveis; diâmetro médio transversal e longitudinal do fruto (DMTF e DMLF; diâmetro médio transversal da inserção do pedúculo (DMTP; espessura média do mesocarpo e epicarpo (EMM e EME; diâmetro médio longitudinal e transversal do lóculo (DMTL e DMLL; proporção da cavidade (PC; desprendimento de sementes (DS; teor de sólidos solúveis totais (SST, pH e acidez titulável (AT] na divergência gen��tica. Obtiveram-se dois grupos de similaridade: I- JAB-20, JAB-21 e 'Bônus nº2' e II- JAB-22 e JAB-23. As características DMLF, DMTP, DMLL, DS e SST foram as que mais contribuíram para a divergência genética entre os genótipos.The genetic divergence of five cultivars of muskmelon was estimated (Cucumis melo var. reticulatus Naud (JAB-20, JAB-21, JAB-22, JAB-23 and 'Bônus nº2' and the relative contribution of each 16 characteristics were determined (number of male flowers per plant; total production of fruit, weight of fruits; longitudinal and transversal diameters of fruits; thickness and color of flesh and skin; longitudinal and transversal loculos diameter of fruits; seed loosing; netting thickness; and % total solvers solids, pH and total acidity in genetic divergence. Two groups of similarity were formed between the genitors by the values of D², one of then was constituted of the JAB-20 and JAB-21 and 'Bônus nº 2' genotypes, and another of the JAB-22 and JAB-23. The characteristics of longitudinal loculos diameters, longitudinal diameter of fruits, transversal diameter of peduncle insertion, % total solvers solids and seed loosing contributed to for genetic
JOÃO CABRAL DE MELO NETO: LA IMAGEN DEL RÍO EN LA POÉTICA DE LOS DESVALIDOS
Directory of Open Access Journals (Sweden)
GLORIA VERGARA
2013-11-01
Full Text Available In this article we review the cosmic image of water, from the theory of Gaston Bachelard, in two long poems of João Cabral de Melo Neto: O Rio ("The River" and O cão sem plumas ("The dog without feathers". I will see the river as cosmic image of the helpless in "The River" and the first part of "The dog without feathers", Paisagem do Capibaribe, understanding that poetry is not a complaint, but these texts denouncing misery. This poems project the worldview of those who resist the rigor, not only hunger and social spoils, but the river. The creatures that inhabit this world are as far away, the neglected, ignored what society. In the river, these beings are confused with the lama, not just your bank or depth, but the margin between liquid and solid, between the filth and survival. The gift of the destitute is his strength. Thus, the different shades reaching cosmic water image helps us to perceive the existence deployments in the "helpless" than lyrical subjects are depicted in Brazilian poetry.
Energy Technology Data Exchange (ETDEWEB)
Kozinka, V; Klasova, A; Niznansky, A
1963-01-01
Through Hygen's method of quantitative analysis of transpiration curves, the authors studied the intensity of stomatal and cuticular transpiration of germinating leaves of Cucumis sativus which were experimentally exposed to solid impurities containing F. The difference between the control and experimental plants shows that the impurities not only blocked the regulating system of breathing but also caused increased cuticular transpiration. Numerous lesions were observed; cuticle damage also spread to the inner tissues. A direct relationship between microscopic and macroscopic symptoms was not proven. The creation of conditions adverse to the normal development of the water balance was intensified when the impurities were dropped onto the surface of the leaves. The possible protective function of trichomes is mentioned, but applies only when the impurities settle on a dry surface.
Directory of Open Access Journals (Sweden)
Raimundo Wilane de Figueiredo
2007-03-01
Full Text Available A maioria das pesquisas em melão minimamente processado é concentrada no tipo 'cantaloupe', devido à sua importância no mercado internacional. O objetivo deste trabalho foi avaliar a qualidade do melão cantaloupe cv. Hy-Mark minimamente processado. Os frutos foram lavados e sanitizados, sendo em seguida cortados na forma de cubos, imersos em solução de CaCl2, acondicionados em embalagens flexíveis PET (tereftalato de polietileno e armazenados a 4ºC por 9 dias. O delineamento foi conduzido inteiramente casualizado, com três repetições. A intervalos de três dias, amostras foram coletadas e analisadas quanto a coliformes totais e fecais, e contagem de bactérias aeróbias mesófilas e bolores e leveduras, pH, sólidos solúveis totais, acidez, vitamina C, açúcares redutores totais, atividade de água, firmeza e análise sensorial através do atributo de aceitação global. O melão minimamente processado apresentou boa estabilidade física, físico-química, microbiológica e sensorial, estimando-se em 9 dias a vida útil deste produto a 4ºC.Most of the research into minimally processed melon is focused on cantaloupe melon, due to its importance in the international market. The objective of this work was to evaluate the quality of cantaloupe melon cv. Hy-Mark, minimally processed and refrigerated. Fruits were washed, sanitized, cut and imbedded in a calcium chloride solution and packed in PET and stored at 4ºC during 9 days. At three-day intervals samples were collected and analyzed for total and fecal coliforms, counting of aerobic mesophilic bacterias, molds and yeast, SS (soluble solids, TTA (total titrable acidity, firmness, pH, TRS (total reducing sugar, Aw, vitamin C, color and acceptability. The minimally processed melon showed good overall physical, pyisico-chemical, microbiological and sensorial stability during the storage period.
Shaik, Razia S; Zhu, Xiaocheng; Clements, David R; Weston, Leslie A
2016-01-01
Part of the challenge in dealing with invasive plant species is that they seldom represent a uniform, static entity. Often, an accurate understanding of the history of plant introduction and knowledge of the real levels of genetic diversity present in species and populations of importance is lacking. Currently, the role of genetic diversity in promoting the successful establishment of invasive plants is not well defined. Genetic profiling of invasive plants should enhance our understanding of the dynamics of colonization in the invaded range. Recent advances in DNA sequencing technology have greatly facilitated the rapid and complete assessment of plant population genetics. Here, we apply our current understanding of the genetics and ecophysiology of plant invasions to recent work on Australian plant invaders from the Cucurbitaceae and Boraginaceae. The Cucurbitaceae study showed that both prickly paddy melon ( Cucumis myriocarpus ) and camel melon ( Citrullus lanatus ) were represented by only a single genotype in Australia, implying that each was probably introduced as a single introduction event. In contrast, a third invasive melon, Citrullus colocynthis , possessed a moderate level of genetic diversity in Australia and was potentially introduced to the continent at least twice. The Boraginaceae study demonstrated the value of comparing two similar congeneric species; one, Echium plantagineum , is highly invasive and genetically diverse, whereas the other, Echium vulgare , exhibits less genetic diversity and occupies a more limited ecological niche. Sequence analysis provided precise identification of invasive plant species, as well as information on genetic diversity and phylogeographic history. Improved sequencing technologies will continue to allow greater resolution of genetic relationships among invasive plant populations, thereby potentially improving our ability to predict the impact of these relationships upon future spread and better manage invaders
Effects of Momordica charantia (Bitter Melon on Ischemic Diabetic Myocardium
Directory of Open Access Journals (Sweden)
Attila Czompa
2017-03-01
Full Text Available Objective: A rat model is here used to test a hypothesis that Momordica charantia (Bitter melon (BM extract favorably alters processes in cardiovascular tissue and is systemically relevant to the pathophysiology of type 2 diabetes (T2DM and related cardiovascular disease. Methods: Male Lean and Zucker Obese (ZO rats were gavage-treated for six weeks with 400 mg/kg body weight bitter melon (BM extract suspended in mucin–water vehicle, or with vehicle (Control. Animals were segregated into four treatment groups, 10 animals in each group, according to strain (Lean or ZO and treatment (Control or BM. Following six-week treatment periods, peripheral blood was collected from selected animals, followed by sacrifice, thoracotomy and mounting of isolated working heart setup. Results: Body mass of both Lean and ZO rats was unaffected by treatment, likewise, peripheral blood fasting glucose levels showed no significant treatment-related effects. However, some BM treatment-related improvement was noted in postischemic cardiac functions when Lean, BM-treated animals were compared to vehicle treated Lean control rats. Treatment of Lean, but not ZO, rats significantly reduced the magnitude of infarcted zone in isolated hearts subjected to 30 min of ischemia followed by 2 h of working mode reperfusion. Immunohistochemical demonstration of caspase-3 expression by isolated heart tissues subjected to 30 min of ischemia followed by 2 h of reperfusion, revealed significant correlation between BM treatment and reduced expression of this enzyme in hearts obtained from both Lean and ZO animals. The hierarchy and order of caspase-3 expression from highest to lowest was as follows: ZO rats receiving vehicle > ZO rats receiving BM extract > Lean rats treated receiving vehicle > Lean rats administered BM extract. Outcomes of analyses of peripheral blood content of cardiac-related analytics: with particular relevance to clinical application was a significant elevation in
Effects of Momordica charantia (Bitter Melon) on Ischemic Diabetic Myocardium.
Czompa, Attila; Gyongyosi, Alexandra; Szoke, Kitti; Bak, Istvan; Csepanyi, Evelin; Haines, David D; Tosaki, Arpad; Lekli, Istvan
2017-03-20
Objective : A rat model is here used to test a hypothesis that Momordica charantia (Bitter melon (BM)) extract favorably alters processes in cardiovascular tissue and is systemically relevant to the pathophysiology of type 2 diabetes (T2DM) and related cardiovascular disease. Methods : Male Lean and Zucker Obese (ZO) rats were gavage-treated for six weeks with 400 mg/kg body weight bitter melon (BM) extract suspended in mucin-water vehicle, or with vehicle (Control). Animals were segregated into four treatment groups, 10 animals in each group, according to strain (Lean or ZO) and treatment (Control or BM). Following six-week treatment periods, peripheral blood was collected from selected animals, followed by sacrifice, thoracotomy and mounting of isolated working heart setup. Results : Body mass of both Lean and ZO rats was unaffected by treatment, likewise, peripheral blood fasting glucose levels showed no significant treatment-related effects. However, some BM treatment-related improvement was noted in postischemic cardiac functions when Lean, BM-treated animals were compared to vehicle treated Lean control rats. Treatment of Lean, but not ZO, rats significantly reduced the magnitude of infarcted zone in isolated hearts subjected to 30 min of ischemia followed by 2 h of working mode reperfusion. Immunohistochemical demonstration of caspase-3 expression by isolated heart tissues subjected to 30 min of ischemia followed by 2 h of reperfusion, revealed significant correlation between BM treatment and reduced expression of this enzyme in hearts obtained from both Lean and ZO animals. The hierarchy and order of caspase-3 expression from highest to lowest was as follows: ZO rats receiving vehicle > ZO rats receiving BM extract > Lean rats treated receiving vehicle > Lean rats administered BM extract. Outcomes of analyses of peripheral blood content of cardiac-related analytics: with particular relevance to clinical application was a significant elevation in blood of ZO
Evaluación agronómica de melón (cucumis melo l bajo condiciones de campo
Directory of Open Access Journals (Sweden)
Fernando Borrego
2001-01-01
Full Text Available Con el objetivo de determinar las variables más relacionadas con el rendimiento, así como los principales componentes de variación, se establecieron en campo, en Ramos Arizpe, Coahuila, 12 genotipos de melón, en un diseño de Bloques Completos al Azar, con cuatro repeticiones. La parcela experimental fue de dos surcos de cinco metros de largo sembrados a doble hilera. Los genotipos en estudio fueron: híbridos: Primo, Pronto, Challenger, Cheyenne, Hi-Line, Cruiser, Durango, Apache, Laguna, Caravelle y Main Pak, y la variedad Top Mark, testigo; las variables evaluadas fueron: rendimiento (11 variables: cuantitativas y cualitativas; fenológicas (tres variables; agroclimáticas (cinco Variables y fisiológicas (cuatro variables. Se encontraron correlaciones significativas (p<0,05 y negativas, entre rendimiento y precocidad, peso promedio de frutos y número de frutos, así como entre número de frutos y longitud de fruto. Las variables fisiológicas más relacionadas fueron fotosíntesis y uso eficiente del agua. En el análisis de componentes principales, se encontró que hasta el componente tres, se explica el 65% de la varianza. En el componente uno, se encuentra un alto valor en las características de rendimiento (producción, peso y tamaño, por lo que se llamaría Características Cuantitativas del Rendimiento. En el componente dos, la mayor variación es el de Componente de Precocidad. Los componentes tres al seis, explican en proporciones muy similares las otras variables, siendo en el seis donde se encuentra con mayor valor la fotosíntesis. El análisis de regresión lineal múltiple fue significativo (p<0,057 que, por las condiciones del estudio, se considera adecuado. El rendimiento en t/ha, se explica por una ecuación lineal múltiple (r2=0,99 de 10 variables
Development and validation of a mathematical model for growth of pathogens in cut melons.
Li, Di; Friedrich, Loretta M; Danyluk, Michelle D; Harris, Linda J; Schaffner, Donald W
2013-06-01
Many outbreaks of foodborne illness associated with the consumption of fresh-cut melons have been reported. The objective of our research was to develop a mathematical model that predicts the growth rate of Salmonella on fresh-cut cantaloupe over a range of storage temperatures and to validate that model by using Salmonella and Escherichia coli O157:H7 on cantaloupe, honeydew, and watermelon, using both new data and data from the published studies. The growth of Salmonella on honeydew and watermelon and E. coli O157:H7 on cantaloupe, honeydew, and watermelon was monitored at temperatures of 4 to 25°C. The Ratkowsky (or square-root model) was used to describe Salmonella growth on cantaloupe as a function of storage temperature. Our results show that the levels of Salmonella on fresh-cut cantaloupe with an initial load of 3 log CFU/g can reach over 7 log CFU/g at 25°C within 24 h. No growth was observed at 4°C. A linear correlation was observed between the square root of Salmonella growth rate and temperature, such that √growth rate = 0.026 × (T - 5.613), R(2) = 0.9779. The model was generally suitable for predicting the growth of both Salmonella and E. coli O157:H7 on cantaloupe, honeydew, and watermelon, for both new data and data from the published literature. When compared with existing models for growth of Salmonella, the new model predicts a theoretic minimum growth temperature similar to the ComBase Predictive Models and Pathogen Modeling Program models but lower than other food-specific models. The ComBase Prediction Models results are very similar to the model developed in this study. Our research confirms that Salmonella can grow quickly and reach high concentrations when cut cantaloupe is stored at ambient temperatures, without visual signs of spoilage. Our model provides a fast and cost-effective method to estimate the effects of storage temperature on fresh-cut melon safety and could also be used in subsequent quantitative microbial risk
Mass rearing of the melon fly in Okinawa, Japan - Special reference to quality control
International Nuclear Information System (INIS)
Yamagishii, Masaaki; Kakinohana, Hiroyuki
2000-01-01
The melon fly, Bactrocera cucurbitae (Coquillett), had been completely eradicated from Okinawa, Japan in 1993 (Yamagishi et al. 1993, Kakinohana 1994, Kuba et al. 1996). Following the expansion of target areas during the eradication campaign, the number of flies produced was increased from 5 million to 280 million per week. In the process of the eradication project, the mass reared strains had been replaced three times with new strains. The aim of this paper is to show the changes in various traits of the third strain that were regularly monitored in the factory. First, unintentional and intentional artificial selections to which the strain was exposed are mentioned. Second, the changes in the monitored traits are shown, and finally, the relation between selection and the response to selection is discussed
INFLUENCIA DE LA DENSIDAD DE SIEMBRA Y LA PODA EN EL CULTIVO DEL PEPINO (Cucumis sativus
Directory of Open Access Journals (Sweden)
Paublo Javier Bravo Bravo
2011-12-01
Full Text Available El objetivo de la investigación fue determinar la influencia de la densidad de siembra y el número de poda de ejes en el cultivo de pepino (Cucumis sativus. Se estudiaron tres distancias de siembra 1.0x0.2, 1.0x0.4 y 1.0x 0.6 m y la poda de ejes productivos dejando 1, 2 y 3 ejes por planta. La poda se realizó a los 30 días después del trasplante. Se evaluaron las características del fruto de diámetro (cm, longitud (cm, peso (g, fruto por planta y rendimiento por hectárea. Los tratamientos se distribuyeron en un diseño de bloques al azar y los datos se analizaron mediante análisis de varianza. Se obtuvo diferencias para la variable rendimiento/hectárea con respecto al resto de las variables evaluadas.
Antidiabetic effects of Momordica charantia (bitter melon) and its medicinal potency
Joseph, Baby; Jini, D
2013-01-01
Diabetes mellitus is among the most common disorder in developed and developing countries, and the disease is increasing rapidly in most parts of the world. It has been estimated that up to one-third of patients with diabetes mellitus use some form of complementary and alternative medicine. One plant that has received the most attention for its anti-diabetic properties is bitter melon, Momordica charantia (M. charantia), commonly referred to as bitter gourd, karela and balsam pear. Its fruit is also used for the treatment of diabetes and related conditions amongst the indigenous populations of Asia, South America, India and East Africa. Abundant pre-clinical studies have documented in the anti-diabetic and hypoglycaemic effects of M. charantia through various postulated mechanisms. However, clinical trial data with human subjects are limited and flawed by poor study design and low statistical power. The present review is an attempt to highlight the antidiabetic activity as well as phytochemical and pharmacological reports on M. charantia and calls for better-designed clinical trials to further elucidate its possible therapeutic effects on diabetes.
Antidiabetic effects of Momordica charantia (bitter melon and its medicinal potency
Directory of Open Access Journals (Sweden)
Baby Joseph
2013-04-01
Full Text Available Diabetes mellitus is among the most common disorder in developed and developing countries, and the disease is increasing rapidly in most parts of the world. It has been estimated that up to one-third of patients with diabetes mellitus use some form of complementary and alternative medicine. One plant that has received the most attention for its anti-diabetic properties is bitter melon, Momordica charantia (M. charantia, commonly referred to as bitter gourd, karela and balsam pear. Its fruit is also used for the treatment of diabetes and related conditions amongst the indigenous populations of Asia, South America, India and East Africa. Abundant pre-clinical studies have documented in the anti-diabetic and hypoglycaemic effects of M. charantia through various postulated mechanisms. However, clinical trial data with human subjects are limited and flawed by poor study design and low statistical power. The present review is an attempt to highlight the antidiabetic activity as well as phytochemical and pharmacological reports on M. charantia and calls for better-designed clinical trials to further elucidate its possible therapeutic effects on diabetes.
International Nuclear Information System (INIS)
Halitligil, M.B.; Akin, A.I.; Kislal, H.; Ozturk, A.; Deviren, A.
2002-01-01
A number of experiments were conducted to investigate the influence of different N rates applied through drip irrigation on the growth and N uptake by tomato, pepper, cucumber, melon and eggplant under greenhouse conditions. It was found that, for tomato, the % NUE was significantly increased by applying the N fertilizer through fertigation (53.9%) as compared to the soil application (34.0%) at 100 mg N/L. In general, any further increase of N fertilizer did not have an improving effect on the tomato yield. With pepper, the % NUE was significantly increased by applying the N fertilizer in the irrigation water (49.2%) as compared to the soil application (33.9%) at the same N level (140 mg N/L), being the optimum N rate under our greenhouse conditions. At a fertilization level of 100 mg N/L with fertigation, the % NUE was significantly increased as compared to the soil application. With respectively cucumber, melon and eggplant; the % NUE with fertigation was 63.4, 21.4 and 50.8%, while with soil application it was 34,0 11.0 and 18.8%. (author)
Energy Technology Data Exchange (ETDEWEB)
Callejon-Ferre, A.J.; Lopez-Martinez, J.A.; Manzano-Agugliaro, F. [Departamento de Ingenieria Rural, Universidad de Almeria, Ctra. Sacramento s/n, La Canada de San Urbano, 04120 Almeria (Spain); Velazquez-Marti, B. [Departamento de Ingenieria Rural y Agroalimentaria, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)
2011-02-15
Almeria, in southeastern Spain, generates some 1,086,261 t year{sup -1} (fresh weight) of greenhouse crop (Cucurbita pepo L., Cucumis sativus L., Solanum melongena L., Solanum lycopersicum L., Phaseoulus vulgaris L., Capsicum annuum L., Citrillus vulgaris Schrad. and Cucumis melo L.) residues. The energy potential of this biomass is unclear. The aim of the present work was to accurately quantify this variable, differentiating between crop species while taking into consideration the area they each occupy. This, however, required the direct analysis of the higher heating value (HHV) of these residues, involving very expensive and therefore not commonly available equipment. Thus, a further aim was to develop models for predicting the HHV of these residues, taking into account variables measured by elemental and/or proximate analysis, thus providing an economically attractive alternative to direct analysis. All the analyses in this work involved the use of worldwide-recognised standards and methods. The total energy potential for these plant residues, as determined by direct analysis, was 1,003,497.49 MW h year{sup -1}. Twenty univariate and multivariate equations were developed to predict the HHV. The R{sup 2} and adjusted R{sup 2} values obtained for the univariate and multivariate models were 0.909 and 0.946 or above respectively. In all cases, the mean absolute percentage error varied between 0.344 and 2.533. These results show that any of these 20 equations could be used to accurately predict the HHV of crop residues. The residues produced by the Almeria greenhouse industry would appear to be an interesting source of renewable energy. (author)
International Nuclear Information System (INIS)
Tanahara, A.; Kirihara, S.; Kakinohana, H.
1994-01-01
To evaluate the effect of chilling on mass-reared melon fly, Bactrocera cucurbitae COQ., groups of adult flies were exposed to 3, 0.5, -2.2 and -3.5°C for 6, 12, 24 and 48h. The recovery and longevity of adult chilled for less than 24h at about 0.5°C was not adversely affected. A special container for chilled flies, which was able to keep the temperature below 10°C for 4h, was designed for their long-distance transport. The longevities of flies using aerial distribution by helicopter and hand release on the ground using the chilled transport container were compared with direct release from an emergence box without chilling at Miyagi Island in Okinawa Prefecture. There were no significant differences in longevity between the three release methods
International Nuclear Information System (INIS)
McCombs, S.D.; Saul, S.H.
1992-01-01
Two new mutants that affect adult wing morphology and render the flies incapable of flight.sbd.bubble wing (bw) in the melon fly, Bactrocera cucurbitae (Coquillett), and small wing (sw) in the oriental fruit fly, Bactrocera dorsalis (Hendel).sbd.are described. Both mutants have variable expression and are caused by autosomal, recessive genes. We discuss the possible role of these alleles in constructing genetic sex sorting systems to improve the effectiveness and efficiency of the sterile insect release method
Directory of Open Access Journals (Sweden)
RENATA TIEKO NASSU
2001-12-01
Full Text Available Fresh and combined methods processed Cantaloupe melons, mangoes and cashew apples were submitted to consumers' acceptance and scored on a nine-point hedonic scale. Fruits were osmotically treated in sucrose syrup with two different concentrations of SO2. Overall acceptance, appearance, aroma, flavor and texture were evaluated. Fresh cashew apples received lower scores for acceptance than processed cashew apples while fresh mangoes were more acceptable than processed mangoes. Acceptance of fresh melons and processed melons was similar. Treatments of the tropical fruits with two different concentrations of SO2 did not demonstrate significant differences between the fruits tested.Melões 'Cantaloupe', mangas e pedúnculos de caju in natura e processados por métodos combinados foram submetidos a testes de aceitação, utilizando-se de escala hedônica de nove pontos. As frutas sofreram tratamento osmótico em um xarope de sacarose com duas diferentes concentrações de SO2. Foram avaliados aceitação global, aparência, aroma, sabor e textura. Pedúnculos de caju in natura obtiveram notas menores para aceitação se comparados aos processados, enquanto mangas in natura foram mais aceitas do que as processadas. A aceitação de melões in natura e processados foi similar. Tratamentos com diferentes concentrações de SO2 não apresentaram diferenças significativas entre os frutos estudados.
Identification of innovative potential quality markers in rocket and melon fresh-cut produce.
Cavaiuolo, Marina; Cocetta, Giacomo; Bulgari, Roberta; Spinardi, Anna; Ferrante, Antonio
2015-12-01
Ready-to-eat fresh cut produce are exposed to pre- and postharvest abiotic stresses during the production chain. Our work aimed to identify stress responsive genes as new molecular markers of quality that can be widely applied to leaves and fruits and easily determined at any stage of the production chain. Stress responsive genes associated with quality losses were isolated in rocket and melon fresh-cut produce and their expression levels analyzed by quantitative real time PCR (qRT-PCR) at different time points after harvest at 20 °C and 4 °C. qRT-PCR results were supported by correlation analysis with physiological and biochemical determinations evaluated at the same conditions such as chlorophyll a fluorescence indices, total, reducing sugars, sucrose, ethylene, ascorbic acid, lipid peroxidation and reactive oxygen species. In both species the putative molecular markers increased their expression soon after harvest suggesting a possible use as novel and objective quality markers of fresh-cut produces. Copyright © 2015 Elsevier Ltd. All rights reserved.
Renormalizable group field theory beyond melonic diagrams: An example in rank four
Carrozza, Sylvain; Lahoche, Vincent; Oriti, Daniele
2017-09-01
We prove the renormalizability of a gauge-invariant, four-dimensional group field theory (GFT) model on SU(2), whose defining interactions correspond to necklace bubbles (found also in the context of new large-N expansions of tensor models), rather than melonic ones, which are not renormalizable in this case. The respective scaling of different interactions in the vicinity of the Gaussian fixed point is determined by the renormalization group itself. This is possible because the appropriate notion of canonical dimension of the GFT coupling constants takes into account the detailed combinatorial structure of the individual interaction terms. This is one more instance of the peculiarity (and greater mathematical richness) of GFTs with respect to ordinary local quantum field theories. We also explore the renormalization group flow of the model at the nonperturbative level, using functional renormalization group methods, and identify a nontrivial fixed point in various truncations. This model is expected to have a similar structure of divergences as the GFT models of 4D quantum gravity, thus paving the way to more detailed investigations on them.
Directory of Open Access Journals (Sweden)
Jorge Corbacho
Full Text Available Mature-fruit abscission (MFA in fleshy-fruit is a genetically controlled process with mechanisms that, contrary to immature-fruit abscission, has not been fully characterized. Here, we use pyrosequencing to characterize the transcriptomes of melon abscission zone (AZ at three stages during AZ-cell separation in order to understand MFA control at an early stage of AZ-activation.The results show that by early induction of MFA, the melon AZ exhibits major gene induction, while by late induction of MFA, melon AZ shows major gene repression. Although some genes displayed similar regulation in both early and late induction of abscission, such as EXT1-EXT4, EGase1, IAA2, ERF1, AP2D15, FLC, MADS2, ERAF17, SAP5 and SCL13 genes, the majority had different expression patterns. This implies that time-specific events occur during MFA, and emphasizes the value of characterizing multiple time-specific abscission transcriptomes. Analysis of gene-expression from these AZs reveal that a sequential induction of cell-wall-degrading genes is associated with the upregulation of genes involved in endo and exocytosis, and a shift in plant-hormone metabolism and signaling genes during MFA. This is accompanied by transcriptional activity of small-GTPases and synthaxins together with tubulins, dynamins, V-type ATPases and kinesin-like proteins potentially involved in MFA signaling. Early events are potentially controlled by down-regulation of MADS-box, AP2/ERF and Aux/IAA transcription-factors, and up-regulation of homeobox, zinc finger, bZIP, and WRKY transcription-factors, while late events may be controlled by up-regulation of MYB transcription-factors.Overall, the data provide a comprehensive view on MFA in fleshy-fruit, identifying candidate genes and pathways associated with early induction of MFA. Our comprehensive gene-expression profile will be very useful for elucidating gene regulatory networks of the MFA in fleshy-fruit.
Directory of Open Access Journals (Sweden)
Camila Abrahão
2009-12-01
Full Text Available A busca pela longevidade e a procura por alimentos mais saudáveis fizeram com que os consumidores se tornassem cada vez mais exigentes. Diante disso, procurou-se estabelecer o comportamento de compra dos consumidores de melão no Mercado Municipal de Piracicaba (SP através do método de Desdobramento da Função Qualidade (QFD e, com base nas respostas obtidas nos questionários aplicados, traçou-se o perfil dos consumidores, destacando-se suas preferências, costumes, reclamações e exigências. Verificou-se que é a mulher que realiza as compras do melão, com preferência pelo consumo na forma in natura. Encontrou-se insatisfação de 42,8% dos entrevistados quanto à qualidade do melão, sendo o sabor aguado a principal causa de descontentamento. Logo, a qualidade do melão não correspondia àquela indicada pelos consumidores (casca sem defeitos, coloração amarela característica da variedade, textura firme, suculento, de preço acessível, garantia de qualidade e gosto doce. Diante da insatisfação dos consumidores e considerando-se que o melão é consumido preferencialmente in natura, deve-se atentar para a preservação da sua aparência e qualidade sensorial. A opinião dos consumidores deve ser considerada na tentativa de identificar os pontos que devem ser melhorados dentro da cadeia de comercialização a fim de minimizar as perdas e promover a melhoria e a manutenção da qualidade do produto final.The search for longevity and the demand for healthy food have made consumers more conscious. A study was carried out to evaluate the purchasing habits of melon consumers in the Municipal Market of Piracicaba (São Paulo State, Brazil by the Quality Function Development (QFD Method. With the answers to the questionnaire, it was possible to determine the consumers' preferences, habits, complaints, and demands. It was verified that women are the consumers and that melons are consumed raw. 42.8% of the interviewees complained about
Hadjilouka, Agni; Polychronopoulou, Melissanthi; Paramithiotis, Spiros; Tzamalis, Periklis; Drosinos, Eleftherios H.
2015-01-01
The aim of the present study was to examine the effect of lemongrass essential oil vapors on the dynamics of surface microbiota and L. monocytogenes growth on rocket and melon under different packaging conditions and storage temperature. For that purpose, rocket and melon were placed on Expanded Polystyrene (EPS) trays, sprayed with L. monocytogenes to a population of 4.5–5.0 log CFU·g−1, packaged using microperforated Oriented Polypropylene (OPP) film in either air or Microperforated Active Modified Atmosphere (MAMA) (initial atmosphere 5% O2, 10% CO2) including a Whatman paper containing the essential oil, without contact with the product, and stored at 0, 5, 10, and 15 °C. Application of lemongrass exhibited a bactericidal effect on enterococci and a fungistatic effect on yeast-mould populations but only during air storage of rocket. The former took place at all temperatures and the latter only at 10 and 15 °C. No effect on shelf life of both products was recorded. However, an important effect on the sensorial properties was observed; during the first 4–5 days of storage both products were organoleptically unacceptable. Regarding MAMA packaging, it affected only Pseudomonas spp. population resulting in a reduction of 1–2 log CFU·g−1 in both products. PMID:27682104
Directory of Open Access Journals (Sweden)
T. Moghbeli
2015-03-01
Full Text Available Seed pretreated with plant growth regulators can improve germination parameters, growth, and yield of crops. Thus, in two greenhouse and field experiments, effects of seed treatment with 0.1 mM salicylic acid (SA, 1µM methyl jasmonate (MJ, 1.5% humic acid (HA, and water (as Control on germination parameters, seedling growth, and also growth and fruit yield were studied. In the first experiment which was conducted on two cultivars (Semsuri and Shahpasandi, all the treatments improved most of parameters the recorded, and the response of two cultivars was rather similar for most parameters. In the second experiment which was conducted on one cultivar (Shahpasandi in the field, all the treatments improved most of parameters the recorded. Compared with the control, SA, MJ and HA increased total plant fresh weight (19, 41 and 19%, fruit number (30, 35 and 20% and fruit yield (31, 45 and 31, respectively. Significant correlations were found between fruit yield and relative water content (r = -0.95*, ion leakage (r = -0.93*, final plant shoot fresh weight (r = 0.99** and fruit number (r = 0.93*, indicating that treatments could increase fruit yield by improving ion leakage and relative water content.
Directory of Open Access Journals (Sweden)
Feher Domonkos
2011-06-01
Full Text Available Abstract Background The rising epidemic of obesity is associated with cognitive decline and is considered as one of the major risk factors for neurodegenerative diseases. Neuroinflammation is a critical component in the progression of several neurological and neurodegenerative diseases. Increased metabolic flux to the brain during overnutrition and obesity can orchestrate stress response, blood-brain barrier (BBB disruption, recruitment of inflammatory immune cells from peripheral blood and microglial cells activation leading to neuroinflammation. The lack of an effective treatment for obesity-associated brain dysfunction may have far-reaching public health ramifications, urgently necessitating the identification of appropriate preventive and therapeutic strategies. The objective of our study was to investigate the neuroprotective effects of Momordica charantia (bitter melon on high-fat diet (HFD-associated BBB disruption, stress and neuroinflammatory cytokines. Methods C57BL/6 female mice were fed HFD with and without bitter melon (BM for 16 weeks. BBB disruption was analyzed using Evans blue dye. Phosphate-buffered saline (PBS perfused brains were analyzed for neuroinflammatory markers such as interleukin-22 (IL-22, IL-17R, IL-16, NF-κB1, and glial cells activation markers such as Iba1, CD11b, GFAP and S100β. Additionally, antioxidant enzymes, ER-stress proteins, and stress-resistant transcription factors, sirtuin 1 (Sirt1 and forkhead box class O transcription factor (FoxO were analyzed using microarray, quantitative real-time RT-PCR, western immunoblotting and enzymatic assays. Systemic inflammation was analyzed using cytokine antibody array. Results BM ameliorated HFD-associated changes in BBB permeability as evident by reduced leakage of Evans blue dye. HFD-induced glial cells activation and expression of neuroinflammatory markers such as NF-κB1, IL-16, IL-22 as well as IL-17R were normalized in the brains of mice supplemented with BM
Directory of Open Access Journals (Sweden)
Glauber Henrique de S. Nunes
2004-12-01
Full Text Available Dois experimentos foram realizados com o objetivo de avaliar o desempenho produtivo e qualitativo de híbridos de melão no agropolo Mossoró-Assu. Em ambos os experimentos foi utilizado o delineamento em blocos casualizados com quatro repetições. O primeiro experimento foi constituído de seis híbridos de melão Gália e dois do tipo Cantaloupe, e o segundo foi composto de sete híbridos de melão Amarelo, um Pele de sapo e três Orange Flesh. Avaliaram-se a produtividade, peso médio do fruto, cavidade interna, espessura da polpa, aparências externa e interna, perda de peso, teor de sólidos solúveis e firmeza da polpa. Considerando as variáveis utilizadas na avaliação, constatou-se variação entre os híbridos nos dois experimentos. Entre os melões Gália, destacaram-se os híbridos DRG 1531 e DRG 1537. Os melões Red Flesh e AFX 700 foram os mais promissores entre os melões do tipo Orange Flesh. Por fim, entre os melões do tipo Valenciano, destacaram-se os híbridos Gold Mine, Gold Pride e Gold Star.Two experiments were carried out with the objective of evaluating the quality and yield performance of hybrids of melon in agropolo Mossoró-Assu, Brazil. In both experiments a randomized complete blocks design with four replications was used. In the first experiment six Galia and two Cantaloupe hybrids were used and in the second experiment seven Yellow hybrids, one Piel del Sapo and three Orange Flesh hybrids were evaluated. Evaluations of productivity, average fruit weight, internal cavity, pulp thickness, external and internal appearance, weight loss, total soluble solids and pulp firmness were made. Variation among the hybrids in both experiments for the assessed characteristics were observed. Among Gália melons, the hybrids DRG 1531 and DRG 1537 were the most promising while among Orange Flesh melons, the Red Flesh and AFX 700 hybrids were the best. Among Yellow melons, the hybrids Gold Mine, Gold Pride and Gold Star were the
International Nuclear Information System (INIS)
Hammach, M.
2010-01-01
Crops under greenhouses offer the possibility of vegetables production of high added value by focusing on earliness. They help to spread the availability timing of vegetables and fruits in the market throughout the year. However, these crops are subject to numerous attacks entailing heavy losses of yield quantity and quality. The plant parasitic nematodes especially rot-knot nematodes of the genus Meloidogyne are considered dangerous enemies of these cultures. The evolution study of these nematodes in different soil types allows one to compare the migration and movement of these nematodes in sandy soils considered as light soils, in clay soils heavy and intermediate silty clay soils. These soils have also rates of organic matter and a percentage of magnesium and calcium that might provide better conditions to the survival and migration of second stage larvae inoculated at a rate of 650 juveniles per pot of 24 cm in diameter where plants of melon Cucumis melo var. (Charentais) known to be susceptible to Meloidogyne was cultivated. The results for the population development of Meloidogyne, after a growing period of 3 months show an increase in the number of eggs, juvenile stages, inflated, swollen females and males in the 3 types of soil and that independently of clay fraction although clay soil may asphyxiate Meloidogyne. The development of the three species of Meloidogyne studied in these soils, the parameters taken into consideration (index of galls, which were 1.58, 1.75 and 1.5 for the sandy clay and the middle ground soils, vigour index and the evolution of populations of Meloidogyne and roots and soil as well as parameters related to production reveal the adaptation of these root-knot nematodes to the clay and sandy loam soils. At the end of culture, the final populations are important in the soils studied; 2680 for soil S. (sandy), 2272 for soil A (clay) and 2327 for soil I (intermediate) with a multiplication rate almost similar ( 4.12, 3.49 and 3
Energy Technology Data Exchange (ETDEWEB)
Endo, Tetsuya [Faculty of Pharmaceutical Sciences, Health Sciences University of Hokkaido, 1757 Ishikari-Tobetsu, Hokkaido 061-0293 (Japan)], E-mail: endotty@hoku-iryo-u.ac.jp; Hisamichi, Yohsuke; Kimura, Osamu [Faculty of Pharmaceutical Sciences, Health Sciences University of Hokkaido, 1757 Ishikari-Tobetsu, Hokkaido 061-0293 (Japan); Haraguchi, Koichi [Daiichi College of Pharmaceutical Sciences, 22-1 Tamagawa-Cho, Minami-Ku, Fukuoka 815-8511 (Japan); Baker, C. Scott [Marine Mammal Institute and Department of Fisheries and Wildlife, Oregon State University, Newport, Oregon 97365 (United States)
2008-08-15
Total mercury (T-Hg), methyl mercury (M-Hg), cadmium (Cd), selenium (Se), zinc (Zn) and copper (Cu) concentrations in the organs of melon-headed whales from a mass stranding on the Japanese coast were analyzed. The mean concentration of T-Hg in the liver (126 {+-} 97 {mu}g/wet g, n = 13) was markedly higher than those in kidney (6.34 {+-} 2.36 {mu}g/wet g, n = 12) and muscle (4.90 {+-} 2.33 {mu}g/wet g, n = 15). In contrast, the mean concentration of M-Hg in the liver (9.08 {+-} 2.24 {mu}g/wet g) was similar to those in the kidney (3.47 {+-} 0.91 {mu}g/wet g) and muscle (3.78 {+-} 1.53 {mu}g/wet g). The mean percentage of M-Hg in the T-Hg found in the liver (13.1 {+-} 10.3) was significantly lower than those in the kidney (58.3 {+-} 15.0) and muscle (78.9 {+-} 8.4). The molar ratio of T-Hg to Se in the liver was effectively 1.0, but those in the kidney and muscle were markedly lower. Conversely, the mean concentration of Cd was markedly higher in the kidney (24.4 {+-} 7.4 {mu}g/wet g) than in the liver (7.24 {+-} 2.08 {mu}g/wet g) and muscle (less than 0.05 {mu}g/wet g). These results suggest that the formation of Hg-Se compounds mainly occurs in the liver after the demethylation of M-Hg, and Cd preferentially accumulates in the kidney of melon-headed whales.
Hao, J H; Dong, C J; Zhang, Z G; Wang, X L; Shang, Q M
2012-05-01
To investigate the response of cucumber seedlings to exogenous salicylic acid (SA) and gain a better understanding of SA action mechanism, we generated a proteomic profile of cucumber (Cucumis sativus L.) cotyledons treated with exogenous SA. Analysis of 1500 protein spots from each gel revealed 63 differentially expressed proteins, 59 of which were identified successfully. Of the identified proteins, 97% matched cucumber proteins using a whole cucumber protein database based on the newly completed genome established by our laboratory. The identified proteins were involved in various cellular responses and metabolic processes, including antioxidative reactions, cell defense, photosynthesis, carbohydrate metabolism, respiration and energy homeostasis, protein folding and biosynthesis. The two largest functional categories included proteins involved in antioxidative reactions (23.7%) and photosynthesis (18.6%). Furthermore, the SA-responsive protein interaction network revealed 13 key proteins, suggesting that the expression changes of these proteins could be critical for SA-induced resistance. An analysis of these changes suggested that SA-induced resistance and seedling growth might be regulated in part through pathways involving antioxidative reactions and photosynthesis. © 2012 Elsevier Ireland Ltd. All rights reserved.
Rojas, E Saalau; Dixon, P M; Batzer, J C; Gleason, M L
2013-09-01
The causal agent of cucurbit bacterial wilt, Erwinia tracheiphila, has a wide host range in the family Cucurbitaceae, including economically important crops such as muskmelon (Cucumis melo), cucumber (C. sativus), and squash (Cucurbita spp.). Genetic variability of 69 E. tracheiphila strains was investigated by repetitive-element polymerase chain reaction (rep-PCR) using BOXA1R and ERIC1-2 primers. Fingerprint profiles revealed significant variability associated with crop host; strains isolated from Cucumis spp. were clearly distinguishable from Cucurbita spp.-isolated strains regardless of geographic origin. Twelve E. tracheiphila strains isolated from muskmelon, cucumber, or summer squash were inoculated onto muskmelon and summer squash seedlings, followed by incubation in a growth chamber. Wilt symptoms were assessed over 3 weeks, strains were reisolated, and rep-PCR profiles were compared with the inoculated strains. Wilting occurred significantly faster when seedlings were inoculated with strains that originated from the same crop host genus (P<0.001). In the first run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon seedlings at a median of 7.8 and 5.6 days after inoculation (dai), respectively. Summer squash seedlings wilted 18.0, 15.7, and 5.7 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. In a second run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon at 7.0 and 6.9 dai, respectively, whereas summer squash seedlings wilted at 23.6, 29.0 and 9.0 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. Our results provide the first evidence of genetic diversity within E. tracheiphila and suggest that strain specificity is associated with plant host. This advance is a first step toward understanding the genetic and population structure of E. tracheiphila.
Uptake and/or utilization of two simple phenolic acids by Cucumis sativus
International Nuclear Information System (INIS)
Shann, J.R.
1986-01-01
The uptake of ferulic acid (FA) and p-hydroxybenzoic acid (p-HBA) from solutions (0.1 to 1.00 mM, pH 4.0 to 7.0), was determined for intact and excised roots of Cucumis sativus. Uptake methods based on high performance liquid chromatographic (HPLC) analysis of phenolic acid depletion from solution were compared to those radioisotopic methods employing [U-ring- 14 C]FA or p-HBA. Although radiotracer methods more accurately reflected actual uptake of the compounds by cucumber seedlings, HPLC solution depletion methods may be useful in the elucidation of trends over very limited periods of time. The uptake of FA was unaffected by the presence of p-HBA. The uptake of p-HBA was reduced by 30% in the presence of FA when compared to the uptake from solutions containing p-HBA alone. Ferulic acid acts both as an allelopathic agent and precursor in the endogenous process of lignification. To evaluate the involvement of exogenous FA in lignin biosynthesis, roots of hydroponically grown cucumber seedlings were exposed to concentrations of FA labeled with [U-ring- 14 C]FA. Radiotracer was distributed throughout the seedling. A quantitative change in lignification occurred in treated seedlings. In roots and stems, the level of lignin increased with the number of exposures and as the concentrations of exogenous FA increased. Radiotracer was found in the residues of lignin isolated from seedling tissue treated with [U-ring- 14 C]FA. This suggested the utilization of the exogenously applied FA in the endogenous process of lignification
Directory of Open Access Journals (Sweden)
Agni Hadjilouka
2015-09-01
Full Text Available The aim of the present study was to examine the effect of lemongrass essential oil vapors on the dynamics of surface microbiota and L. monocytogenes growth on rocket and melon under different packaging conditions and storage temperature. For that purpose, rocket and melon were placed on Expanded Polystyrene (EPS trays, sprayed with L. monocytogenes to a population of 4.5–5.0 log CFU·g−1, packaged using microperforated Oriented Polypropylene (OPP film in either air or Microperforated Active Modified Atmosphere (MAMA (initial atmosphere 5% O2, 10% CO2 including a Whatman paper containing the essential oil, without contact with the product, and stored at 0, 5, 10, and 15 °C. Application of lemongrass exhibited a bactericidal effect on enterococci and a fungistatic effect on yeast-mould populations but only during air storage of rocket. The former took place at all temperatures and the latter only at 10 and 15 °C. No effect on shelf life of both products was recorded. However, an important effect on the sensorial properties was observed; during the first 4–5 days of storage both products were organoleptically unacceptable. Regarding MAMA packaging, it affected only Pseudomonas spp. population resulting in a reduction of 1–2 log CFU·g−1 in both products.
International Nuclear Information System (INIS)
Endo, Tetsuya; Hisamichi, Yohsuke; Kimura, Osamu; Haraguchi, Koichi; Baker, C. Scott
2008-01-01
Total mercury (T-Hg), methyl mercury (M-Hg), cadmium (Cd), selenium (Se), zinc (Zn) and copper (Cu) concentrations in the organs of melon-headed whales from a mass stranding on the Japanese coast were analyzed. The mean concentration of T-Hg in the liver (126 ± 97 μg/wet g, n = 13) was markedly higher than those in kidney (6.34 ± 2.36 μg/wet g, n = 12) and muscle (4.90 ± 2.33 μg/wet g, n = 15). In contrast, the mean concentration of M-Hg in the liver (9.08 ± 2.24 μg/wet g) was similar to those in the kidney (3.47 ± 0.91 μg/wet g) and muscle (3.78 ± 1.53 μg/wet g). The mean percentage of M-Hg in the T-Hg found in the liver (13.1 ± 10.3) was significantly lower than those in the kidney (58.3 ± 15.0) and muscle (78.9 ± 8.4). The molar ratio of T-Hg to Se in the liver was effectively 1.0, but those in the kidney and muscle were markedly lower. Conversely, the mean concentration of Cd was markedly higher in the kidney (24.4 ± 7.4 μg/wet g) than in the liver (7.24 ± 2.08 μg/wet g) and muscle (less than 0.05 μg/wet g). These results suggest that the formation of Hg-Se compounds mainly occurs in the liver after the demethylation of M-Hg, and Cd preferentially accumulates in the kidney of melon-headed whales
Cheikhyoussef, Natascha; Kandawa-Schulz, Martha; Böck, Ronnie; de Koning, Charles; Cheikhyoussef, Ahmad; Hussein, Ahmed A
2017-10-01
The physicochemical characteristics, fatty acid, tocopherol, stigmasterol, β-sitosterol, and 1 H NMR profiles of Citrullus lanatus and Acanthosicyos horridus melon seed oils were determined and compared among different extraction methods (cold pressing, traditional, and Soxhlet). The oil content was 40.2 ± 3.45 and 37.8 ± 7.26% for C. lanatus and A. horridus , respectively. Significant differences ( p yield, physicochemical characteristics, tocopherol, and fatty acid composition have the potential to replace or improve major commercial vegetable oils and to be used for various applications in the food industry and nutritive medicines.
International Nuclear Information System (INIS)
Tian, Hongmei; Ma, Leyuan; Zhao, Cong; Hao, Hui; Gong, Biao; Yu, Xiyan; Wang, Xiufeng
2010-01-01
To unravel the roles of sucrose phosphate synthase (SPS) in muskmelon (Cucumis melo L.), we reduced its activity in transgenic muskmelon plants by an antisense approach. For this purpose, an 830 bp cDNA fragment of muskmelon sucrose phosphate synthase was expressed in antisense orientation behind the 35S promoter of the cauliflower mosaic virus. The phenotype of the antisense plants clearly differed from that of control plants. The transgenic plant leaves were markedly smaller, and the plant height and stem diameter were obviously shorter and thinner. Transmission electron microscope observation revealed that the membrane degradation of chloroplast happened in transgenic leaves and the numbers of grana and grana lamella in the chloroplast were significantly less, suggesting that the slow growth and weaker phenotype of transgenic plants may be due to the damage of the chloroplast ultrastructure, which in turn results in the decrease of the net photosynthetic rate. The sucrose concentration and levels of sucrose phosphate synthase decreased in transgenic mature fruit, and the fruit size was smaller than the control fruit. Together, our results suggest that sucrose phosphate synthase may play an important role in regulating the muskmelon plant growth and fruit development.
Udayanga, Dhanushka; Castlebury, Lisa A; Rossman, Amy Y; Chukeatirote, Ekachai; Hyde, Kevin D
2015-05-01
Phytopathogenic species of Diaporthe are associated with a number of soybean diseases including seed decay, pod and stem blight and stem canker and lead to considerable crop production losses worldwide. Accurate morphological identification of the species that cause these diseases has been difficult. In this study, we determined the phylogenetic relationships and species boundaries of Diaporthe longicolla, Diaporthe phaseolorum, Diaporthe sojae and closely related taxa. Species boundaries for this complex were determined based on combined phylogenetic analysis of five gene regions: partial sequences of calmodulin (CAL), beta-tubulin (TUB), histone-3 (HIS), translation elongation factor 1-α (EF1-α), and the nuclear ribosomal internal transcribed spacers (ITS). Phylogenetic analyses revealed that this large complex of taxa is comprised of soybean pathogens as well as species associated with herbaceous field crops and weeds. Diaporthe arctii, Diaporthe batatas, D. phaseolorum and D. sojae are epitypified. The seed decay pathogen D. longicolla was determined to be distinct from D. sojae. D. phaseolorum, originally associated with stem and leaf blight of Lima bean, was not found to be associated with soybean. A new species, Diaporthe ueckerae on Cucumis melo, is introduced with description and illustrations. Published by Elsevier Ltd.
Shofian, Norshahida Mohamad; Hamid, Azizah Abdul; Osman, Azizah; Saari, Nazamid; Anwar, Farooq; Dek, Mohd Sabri Pak; Hairuddin, Muhammad Redzuan
2011-01-01
The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L.), mango (Mangifera indica L.), papaya (Carica papaya L.), muskmelon (Cucumis melo L.), and watermelon Citruluss lanatus (Thunb.) were investigated. Significant (p 0.05) change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p < 0.05) higher levels were detected in the fresh samples. The results of DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging and reducing power assays revealed that fresh samples of starfruit and mango had relatively higher antioxidant activity. In case of linoleic acid peroxidation inhibition measurement, a significant (p < 0.05) but random variation was recorded between the fresh and freeze-dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested. PMID:21845104
Effects of 20 Selected Fruits on Ethanol Metabolism: Potential Health Benefits and Harmful Impacts.
Zhang, Yu-Jie; Wang, Fang; Zhou, Yue; Li, Ya; Zhou, Tong; Zheng, Jie; Zhang, Jiao-Jiao; Li, Sha; Xu, Dong-Ping; Li, Hua-Bin
2016-04-01
The consumption of alcohol is often accompanied by other foods, such as fruits and vegetables. This study is aimed to investigate the effects of 20 selected fruits on ethanol metabolism to find out their potential health benefits and harmful impacts. The effects of the fruits on ethanol metabolism were characterized by the concentrations of ethanol and acetaldehyde in blood, as well as activities of alcohol dehydrogenase and acetaldehyde dehydrogenase in liver of mice. Furthermore, potential health benefits and harmful impacts of the fruits were evaluated by biochemical parameters including aspartate transaminase (AST), alanine transferase (ALT), malondialdehyde, and superoxide dismutase. Generally, effects of these fruits on ethanol metabolism were very different. Some fruits (such as Citrus limon (yellow), Averrhoa carambola, Pyrus spp., and Syzygium samarangense) could decrease the concentration of ethanol in blood. In addition, several fruits (such as Cucumis melo) showed hepatoprotective effects by significantly decreasing AST or ALT level in blood, while some fruits (such as Averrhoa carambola) showed adverse effects. The results suggested that the consumption of alcohol should not be accompanied by some fruits, and several fruits could be developed as functional foods for the prevention and treatment of hangover and alcohol use disorder.
Energy Technology Data Exchange (ETDEWEB)
Tian, Hongmei; Ma, Leyuan; Zhao, Cong; Hao, Hui; Gong, Biao [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China); Yu, Xiyan, E-mail: yuxiyan@sdau.edu.cn [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China); Wang, Xiufeng, E-mail: xfwang@sdau.edu.cn [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China)
2010-03-12
To unravel the roles of sucrose phosphate synthase (SPS) in muskmelon (Cucumis melo L.), we reduced its activity in transgenic muskmelon plants by an antisense approach. For this purpose, an 830 bp cDNA fragment of muskmelon sucrose phosphate synthase was expressed in antisense orientation behind the 35S promoter of the cauliflower mosaic virus. The phenotype of the antisense plants clearly differed from that of control plants. The transgenic plant leaves were markedly smaller, and the plant height and stem diameter were obviously shorter and thinner. Transmission electron microscope observation revealed that the membrane degradation of chloroplast happened in transgenic leaves and the numbers of grana and grana lamella in the chloroplast were significantly less, suggesting that the slow growth and weaker phenotype of transgenic plants may be due to the damage of the chloroplast ultrastructure, which in turn results in the decrease of the net photosynthetic rate. The sucrose concentration and levels of sucrose phosphate synthase decreased in transgenic mature fruit, and the fruit size was smaller than the control fruit. Together, our results suggest that sucrose phosphate synthase may play an important role in regulating the muskmelon plant growth and fruit development.
International Nuclear Information System (INIS)
Nakamori, Hiroaki
1987-01-01
The duration and distance of flight and the flight velocity of the melon fly, Dacus cucurbitae Coquillett, were investigated by using a flight mill system. Mean flight duration of the normal female flies was significantly longer than that of the sterile ones which were irradiated with a dose of 7, 20, 30 KR γ-ray. No significant differences were recognized between normal and sterile male flies irradiated with 7 KR. No adverse effect of irradiation on the flight velocity was detected. Flight distance was the longest for the unirradiated flies and it decreased with the increase of the irradiation doses, but the difference among normal and sterile flies irradiated with either 7 or 20 KR was not statistically significant. Generally, the flight ability decreased with the increase of the irradiation doses. (author)
Rossi, Marika; Vallino, Marta; Abbà, Simona; Ciuffo, Marina; Balestrini, Raffaella; Genre, Andrea; Turina, Massimo
2015-01-01
The N-terminal region of the Ourmia melon virus (OuMV) coat protein (CP) contains a short lysine/arginine-rich (KR) region. By alanine scanning mutagenesis, we showed that the KR region influences pathogenicity and virulence of OuMV without altering viral particle assembly. A mutant, called OuMV6710, with three basic residue substitutions in the KR region, was impaired in the ability to maintain the initial systemic infection in Nicotiana benthamiana and to infect both cucumber and melon plants systemically. The integrity of this protein region was also crucial for encapsidation of viral genomic RNA; in fact, certain mutations within the KR region partially compromised the RNA encapsidation efficiency of the CP. In Arabidopsis thaliana Col-0, OuMV6710 was impaired in particle accumulation; however, this phenotype was abolished in dcl2/dcl4 and dcl2/dcl3/dcl4 Arabidopsis mutants defective for antiviral silencing. Moreover, in contrast to CPwt, in situ immunolocalization experiments indicated that CP6710 accumulates efficiently in the spongy mesophyll tissue of infected N. benthamiana and A. thaliana leaves but only occasionally infects palisade tissues. These results provided strong evidence of a crucial role for OuMV CP during viral infection and highlighted the relevance of the KR region in determining tissue tropism, host range, pathogenicity, and RNA affinity, which may be all correlated with a possible CP silencing-suppression activity.
Sánchez, M.V.; Agüero, R.; Rivera, C.
2001-01-01
Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera) en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma ápter...
Bai, Juan; Zhu, Ying; Dong, Ying
2016-12-24
Bitter melon (Momordica charantia L.) is rich in a variety of biologically active ingredients, and has been widely used in traditional Chinese medicine (TCM) to treat various diseases, including type 2 diabetes and obesity. We aimed to investigate how bitter melon powder (BMP) could affect obesity-associated inflammatory responses to ameliorate high-fat diet (HFD)-induced insulin resistance, and investigated whether its anti-inflammatory properties were effected by modulating the gut microbiota. Obese SD rats (Sprague-Dawley rats, rattus norregicus) were randomly divided into four groups: (a) normal control diet (NCD) and distilled water, (b) HFD and distilled water, (c) HFD and 300mg BMP/kg body weight (bw), (d) HFD and 10mg pioglitazone (PGT)/kg bw. We observed remarkable decreases in the fasting glucose, fasting insulin, HOMA-IR index, serum lipid levels, and cell sizes of epididymal adipose tissues in the BMP and PGT groups after 8 weeks. BMP could significantly improve the proinflammatory cytokine tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6), anti-inflammatory cytokine interleukin-10 (IL-10), and local endotoxin levels compared to the HFD group (p<0.05). BMP suppressed the activation of nuclear factor-κB (NF-κB) by inhibiting inhibitor of NF-κB alpha (IκBα) degradation and phosphorylation of c-Jun N-terminal kinase/ p38 mitogen-activated protein kinases (JNK/p38 MAPKs) in adipose tissue. Sequencing results illustrated that BMP treatment markedly decreased the proportion of the endotoxin-producing opportunistic pathogens and increased butyrate producers. These results demonstrate that BMP ameliorates insulin sensitivity partly via relieving the inflammatory status in the system and in white adipose tissues of obese rats, and is associated with a proportional regulation of specific gut microbiota. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Lehmkuhl, Mílard Zhaf Alves
2012-01-01
O presente trabalho apresenta uma visão da obra “Fundamentos da Política Jurídica” de Osvaldo Ferreira de Melo a partir dos elementos de Percepção Jurídica, fato – valor – norma, colhidos da obra “Teoria Tridimensional do Direito” de Miguel Reale. O artigo se inicia com uma breve apresentação da obra “Fundamentos da Política Jurídica” e sobre os elementos de percepção jurídica da “Teoria Tridimensional do Direito”. Partindo dessa contextualização e dessa tridimensionalidade como ferramenta de...
Landi, Marco; Remorini, Damiano; Pardossi, Alberto; Guidi, Lucia
2013-11-01
This study aimed to evaluate the behavior of zucchini (Cucurbita pepo L.) and cucumber (Cucumis sativus L.) under boron (B) excess. Plants were grown under greenhouse conditions in a sandy soil-peat mixture using a nutrient solution containing 0.2 (control), 10 and 20 mg L(-1) B. Visible symptoms were quantified and leaf B accumulation, gas exchanges, chlorophyll (Chl) a fluorescence, malondialdehyde by-products and antioxidants were investigated 20 days after the beginning of the treatments. Boron toxicity induced oxidative load and leaf necrotic burns coupled with the reduction of leaf growth and biomass accumulation in both species. Boron excess resulted in a decrease of Chl a/b ratio, potential (Fv/Fm) and actual (ΦPSII) PSII quantum efficiency, photosynthetic rate (Pn), stomatal conductance (gs), and transpiration (E) as well. A general stimulation of the antioxidant enzymes ascorbate peroxidase, catalase and superoxide dismutase was observed, and a significant increase in the oxidized form of ascorbate and glutathione was evidenced for treated plants of both species. A difference between the two species was observed: C. pepo appeared to be more sensitive to B stress being damaged at all B concentration. C. sativus grown at 10 mg L(-1) B in nutrient solution showed some down-regulated mechanisms, i.e. increase in Chl b content and a good photochemical PSII efficiency as well as a higher amount of constitutive antioxidant molecules, that, however, are not sufficient to contrast the negative effects of B.
International Nuclear Information System (INIS)
Nakamori, H.; Shiga, M.; Kinjo, K.
1993-01-01
The spatio-temporal dynamics of populations of the melon fly, Bactrocera (Dacus) cucurbitae COQUILLETT, in the southern part of Okinawa Island where an eradication program using sterile flies has been conducted, were analyzed in relation to the seasonal succession and abundance of wild and cultivated host fruits. The study areas were classified into four major zones according to the seasonal abundance of flies caught by cue-lure traps and the availability of host fruits including Diplocyclos palmatus, Melothria liukiuensis and Momordica charantia var. pevel. Zone-I is characterized by the continuous presence of host fruits and a relatively-high population density of the melon fly indicated by the cue-lure trap catch of more than 1, 000 flies per 1, 000 traps per day throughout the year. Zone-II has a characteristic decline in both number of host fruits and fly density during the fall-winter period with an annual average of less than 1, 000 flies per 1, 000 traps per day. Zone-III includes areas where host fruits and flies (about 1 fly/trap/day) were relatively abundant only during the winter-spring period. Zone-IV is characterized by constantly low availability of host fruits and low fly density throughout the year. Hot spots, which are defined as areas where the ratio of sterile to wild flies hardly increases despite frequent and intensive release of sterile flies, were found in the Zone-I areas. Therefore, the continuous presence and abundance of host fruits appears to hot spots. For effective control of this species, it is essential to locate such areas and release sterile flies
PORSUK NEHRİ SUYUNUN CUCUMIS SATIVUS (L. TOHUMLARININ FİDE GELİŞİMİ ÜZERİNE ETKİLERİNİN BELİRLENMESİ
Directory of Open Access Journals (Sweden)
Mehmet ÇALISEKİ
2016-03-01
Full Text Available Porsuk Çayı 448 km uzunluğu ile Sakarya Irmağı’nın en uzun koludur ve Bayatçık Deresi ile Kızıltaş Suyu’nun birleşmesi ile oluşur. Kütahya Ovası’ndan geçip Eskişehir’in güneybatısında yer alan Porsuk-I ve Porsuk-II barajlarında toplandıktan sonra Eskişehir Ovası’ndan ve Eskişehir ilinden geçer ve Sakarya Irmağı’na ulaşır. Porsuk Çayı, Eskişehir’de tarım arazilerinin sulama suyu olarak kullanılmaktadır. Tüm İç Anadolu’da olduğu gibi Eskişehir’de de tarımı yapılan en yaygın bahçe bitkileri arasında Cucumis sativus (L. yer almaktadır. İnsan beslenmesinde ilk bakışta önemli gibi görünmese de Cucumis sativus; vitaminler, enzimler, mineral maddeler bakımından zengin bir bitkidir. Fakat protein, karbonhidrat ve yağ bakımından fakirdir. Bu çalışmada, tohumların çimlendirilmesinde şehir şebeke suyu ve farklı oranlarda seyreltilmiş, şehir içinde ve şehir dışında belirlenen istasyonlardan alınan Porsuk nehrine ait su örnekleri kullanılmıştır. Fidelerin kök-gövde uzunlukları, kök ve gövdeye ait yaş ve kuru ağırlıklar ölçülerek şebeke suyu ve Porsuk nehrine ait suyun fide gelişimi üzerine etkileri araştırılmıştır. Elde edilen verilere göre, kök uzunluğunun nehir suyunun seyreltme oranı ile doğru orantıda arttığı ve su içeriğinin seyreltme oranı arttıkça azaldığı tespit edilmiştir
Directory of Open Access Journals (Sweden)
LÚCIA H.P. KIILL
2014-12-01
Full Text Available The study was carried out to verify if there are differences in foraging frequency and behavior of Apis mellifera in two melon hybrids (10:00 – ‘Yellow melon’ and Sancho -‘Piel de Sapo’ in the municipality of Juazeiro, state of Bahia, Brazil. The frequency, behavior of visitors and the floral resource foraged were registered from 5:00 am to 6:00 pm. There was a significant difference in the frequency of visits when comparing hydrids (F = 103.74, p <0.0001, floral type (F = 47.25, p <0.0001 and resource foraged (F = 239.14, p <0.0001. The flowers of Sancho were more attractive to A. mellifera when compared with hybrid 10:00, which may be correlated to the morphology and floral resources available. This could be solved with scaled planting, avoiding the overlapping of flowering of both types.
Qian, Chunlu; Ren, Nannan; Wang, Jingye; Xu, Qiang; Chen, Xuehao; Qi, Xiaohua
2018-03-15
In protected vegetable fields, plant growth regulators are often used to improve cucumber fruit growth. However, the effects of plant growth regulators on the appearance and nutritional quality of cucumber (Cucumis sativus L.) remain largely unknown. In the present study, 100 mg/L N-(2-chloro-4-pyridyl)-N'-phenylurea (CPPU), naphthaleneacetic acid (NAA) or gibberellin A4+A7 (GA 4+7 ) was applied to the female cucumber flowers 1 day before anthesis and at anthesis. The CPPU, NAA and GA 4+7 treatments resulted in parthenocarpic fruits with similar weights, sizes and shapes as the pollinated fruits. NAA treatment did not affect the appearance and nutritional characteristics of cucumber at harvest and after storage. CPPU treatment increased the flesh firmness at harvest but decreased phenolic acid and vitamin C contents after storage. GA 4+7 treatment decreased the flesh firmness but increased total flavonoids and protein content after storage. Copyright © 2017 Elsevier Ltd. All rights reserved.
Identification of the aggregation pheromone of the melon thrips, Thrips palmi.
Akella, Sudhakar V S; Kirk, William D J; Lu, Yao-bin; Murai, Tamotsu; Walters, Keith F A; Hamilton, James G C
2014-01-01
The objective of this study was to identify the aggregation pheromone of the melon thrips Thrips palmi, a major pest of vegetable and ornamental plants around the world. The species causes damage both through feeding activities and as a vector of tospoviruses, and is a threat to world trade and European horticulture. Improved methods of detecting and controlling this species are needed and the identification of an aggregation pheromone will contribute to this requirement. Bioassays with a Y-tube olfactometer showed that virgin female T. palmi were attracted to the odour of live males, but not to that of live females, and that mixed-age adults of both sexes were attracted to the odour of live males, indicating the presence of a male-produced aggregation pheromone. Examination of the headspace volatiles of adult male T. palmi revealed only one compound that was not found in adult females. It was identified by comparison of its mass spectrum and chromatographic details with those of similar compounds. This compound had a structure like that of the previously identified male-produced aggregation pheromone of the western flower thrips Frankliniella occidentalis. The compound was synthesised and tested in eggplant crops infested with T. palmi in Japan. Significantly greater numbers of both males and females were attracted to traps baited with the putative aggregation pheromone compared to unbaited traps. The aggregation pheromone of T. palmi is thus identified as (R)-lavandulyl 3-methyl-3-butenoate by spectroscopic, chromatographic and behavioural analysis.
Directory of Open Access Journals (Sweden)
Francisco de Queiroz Porto Filho
2006-04-01
Full Text Available Com o objetivo de estudar os efeitos da aplicação de águas de irrigação de diferentes salinidades no rendimento do melão irrigado por gotejamento e de associar a produção obtida com o custo da água utilizada, desenvolveu-se este trabalho em Mossoró-RN. Águas de diferentes salinidades (S1=0,6, S2=1,9, S3=3,2 e S4=4,5dS m-1, utilizadas de forma incremental em três estádios de desenvolvimento ou sem variar durante o ciclo da cultura, formaram dez tratamentos arranjados em blocos inteiramente casualizados com quatro repetições. O uso de águas salinas por longos períodos afetou a produção de melão. Substituições tardias na salinidade da água tenderam a não exercer efeito significativo sobre a produção do meloeiro. O tratamento irrigado com a água de menor salinidade durante todo ciclo apresentou, simultaneamente, o maior custo com água de irrigação e o maior lucro na produção de melão.This study was carried out in Mossoró, RN, Brazil, to evaluate the effects of different irrigation water salinity levels on yield of drip irrigated melon, and to relate yield with the cost of water. The waters of different salinities (S1=0.6, S2=1.9, S3=3.2 e S4=4.5dS m-1 were used both in incremental way in three different phenological stages and without replacement during the crop cycle totalizing ten treatments arranged in a completely randomized block design with four repetitions. The use of saline waters without substitutions affected melon production. The treatments irrigated with low salinity water presented simultaneously the higher cost of irrigation water and higher profits of melon cultivation.
Directory of Open Access Journals (Sweden)
Rogério Lopes Vieites
2012-04-01
Full Text Available The aim of this work was to evaluate the quality of yellow melon inodorus Valenciano Amarelo (CAC fresh cut submitted to two cut types and with application postharvest of calcium chloride. After preparation cubes and slices melon were immersed in solution with different calcium chloride (CaCl2 concentrations for two minutes, afterwards they were conditioned in trays of expanded polystyrene (EPS, covered by plastic film of low density polyethylene (PEBD, stored in cold camera to 5°C ±1 and analyzed for 8 days. They were evaluated pH, firmness, tritable acidity (AT, soluble solids (SS sugar reducer and ratio. The pH values varied from 5.27 to 5.68. The sugars reducers content and the ratio were superior in the slices compared to the cubes. The melon slices maintained larger firmness values compared to the cubes and in general there was reduction in the values of this parameter along the storage period for all treatments. Concentrations of 1.0 and 1.5% of CaCl2, result in larger values of firmness. The storage temperature and modified passive atmosphere they contributed to quality maintenance of MP melon. Concentrations of up to 1.0% of CaCl2 they could be recommended to maintain the melon quality MP melon yellow inodorus (CAC.Objetivou-se neste trabalho avaliar a qualidade de melão amarelo inodorus (cultivar Valenciano Amarelo CAC minimamente processado (MP submetido a dois tipos de corte e com aplicação pós-colheita de cloreto de cálcio. Após preparo cubos e fatias de melão foram imersos em solução com diferentes concentrações de cloreto de cálcio (CaCl2 por dois minutos, sendo em seguida acondicionados em bandejas de poliestireno expandido (EPS, revestidas por filme plástico de polietileno de baixa densidade (PEBD, armazenados em câmara fria a 5°C ±1 e analisadas durante 8 dias. Foram avaliados pH, firmeza, acidez titulável (AT, sólidos solúveis (SS, açúcar redutor e ratio. Os valores de pH variaram de 5,27 a 5,68. O teor
Silicon improves salt tolerance by increasing root water uptake in Cucumis sativus L.
Zhu, Yong-Xing; Xu, Xuan-Bin; Hu, Yan-Hong; Han, Wei-Hua; Yin, Jun-Liang; Li, Huan-Li; Gong, Hai-Jun
2015-09-01
Silicon enhances root water uptake in salt-stressed cucumber plants through up-regulating aquaporin gene expression. Osmotic adjustment is a genotype-dependent mechanism for silicon-enhanced water uptake in plants. Silicon can alleviate salt stress in plants. However, the mechanism is still not fully understood, and the possible role of silicon in alleviating salt-induced osmotic stress and the underlying mechanism still remain to be investigated. In this study, the effects of silicon (0.3 mM) on Na accumulation, water uptake, and transport were investigated in two cucumber (Cucumis sativus L.) cultivars ('JinYou 1' and 'JinChun 5') under salt stress (75 mM NaCl). Salt stress inhibited the plant growth and photosynthesis and decreased leaf transpiration and water content, while added silicon ameliorated these negative effects. Silicon addition only slightly decreased the shoot Na levels per dry weight in 'JinYou 1' but not in 'JinChun 5' after 10 days of stress. Silicon addition reduced stress-induced decreases in root hydraulic conductivity and/or leaf-specific conductivity. Expressions of main plasma membrane aquaporin genes in roots were increased by added silicon, and the involvement of aquaporins in water uptake was supported by application of aquaporin inhibitor and restorative. Besides, silicon application decreased the root xylem osmotic potential and increased root soluble sugar levels in 'JinYou 1.' Our results suggest that silicon can improve salt tolerance of cucumber plants through enhancing root water uptake, and silicon-mediated up-regulation of aquaporin gene expression may in part contribute to the increase in water uptake. In addition, osmotic adjustment may be a genotype-dependent mechanism for silicon-enhanced water uptake in plants.
Antidiabetic Activity and Chemical Composition of Sanbai Melon Seed Oil
Li, Haili; Zhao, Hang; Zhang, Ya; Qiu, Pengcheng; Li, Jie
2018-01-01
Objectives Many fruits and herbs had been used in Traditional Chinese Medicines for treating diabetes mellitus (DM); however, scientific and accurate evidences regarding their efficacy and possible mechanisms were largely unknown. Sanbai melon seed oil (SMSO) was used in folk medicine in treating DM, but there is no literature about these effects. The present study was aimed at confirming the treatment effects of SMSO in type 1 DM. Methods Diabetes was induced by single intraperitoneal injection of streptozotocin (STZ) at a dose of 65 mg/kg body weight. After diabetes induction, mice were treated with SMSO at dose of 1 g/kg, 2 g/kg, and 4 g/kg. Drugs were given by gavage administration once a day continuously for 28 days. At the end of treatment, several biochemical parameters and molecular mechanisms were determined by biochemical assays, ELISA, and Western blotting. The chemical compositions of SMSO were also tested. Results SMSO treatment significantly improved the symptoms of weight loss, polydipsia, reduced FBG level, increased plasma insulin levels, reduced plasma lipids levels, and protected islet injury. The results also showed that SMSO mitigated oxidative stress and alleviated the liver and renal injury in diabetes mice. SMSO also protected islet cells from apoptotic damage by suppressing ER mediated and mitochondrial dependent apoptotic pathways. Further constituent analysis results showed that SMSO had rich natural resources which had beneficial effects on DM. Conclusions This study showed that SMSO had excellent antidiabetes effect and provided scientific basis for the use of SMSO as the functional ingredients production and dietary supplements production in the food and pharmaceutical industries. PMID:29853958
Directory of Open Access Journals (Sweden)
Celeste Trejo-Moreno
2018-02-01
Full Text Available Inflammation and oxidative stress play major roles in endothelial dysfunction, and are key factors in the progression of cardiovascular diseases. The aim of this study was to evaluate in vitro the effect of three subfractions (SFs from the Cucumis sativus aqueous fraction to reduce inflammatory factors and oxidative stress induced by angiotensin II (Ang II in human microvascular endothelial cells-1 (HMEC-1 cells. The cells were cultured with different concentrations of Ang II and 0.08 or 10 μg/mL of SF1, SF2, or SF3, or 10 μmol of losartan as a control. IL-6 (Interleukin 6 concentration was quantified. To identify the most effective SF combinations, HMEC-1 cells were cultured as described above in the presence of four combinations of SF1 and SF3. Then, the effects of the most effective combination on the expression of adhesion molecules, the production of reactive oxygen species (ROS, and the bioavailability of nitric oxide (NO were evaluated. Finally, a mass spectrometry analysis was performed. Both SF1 and SF3 subfractions decreased the induction of IL-6 by Ang II, and C4 (SF1 and SF3, 10 μg/mL each was the most effective combination to inhibit the production of IL-6. Additionally, C4 prevented the expression of adhesion molecules, reduced the production of ROS, and increased the bioavailability of NO. Glycine, arginine, asparagine, lysine, and aspartic acid were the main components of both subfractions. These results demonstrate that C4 has anti-inflammatory and antioxidant effects.
Optimising the use of plastic protective covers in field grown melon on a farm scale
Directory of Open Access Journals (Sweden)
Paolo Benincasa
2014-01-01
Full Text Available This in-farm research study was aimed at evaluating new strategies in the use of plastic protective covers in field grown melon in order to expand the production period and reduce costs. Four experiments were set up in 2010 and repeated in 2011 in Central Italy, in an inland region with a temperate climate. We evaluated: i the use of high tunnels for two growing cycles per year, i.e. for very early and very late production (target transplanting in late winter and mid-summer, respectively, for either one year or two consecutive years, and the use of grafted plants in the second year as an alternative to normal plants to prevent soil born diseases; ii the use of ethylene-vinyl-acetate film low tunnels alone or combined with non-woven floating row covers for transplanting in early spring; iii the use of non-woven low tunnels for transplanting in mid-spring; iv the use of biodegradable and conventional polyethylene ground mulch films, both in the presence of nonwoven low tunnels. As far as the non-woven cover is concerned, we adopted the strategy of removing later with respect to usual practices, i.e. ten days after the onset of first pistillate flowers. This was based on the evidence that covers hamper honeybee circulation, which may be exploited on a farm-scale to delay pollination until an adequate number of pistillate flowers set, in order to shorten scaled fruit ripening and harvest. Our results demonstrate that high tunnels may be used for at least four consecutive melon growing cycles (early and late productions for two years with good off-season yields and no appreciable drawbacks in terms of disease scale-up, irrespective of the use of normal or grafted plants. The non-woven low tunnel was effective in hampering honeybee circulation and its delayed removal allowed the harvest period to be halved, a more uniform fruit size to be obtained, and labour productivity of harvest to be increased. This had positive implications on the management of
Directory of Open Access Journals (Sweden)
A. Dauda
2017-02-01
Full Text Available An appropriate tillage method is necessary to create an optimum seed bed condition for optimum crop growth and yield. Two-year field experiment was conducted in 2013 and 2014 to investigate the effects of different tillage methods on the physical properties of sandy loam soil, growth and yield of water melon (Citrullus vulgaris in a semi-arid environment. The Tillage treatments were disc ploughing plus disc harrowing (DP+DH, double disc ploughing (DDP, double disc harrowing (DDH, disc ploughing (DP and disc harrowing (DH as minimum tillage (MT and zero tillage (ZT and direct drilling method (control. The watermelon seeds were Planted manually placing three (3 seeds per hole at an interval of 1.5m along the rows and 50cm between the rows at an average depth of 5cm. The treatments were laid in a randomized complete block design (RCBD with four replications. Results showed that disc ploughing + disc harrowing (DP+DH was found to be more appropriate and profitable tillage method in improving soil physical properties and growth and yield of water melon in a sandy loam soil. Watermelon yield, fruit weight (FW, fruit length (FL, fruit diameter (FD and leaf area index (LAI were significantly influenced (P=0.05, but influence of tillage treatments were not significant on the number of fruit per plant (NFPP. A numerical value of 31.0t/ha, 26.0, 5.4kg, 29.0cm, and 33.8cm were recorded for maximum crop yield, NFPP, FW, FD and FL respectively in DP+DH-treated plots. For zero tillage (ZT treatment, maximum of crop yield and NFPP were 26.5t/ha and 20.0 respectively. Thus for enhanced growth and yield of watermelon, DP/DH would be more preferable. The orthodox method of zero tillage is out rightly discouraged
Han, Yan-Hong; Xiang, Hai-Ying; Wang, Qian; Li, Yuan-Yuan; Wu, Wen-Qi; Han, Cheng-Gui; Li, Da-Wei; Yu, Jia-Lin
2010-10-10
Melon aphid-borne yellows virus (MABYV) is a newly identified polerovirus occurring in China. Here, we demonstrate that the MABYV encoded P0 (P0(MA)) protein is a strong suppressor of post-transcriptional gene silencing (PTGS) with activity comparable to tobacco etch virus (TEV) HC-Pro. In addition we have shown that the LP F-box motif present at the N-terminus of P0(MA) is required for suppressor activity. Detailed mutational analyses on P0(MA) revealed that changing the conserved Trp 212 with non-ring structured amino acids altered silencing suppressor functions. Ala substitutions at positions 12 and 211 for Phe had no effect on P0 suppression-activity, whereas Arg and Glu substitutions had greatly decreased suppressor activity. Furthermore, substitutions targeting Phe at position 30 also resulted in reduced P0 suppression-activity. Altogether, these results suggest that ring structured Trp/Phe residues in P0 have important roles in suppressor activity. Copyright © 2010 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Muhammad Redzuan Hairuddin
2011-07-01
Full Text Available The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L., mango (Mangifera indica L., papaya (Carica papaya L., muskmelon (Cucumis melo L., and watermelon Citruluss lanatus (Thunb. were investigated. Significant (p < 0.05 differences, for the amounts of total phenolic compounds (TPC, were found between the fresh and freeze-dried fruit samples, except muskmelon. There was no significant (p > 0.05 change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p < 0.05 higher levels were detected in the fresh samples. The results of DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging and reducing power assays revealed that fresh samples of starfruit and mango had relatively higher antioxidant activity. In case of linoleic acid peroxidation inhibition measurement, a significant (p < 0.05 but random variation was recorded between the fresh and freeze-dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested.
Identification of the aggregation pheromone of the melon thrips, Thrips palmi.
Directory of Open Access Journals (Sweden)
Sudhakar V S Akella
Full Text Available The objective of this study was to identify the aggregation pheromone of the melon thrips Thrips palmi, a major pest of vegetable and ornamental plants around the world. The species causes damage both through feeding activities and as a vector of tospoviruses, and is a threat to world trade and European horticulture. Improved methods of detecting and controlling this species are needed and the identification of an aggregation pheromone will contribute to this requirement. Bioassays with a Y-tube olfactometer showed that virgin female T. palmi were attracted to the odour of live males, but not to that of live females, and that mixed-age adults of both sexes were attracted to the odour of live males, indicating the presence of a male-produced aggregation pheromone. Examination of the headspace volatiles of adult male T. palmi revealed only one compound that was not found in adult females. It was identified by comparison of its mass spectrum and chromatographic details with those of similar compounds. This compound had a structure like that of the previously identified male-produced aggregation pheromone of the western flower thrips Frankliniella occidentalis. The compound was synthesised and tested in eggplant crops infested with T. palmi in Japan. Significantly greater numbers of both males and females were attracted to traps baited with the putative aggregation pheromone compared to unbaited traps. The aggregation pheromone of T. palmi is thus identified as (R-lavandulyl 3-methyl-3-butenoate by spectroscopic, chromatographic and behavioural analysis.
International Nuclear Information System (INIS)
Buzano Barrantes, Pedro
2002-01-01
This research realized a study in the melon cultivation of cantaloupe kind with the objective to evaluate the utilization of metam sodium joint with the clomazone and sulfentrazone weed-killers like substitutes of methyl bromide in the experimental station of Melons de Costa Rica located in Carrillo, Guanacaste, during the season of 1998-1999. The treatments were: metam sodium (148 g.i.a./ha) + sulfentrazone (60 g.i.a./ha), metam sodium (148 g.i.a./ha) + sulfentrazone (100 g.i.a./ha), metam sodium (148 g.i.a./ha) + clomazone (240 g.i.a./ha), metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha), sulfentrazone (60 g.i.a.), sulfentrazone (100 g.i.a.), clomazone (240 g.i.a./ha), clomazone (480 g.i.a./ha), metam sodium (148 g.i.a./ha), methyl bromide (250 kg./ha) and an absolute control. The experimental design was unconditional at random with eleven treatments and three repetitions by treatments with four beds of 35m x 0.8m by repetition. The results showed that the best treatments were: metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha), with a 13.3% less of weeds control than the methyl bromide (250 kg/ha) and the treatment with metam sodium (148 g.i.a./ha) with a 19.2% less of weeds control than the methyl bromide (250 Kg/ha). The 5,9% of difference among them is by the clomazone's action (480 g.i.a./ha). The treatment with methyl bromide (250 Kg./ha) was the highest in output, 2286 total boxes by hectare, followed by the treatments with metam sodium (148 g.i.a./ha) + sulfentrazone (100 g.i.a./ha) with 1906 and metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha) that produced 1912.33 boxes of melon by hectare. (Author) [es
Boron toxicity is alleviated by hydrogen sulfide in cucumber (Cucumis sativus L.) seedlings.
Wang, Bao-Lan; Shi, Lei; Li, Yin-Xing; Zhang, Wen-Hao
2010-05-01
Boron (B) is an essential micronutrient for plants, which when occurs in excess in the growth medium, becomes toxic to plants. Rapid inhibition of root elongation is one of the most distinct symptoms of B toxicity. Hydrogen sulfide (H(2)S) is emerging as a potential messenger molecule involved in modulation of physiological processes in plants. In the present study, we investigated the role of H(2)S in B toxicity in cucumber (Cucumis sativus) seedlings. Root elongation was significantly inhibited by exposure of cucumber seedlings to solutions containing 5 mM B. The inhibitory effect of B on root elongation was substantially alleviated by treatment with H(2)S donor sodium hydrosulfide (NaHS). There was an increase in the activity of pectin methylesterase (PME) and up-regulated expression of genes encoding PME (CsPME) and expansin (CsExp) on exposure to high B concentration. The increase in PME activity and up-regulation of expression of CsPME and CsExp induced by high B concentration were markedly reduced in the presence of H(2)S donor. There was a rapid increase in soluble B concentrations in roots on exposure to high concentration B solutions. Treatment with H(2)S donor led to a transient reduction in soluble B concentration in roots such that no differences in soluble B concentrations in roots in the absence and presence of NaHS were found after 8 h exposure to the high concentration B solutions. These findings suggest that increases in activities of PME and expansin may underlie the inhibition of root elongation by toxic B, and that H(2)S plays an ameliorative role in protection of plants from B toxicity by counteracting B-induced up-regulation of cell wall-associated proteins of PME and expansins.
Resistance to Cucurbit aphid-borne yellows virus in Melon Accession TGR-1551.
Kassem, Mona A; Gosalvez, Blanca; Garzo, Elisa; Fereres, Alberto; Gómez-Guillamón, Maria Luisa; Aranda, Miguel A
2015-10-01
The genetic control of resistance to Cucurbit aphid-borne yellows virus (CABYV; genus Polerovirus, family Luteoviridae) in the TGR-1551 melon accession was studied through agroinoculation of a genetic family obtained from the cross between this accession and the susceptible Spanish cultivar 'Bola de Oro'. Segregation analyses were consistent with the hypothesis that one dominant gene and at least two more modifier genes confer resistance; one of these additional genes is likely present in the susceptible parent 'Bola de Oro'. Local and systemic accumulation of the virus was analyzed in a time course experiment, showing that TGR-1551 resistance was expressed systemically as a significant reduction of virus accumulation compared with susceptible controls, but not locally in agroinoculated cotyledons. In aphid transmission experiments, CABYV inoculation by aphids was significantly reduced in TGR-1551 plants, although the virus was acquired at a similar rate from TGR-1551 as from susceptible plants. Results of feeding behavior studies using the DC electrical penetration graph technique suggested that viruliferous aphids can salivate and feed from the phloem of TGR-1551 plants and that the observed reduction in virus transmission efficiency is not related to reduced salivation by Aphis gossypii in phloem sieve elements. Since the virus is able to accumulate to normal levels in agroinoculated tissues, our results suggest that resistance of TGR-1551 plants to CABYV is related to impairment of virus movement or translocation after it reaches the phloem sieve elements.
Directory of Open Access Journals (Sweden)
Elís Regina Costa de Morais
2010-04-01
Full Text Available Objetivou-se com este trabalho, avaliar índices de crescimento e fisiológicos do meloeiro em função dos graus-dia acumulados e determinar a relação dos índices fisiológicos com a produtividade da cultura em coberto com filme plástico nas cores preto, prateado, amarelo e marrom, e do solo descoberto como testemunha. O experimento foi desenvolvido na Fazenda Santa Júlia Agrocomercial Exportadora de Frutos Tropicais Ltda., Mossoró, Estado do Rio Grande do Norte (agosto-outubro de 2003, em Latossolo Vermelho eutrófico Argissólico, utilizando-se o melão Torreon em blocos casualizados comquatro repetições. A taxa de crescimento absoluta e a taxa de crescimento relativa para o número de folhas e índice de área foliar foram influenciadas pela cobertura do solo e decresceram com o desenvolvimento da planta, e ainda que a maior produtividade de frutoscomercializáveis foi registrada nas coberturas do solo com plástico.The objective of this work was to evaluate the growth and physiological indexes of the melon crop in function of accumulated degree-days and to determine the relationship between the physiological index and yield of the crop in soil covered with plastic film in the colors black, silver, yellow, and brown, and of the uncovered soil as witness. The experiment was conducted at Fazenda Santa Júlia Agrocomercial Exportadora de Frutos Tropicais Ltda, Mossoró, Rio Grande do Norte State (August-October 2003 in Oxissol, using the Torreon melon in a randomized experimental blocks design with four replications. The relative growth rate for the number of leaves and leaf area index were influenced by soil cover and decreased with the development of the plant; the highestproductivity of marketable fruits was registered on plastic soil coverage.
Influence of hot water dip and gamma irradiation on postharvest fungal decay of Galia melons
International Nuclear Information System (INIS)
Barkai-Golan, R.; Padova, R.; Ross, I.; Lapidot, M.; Copel, A.; Davidson, H.
1993-01-01
Dipping Galia melons in hot water at 52 deg C for 5 min or at 55 deg for 2 min resulted in 12-15% decay (caused by Alternaria alternata, Fusarium spp. and Trichothecium roseum) during prolonged storage (12 d at 6 deg plus 3 d at 18 deg ) compared with 75% decay in untreated fruit or 60% decay in cold-water-dipped fruit. Irradiation at 0.5 or 1 kGy had no significant effect on decay development. However, combination of heat treatment with a 0.5 kGy dose prevented fungal growth, resulting in 5% decay during storage. Combinations of heating with 1 kGy irradiation gave no improvement in anti-fungal effect over treatment with 0.5 kGy and sometimes resulted in a decreased suppressive effect. Reducing the duration of dipping at 55 deg from 2 to 0.5 min, applied alone or in combination with irradiation, considerably reduced the anti-fungal effect of the treatment. The effective combined treatment resulted in 12-15% of slight peel damage, but all the fruits were regarded as marketable. No differences in fruit firmness were recorded among the treatments
MENTIMUN(Cucumis Sativus L DI DESA TIRTA MULYA KECAMATAN MAKARTI JAYA KABUPATEN BANYUASIN II
Directory of Open Access Journals (Sweden)
Irham Falahudin
2015-08-01
Full Text Available Cucumber plants (Cucumis sativus L. that includes or creeping vines and is one type of vegetable-fruit of the gourd family labuan (Cucurbitaceae that has been popular throughout the world and favored from Asia. Cucumber cultivation in Indonesia, found almost in every region, ranging from lowland to highland hot climate (tropical and moderate. One animal that has an abundant amount in cucumber plants are insects. This study aims to know the different types of species that exist on the Order Coleoptera cucumber farm in the village of Tirta Mulya District of makarti Jaya Banyuasin II and determine the role of the Order Coleoptera insects on cucumber plantations in the village of Tirta Mulya District of makarti Jaya Banyuasin II. This is a qualitative study conducted in October-November 2014 held in Cucumber Plants in the village of Tirta Mulya District of makarti Jaya Banyuasin II. Catching insects done using transect method and pitfall traps such as sweeping the net, pit fall traps and light traps, results in identification in the laboratory penelitanya UIN Raden Fatah Palembang. The results of this study indicate that insects are caught in a cucumber plantation obtained as many as 113 individual 3 families and 7 species. Insects which dominates in the village of Tirta Mulya District of makarti Jaya Banyuasin II is Cocinella repanda, Curinus coeruleus, Coelophora inaequalis, and Aulacophora similis, and insects that have the fewest number is Micraspis discolor, Micraspis vincta and Oryctes rhinoceros. The role of the Order Coleoptera Insects in general predators of the family Coccinellidae to eradicate mites while the family Chrysomelidae Scarabacidae and are pests that attack on cucumber plants that can cause death.