49 CFR 27.9 - Assurance required.

Science.gov (United States)

2010-10-01

... OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 27.9 Assurance required. (a) General... requirements of this part for so long as the property is used for the purpose for which the Federal financial assistance was provided or for a similar purpose. (2) When Federal financial assistance is used by a...

26 CFR 1.279-1 - General rule; purpose.

Science.gov (United States)

2010-04-01

... limitations on the deductibility of interest paid or incurred on obligations which have certain equity... 279 as to whether a particular instrument labeled a bond, debenture, note, or other evidence of...

Phosphorylation of connexin43 on S279/282 may contribute to laminopathy-associated conduction defects

Energy Technology Data Exchange (ETDEWEB)

Chen, Steven C., E-mail: bug@uw.edu [Fred Hutchinson Cancer Research Center (FHCRC), Public Health Sciences Division, 1100 Fairview Ave. N., Seattle, WA 98109 (United States); University of Washington Department of Biochemistry, 1959 NE Pacific St., Seattle, WA 98195 (United States); Kennedy, Brian K., E-mail: bkennedy@buckinstitute.org [University of Washington Department of Biochemistry, 1959 NE Pacific St., Seattle, WA 98195 (United States); Buck Institute for Research on Aging, 8001 Redwood Boulevard, Novato, CA 94945 (United States); Lampe, Paul D., E-mail: plampe@fhcrc.org [Fred Hutchinson Cancer Research Center (FHCRC), Public Health Sciences Division, 1100 Fairview Ave. N., Seattle, WA 98109 (United States)

2013-04-01

An understanding of the molecular mechanism behind the arrhythmic phenotype associated with laminopathies has yet to emerge. A-type lamins have been shown to interact and sequester activated phospho-ERK1/2(pERK1/2) at the nucleus. The gap junction protein connexin43 (Cx43) can be phosphorylated by pERK1/2 on S279/282 (pS279/282), inhibiting intercellular communication. We hypothesized that without A-type lamins, pS279/282 Cx43 will increase due to inappropriate phosphorylation by pERK1/2, resulting in decreased gap junction function. We observed a 1.6-fold increase in pS279/282 Cx43 levels in Lmna{sup −/−} mouse embryonic fibroblasts (MEFs) compared to Lmna{sup +/+}, and 1.8-fold more pERK1/2 co-precipitated from Lmna{sup −/−} MEFs with Cx43 antibodies. We found a 3-fold increase in the fraction of non-nuclear pERK1/2 and a concomitant 2-fold increase in the fraction of pS279/282 Cx43 in Lmna{sup −/−} MEFs by immunofluorescence. In an assay of gap junctional function, Lmna{sup −/−} MEFs transferred dye to 60% fewer partners compared to Lmna{sup +/+} controls. These results are mirrored in 5–6 week-old Lmna{sup −/−} mice compared to their Lmna{sup +/+} littermates as we detect increased pS279/282 Cx43 in gap junctions by immunofluorescence and 1.7-fold increased levels by immunoblot. We conclude that increased pS279/282 Cx43 in the Lmna{sup −/−} background results in decreased cell communication and may contribute to the arrhythmic pathology in vivo. - Highlights: ► Connexin43 phosphorylation plays a role in laminopathy-associated conduction defects. ► Loss of A-type lamin activity results in release of pERK1/2 from the nucleus. ► Increased cytoplasmic localization of pERK1/2 acts to phosphorylate S279/282 of Cx43. ► Phosphorylation of S279/282 on Cx43 decreases gap junction activity in cell culture. ► Mice lacking A-type lamins have increased phosphorylation on S279/282 of Cx43.

14 CFR 121.279 - Control of engine rotation.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Control of engine rotation. 121.279 Section... of engine rotation. (a) Except as provided in paragraph (b) of this section, each airplane must have a means of individually stopping and restarting the rotation of any engine in flight. (b) In the...

Roles of ATR1 paralogs YMR279c and YOR378w in boron stress tolerance

International Nuclear Information System (INIS)

Bozdag, Gonensin Ozan; Uluisik, Irem; Gulculer, Gulce Sila; Karakaya, Huseyin C.; Koc, Ahmet

2011-01-01

Highlights: → ATR1 paralog YMR279c plays role in boron detoxification. → YMR279c overexpression lowers cytoplasmic boron levels. → ATR1 paralog YOR378w has no roles in boron stress response. -- Abstract: Boron is a necessary nutrient for plants and animals, however excess of it causes toxicity. Previously, Atr1 and Arabidopsis Bor1 homolog were identified as the boron efflux pump in yeast, which lower the cytosolic boron concentration and help cells to survive in the presence of toxic amount of boron. In this study, we analyzed ATR1 paralogs, YMR279c and YOR378w, to understand whether they participate in boron stress tolerance in yeast. Even though these genes share homology with ATR1, neither their deletion rendered cells boron sensitive nor their expression was significantly upregulated by boron treatment. However, expression of YMR279, but not YOR378w, from the constitutive GAPDH promoter on a high copy plasmid provided remarkable boron resistance by decreasing intracellular boron levels. Thus our results suggest the presence of a third boron exporter, YMR279c, which functions similar to ATR1 and provides boron resistance in yeast.

Arg279 is the key regulator of coenzyme selectivity in the flavin-dependent ornithine monooxygenase SidA.

Science.gov (United States)

Robinson, Reeder; Franceschini, Stefano; Fedkenheuer, Michael; Rodriguez, Pedro J; Ellerbrock, Jacob; Romero, Elvira; Echandi, Maria Paulina; Martin Del Campo, Julia S; Sobrado, Pablo

2014-04-01

Siderophore A (SidA) is a flavin-dependent monooxygenase that catalyzes the NAD(P)H- and oxygen-dependent hydroxylation of ornithine in the biosynthesis of siderophores in Aspergillus fumigatus and is essential for virulence. SidA can utilize both NADPH or NADH for activity; however, the enzyme is selective for NADPH. Structural analysis shows that R279 interacts with the 2'-phosphate of NADPH. To probe the role of electrostatic interactions in coenzyme selectivity, R279 was mutated to both an alanine and a glutamate. The mutant proteins were active but highly uncoupled, oxidizing NADPH and producing hydrogen peroxide instead of hydroxylated ornithine. For wtSidA, the catalytic efficiency was 6-fold higher with NADPH as compared to NADH. For the R279A mutant the catalytic efficiency was the same with both coenyzmes, while for the R279E mutant the catalytic efficiency was 5-fold higher with NADH. The effects are mainly due to an increase in the KD values, as no major changes on the kcat or flavin reduction values were observed. Thus, the absence of a positive charge leads to no coenzyme selectivity while introduction of a negative charge leads to preference for NADH. Flavin fluorescence studies suggest altered interaction between the flavin and NADP⁺ in the mutant enzymes. The effects are caused by different binding modes of the coenzyme upon removal of the positive charge at position 279, as no major conformational changes were observed in the structure for R279A. The results indicate that the positive charge at position 279 is critical for tight binding of NADPH and efficient hydroxylation. Copyright © 2014 Elsevier B.V. All rights reserved.

The microRNA ame-miR-279a regulates sucrose responsiveness of forager honey bees (Apis mellifera).

Science.gov (United States)

Liu, Fang; Shi, Tengfei; Yin, Wei; Su, Xin; Qi, Lei; Huang, Zachary Y; Zhang, Shaowu; Yu, Linsheng

2017-11-01

Increasing evidence demonstrates that microRNAs (miRNA) play an important role in the regulation of animal behaviours. Honey bees (Apis mellifera) are eusocial insects, with honey bee workers displaying age-dependent behavioural maturation. Many different miRNAs have been implicated in the change of behaviours in honey bees and ame-miR-279a was previously shown to be more highly expressed in nurse bee heads than in those of foragers. However, it was not clear whether this difference in expression was associated with age or task performance. Here we show that ame-miR-279a shows significantly higher expression in the brains of nurse bees relative to forager bees regardless of their ages, and that ame-miR-279a is primarily localized in the Kenyon cells of the mushroom body in both foragers and nurses. Overexpression of ame-miR-279a attenuates the sucrose responsiveness of foragers, while its absence enhances their sucrose responsiveness. Lastly, we determined that ame-miR-279a directly target the mRNA of Mblk-1. These findings suggest that ame-miR-279a plays important roles in regulating honey bee division of labour. Copyright © 2017 Elsevier Ltd. All rights reserved.

The Gpn3 Q279* cancer-associated mutant inhibits Gpn1 nuclear export and is deficient in RNA polymerase II nuclear targeting.

Science.gov (United States)

Barbosa-Camacho, Angel A; Méndez-Hernández, Lucía E; Lara-Chacón, Bárbara; Peña-Gómez, Sonia G; Romero, Violeta; González-González, Rogelio; Guerra-Moreno, José A; Robledo-Rivera, Angélica Y; Sánchez-Olea, Roberto; Calera, Mónica R

2017-11-01

Gpn3 is required for RNA polymerase II (RNAPII) nuclear targeting. Here, we investigated the effect of a cancer-associated Q279* nonsense mutation in Gpn3 cellular function. Employing RNAi, we replaced endogenous Gpn3 by wt or Q279* RNAi-resistant Gpn3R in epithelial model cells. RNAPII nuclear accumulation and transcriptional activity were markedly decreased in cells expressing only Gpn3R Q279*. Wild-type Gpn3R localized to the cytoplasm but a fraction of Gpn3R Q279* entered the cell nucleus and inhibited Gpn1-EYFP nuclear export. This property and the transcriptional deficit in Gpn3R Q279*-expressing cells required a PDZ-binding motif generated by the Q279* mutation. We conclude that an acquired PDZ-binding motif in Gpn3 Q279* caused Gpn3 nuclear entry, and inhibited Gpn1 nuclear export and Gpn3-mediated RNAPII nuclear targeting. © 2017 Federation of European Biochemical Societies.

The mir-279/996 cluster represses receptor tyrosine kinase signaling to determine cell fates in the Drosophila eye.

Science.gov (United States)

Duan, Hong; de Navas, Luis F; Hu, Fuqu; Sun, Kailiang; Mavromatakis, Yannis E; Viets, Kayla; Zhou, Cyrus; Kavaler, Joshua; Johnston, Robert J; Tomlinson, Andrew; Lai, Eric C

2018-04-09

Photoreceptors in the crystalline Drosophila eye are recruited by receptor tyrosine kinase (RTK)/Ras signaling mediated by Epidermal growth factor receptor (EGFR) and the Sevenless (Sev) receptor. Analyses of an allelic deletion series of the mir-279/996 locus, along with a panel of modified genomic rescue transgenes, show that Drosophila eye patterning depends on both miRNAs. Transcriptional reporter and activity sensor transgenes reveal expression and function of miR-279/996 in non-neural cells of the developing eye. Moreover, mir-279/996 mutants exhibit substantial numbers of ectopic photoreceptors, particularly of R7, and cone cell loss. These miRNAs restrict RTK signaling in the eye, since mir-279/996 nulls are dominantly suppressed by positive components of the EGFR pathway and enhanced by heterozygosity for an EGFR repressor. miR-279/996 limit photoreceptor recruitment by targeting multiple positive RTK/Ras signaling components that promote photoreceptor/R7 specification. Strikingly, deletion of mir-279/996 sufficiently derepresses RTK/Ras signaling so as to rescue a population of R7 cells in R7-specific RTK null mutants boss and sev , which otherwise completely lack this cell fate. Altogether, we reveal a rare setting of developmental cell specification that involves substantial miRNA control. © 2018. Published by The Company of Biologists Ltd.

The V279F polymorphism might change protein character and ...

African Journals Online (AJOL)

Widodo

2017-08-18

Aug 18, 2017 ... family [1,2] that can degrade oxidized lipids, presumably having .... with aquadest (9 ul), then 90 μL coating buffer was added, then vortexed. .... the 279 F variant is protective, while some express it as an inductor of AMI [19,20 ...

Optical spectroscopy of the blue supergiant Sk-69° 279 and its circumstellar shell with SALT

Science.gov (United States)

Gvaramadze, V. V.; Kniazev, A. Y.; Maryeva, O. V.; Berdnikov, L. N.

2018-02-01

We report the results of optical spectroscopy of the blue supergiant Sk-69° 279 and its circular shell in the Large Magellanic Cloud (LMC) with the Southern African Large Telescope (SALT). We classify Sk-69° 279 as an O9.2 Iaf star and analyse its spectrum by using the stellar atmosphere code CMFGEN, obtaining a stellar temperature of ≈30 kK, a luminosity of log (L*/ L⊙) = 5.54, a mass-loss rate of log (\\dot{M}/ M_{⊙} yr^{-1}) = -5.26, and a wind velocity of 800km s-1. We found also that Sk-69° 279 possesses an extended atmosphere with an effective temperature of ≈24 kK and that its surface helium and nitrogen abundances are enhanced, respectively, by factors of ≈2 and 20-30. This suggests that either Sk-69° 279 was initially a (single) fast-rotating ( ≳ 400 km s- 1) star, which only recently evolved off the main sequence, or that it is a product of close binary evolution. The long-slit spectroscopy of the shell around Sk-69° 279 revealed that its nitrogen abundance is enhanced by the same factor as the stellar atmosphere, which implies that the shell is composed mostly of the CNO processed material lost by the star. Our findings support previous propositions that some massive stars can produce compact circumstellar shells and, presumably, appear as luminous blue variables while they are still on the main sequence or have only recently left it.

BLAZAR ANTI-SEQUENCE OF SPECTRAL VARIATION WITHIN INDIVIDUAL BLAZARS: CASES FOR MRK 501 AND 3C 279

Energy Technology Data Exchange (ETDEWEB)

Zhang, Jin; Zhang, Shuang-Nan; Liang, En-Wei, E-mail: zhang.jin@hotmail.com [National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)

2013-04-10

The jet properties of Mrk 501 and 3C 279 are derived by fitting broadband spectral energy distributions (SEDs) with lepton models. The derived {gamma}{sub b} (the break Lorenz factor of the electron distribution) is 10{sup 4}-10{sup 6} for Mrk 501 and 200 {approx} 600 for 3C 279. The magnetic field strength (B) of Mrk 501 is usually one order of magnitude lower than that of 3C 279, but their Doppler factors ({delta}) are comparable. A spectral variation feature where the peak luminosity is correlated with the peak frequency, which is opposite from the blazar sequence, is observed in the two sources. We find that (1) the peak luminosities of the two bumps in the SEDs for Mrk 501 depend on {gamma}{sub b} in both the observer and co-moving frames, but they are not correlated with B and {delta} and (2) the luminosity variation of 3C 279 is dominated by the external Compton (EC) peak and its peak luminosity is correlated with {gamma}{sub b} and {delta}, but anti-correlated with B. These results suggest that {gamma}{sub b} may govern the spectral variation of Mrk 501 and {delta} and B would be responsible for the spectral variation of 3C 279. The narrow distribution of {gamma}{sub b} and the correlation of {gamma}{sub b} and B in 3C 279 would be due to the cooling from the EC process and the strong magnetic field. Based on our brief discussion, we propose that this spectral variation feature may originate from the instability of the corona but not from the variation of the accretion rate as does the blazar sequence.

The V279F polymorphism might change protein character and ...

African Journals Online (AJOL)

Polymorphisms at the protein level are also estimated to correlate with increased risk factors for heart attacks. One such polymorphism is the V279F polymorphism in Lp-PLA2 which results in a change in enzyme performance capability. This in turn implies a reduced risk of acute myocardial infarct (AMI) in Korean and ...

Telomerase variant A279T induces telomere dysfunction and inhibits non-canonical telomerase activity in esophageal carcinomas.

Directory of Open Access Journals (Sweden)

Yuwei Zhang

Full Text Available Although implicated in the pathogenesis of several chronic inflammatory disorders and hematologic malignancies, telomerase mutations have not been thoroughly characterized in human cancers. The present study was performed to examine the frequency and potential clinical relevance of telomerase mutations in esophageal carcinomas.Sequencing techniques were used to evaluate mutational status of telomerase reverse transcriptase (TERT and telomerase RNA component (TERC in neoplastic and adjacent normal mucosa from 143 esophageal cancer (EsC patients. MTS, flow cytometry, time lapse microscopy, and murine xenograft techniques were used to assess proliferation, apoptosis, chemotaxis, and tumorigenicity of EsC cells expressing either wtTERT or TERT variants. Immunoprecipitation, immunoblot, immunofluorescence, promoter-reporter and qRT-PCR techniques were used to evaluate interactions of TERT and several TERT variants with BRG-1 and β-catenin, and to assess expression of cytoskeletal proteins, and cell signaling. Fluorescence in-situ hybridization and spectral karyotyping techniques were used to examine telomere length and chromosomal stability.Sequencing analysis revealed one deletion involving TERC (TERC del 341-360, and two non-synonymous TERT variants [A279T (2 homozygous, 9 heterozygous; A1062T (4 heterozygous]. The minor allele frequency of the A279T variant was five-fold higher in EsC patients compared to healthy blood donors (p<0.01. Relative to wtTERT, A279T decreased telomere length, destabilized TERT-BRG-1-β-catenin complex, markedly depleted β-catenin, and down-regulated canonical Wnt signaling in cancer cells; these phenomena coincided with decreased proliferation, depletion of additional cytoskeletal proteins, impaired chemotaxis, increased chemosensitivity, and significantly decreased tumorigenicity of EsC cells. A279T expression significantly increased chromosomal aberrations in mouse embryonic fibroblasts (MEFs following Zeocin�

The small molecule inhibitor YK-4-279 disrupts mitotic progression of neuroblastoma cells, overcomes drug resistance and synergizes with inhibitors of mitosis.

Science.gov (United States)

Kollareddy, Madhu; Sherrard, Alice; Park, Ji Hyun; Szemes, Marianna; Gallacher, Kelli; Melegh, Zsombor; Oltean, Sebastian; Michaelis, Martin; Cinatl, Jindrich; Kaidi, Abderrahmane; Malik, Karim

2017-09-10

Neuroblastoma is a biologically and clinically heterogeneous pediatric malignancy that includes a high-risk subset for which new therapeutic agents are urgently required. As well as MYCN amplification, activating point mutations of ALK and NRAS are associated with high-risk and relapsing neuroblastoma. As both ALK and RAS signal through the MEK/ERK pathway, we sought to evaluate two previously reported inhibitors of ETS-related transcription factors, which are transcriptional mediators of the Ras-MEK/ERK pathway in other cancers. Here we show that YK-4-279 suppressed growth and triggered apoptosis in nine neuroblastoma cell lines, while BRD32048, another ETV1 inhibitor, was ineffective. These results suggest that YK-4-279 acts independently of ETS-related transcription factors. Further analysis reveals that YK-4-279 induces mitotic arrest in prometaphase, resulting in subsequent cell death. Mechanistically, we show that YK-4-279 inhibits the formation of kinetochore microtubules, with treated cells showing a broad range of abnormalities including multipolar, fragmented and unseparated spindles, together leading to disrupted progression through mitosis. Notably, YK-4-279 does not affect microtubule acetylation, unlike the conventional mitotic poisons paclitaxel and vincristine. Consistent with this, we demonstrate that YK-4-279 overcomes vincristine-induced resistance in two neuroblastoma cell-line models. Furthermore, combinations of YK-4-279 with vincristine, paclitaxel or the Aurora kinase A inhibitor MLN8237/Alisertib show strong synergy, particularly at low doses. Thus, YK-4-279 could potentially be used as a single-agent or in combination therapies for the treatment of high-risk and relapsing neuroblastoma, as well as other cancers. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

K-capture probabilities to 400. 56 and 279. 48 keV levels in the decay of /sup 75/Se

Energy Technology Data Exchange (ETDEWEB)

Singh, K; Sahota, H S

1984-02-01

Precisely calibrated high resolution intrinsic semiconductor detector has been used to find K-capture probabilities to 400.56 and 279.48 keV levels in the decay of /sup 75/Se. The measurement to 279.48 keV level is reported for the first time in literature.

A small molecule inhibitor of ETV1, YK-4-279, prevents prostate cancer growth and metastasis in a mouse xenograft model.

Directory of Open Access Journals (Sweden)

Said Rahim

Full Text Available The erythroblastosis virus E26 transforming sequences (ETS family of transcription factors consists of a highly conserved group of genes that play important roles in cellular proliferation, differentiation, migration and invasion. Chromosomal translocations fusing ETS factors to promoters of androgen responsive genes have been found in prostate cancers, including the most clinically aggressive forms. ERG and ETV1 are the most commonly translocated ETS proteins. Over-expression of these proteins in prostate cancer cells results in a more invasive phenotype. Inhibition of ETS activity by small molecule inhibitors may provide a novel method for the treatment of prostate cancer.We recently demonstrated that the small molecule YK-4-279 inhibits biological activity of ETV1 in fusion-positive prostate cancer cells leading to decreased motility and invasion in-vitro. Here, we present data from an in-vivo mouse xenograft model. SCID-beige mice were subcutaneously implanted with fusion-positive LNCaP-luc-M6 and fusion-negative PC-3M-luc-C6 tumors. Animals were treated with YK-4-279, and its effects on primary tumor growth and lung metastasis were evaluated. YK-4-279 treatment resulted in decreased growth of the primary tumor only in LNCaP-luc-M6 cohort. When primary tumors were grown to comparable sizes, YK-4-279 inhibited tumor metastasis to the lungs. Expression of ETV1 target genes MMP7, FKBP10 and GLYATL2 were reduced in YK-4-279 treated animals. ETS fusion-negative PC-3M-luc-C6 xenografts were unresponsive to the compound. Furthermore, YK-4-279 is a chiral molecule that exists as a racemic mixture of R and S enantiomers. We established that (S-YK-4-279 is the active enantiomer in prostate cancer cells.Our results demonstrate that YK-4-279 is a potent inhibitor of ETV1 and inhibits both the primary tumor growth and metastasis of fusion positive prostate cancer xenografts. Therefore, YK-4-279 or similar compounds may be evaluated as a potential

Au279(SR)84: The Smallest Gold Thiolate Nanocrystal That Is Metallic and the Birth of Plasmon.

Science.gov (United States)

Sakthivel, Naga Arjun; Stener, Mauro; Sementa, Luca; Fortunelli, Alessandro; Ramakrishna, Guda; Dass, Amala

2018-03-15

We report a detailed study on the optical properties of Au 279 (SR) 84 using steady-state and transient absorption measurements to probe its metallic nature, time-dependent density functional theory (TDDFT) studies to correlate the optical spectra, and density of states (DOS) to reveal the factors governing the origin of the collective surface plasmon resonance (SPR) oscillation. Au 279 is the smallest identified gold nanocrystal to exhibit SPR. Its optical absorption exhibits SPR at 510 nm. Power-dependent bleach recovery kinetics of Au 279 suggests that electron dynamics dominates its relaxation and it can support plasmon oscillations. Interestingly, TDDFT and DOS studies with different tail group residues (-CH 3 and -Ph) revealed the important role played by the tail groups of ligands in collective oscillation. Also, steady-state and time-resolved absorption for Au 36 , Au 44 , and Au 133 were studied to reveal the molecule-to-metal evolution of aromatic AuNMs. The optical gap and transient decay lifetimes decrease as the size increases.

TeV gamma rays from 3C 279 - A possible probe of origin and intergalactic infrared radiation fields

Science.gov (United States)

Stecker, F. W.; De Jager, O. C.; Salamon, M. H.

1992-01-01

The gamma-ray spectrum of 3C 279 during 1991 June exhibited a near-perfect power law between 50 MeV and over 5 GeV with a differential spectral index of -(2.02 +/- 0.07). If extrapolated, the gamma-ray spectrum of 3C 279 should be easily detectable with first-generation air Cerenkov detectors operating above about 0.3 TeV provided there is no intergalactic absorption. However, by using model-dependent lower and upper limits for the extragalactic infrared background radiation field, a sharp cutoff of the 3C 279 spectrum is predicted at between about 0.1 and about 1 TeV. The sensitivity of present air Cerenkov detectors is good enough to measure such a cutoff, which would provide the first opportunity to obtain a measurement of the extragalactic background infrared radiation field.

Erratum to "News from the online traveling repairman" [TCS 295(1-3) 279-294

NARCIS (Netherlands)

Krumke, S.O.; Paepe, de W.E.; Poensgen, D.; Stougie, L.

2006-01-01

This note identifies and corrects an error in our paper "News from the Traveling Repairman", which appeared in S.O. Krumke et al. [News from the online traveling repairman, Theoret. Comput. Sci. 295 (1–3) (2003) 279–294].

Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279

International Nuclear Information System (INIS)

Dermer, Charles D.; Cerruti, Matteo; Lott, Benoit; Boisson, Catherine; Zech, Andreas

2014-01-01

Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ D or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ D , B', and the peak electron Lorentz factor γ pk ′ . The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ D ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10 –2 -10 –3 erg cm –3 , implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ 2 ct var ∼ 0.1(Γ/30) 2 (t var /10 4 s) pc from the black hole powering 3C 279's jets, where t var is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.

Molecular Cloning of Phytase Gene from ASUIA279 and Its Expression in Pichia pastoris System

Directory of Open Access Journals (Sweden)

M. H. Mahamad Maifiah

2011-12-01

Full Text Available Phytases catalyze the hydrolysis of phytate (myo-inositol hexakisphosphate, one of the major storage form of phosphate in plants, with subsequent release of myo-inositol, phosphate and phytate-bound minerals. Non-ruminant animals such as chicken, swine and fish can't use the organic phosphorus and minerals from their diet because there is no phytase activity in their digestive tract. Phytate degrading enzyme is added to the animal feed diet to improve phosphorus availability from the dietary phytate and at the same time this lessen the phosphate pollution level in areas of intensive animal production as the phosphate would not be excreted out to the environment. ASUIA279, a bacterial strain isolated from Malaysian soil has potentially shown good phytase activity. In the present work, the gene encoding for phytase has been amplified from the plasmid DNA of recombinant ASUIA279(5 obtained from a previous study (unpublished data by a polymerase chain reaction (PCR methodology. The amplified phytase gene was extracted, purified then cloned into the pPICZA plasmid and transformed into Pichia pastorisX-33 strain for enzyme production.ABSTRAK: Fitase pemangkinan hidrolisis fitat (myo-inositol hexakisphosphate, merupakan salah satu cara penyimpanan utama fosfat dalam tumbuhan, dengan pelepasan berturut myo-inositol , fosfat dan galian terikat fitat. Haiwan bukan ruminan seperti ayam, khinzir dan ikan tidak dapat memanfaatkan fosforus organik serta galian yang diperolehi daripada makanan kerana tidak mempunyai aktiviti fitase di dalam saluran pencernaan mereka. Enzim pengecilan fitase dicampurkan ke dalam pemakanan haiwan untuk mempertingkatkan keperolehan fosforus dari fitat diet. Pada masa yang sama ia dapat mengurangkan tahap pencemaran fosfat di kawasan yang terdapat penternakan haiwan secara intensif agar fosfat tidak dikumuhkan ke persekitaran. ASUIA279, satu strain bakteria yang diasingkan daripada tanih di Malaysiamenunjukkan aktiviti fitase

New Gener. High-Energy Spectra of the Blazar 3C 279 with XMM-Newton and GLAST

Science.gov (United States)

Collmar, Werner

2007-10-01

We propose two 20 ksec XMM-Newton observations of the X-ray bright gamma-ray blazar 3C~279 simultaneous with GLAST/LAT. The main goal is to measure its X-ray properties (spectrum, variability) in order to (1) improve our knowledge on the X-ray emission of the blazar, and (2) to supplement and correlate them to simultaneous GLAST/LAT Gamma-ray observations (30 MeV-300 GeV). Simultaneous GLAST observations of 3C 279 are guaranteed (assuming proper operation then). The high-energy data will be supplemented by ground-based measurements, adding finally up to multifrequency spectra which have unprecedented accuracy and will extend up to high-energy gamma-rays. Such high-quality SEDs will provide severe constraints on their modeling and have the potential to discriminate among models.

Properties of the transitions populating and depopulating the 279 keV level in /sup 75/As

Energy Technology Data Exchange (ETDEWEB)

Puri, V S; Khurana, C S; Sahota, H S [Punjabi Univ., Patiala (India). Nuclear Science Labs.

1977-09-01

The low-energy gamma-ray spectrum of /sup 75/As from /sup 75/Sc has been investigated using a 6 mm x 6 mm Si(Li) spectrometer. The intensity of the 24.4 keV transition has been found to be 0.07 +- 0.01. No evidence has been found for the presence of a 14.9 keV transition. From directional correlation measurements involving the 24.4 keV transition detected in the Si(Li) detector, the multipolarity of this transition has been found to be delta(E3/M2)sub(24.4) =0.18 +- 0.02. The internal conversion process of the 279 keV transition seems to be normal. No effect of the chemical environment has been observed on the (121 ..gamma..-279..gamma..) directional correlation coefficients.

Wild-type catalase peroxidase vs G279D mutant type: Molecular basis of Isoniazid drug resistance in Mycobacterium tuberculosis.

Science.gov (United States)

Singh, Aishwarya; Singh, Aditi; Grover, Sonam; Pandey, Bharati; Kumari, Anchala; Grover, Abhinav

2018-01-30

Mycobacterium tuberculosis katG gene is responsible for production of an enzyme catalase peroxidase that peroxidises and activates the prodrug Isoniazid (INH), a first-line antitubercular agent. INH interacts with catalase peroxidase enzyme within its heme pocket and gets converted to an active form. Mutations occurring in katG gene are often linked to reduced conversion rates for INH. This study is focussed on one such mutation occurring at residue 279, where glycine often mutates to aspartic acid (G279D). In the present study, several structural analyses were performed to study the effect of this mutation on functionality of KatG protein. On comparison, mutant protein exhibited a lower docking score, smaller binding cavity and reduced affinity towards INH. Molecular dynamics analysis revealed the mutant to be more rigid and less compact than the native protein. Essential dynamics analysis determined correlated motions of residues within the protein structure. G279D mutant was found to have many residues that showed related motions and an undesirable effect on the functionality of protein. Copyright © 2017 Elsevier B.V. All rights reserved.

78 FR 49469 - Stephen Glen Guerra, Inmate #98595-279, FCI Yazoo City Medium, Federal Correctional Institution...

Science.gov (United States)

2013-08-14

... DEPARTMENT OF COMMERCE Bureau of Industry and Security Stephen Glen Guerra, Inmate 98595-279, FCI... Export Privileges On February 6, 2012, in the U.S. District Court, Western District of Texas, Stephen... conviction. [[Page 49470

Energy distribution of 0. 279 MeV gamma rays Compton scattered from bound electrons

Energy Technology Data Exchange (ETDEWEB)

Singh, B; Singh, P; Singh, G; Ghumman, B S

1984-11-01

Energy and intensity distribution of 0.279 MeV gamma rays Compton scattered from K-shell electrons of tantalum is measured at scattering angle of 70deg. The experimental results are compared with the available theoretical data. Spectral distribution is also obtained as a function of scatterer thickness to account for the contribution of false events. 13 refs.

Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279

Energy Technology Data Exchange (ETDEWEB)

Dermer, Charles D. [Code 7653, Space Science Division, U.S. Naval Research Laboratory, Washington, DC 20375 (United States); Cerruti, Matteo [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Lott, Benoit [Centre d' Études Nucléaires Bordeaux Gradignan, Université de Bordeaux, CNRS/IN2P3, UMR 5797, F-33175 Gradignan (France); Boisson, Catherine; Zech, Andreas, E-mail: charles.dermer@nrl.navy.mil, E-mail: matteo.cerruti@cfa.harvard.edu [Laboratoire Univers et THeories (LUTH), Observatoire de Paris-Meudon, 5 Place Jules Janssen, F-92195 Meudon Cedex (France)

2014-02-20

Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ{sub D} or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ{sub D}, B', and the peak electron Lorentz factor γ{sub pk}{sup ′}. The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ{sub D} ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10{sup –2}-10{sup –3} erg cm{sup –3}, implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ{sup 2} ct {sub var} ∼ 0.1(Γ/30){sup 2}(t {sub var}/10{sup 4} s) pc from the black hole powering 3C 279's jets, where t {sub var} is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.

The Disulfide Bond Cys255-Cys279 in the Immunoglobulin-Like Domain of Anthrax Toxin Receptor 2 Is Required for Membrane Insertion of Anthrax Protective Antigen Pore.

Directory of Open Access Journals (Sweden)

Pedro Jacquez

Full Text Available Anthrax toxin receptors act as molecular clamps or switches that control anthrax toxin entry, pH-dependent pore formation, and translocation of enzymatic moieties across the endosomal membranes. We previously reported that reduction of the disulfide bonds in the immunoglobulin-like (Ig domain of the anthrax toxin receptor 2 (ANTXR2 inhibited the function of the protective antigen (PA pore. In the present study, the disulfide linkage in the Ig domain was identified as Cys255-Cys279 and Cys230-Cys315. Specific disulfide bond deletion mutants were achieved by replacing Cys residues with Ala residues. Deletion of the disulfide bond C255-C279, but not C230-C315, inhibited the PA pore-induced release of the fluorescence dyes from the liposomes, suggesting that C255-C279 is essential for PA pore function. Furthermore, we found that deletion of C255-C279 did not affect PA prepore-to-pore conversion, but inhibited PA pore membrane insertion by trapping the PA membrane-inserting loops in proteinaceous hydrophobic pockets. Fluorescence spectra of Trp59, a residue adjacent to the PA-binding motif in von Willebrand factor A (VWA domain of ANTXR2, showed that deletion of C255-C279 resulted in a significant conformational change on the receptor ectodomain. The disulfide deletion-induced conformational change on the VWA domain was further confirmed by single-particle 3D reconstruction of the negatively stained PA-receptor heptameric complexes. Together, the biochemical and structural data obtained in this study provides a mechanistic insight into the role of the receptor disulfide bond C255-C279 in anthrax toxin action. Manipulation of the redox states of the receptor, specifically targeting to C255-C279, may become a novel strategy to treat anthrax.

Interplanetary scintillations of the 3C 279 radiosource from RATAN-600 observations

International Nuclear Information System (INIS)

Shishova, T.D.; Mingaliev, M.G.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)

1980-01-01

In 1976 and 1977 observations of interplanetary scintillations of the 3C 279 radiosource were carred out at the RATAN-600 at centimeter wavelengths. At Lambda=3.9 cm the index of scintillations gets suturated at the distance R approximately equal to 4 Rsub(Sun) from the Sun. The estimation of solar wind velocity is approximately 140 km/s at R=5Rsub(Sun); it grows up to approximately 400 km/s at R approximately equal to 10 Rsub(Sun)

Rational Design of Bacillus coagulans NL01 l-Arabinose Isomerase and Use of Its F279I Variant in d-Tagatose Production.

Science.gov (United States)

Zheng, Zhaojuan; Mei, Wending; Xia, Meijuan; He, Qin; Ouyang, Jia

2017-06-14

d-Tagatose is a prospective functional sweetener that can be produced by l-arabinose isomerase (AI) from d-galactose. To improve the activity of AI toward d-galactose, the AI of Bacillus coagulans was rationally designed on the basis of molecular modeling and docking. After alanine scanning and site-saturation mutagenesis, variant F279I that exhibited improved activity toward d-galactose was obtained. The optimal temperature and pH of F279I were determined to be 50 °C and 8.0, respectively. This variant possessed 1.4-fold catalytic efficiency compared with the wild-type (WT) enzyme. The recombinant Escherichia coli overexpressing F279I also showed obvious advantages over the WT in biotransformation. Under optimal conditions, 67.5 and 88.4 g L -1 d-tagatose could be produced from 150 and 250 g L -1 d-galactose, respectively, in 15 h. The biocatalyst constructed in this study presents a promising alternative for large-scale d-tagatose production.

Antibody production of wild-type and enzyme V279F variants of PAF-AH as a risk factor for Cardiovascular disease

Science.gov (United States)

Ramadhani, Anggia N.; Puspitarini, Sapti; Sari, Anissa N.; Widodo

2017-11-01

Coronary artery disease (CAD) has emerged as a leading cause of death in Indonesia nowadays. WHO data in 2012 revealed that 37% of the Indonesian population died from this disease. CAD occurs because of endothelial dysfunction in the arteries. Lipoprotein-associated phospholipase A2 (Lp-PLA2), also known as platelet-activating factor acetylhydrolase (PAF-AH), is a phospholipase A2 enzyme, encoded by the PLA2G7 gene. This protein is predicted to be involved in inflammatory phospholipid metabolism so it can be used as a biomarker of CAD in the early phase. Thus, the purpose of this research is to discover the difference in antibody production between wild-type and mutant V279F. The PAF-AH enzyme was isolated from mice lymphocyte cells in order to develop this enzyme as a biomarker of cardiovascular disease. PAF-AH migrates at 55kDa according to SDS-PAGE analysis. Flow cytometry analysis showed that mutant PAF-AH (V279F) is more antigenic than wild-type PAF-AH. The missense mutation of V279F PAF-AH means this enzyme cannot catabolize the acetyl group at the sn-2 position of PAF.

Experimental investigation of the multiple scatter peak of gamma rays in portland cement in the energy range 279-1332 keV

International Nuclear Information System (INIS)

Singh, Tejbir; Singh, Parjit S

2011-01-01

The pulse height spectra for different thicknesses of portland cement in the reflected geometry has been recorded with the help of a NaI(Tl) scintillator detector and 2 K MCA card using different gamma-ray sources such as Hg 203 (279 keV), Cs 137 (662 keV) and Co 60 (1173 and 1332 keV). It has been observed that the multiple scatter peak for portland cement appears at 110 (±7) keV in all the spectra irrespective of different incident photon energies in the range 279-1332 keV from different gamma-ray sources. Further, the variation in the intensity of the multiple scatter peak with the thickness of portland cement in the backward semi-cylinders has been investigated.

The WEBT Campaign on the Blazar 3C 279 in 2006

Science.gov (United States)

Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berduygin, A.; Blaek, M.; Buemi, C.; Castro-Tirado, A. J.; De Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V. A.; Henson, G.; Hovatta, T.; Hudec, R.; Ibrahimov, M.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y. Y.; Kovalev, Yu. A.; Kubánek, P.; Kurosaki, M.; Kurtanidze, O.; Lähteenmäki, A.; Lanteri, L.; Larionov, V. M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H. R.; Mingaliev, M. G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.; Nilsson, K.; Nishiyama, S.; Ohlert, J.; Osterman, M. A.; Pak, S.; Pasanen, M.; Peters, C. S.; Pursimo, T.; Raiteri, C. M.; Robertson, J.; Robertson, T.; Ryle, W. T.; Sadakane, K.; Sadun, A.; Sigua, L.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L. O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J. R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vitek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, H.-S.

2007-12-01

The quasar 3C 279 was the target of an extensive multiwavelength monitoring campaign from 2006 January through April. An optical-IR-radio monitoring campaign by the Whole Earth Blazar Telescope (WEBT) collaboration was organized around target-of-opportunity X-ray and soft γ-ray observations with Chandra and INTEGRAL in 2006 mid-January, with additional X-ray coverage by RXTE and Swift XRT. In this paper we focus on the results of the WEBT campaign. The source exhibited substantial variability of optical flux and spectral shape, with a characteristic timescale of a few days. The variability patterns throughout the optical BVRI bands were very closely correlated with each other, while there was no obvious correlation between the optical and radio variability. After the ToO trigger, the optical flux underwent a remarkably clean quasi-exponential decay by about 1 mag, with a decay timescale of τd~12.8 days. In intriguing contrast to other (in particular, BL Lac type) blazars, we find a lag of shorter wavelength behind longer wavelength variability throughout the RVB wavelength ranges, with a time delay increasing with increasing frequency. Spectral hardening during flares appears delayed with respect to a rising optical flux. This, in combination with the very steep IR-optical continuum spectral index of α0~1.5-2.0, may indicate a highly oblique magnetic field configuration near the base of the jet, leading to inefficient particle acceleration and a very steep electron injection spectrum. An alternative explanation through a slow (timescale of several days) acceleration mechanism would require an unusually low magnetic field of B<~0.2 G, about an order of magnitude lower than inferred from previous analyses of simultaneous SEDs of 3C 279 and other flat-spectrum radio quasars with similar properties. For questions regarding the availability of the data from the WEBT campaign presented in this paper, please contact the WEBT President Massimo Villata at villata@oato.inaf.it.

The Bright γ-ray Flare of 3C 279 in 2015 June: AGILE Detection and Multifrequency Follow-up Observations

Science.gov (United States)

Pittori, C.; Lucarelli, F.; Verrecchia, F.; Raiteri, C. M.; Villata, M.; Vittorini, V.; Tavani, M.; Puccetti, S.; Perri, M.; Donnarumma, I.; Vercellone, S.; Acosta-Pulido, J. A.; Bachev, R.; Benítez, E.; Borman, G. A.; Carnerero, M. I.; Carosati, D.; Chen, W. P.; Ehgamberdiev, Sh. A.; Goded, A.; Grishina, T. S.; Hiriart, D.; Hsiao, H. Y.; Jorstad, S. G.; Kimeridze, G. N.; Kopatskaya, E. N.; Kurtanidze, O. M.; Kurtanidze, S. O.; Larionov, V. M.; Larionova, L. V.; Marscher, A. P.; Mirzaqulov, D. O.; Morozova, D. A.; Nilsson, K.; Samal, M. R.; Sigua, L. A.; Spassov, B.; Strigachev, A.; Takalo, L. O.; Antonelli, L. A.; Bulgarelli, A.; Cattaneo, P.; Colafrancesco, S.; Giommi, P.; Longo, F.; Morselli, A.; Paoletti, F.

2018-04-01

We report the AGILE detection and the results of the multifrequency follow-up observations of a bright γ-ray flare of the blazar 3C 279 in 2015 June. We use AGILE and Fermi gamma-ray data, together with Swift X-ray andoptical-ultraviolet data, and ground-based GASP-WEBT optical observations, including polarization information, to study the source variability and the overall spectral energy distribution during the γ-ray flare. The γ-ray flaring data, compared with as yet unpublished simultaneous optical data that will allow constraints on the big blue bump disk luminosity, show very high Compton dominance values of ∼100, with the ratio of γ-ray to optical emission rising by a factor of three in a few hours. The multiwavelength behavior of the source during the flare challenges one-zone leptonic theoretical models. The new observations during the 2015 June flare are also compared with already published data and nonsimultaneous historical 3C 279 archival data.

3C 279 IN OUTBURST IN 2015 JUNE: A BROADBAND SED STUDY BASED ON THE INTEGRAL DETECTION

Energy Technology Data Exchange (ETDEWEB)

Bottacini, Eugenio [W.W. Hansen Experimental Physics Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, Stanford University (United States); Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2531 (South Africa); Pian, Elena [INAF, Istituto di Astrofisica Spaziale e Fisica Cosmica, via P. Gobetti 101, I-40129 Bologna (Italy); Collmar, Werner, E-mail: eugenio.bottacini@stanford.edu [Max-Planck-Institut für extraterrestrische Physik, Giessenbach, D-85748 Garching (Germany)

2016-11-20

Blazars radiate from radio through gamma-ray frequencies and thereby make ideal targets for multifrequency studies. Such studies allow the properties of the emitting jet to be constrained. 3C 279 is among the most notable blazars and therefore subject to extensive multifrequency campaigns. We report the results of a campaign ranging from near-IR to gamma-ray energies that targeted an outburst of 3C 279 in 2015 June. The campaign pivots around the detection in only 50 ks by INTEGRAL , whose IBIS/ISGRI data pin down the high-energy component of the spectral energy distribution (SED) between Swift -XRT data and Fermi -LAT data. The overall SED from near-IR to gamma rays can be well represented by either a leptonic or a lepto-hadronic radiation transfer model. Even though the data are equally well represented by the two models, their inferred parameters challenge the physical conditions in the jet. In fact, the leptonic model requires parameters with a magnetic field far below equipartition with the relativistic particle energy density. In contrast, equipartition may be achieved with the lepto-hadronic model, although this implies an extreme total jet power close to the Eddington luminosity.

Multiwavelength Variability Analysis of 3C 279

Directory of Open Access Journals (Sweden)

Víctor M. Patiño-Álvarez

2017-11-01

Full Text Available We present a multifrequency analysis of the variability in the flat-spectrum radio quasar 3C 279 from 2008 to 2014. Our multiwavelength datasets range from 1 mm to gamma-rays, with additional optical polarimetry. Cross-correlation analysis shows a significant correlation between the UV continuum emission, the optical and NIR bands, at a delay consistent with zero, implying co-spatial emission regions. We also find a correlation between the UV continuum and the 1 mm data, which implies that the dominant process in producing the UV continuum is synchrotron emission. Based on the behavior of the gamma-ray light curve with respect to other bands, we identified three different activity periods. During period A we find a significant correlation at zero delay between the UV continuum and the gamma-rays, implying co-spatial emission regions which points toward synchrotron self-Compton as dominant gamma-ray emission mechanism. During period C we find a delay between the UV continuum and the gamma-rays, as well as a correlation at zero delay between X-rays and gamma-rays, both results implying that external inverse Compton is the dominant gamma-ray emission mechanism. During period B there are multiple flares in the bands from 1 mm to UV, however, none of these show a counterpart in the gamma-rays band. We propose that this is caused by an increase in the gamma-ray opacity due to electron-positron pair production.

Multiwavelength Variability Analysis of 3C 279

Energy Technology Data Exchange (ETDEWEB)

Patiño-Álvarez, Víctor M. [Max-Planck-Institut für Radioastronomie, Bonn (Germany); Fernandes, Sunil [Department of Physics and Astronomy, University of Texas at San Antonio, San Antonio, TX (United States); Chavushyan, Vahram [Instituto Nacional de Astrofísica Óptica y Electrónica, Puebla (Mexico); López-Rodríguez, Erique [SOFIA Science Center, NASA Ames Center, Mountain View, CA (United States); León-Tavares, Jonathan [Centre for Remote Sensing and Earth Observation Processes (TAP), Flemish Institute for Technological Research (VITO), Mol (Belgium); Schlegel, Eric M. [Department of Physics and Astronomy, University of Texas at San Antonio, San Antonio, TX (United States); Carrasco, Luis; Valdés, José R.; Carramiñana, Alberto, E-mail: patinoavm@mpifr-bonn.mpg.de [Instituto Nacional de Astrofísica Óptica y Electrónica, Puebla (Mexico)

2017-11-23

We present a multifrequency analysis of the variability in the flat-spectrum radio quasar 3C 279 from 2008 to 2014. Our multiwavelength datasets range from 1 mm to gamma-rays, with additional optical polarimetry. Cross-correlation analysis shows a significant correlation between the UV continuum emission, the optical and NIR bands, at a delay consistent with zero, implying co-spatial emission regions. We also find a correlation between the UV continuum and the 1 mm data, which implies that the dominant process in producing the UV continuum is synchrotron emission. Based on the behavior of the gamma-ray light curve with respect to other bands, we identified three different activity periods. During period A we find a significant correlation at zero delay between the UV continuum and the gamma-rays, implying co-spatial emission regions which points toward synchrotron self-Compton as dominant gamma-ray emission mechanism. During period C we find a delay between the UV continuum and the gamma-rays, as well as a correlation at zero delay between X-rays and gamma-rays, both results implying that external inverse Compton is the dominant gamma-ray emission mechanism. During period B there are multiple flares in the bands from 1 mm to UV, however, none of these show a counterpart in the gamma-rays band. We propose that this is caused by an increase in the gamma-ray opacity due to electron-positron pair production.

Fermi LAT detection of renewed strong GeV activity from the FSRQ 3C 279

Science.gov (United States)

Ojha, Roopesh; van Zyl, Pfesesani; Fermi Large Area Telescope Collaboration

2018-04-01

The Large Area Telescope (LAT), one of two instruments on the Fermi Gamma-ray Space Telescope, has observed an intense and hard gamma-ray flare from a source positionally consistent with the flat spectrum radio quasar 3C 279, also known as 3FGL J1256.1-0547 (Acero et al. 2015, ApJS, 218, 23), with radio coordinates R.A.: 12h56m11.1665s, Dec: -05d47m21.523s (J2000.0; Johnston et al. 1995, AJ, 110, 880).

ASAS-SN Discovery of an Unprecedented >1.5 Magnitude Optical Flare from QSO B0346-279

Science.gov (United States)

Vallely, P.; Stanek, K. Z.; Kochanek, C. S.; Shields, J. V.; Thompson, T. A.; Shappee, B. J.; Holoien, T. W.-S.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Stritzinger, M.

2018-02-01

During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Brutus" telescope in Haleakala, Hawaii, the quadruple 14-cm "Leavitt" telescope in Fort Davis, Texas, the quadruple 14-cm "Payne-Gaposchkin" telescope in Sutherland, South Africa, and the quadruple 14-cm "Cassius" and "Paczynski" telescopes in Cerro Tololo, Chile, we have discovered an unprecedented optical brightening of QSO B0346-279 (z 0.9874).

Dirac-Hartree-Fock studies of X-ray transitions in meitnerium

International Nuclear Information System (INIS)

Thierfelder, C.; Schwerdtfeger, P.; Hessberger, F.P.; Hofmann, S.

2008-01-01

The K -shell and L -shell ionizations potentials for 268 109 Mt were calculated at the Dirac-Hartree-Fock level taking into account quantum electrodynamic and finite nuclear-size effects. The K α1 transition energies for different ionization states are accurately predicted and compared with recent experiments in the α -decay of 272 111 Rg. (orig.)

RRS "Discovery" Cruise D279, 04 Apr - 10 May 2004. A Transatlantic hydrography section at 24.5N

OpenAIRE

Cunningham, S.A.

2005-01-01

The cruise report describes the acquisition and processing of transatlantic hydrographic, velocity, chemistry and other measurements made during three cruises in Spring 2004 at 24.5°N. Measurements were made from shallow water near Africa to shallow water just off Palm Springs beach on the eastern seaboard of the USA. During the principal cruise, RRS Discovery Cruise D279 (4 April to 10 May 2004), 125 full depth CTD and lowered acoustic Doppler current profiler (LADP) stations were complete...

X-ray/ultraviolet observing campaign of the Markarian 279 active galactic nucleus outflow: a close look at the absorbing/emitting gas with Chandra-LETGS

NARCIS (Netherlands)

Costantini, E.; Kaastra, J.S.; Arav, N.; Kriss, G.A.; Steenbrugge, K.C.; Gabel, J.R.; Verbunt, F.W.M.; Behar, E.; Gaskell, C. Martin; Korista, K.T.; Proga, D.; Kim Quijano, J.; Scott, J.E.; Klimek, E.S.; Hedrick, C.H.

2007-01-01

We present a Chandra-LETGS observation of the Seyfert 1 galaxy Mrk 279. This observation was simultaneous with HST-STIS and FUSE observations, in the context of a multiwavelength study of this source. The data also allow for the presence of intermediate ionization components. The distribution of the

Earliest stone-tipped projectiles from the Ethiopian rift date to >279,000 years ago.

Science.gov (United States)

Sahle, Yonatan; Hutchings, W Karl; Braun, David R; Sealy, Judith C; Morgan, Leah E; Negash, Agazi; Atnafu, Balemwal

2013-01-01

Projectile weapons (i.e. those delivered from a distance) enhanced prehistoric hunting efficiency by enabling higher impact delivery and hunting of a broader range of animals while reducing confrontations with dangerous prey species. Projectiles therefore provided a significant advantage over thrusting spears. Composite projectile technologies are considered indicative of complex behavior and pivotal to the successful spread of Homo sapiens. Direct evidence for such projectiles is thus far unknown from >80,000 years ago. Data from velocity-dependent microfracture features, diagnostic damage patterns, and artifact shape reported here indicate that pointed stone artifacts from Ethiopia were used as projectile weapons (in the form of hafted javelin tips) as early as >279,000 years ago. In combination with the existing archaeological, fossil and genetic evidence, these data isolate eastern Africa as a source of modern cultures and biology.

Earliest stone-tipped projectiles from the Ethiopian rift date to >279,000 years ago.

Directory of Open Access Journals (Sweden)

Yonatan Sahle

Full Text Available Projectile weapons (i.e. those delivered from a distance enhanced prehistoric hunting efficiency by enabling higher impact delivery and hunting of a broader range of animals while reducing confrontations with dangerous prey species. Projectiles therefore provided a significant advantage over thrusting spears. Composite projectile technologies are considered indicative of complex behavior and pivotal to the successful spread of Homo sapiens. Direct evidence for such projectiles is thus far unknown from >80,000 years ago. Data from velocity-dependent microfracture features, diagnostic damage patterns, and artifact shape reported here indicate that pointed stone artifacts from Ethiopia were used as projectile weapons (in the form of hafted javelin tips as early as >279,000 years ago. In combination with the existing archaeological, fossil and genetic evidence, these data isolate eastern Africa as a source of modern cultures and biology.

Energy and intensity distributions of 0.279 MeV multiply Compton-scattered photons in soldering material

International Nuclear Information System (INIS)

Singh, Manpreet; Singh, Gurvinderjit; Singh, Bhajan; Sandhu, B.S.

2007-01-01

An inverse response matrix converts the observed pulse-height distribution of a NaI(Tl) scintillation detector to a photon spectrum. This also results in extraction of intensity distribution of multiply scattered events originating from interactions of 0.279 MeV photons with thick targets of soldering material. The observed pulse-height distributions are a composite of singly and multiply scattered events in addition to bremmstrahlung-and Rayleigh-scattered events. To evaluate the contribution of multiply scattered events, the spectrum of singly scattered events contributing to inelastic Compton peak is reconstructed analytically. The optimum thickness (saturation depth), at which the number of multiply scattered events saturates, has been measured. Monte Carlo calculations also support the present results

A novel truncating AIP mutation, p.W279*, in a familial isolated pituitary adenoma (FIPA) kindred.

Science.gov (United States)

Cansu, Güven Barış; Taşkıran, Bengür; Trivellin, Giampaolo; Faucz, Fabio R; Stratakis, Constantine A

2016-07-01

Familial isolated pituitary adenomas (FIPA) constitute 2-3% of pituitary tumours. AIP is the most commonly mutated gene in FIPA. We herein report a novel germline mutation of the AIP gene in a family with FIPA. We present two patients, a father and his 12-year-old daughter, diagnosed clinically and using laboratory measures with acromegaly-gigantism. Both underwent transsphenoidal hypophyseal surgery for macroadenomas. We initially detected a novel heterozygous germline AIP mutation, c.836G>A (p.W279*), in the father's DNA. We then found the same mutation in his affected daughter. Pituitary adenomas associated with AIP mutations mostly present as FIPA (68%) at an early age (78% occur at treatment success, and genetic counseling.

Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

Science.gov (United States)

Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

2018-01-01

Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

279 Watt Metal-Wrap-Through module using industrial processes

Energy Technology Data Exchange (ETDEWEB)

Guillevin, N.; Heurtault, B.; Geerligs, L.J.; Anker, J.; Van Aken, B.B.; Bennett, I.J.; Jansen, M.J.; Berkeveld, L.D.; Weeber, A.W.; Bultman, J.H. [ECN Solar Energy, PO Box 1, 1755 ZG Petten (Netherlands); Wenchao, Zhao; Jianming, Wang; Ziqian, Wang; Yingle, Chen; Yanlong, Shen; Zhiyan, Hu; Gaofei, Li; Jianhui, Chen; Bo, Yu; Shuquan, Tian; Jingfeng, Xiong [Yingli Solar, 3399 Chaoyang North Street, Baoding (China)

2012-09-15

This paper describes results of metal wrap through (MWT) cells produced from n-type Czochralski silicon wafers, and modules produced from those cells. The use of n-type silicon as base material allows for high efficiencies: for front emitter contacted industrial cells, efficiencies up to 20% have been reported. MWT cells allow even higher cell efficiency due to reduced front metal coverage, and additionally full back-contacting of the MWT cells in a module results in reduced cell to module (CTM) fill factor losses. MWT cells were produced by industrial process technologies. The efficiency of the MWT cells reproducibly exceeds the efficiency of front contact cells based on the same technology by about 0.2-0.3%, and routes for further improvement are analyzed. 60-cell modules were produced from both types of cells (MWT and H-pattern front emitter). In a direct module performance comparison, the MWT module, based on integrated backfoil, produced 3% higher power output than the comparable tabbed front emitter contact module. CTM current differences arise from the higher packing density, and in this experiment from a lower reflectance of the backfoil, in MWT modules. CTM FF differences are related to resistive losses in copper circuitry on the backfoil versus tabs. The CTM FF loss of the MWT module was reduced by 2.2%abs compared to the tabbed front emitter contact module. Finally, simple process optimizations were tested to improve the n-type MWT cell and module efficiency. A module made using MWT cells of 19.6% average efficiency resulted in a power output of 279W. The cell and module results are analyzed and routes for improvements are discussed.

LC-MS/MS determination of 2-(4-((2-(2S,5R)-2-Cyano-5-ethynyl-1-pyrrolidinyl)-2-oxoethylamino)-4-methyl-1-piperidinyl)-4-pyridinecarboxylic acid (ABT-279) in dog plasma with high-throughput protein precipitation sample preparation.

Science.gov (United States)

Kim, Joseph; Flick, Jeanette; Reimer, Michael T; Rodila, Ramona; Wang, Perry G; Zhang, Jun; Ji, Qin C; El-Shourbagy, Tawakol A

2007-11-01

As an effective DPP-IV inhibitor, 2-(4-((2-(2S,5R)-2-Cyano-5-ethynyl-1-pyrrolidinyl)-2-oxoethylamino)-4-methyl-1-piperidinyl)-4-pyridinecarboxylic acid (ABT-279), is an investigational drug candidate under development at Abbott Laboratories for potential treatment of type 2 diabetes. In order to support the development of ABT-279, multiple analytical methods for an accurate, precise and selective concentration determination of ABT-279 in different matrices were developed and validated in accordance with the US Food and Drug Administration Guidance on Bioanalytical Method Validation. The analytical method for ABT-279 in dog plasma was validated in parallel to other validations for ABT-279 determination in different matrices. In order to shorten the sample preparation time and increase method precision, an automated multi-channel liquid handler was used to perform high-throughput protein precipitation and all other liquid transfers. The separation was performed through a Waters YMC ODS-AQ column (2.0 x 150 mm, 5 microm, 120 A) with a mobile phase of 20 mm ammonium acetate in 20% acetonitrile at a flow rate of 0.3 mL/min. Data collection started at 2.2 min and continued for 2.0 min. The validated linear dynamic range in dog plasma was between 3.05 and 2033.64 ng/mL using a 50 microL sample volume. The achieved r(2) coefficient of determination from three consecutive runs was between 0.998625 and 0.999085. The mean bias was between -4.1 and 4.3% for all calibration standards including lower limit of quantitation. The mean bias was between -8.0 and 0.4% for the quality control samples. The precision, expressed as a coefficient of variation (CV), was < or =4.1% for all levels of quality control samples. The validation results demonstrated that the high-throughput method was accurate, precise and selective for the determination of ABT-279 in dog plasma. The validated method was also employed to support two toxicology studies. The passing rate was 100% for all 49 runs from

Pressure and temperature-dependent quantum yields for the photodissociation of acetone between 279 and 327.5 nm

Science.gov (United States)

Blitz, M. A.; Heard, D. E.; Pilling, M. J.; Arnold, S. R.; Chipperfield, M. P.

2004-03-01

The photodissociation of acetone has been studied over the wavelength (λ) range 279-327.5 nm as a function of temperature (T) and pressure (p) using a spectroscopic method to monitor the acetyl (CH3CO) radical fragment. Above 310 nm the quantum yield (QY) is substantially smaller than previous measurements, and decreases with T. The QYs for production of CH3CO + CH3 and CH3 + CH3 + CO have been parameterised as a function of λ, p and T and used to calculate the altitude dependence of the photolysis frequency. In the upper troposphere (UT) the acetone photolysis lifetime is a factor of 2.5-10 longer, dependent upon latitude and season, than if the previously recommended QYs are used.

Preliminary Investigation of Myo-Inositol Phosphates Produced by ASUIA279 Phytase on MCF-7 Cancer Cells

Directory of Open Access Journals (Sweden)

N. Mohd. Yusoff

2011-12-01

Full Text Available Phytate or myo-inositol hexakisphosphates (IP6 is widely distributed in plants like rice brans. The production of myo-inositol phosphate intermediates has received much attention due to the remarkable potential health benefits offered by the compounds. In this study, the cytotoxicity of the partially purified myo-inositol phosphate fractions and commercial IP1 and IP6 were investigated against MCF-7 breast cancer cell lines. The study showed that the commercial standard IP1 and IP6 showed good inhibition towards the MCF-7 cell line. The MCF-7 cells growth was inhibited in minimum concentration of myo-inositol phosphates (<1000 µg/ml. However, no inhibition observed on the MCF-7 cell line by the myo-inositol phosphates fractions partially purified from rice bran at concentration <1000 ?g/ml. The inhibition of MCF-7 was only observed at concentration more than 30 mg/ml with more than 40% cells were inhibited. This indicates that the partially purified rice bran myo-inositol phosphates degraded by ASUIA279 phytase on MCF-7 breast cancer cells exhibit positive results towards the inhibition of cancer cells growth at relatively high concentration..KEYWORDS: myo-inositol phosphates, phytase, MCF-7,  cancerABSTRAK: Fitat atau myo-inositol hexakisphosphate (IP6 dikenali umum teragih di dalam tumbuhan seperti dedak padi. Penghasilan perantaraan fosfat myo-inositol mendapat perhatian memandangkan ia berpotensi tinggi dalam kesihatan. Dalam kajian ini, kesitotoksikan sebahagian daripada fosfat myo-inositol separa tulen, IP1 komersil dan IP6 komersil dikaji terhadap produk yang berupa sel kekal (cell lines kanser payu dara MCF-7. Tumbesaran sel MCF-7 direncatkan dalam pekatan minima fosfat myo-inositol (<1000 μg/ml. Tetapi, tidak ada perencatan dilihat terhadap sel kekal MCF-7 oleh sebahagian fosfat myo-inositol separa tulen daripada dedak padi pada kepekatan <1000 mg/ml. Perencatan MCF-7 hanya dilihat pada kepekatan lebih daripada 30 mg/ml dengan lebih

A Study of 279 General Outbreaks of Gastrointestinal Infection in the North-East Region of England

Science.gov (United States)

Tebbutt, Grahame M.; Wilson, Deborah; Holtby, Ian

2009-01-01

All outbreaks of infectious intestinal disease reported to the authorities were entered on a computer database with outbreak control teams being established to investigate larger or more significant incidents. The outbreak database and, when set up, the notes of outbreak team meetings were examined for the 279 outbreaks reported in a three-year period (2003–2005). Faeces specimens submitted as part of an outbreak were examined for microbial pathogens and the results cross-matched to the outbreak number. Almost half of the general outbreaks reported (137) occurred in long-term care facilities for the elderly, 51 outbreaks were recorded in hospitals and 31 occurred in the wider community. In 76 outbreaks no specimen was logged. A microbial cause was confirmed in about one-third of outbreaks, with noroviruses being the most common (19%). Salmonellas accounted for 12 of the 21 community outbreaks linked to social events and all were foodborne. Suggestions for improving notification and surveillance are discussed. PMID:19440398

2007 Nuclear Data Review

International Nuclear Information System (INIS)

Holden, N.E.

2008-01-01

The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

Rapid variability of blazar 3C 279 during flaring states in 2013-2014 with joint FERMI-LAT, NuSTAR, swift, and ground-based multi-wavelength observations

DEFF Research Database (Denmark)

Hayashida, M.; Nalewajko, K.; Madejski, G. M.

2015-01-01

We report the results of a multiband observing campaign on the famous blazar 3C 279 conducted during a phase of increased activity from 2013 December to 2014 April, including first observations of it with NuSTAR. The γ-ray emission of the source measured by Fermi-LAT showed multiple distinct flar...

Smoking, diabetes, blood hypertension: possible etiologic role for Peyronie’s disease? Analysis in 279 patients with a control group in Sicily

Directory of Open Access Journals (Sweden)

Carlo Pavone

2015-03-01

Full Text Available Objective: To assess the proportion of patients with Peyronie’s Disease (PD and the possible association with its potential risk factors in the general population of the central and western Sicily in our weekly andrological outpatient clinic. Materials and methods: We recruited a sample of 279 consecutive patients consulting our andrological outpatient clinic. Two arms were created: the first one composed by PD patients (men with symptoms suggestive for PD, the second one composed by patients with other andrological diseases (control arm. For each patient we evaluated the age, cigarette smoking, diabetes, blood hypertension and erectile function. In the PD arm we administered validated questionnaires to determine the erectile function status by the International Index of Erectile Function 5 (IIEF-5 and the pain status during erection by the Visual Analogue Scale (VAS. A univariate analysis was conducted using R software. Results: We enrolled 279 consecutive patients. The number of PD patients was 97 (34,7%. The univariate analysis showed a correlation between PD and cigarette smoking (p = 0.0242, blood hypertension (p < 0.001, erectile dysfunction (p < 0.001. No significant association was observed between diabetes and PD (p = 0.358. The median age of PD arm was 60 years and the median age of the control arm was 63,5 years; therefore the median age of PD arm resulted lower than the median age of the control arm (p = 0,031. Conclusions: Peyronie’s disease is more common than we might think; furthermore it can be diagnosed among young patients. According to our results, cigarette smoking and blood hypertension may be considered statically significant risk factors for developing PD. On the contrary diabetes seems not to be a risk factor for PD. According to our results PD should be sought also in young patients. Further studies are necessary to confirm that removing the indicated risk factors may reduce the incidence of PD.

Synthesis of 2-deoxy-2,2-difluoro-α-maltosyl fluoride and its X-ray structure in complex with Streptomyces coelicolor GlgEI-V279S

Energy Technology Data Exchange (ETDEWEB)

Thanna, Sandeep; Lindenberger, Jared J.; Gaitonde, Vishwanath V.; Ronning, Donald R.; Sucheck, Steven J. (Toledo)

2015-06-05

Streptomyces coelicolor (Sco) GlgEI is a glycoside hydrolase involved in α-glucan biosynthesis and can be used as a model enzyme for structure-based inhibitor design targeting Mycobacterium tuberculosis (Mtb) GlgE. The latter is a genetically validated drug target for the development of anti-Tuberculosis (TB) treatments. Inhibition of Mtb GlgE results in a lethal buildup of the GlgE substrate maltose-1-phosphate (M1P). However, Mtb GlgE is difficult to crystallize and affords lower resolution X-ray structures. Sco GlgEI-V279S on the other hand crystallizes readily, produces high resolution X-ray data, and has active site topology identical to Mtb GlgE. We report the X-ray structure of Sco GlgEI-V279S in complex with 2-deoxy-2,2-difluoro-α-maltosyl fluoride (α-MTF, 5) at 2.3 Å resolution. α-MTF was designed as a non-hydrolysable mimic of M1P to probe the active site of GlgE1 prior to covalent bond formation without disruption of catalytic residues. The α-MTF complex revealed hydrogen bonding between Glu423 and the C1F which provides evidence that Glu423 functions as proton donor during catalysis. Further, hydrogen bonding between Arg392 and the axial C2 difluoromethylene moiety of α-MTF was observed suggesting that the C2 position tolerates substitution with hydrogen bond acceptors. The key step in the synthesis of α-MDF was transformation of peracetylated 2-fluoro-maltal 1 into peracetylated 2,2-difluoro-α-maltosyl fluoride 2 in a single step via the use of Selectfluor®

The 2-79 keV X-ray spectrum of the circinus galaxy with NuSTAR, XMM-Newton, and Chandra: a fully compton-thick active galactic nucleus

DEFF Research Database (Denmark)

Arévalo, P.; Bauer, F. E.; Puccetti, S.

2014-01-01

The Circinus galaxy is one of the closest obscured active galactic nuclei (AGNs), making it an ideal target for detailed study. Combining archival Chandra and XMM-Newton data with new NuSTAR observations, we model the 2-79 keV spectrum to constrain the primary AGN continuum and to derive physical......-nuclear emission amounts to 18% of the nuclear flux in the Fe line region, but becomes comparable to the nuclear emission above 30 keV. The new analysis no longer supports a prominent transmitted AGN component in the observed band. We find that the nuclear spectrum is consistent with Compton scattering...

MINUTE-TIMESCALE >100 MeV γ -RAY VARIABILITY DURING THE GIANT OUTBURST OF QUASAR 3C 279 OBSERVED BY FERMI -LAT IN 2015 JUNE

Energy Technology Data Exchange (ETDEWEB)

Ackermann, M.; Buehler, R. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Anantua, R.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A.; Cameron, R. A. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Asano, K. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba, 277-8582 (Japan); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Gonzalez, J. Becerra [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Bellazzini, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bissaldi, E.; Caragiulo, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, I-70126 Bari (Italy); Bonino, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Bruel, P. [Laboratoire Leprince-Ringuet, École polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Caraveo, P. A. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica, I-20133 Milano (Italy); Cavazzuti, E. [Agenzia Spaziale Italiana (ASI) Science Data Center, I-00133 Roma (Italy); and others

2016-06-20

On 2015 June 16, Fermi -LAT observed a giant outburst from the flat spectrum radio quasar 3C 279 with a peak >100 MeV flux of ∼3.6 × 10{sup −5} photons cm{sup −2} s{sup −1}, averaged over orbital period intervals. It is historically the highest γ -ray flux observed from the source, including past EGRET observations, with the γ -ray isotropic luminosity reaching ∼10{sup 49} erg s{sup −1}. During the outburst, the Fermi spacecraft, which has an orbital period of 95.4 minutes, was operated in a special pointing mode to optimize the exposure for 3C 279. For the first time, significant flux variability at sub-orbital timescales was found in blazar observations by Fermi -LAT. The source flux variability was resolved down to 2-minute binned timescales, with flux doubling times of less than 5 minutes. The observed minute-scale variability suggests a very compact emission region at hundreds of Schwarzschild radii from the central engine in conical jet models. A minimum bulk jet Lorentz factor (Γ) of 35 is necessary to avoid both internal γ -ray absorption and super-Eddington jet power. In the standard external radiation Comptonization scenario, Γ should be at least 50 to avoid overproducing the synchrotron self-Compton component. However, this predicts extremely low magnetization (∼5 × 10{sup −4}). Equipartition requires Γ as high as 120, unless the emitting region is a small fraction of the dissipation region. Alternatively, we consider γ rays originating as synchrotron radiation of γ {sub e} ∼ 1.6 × 10{sup 6} electrons, in a magnetic field B ∼ 1.3 kG, accelerated by strong electric fields E ∼ B in the process of magnetoluminescence. At such short distance scales, one cannot immediately exclude the production of γ -rays in hadronic processes.

Exploring the Connection between Parsec-scale Jet Activity and Broadband Outbursts in 3C 279

Science.gov (United States)

Rani, B.; Jorstad, S. G.; Marscher, A. P.; Agudo, I.; Sokolovsky, K. V.; Larionov, V. M.; Smith, P.; Mosunova, D. A.; Borman, G. A.; Grishina, T. S.; Kopatskaya, E. N.; Mokrushina, A. A.; Morozova, D. A.; Savchenko, S. S.; Troitskaya, Yu. V.; Troitsky, I. S.; Thum, C.; Molina, S. N.; Casadio, C.

2018-05-01

We use a combination of high-resolution very long baseline interferometry (VLBI) radio and multiwavelength flux density and polarization observations to constrain the physics of the dissipation mechanism powering the broadband flares in 3C 279 during an episode of extreme flaring activity in 2013–2014. Six bright flares superimposed on a long-term outburst are detected at γ-ray energies. Four of the flares have optical and radio counterparts. The two modes of flaring activity (faster flares sitting on top of a long-term outburst) present at radio, optical, and γ-ray frequencies are missing in X-rays. X-ray counterparts are only observed for two flares. The first three flares are accompanied by ejection of a new VLBI component (NC2), suggesting the 43 GHz VLBI core as the site of energy dissipation. Another new component, NC3, is ejected after the last three flares, which suggests that the emission is produced upstream from the core (closer to the black hole). The study therefore indicates multiple sites of energy dissipation in the source. An anticorrelation is detected between the optical percentage polarization (PP) and optical/γ-ray flux variations, while the PP has a positive correlation with optical/γ-ray spectral indices. Given that the mean polarization is inversely proportional to the number of cells in the emission region, the PP versus optical/γ-ray anticorrelation could be due to more active cells during the outburst than at other times. In addition to the turbulent component, our analysis suggests the presence of a combined turbulent and ordered magnetic field, with the ordered component transverse to the jet axis.

FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

Energy Technology Data Exchange (ETDEWEB)

Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J. [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Akiyama, Kazunori; Honma, Mareki [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan); Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan, R.O.C. (China); Bower, Geoffrey C.; Dexter, Matt [Department of Astronomy, Radio Astronomy Laboratory, University of California Berkeley, 601 Campbell, Berkeley, CA 94720-3411 (United States); Brinkerink, Christiaan [Department of Astrophysics, IMAPP, Radboud University Nijmegen, P.O. Box 9010, 6500-GL Nijmegen (Netherlands); Chamberlin, Richard [Caltech Submillimeter Observatory, 111 Nowelo Street, Hilo, HI 96720 (United States); Freund, Robert [Arizona Radio Observatory, Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721-0065 (United States); Friberg, Per [James Clerk Maxwell Telescope, Joint Astronomy Centre, 660 North A' ohoku Place, University Park, Hilo, HI 96720 (United States); Gurwell, Mark A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Jorstad, Svetlana G. [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Krichbaum, Thomas P. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany); Loinard, Laurent, E-mail: rslu@haystack.mit.edu [Centro de Radiostronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, 58089 Morelia, Michoacan (Mexico); and others

2013-07-20

We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of {approx}1 pc extending along the northwest-southeast direction (P.A. = 127 Degree-Sign {+-} 3 Degree-Sign ), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of {approx}8 Multiplication-Sign 10{sup 10} K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 {mu}as (5-7 light months) resolution.

FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

International Nuclear Information System (INIS)

Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J.; Akiyama, Kazunori; Honma, Mareki; Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto; Bower, Geoffrey C.; Dexter, Matt; Brinkerink, Christiaan; Chamberlin, Richard; Freund, Robert; Friberg, Per; Gurwell, Mark A.; Jorstad, Svetlana G.; Krichbaum, Thomas P.; Loinard, Laurent

2013-01-01

We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of ∼1 pc extending along the northwest-southeast direction (P.A. = 127° ± 3°), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of ∼8 × 10 10 K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 μas (5-7 light months) resolution.

The synthesis of the deformed superheavy elements 107 to 111

International Nuclear Information System (INIS)

Armbuster, P.

1995-01-01

By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

Residual energy deposition in dental enamel during IR laser ablation at 2.79, 2.94, 9.6, and 10.6 μm

Science.gov (United States)

Ragadio, Jerome N.; Lee, Christian K.; Fried, Daniel

2000-03-01

The objective of this study was to measure the residual heat deposition during laser ablation at those IR laser wavelengths best suited for the removal of dental caries. The principal factor limiting the rate of laser ablation of dental hard tissue is the risk of excessive heat accumulation in the tooth, which has the potential for causing damage to the pulp. Optimal laser ablation systems minimize the residual energy deposition in the tooth by transferring deposited laser energy to kinetic and internal energy of ejected tissue components. The residual heat deposition in the tooth was measured at laser wavelengths of 2.79, 2.94, 9.6 and 10.6 micrometer and pulse widths of 150 ns - 150 microsecond(s) . The residual energy was at a minimum for fluences well above the ablation threshold where it saturates at values from 25 - 70% depending on pulse duration and wavelength for the systems investigated. The lowest values of the residual energy were measured for short (less than 20 microseconds) CO2 laser pulses at 9.6 micrometer and for Q-switched erbium laser pulses. This work was supported by NIH/NIDCR R29DE12091 and the Center for Laser Applications in Medicine, DOE DEFG0398ER62576.

X-ray/UV Observing Campaign on the Mrk 279 AGN Outflow: A Global Fitting Analysis of the UV Absorption

Energy Technology Data Exchange (ETDEWEB)

Gabel, J.

2005-03-17

We present an analysis of the intrinsic UV absorption in the Seyfert 1 galaxy Mrk 279 based on simultaneous long observations with the ''Hubble Space Telescope'' (41 ks) and the ''Far Ultraviolet Spectroscopic Explorer'' (91 ks). To extract the line-of-sight covering factors and ionic column densities, we separately fit two groups of absorption lines: the Lyman series and the CNO lithium-like doublets. For the CNO doublets we assume that all three ions share the same covering factors. The fitting method applied here overcomes some limitations of the traditional method using individual doublet pairs; it allows for the treatment of more complex, physically realistic scenarios for the absorption-emission geometry and eliminates systematic errors that we show are introduced by spectral noise. We derive velocity-dependent solutions based on two models of geometrical covering--a single covering factor for all background emission sources, and separate covering factors for the continuum and emission lines. Although both models give good statistical fits to the observed absorption, we favor the model with two covering factors because: (a) the best-fit covering factors for both emission sources are similar for the independent Lyman series and CNO doublet fits; (b) the fits are consistent with full coverage of the continuum source and partial coverage of the emission lines by the absorbers, as expected from the relative sizes of the nuclear emission components; and (c) it provides a natural explanation for variability in the Lya absorption detected in an earlier epoch. We also explore physical and geometrical constraints on the outflow from these results.

Using UVC Light-Emitting Diodes at Wavelengths of 266 to 279 Nanometers To Inactivate Foodborne Pathogens and Pasteurize Sliced Cheese

Science.gov (United States)

Kim, Soo-Ji; Kim, Do-Kyun

2015-01-01

UVC light is a widely used sterilization technology. However, UV lamps have several limitations, including low activity at refrigeration temperatures, a long warm-up time, and risk of mercury exposure. UV-type lamps only emit light at 254 nm, so as an alternative, UV light-emitting diodes (UV-LEDs) which can produce the desired wavelengths have been developed. In this study, we validated the inactivation efficacy of UV-LEDs by wavelength and compared the results to those of conventional UV lamps. Selective media inoculated with Escherichia coli O157:H7, Salmonella enterica serovar Typhimurium, and Listeria monocytogenes were irradiated using UV-LEDs at 266, 270, 275, and 279 nm in the UVC spectrum at 0.1, 0.2, 0.5, and 0.7 mJ/cm2, respectively. The radiation intensity of the UV-LEDs was about 4 μW/cm2, and UV lamps were covered with polypropylene films to adjust the light intensity similar to those of UV-LEDs. In addition, we applied UV-LED to sliced cheese at doses of 1, 2, and 3 mJ/cm2. Our results showed that inactivation rates after UV-LED treatment were significantly different (P UV lamps at a similar intensity. On microbiological media, UV-LED treatments at 266 and 270 nm showed significantly different (P < 0.05) inactivation effects than other wavelength modules. For sliced cheeses, 4- to 5-log reductions occurred after treatment at 3 mJ/cm2 for all three pathogens, with negligible generation of injured cells. PMID:26386061

Using UVC Light-Emitting Diodes at Wavelengths of 266 to 279 Nanometers To Inactivate Foodborne Pathogens and Pasteurize Sliced Cheese.

Science.gov (United States)

Kim, Soo-Ji; Kim, Do-Kyun; Kang, Dong-Hyun

2016-01-01

UVC light is a widely used sterilization technology. However, UV lamps have several limitations, including low activity at refrigeration temperatures, a long warm-up time, and risk of mercury exposure. UV-type lamps only emit light at 254 nm, so as an alternative, UV light-emitting diodes (UV-LEDs) which can produce the desired wavelengths have been developed. In this study, we validated the inactivation efficacy of UV-LEDs by wavelength and compared the results to those of conventional UV lamps. Selective media inoculated with Escherichia coli O157:H7, Salmonella enterica serovar Typhimurium, and Listeria monocytogenes were irradiated using UV-LEDs at 266, 270, 275, and 279 nm in the UVC spectrum at 0.1, 0.2, 0.5, and 0.7 mJ/cm(2), respectively. The radiation intensity of the UV-LEDs was about 4 μW/cm(2), and UV lamps were covered with polypropylene films to adjust the light intensity similar to those of UV-LEDs. In addition, we applied UV-LED to sliced cheese at doses of 1, 2, and 3 mJ/cm(2). Our results showed that inactivation rates after UV-LED treatment were significantly different (P < 0.05) from those of UV lamps at a similar intensity. On microbiological media, UV-LED treatments at 266 and 270 nm showed significantly different (P < 0.05) inactivation effects than other wavelength modules. For sliced cheeses, 4- to 5-log reductions occurred after treatment at 3 mJ/cm(2) for all three pathogens, with negligible generation of injured cells. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

Residual heat deposition in dental enamel during IR laser ablation at 2.79, 2.94, 9.6, and 10.6 microm.

Science.gov (United States)

Fried, D; Ragadio, J; Champion, A

2001-01-01

The principal factor limiting the rate of laser ablation of dental hard tissue is the risk of excessive heat accumulation in the tooth. Excessive heat deposition or accumulation may result in unacceptable damage to the pulp. The objective of this study was to measure the residual heat deposition during the laser ablation of dental enamel at those IR laser wavelengths well suited for the removal of dental caries. Optimal laser ablation systems minimize the residual heat deposition in the tooth by efficiently transferring the deposited laser energy to kinetic and internal energy of ejected tissue components. The residual heat deposition in dental enamel was measured at laser wavelengths of 2.79, 2.94, 9.6, and 10.6 microm and pulse widths of 150 nsec -150 microsec using bovine block "calorimeters." Water droplets were applied to the surface before ablation with 150 microsec Er:YAG laser pulses to determine the influence of an optically thick water layer on reducing heat deposition. The residual heat was at a minimum for fluences well above the ablation threshold where measured values ranged from 25-70% depending on pulse duration and wavelength for the systems investigated. The lowest values of the residual heat were measured for short (heat deposition during ablation with 150 microsec Er:YAG laser pulses. Residual heat deposition can be markedly reduced by using CO(2) laser pulses of less than 20 microsec duration and shorter Q-switched Er:YAG and Er:YSGG laser pulses for enamel ablation. Copyright 2001 Wiley-Liss, Inc.

26 CFR 1.279-5 - Rules for application of section 279(b).

Science.gov (United States)

2010-04-01

... from classification as corporate acquisition indebtedness for 1973 and all subsequent taxable years... paragraph as to whether such obligations may escape classification as corporate acquisition indebtedness...) Special rules for banks and lending or finance companies—(1) Debt to equity and projected earnings. Under...

Iron is a signal for Stenotrophomonas maltophilia biofilm formation, oxidative stress response, OMPs expression and virulence

Directory of Open Access Journals (Sweden)

Carlos Adrian Garcia

2015-09-01

Full Text Available Stenotrophomonas maltophilia is an emerging nosocomial pathogen. In many bacteria iron availability regulates, trough the Fur system, not only iron homeostasis but also virulence. The aim of this work was to assess the role of iron on S. maltophilia biofilm formation, EPS production, oxidative stress response, OMPs regulation, quorum sensing (QS, and virulence. Studies were done on K279 and its isogenic fur mutant F60 cultured in the presence or absence of dipyridyl. This is the first report of spontaneous fur mutants obtained in S. maltophilia. F60 produced higher amounts of biofilms than K279a and CLSM analysis demonstrated improved adherence and biofilm organization. Under iron restricted conditions, K279a produced biofilms with more biomass and enhanced thickness. In addition, F60 produced higher amounts of EPS than K279a but with a similar composition, as revealed by ATR-FTIR spectroscopy. With respect to the oxidative stress response, MnSOD was the only SOD isoenzyme detected in K279a. F60 presented higher SOD activity than the wt strain in planktonic and biofilm cultures, and iron deprivation increased K279a SOD activity. Under iron starvation, SDS-PAGE profile from K279a presented two iron-repressed proteins. Mass spectrometry analysis revealed homology with FepA and another putative TonB-dependent siderophore receptor of K279a. In silico analysis allowed the detection of potential Fur boxes in the respective coding genes. K279a encodes the QS diffusible signal factor (DSF. Under iron restriction K279a produced higher amounts of DSF than under iron rich condition. Finally, F60 was more virulent than K279a in the Galleria mellonella killing assay. These results put in evidence that iron levels regulate, likely through the Fur system, S. maltophilia biofilm formation, oxidative stress response, OMPs expression, DSF production and virulence.

Korean Affairs Report, Number 279

Science.gov (United States)

1983-04-27

genius of thought but also a true leader of the people. Alberto Beltran, chairman of the editorial council of the Mexican paper "El Dia," said...Guinea-Bissau and Cape Verde and minister of rural develop- ment, who had been on a visit to our country as a special envoy of Comrade Joao Bernardo

40 CFR 279.20 - Applicability.

Science.gov (United States)

2010-07-01

... this part. (2) Vessels. Vessels at sea or at port are not subject to this subpart. For purposes of this... reuse pursuant to section 402 or section 307(b) of the Clean Water Act or other applicable Federal or...) Filtering, separating or otherwise reconditioning used oil before burning it in a space heater pursuant to...

40 CFR 279.12 - Prohibitions.

Science.gov (United States)

2010-07-01

... new products, including the component parts of products, by mechanical or chemical processes; (ii) Utility boilers used to produce electric power, steam, heated or cooled air, or other gases or fluids for...

40 CFR 279.10 - Applicability.

Science.gov (United States)

2010-07-01

... crude distillation or catalytic cracking without prior mixing with crude oil is exempt from the... listed or identified as hazardous wastes. (4) Used oil re-refining distillation bottoms that are used as...) Used oil introduced into crude oil pipelines or a petroleum refining facility. (1) Used oil mixed with...

279-IJBCS-Article-Gbombele Soro

African Journals Online (AJOL)

User

Les sédiments de la lagune Ebrié (Côte d'Ivoire) ont été étudiés en vue de déterminer leur degré de pollution par ... alors que la partie centrale qui regroupe les baies a un index compris entre 0 et 1. ..... conductivité électrique (CE), la salinité,.

The 2-79 keV X-ray spectrum of the Circinus galaxy with NuSTAR, XMM-Newton, and Chandra: a fully Compton-thick active galactic nucleus

International Nuclear Information System (INIS)

Arévalo, P.; Bauer, F. E.; Puccetti, S.; Walton, D. J.; Fuerst, F.; Grefenstette, B. W.; Harrison, F. A.; Madsen, K. K.; Koss, M.; Boggs, S. E.; Craig, W. W.; Brandt, W. N.; Luo, B.; Brightman, M.; Christensen, F. E.; Comastri, A.; Gandhi, P.; Hailey, C. J.; Madejski, G.; Marinucci, A.

2014-01-01

The Circinus galaxy is one of the closest obscured active galactic nuclei (AGNs), making it an ideal target for detailed study. Combining archival Chandra and XMM-Newton data with new NuSTAR observations, we model the 2-79 keV spectrum to constrain the primary AGN continuum and to derive physical parameters for the obscuring material. Chandra's high angular resolution allows a separation of nuclear and off-nuclear galactic emission. In the off-nuclear diffuse emission, we find signatures of strong cold reflection, including high equivalent-width neutral Fe lines. This Compton-scattered off-nuclear emission amounts to 18% of the nuclear flux in the Fe line region, but becomes comparable to the nuclear emission above 30 keV. The new analysis no longer supports a prominent transmitted AGN component in the observed band. We find that the nuclear spectrum is consistent with Compton scattering by an optically thick torus, where the intrinsic spectrum is a power law of photon index Γ = 2.2-2.4, the torus has an equatorial column density of N H = (6-10) × 10 24 cm –2 , and the intrinsic AGN 2-10 keV luminosity is (2.3-5.1) × 10 42 erg s –1 . These values place Circinus along the same relations as unobscured AGNs in accretion rate versus Γ and L X versus L IR phase space. NuSTAR's high sensitivity and low background allow us to study the short timescale variability of Circinus at X-ray energies above 10 keV for the first time. The lack of detected variability favors a Compton-thick absorber, in line with the spectral fitting results.

The Structure and Emission Model of the Relativistic Jet in the Quasar 3C 279 Inferred From Radio To High-Energy Gamma-Ray Observations in 2008-2010

Science.gov (United States)

2012-01-01

We present time-resolved broad-band observations of the quasar 3C 279 obtained from multiwavelength campaigns conducted during the first two years of the Fermi Gamma-ray Space Telescope mission. While investigating the previously reported gamma-ray/optical flare accompanied by a change in optical polarization, we found that the optical emission appears delayed with respect to the gamma-ray emission by about 10 days. X-ray observations reveal a pair of 'isolated' flares separated. by approx. 90 days, with only weak gamma-ray/optical counterparts. The spectral structure measured by Spitzer reveals a synchrotron component peaking in the mid-infrared band with a sharp break at the far-infrared band during the gamma-ray flare, while the peak appears in the mm/sub-mm band in the low state. Selected spectral energy distributions are fitted with leptonic models including Comptonization of external radiation produced in a dusty torus or the broad-line region. Adopting the interpretation of the polarization swing involving propagation of the emitting region along a curved trajectory, we can explain the evolution of the broad-band spectra during the gamma-ray flaring event by a shift of its location from approx. 1 pc to approx. 4 pc from the central black hole. On the other hand, if the gamma-ray flare is generated instead at sub-pc distance from the central black hole, the far-infrared break can be explained by synchrotron self-absorption. We also model the low spectral state, dominated by the mm/sub-mm peaking synchrotron component, and suggest that the corresponding inverse-Compton component explains the steady X-ray emission.

Liver fat content, non-alcoholic fatty liver disease, and ischaemic heart disease: Mendelian randomization and meta-analysis of 279 013 individuals.

Science.gov (United States)

Lauridsen, Bo Kobberø; Stender, Stefan; Kristensen, Thomas Skårup; Kofoed, Klaus Fuglsang; Køber, Lars; Nordestgaard, Børge G; Tybjærg-Hansen, Anne

2018-02-01

In observational studies, non-alcoholic fatty liver disease (NAFLD) is associated with high risk of ischaemic heart disease (IHD). We tested the hypothesis that a high liver fat content or a diagnosis of NAFLD is a causal risk factor for IHD. In a cohort study of the Danish general population (n = 94 708/IHD = 10 897), we first tested whether a high liver fat content or a diagnosis of NAFLD was associated observationally with IHD. Subsequently, using Mendelian randomization, we tested whether a genetic variant in the gene encoding the protein patatin-like phospholipase domain containing 3 protein (PNPLA3), I148M (rs738409), a strong and specific cause of high liver fat content and NAFLD, was causally associated with the risk of IHD. We found that the risk of IHD increased stepwise with increasing liver fat content (in quartiles) up to an odds ratio (OR) of 2.41 (1.28-4.51)(P-trend = 0.004). The corresponding OR for IHD in individuals with vs. without NAFLD was 1.65 (1.34-2.04)(P = 3×10-6). PNPLA3 I148M was associated with a stepwise increase in liver fat content of up to 28% in MM vs. II-homozygotes (P-trend = 0.0001) and with ORs of 2.03 (1.52-2.70) for NAFLD (P = 3×10-7), 3.28 (2.37-4.54) for cirrhosis (P = 4×10-12), and 0.95 (0.86-1.04) for IHD (P = 0.46). In agreement, in meta-analysis (N = 279 013/IHD = 71 698), the OR for IHD was 0.98 (0.96-1.00) per M-allele vs. I-allele. The OR for IHD per M-allele higher genetically determined liver fat content was 0.98 (0.94-1.03) vs. an observational estimate of 1.05 (1.02-1.09)(P for comparison = 0.02). Despite confirming the known observational association of liver fat content and NAFLD with IHD, lifelong, genetically high liver fat content was not causally associated with risk of IHD. These results suggest that the observational association is due to confounding or reverse causation. Published on behalf of the European Society of Cardiology. All rights reserved. �

32 CFR 279.4 - Claims process.

Science.gov (United States)

2010-07-01

... should be taken to work with family members of eligible Service members who are deceased. These family... by the Service, then sent forward to the Defense Finance and Accounting Service (DFAS) for payment...

Reference: 279 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ork, N.Y.) Bandyopadhyay Anindita|Blakeslee Joshua|Gaxiola Roberto|Gilroy Simon|Khodakovskaya Mariya|Krizek ...Beth|Li Jisheng|Murphy Angus S|Peer Wendy Ann|Richards Elizabeth L|Richter Gregory|Titapiwantakun Boosaree|Undurraga Soledad|Yang Haibing

Inhibition of the oncogenic fusion protein EWS-FLI1 causes G2-M cell cycle arrest and enhanced vincristine sensitivity in Ewing's sarcoma.

Science.gov (United States)

Zöllner, Stefan K; Selvanathan, Saravana P; Graham, Garrett T; Commins, Ryan M T; Hong, Sung Hyeok; Moseley, Eric; Parks, Sydney; Haladyna, Jessica N; Erkizan, Hayriye V; Dirksen, Uta; Hogarty, Michael D; Üren, Aykut; Toretsky, Jeffrey A

2017-10-03

Ewing's sarcoma (ES) is a rare and highly malignant cancer that grows in the bones or surrounding tissues mostly affecting adolescents and young adults. A chimeric fusion between the RNA binding protein EWS and the ETS family transcription factor FLI1 (EWS-FLI1), which is generated from a chromosomal translocation, is implicated in driving most ES cases by modulation of transcription and alternative splicing. The small-molecule YK-4-279 inhibits EWS-FLI1 function and induces apoptosis in ES cells. We aimed to identify both the underlying mechanism of the drug and potential combination therapies that might enhance its antitumor activity. We tested 69 anticancer drugs in combination with YK-4-279 and found that vinca alkaloids exhibited synergy with YK-4-279 in five ES cell lines. The combination of YK-4-279 and vincristine reduced tumor burden and increased survival in mice bearing ES xenografts. We determined that independent drug-induced events converged to cause this synergistic therapeutic effect. YK-4-279 rapidly induced G 2 -M arrest, increased the abundance of cyclin B1, and decreased EWS-FLI1-mediated generation of microtubule-associated proteins, which rendered cells more susceptible to microtubule depolymerization by vincristine. YK-4-279 reduced the expression of the EWS-FLI1 target gene encoding the ubiquitin ligase UBE2C, which, in part, contributed to the increase in cyclin B1. YK-4-279 also increased the abundance of proapoptotic isoforms of MCL1 and BCL2, presumably through inhibition of alternative splicing by EWS-FLI1, thus promoting cell death in response to vincristine. Thus, a combination of vincristine and YK-4-279 might be therapeutically effective in ES patients. Copyright © 2017 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

Comparison of the long-term trends in stratospheric dynamics of four reanalyses

Czech Academy of Sciences Publication Activity Database

Kozubek, Michal; Križan, Peter; Laštovička, Jan

2017-01-01

Roč. 35, č. 2 (2017), s. 279-294 ISSN 0992-7689 R&D Projects: GA ČR(CZ) GA15-03909S; GA ČR(CZ) GA15-24688S Institutional support: RVO:68378289 Keywords : climatology * general circulation * middle atmosphere dynamic Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 1.610, year: 2016 http://www.ann-geophys.net/35/279/2017/angeo-35-279-2017.html

In vivo efficacy of the AKT inhibitor ARQ 092 in Noonan Syndrome with multiple lentigines-associated hypertrophic cardiomyopathy.

Directory of Open Access Journals (Sweden)

Jianxun Wang

Full Text Available Noonan Syndrome with Multiple Lentigines (NSML, formerly LEOPARD syndrome is an autosomal dominant "RASopathy" disorder manifesting in congenital heart disease. Most cases of NSML are caused by catalytically inactivating mutations in the protein tyrosine phosphatase (PTP, non-receptor type 11 (PTPN11, encoding the SH2 domain-containing PTP-2 (SHP2 protein. We previously generated knock-in mice harboring the PTPN11 mutation Y279C, one of the most common NSML alleles; these now-termed SHP2Y279C/+ mice recapitulate the human disorder and develop hypertrophic cardiomyopathy (HCM by 12 weeks of age. Functionally, heart and/or cardiomyocyte lysates from SHP2Y279C/+ mice exhibit increased basal and agonist-induced AKT and mTOR activities. Here, we sought to determine whether we could reverse the hypertrophy in SHP2Y279C/+ mice using ARQ 092, an oral and selective allosteric AKT inhibitor currently in clinical trials for patients with PI3K/AKT-driven tumors or Proteus syndrome. We obtained echocardiographs of SHP2Y279C/+ and wildtype (SHP2+/+ littermates, either in the presence or absence of ARQ 092 at 12, 14, and 16 weeks of age. While SHP2Y279C/+ mice developed significant left ventricular hypertrophy by 12 weeks, as indicated by decreased chamber dimension and increased posterior wall thickness, treatment of SHP2Y279C/+ mice with ARQ 092 normalized the hypertrophy in as early as 2 weeks following treatment, with hearts comparable in size to those in wildtype (SHP2+/+ mice. In addition, we observed an increase in fractional shortening (FS% in SHP2Y279C/+ mice, an effect of increased compensatory hypertrophy, which was not apparent in SHP2Y279C/+ mice treated with ARQ 092, suggesting functional improvement of HCM upon treatment with the AKT inhibitor. Finally, we found that ARQ 092 specifically inhibited AKT activity, as well as its downstream effectors, PRAS and S6RP in NSML mice. Taken together, these data suggest ARQ 092 may be a promising novel

In Silico Genome Mismatch Scanning to Map Breast Cancer Genes in Extended Pedigrees

Science.gov (United States)

2008-07-01

University College London Annals of Human Genetics (2008) 72,279–287 279 A. Thomas et al. Methods IBD sharing in pedigrees There is considerable literature...is sufficient to maintain interest in the region. 282 Annals of Human Genetics (2008) 72,279–287 C© 2007 The Authors Journal compilation C© 2007...for observed IBS instead of IBD, and for sporadic cases reducing the number of meioses, pedigrees with meiosis count d in the 25 to 30 range are

Medical Resource Allocation: Injury and Disease Incidence among Marines in Vietnam

Science.gov (United States)

1989-09-01

HELMINTHIASIS ALL 279 0.00000 0.00O00 0.04259 0.00000 0.00000 INTRACRAN HEMOR NON-TRAUMA 280 0.00000 0.00000 0.00000 0.00000 0.00000 COMA INTRACRAN HEMOR NON...WMO CHRNC 278 0 0.00000 HELMINTHIASIS ALL 279 2068 0.01618 INTRACRAN HEMOR NON-TRAUMA 280 0 0.00000 COMA INTRACRAN HEMOR NON-TRAU14ATC 281 0 0.00000...disabling symptoms, unresponsive to treatment 278 Regional ileitis, responds to treatment 279 Helminthiasis , al] cases 280 Intracranial hemorrhage

Environmental stability and seasonality of a harpacticoid copepod community

Digital Repository Service at National Institute of Oceanography (India)

Ansari, Z.A.; Parulekar, A.H.

stream_size 8 stream_content_type text/plain stream_name Mar_Biol_115_279.pdf.txt stream_source_info Mar_Biol_115_279.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

75 FR 8313 - Privacy Act of 1974; System of Records

Science.gov (United States)

2010-02-24

... Psychological Assessment (PPA), Building 5725, Room 279, 319th Training Squadron, 1550 Wurtsmith Street... authority, Personnel Psychological Assessment (PPA) psychologist and squadron commanders to determine an...: Personnel Psychological Assessment (PPA), Building 5725, Room 279, 319th Training Squadron, 1550 Wurtsmith...

26 CFR 1.279-4 - Special rules.

Science.gov (United States)

2010-04-01

... issuing corporation issues any obligation to provide consideration for an acquisition described in section... as corporate acquisition indebtedness in any taxable year following 1975, even if the issuing... later years to provide consideration for the acquisition of additional stock in, or assets of, the same...

40 CFR 279.61 - Restrictions on burning.

Science.gov (United States)

2010-07-01

... other gases or fluids for sale; or (iii) Used oil-fired space heaters provided that the burner meets the... substances are transformed into new products, including the component parts of products, by mechanical or...

33 CFR 279.8 - Synthesis and analysis.

Science.gov (United States)

2010-07-01

... attainment of tangible recreation benefits. However, preservation of the existing habitat would produce intangible benefits to society by enhancing a species otherwise likely to be lost to the area. (b) Diversity... fishing and passive recreation use such as hiking trails, nature, and ecological study areas. (c...

40 CFR 279.52 - General facility standards.

Science.gov (United States)

2010-07-01

... familiar with all aspects of the facility's contingency plan, all operations and activities at the facility... response roles if their help is needed. (ii) Whenever there is a release, fire, or explosion, the emergency...

P2X1 Receptor Antagonists Inhibit HIV-1 Fusion by Blocking Virus-Coreceptor Interactions.

Science.gov (United States)

Giroud, Charline; Marin, Mariana; Hammonds, Jason; Spearman, Paul; Melikyan, Gregory B

2015-09-01

HIV-1 Env glycoprotein-mediated fusion is initiated upon sequential binding of Env to CD4 and the coreceptor CXCR4 or CCR5. Whereas these interactions are thought to be necessary and sufficient to promote HIV-1 fusion, other host factors can modulate this process. Previous studies reported potent inhibition of HIV-1 fusion by selective P2X1 receptor antagonists, including NF279, and suggested that these receptors play a role in HIV-1 entry. Here we investigated the mechanism of antiviral activity of NF279 and found that this compound does not inhibit HIV-1 fusion by preventing the activation of P2X1 channels but effectively blocks the binding of the virus to CXCR4 or CCR5. The notion of an off-target effect of NF279 on HIV-1 fusion is supported by the lack of detectable expression of P2X1 receptors in cells used in fusion experiments and by the fact that the addition of ATP or the enzymatic depletion of ATP in culture medium does not modulate viral fusion. Importantly, NF279 fails to inhibit HIV-1 fusion with cell lines and primary macrophages when added at an intermediate stage downstream of Env-CD4-coreceptor engagement. Conversely, in the presence of NF279, HIV-1 fusion is arrested downstream of CD4 binding but prior to coreceptor engagement. NF279 also antagonizes the signaling function of CCR5, CXCR4, and another chemokine receptor, as evidenced by the suppression of calcium responses elicited by specific ligands and by recombinant gp120. Collectively, our results demonstrate that NF279 is a dual HIV-1 coreceptor inhibitor that interferes with the functional engagement of CCR5 and CXCR4 by Env. Inhibition of P2X receptor activity suppresses HIV-1 fusion and replication, suggesting that P2X signaling is involved in HIV-1 entry. However, mechanistic experiments conducted in this study imply that P2X1 receptor is not expressed in target cells or involved in viral fusion. Instead, we found that inhibition of HIV-1 fusion by a specific P2X1 receptor antagonist, NF

Bioeconomic synergy between tactics for insect eradication in the presence of Allee effects

Czech Academy of Sciences Publication Activity Database

Blackwood, J. C.; Berec, Luděk; Yamanaka, T.; Epanchin-Niell, R. S.; Hastings, A.; Liebhold, A. M.

2012-01-01

Roč. 279, č. 1739 (2012), s. 2807-2815 ISSN 0962-8452 Grant - others:National Science Foundation(US) EF-0553768 Institutional research plan: CEZ:AV0Z50070508 Keywords : Allee effect * eradication * management cost Subject RIV: EH - Ecology, Behaviour Impact factor: 5.683, year: 2012 http://rspb.royalsocietypublishing.org/content/279/1739/2807.full

A comparison of the impact of direct and indirect benefits of mating decisions in the rose bitterling (Rhodeus ocellatus)

Czech Academy of Sciences Publication Activity Database

Agbali, M.; Spence, R.; Reichard, Martin; Smith, C.

2012-01-01

Roč. 58, č. 4 (2012), s. 279-288 ISSN 1565-9801 R&D Projects: GA ČR GA206/09/1163 Institutional support: RVO:68081766 Keywords : bitterling * direct selection * indirect selection * mate choice * oviposition * Rhodeus ocellatus Subject RIV: EG - Zoology Impact factor: 0.444, year: 2012 http://www.tandfonline.com/doi/abs/10.1560/IJEE.58.4.279

Non-Self-Maintained Discharge Application for Fuel Activation

Science.gov (United States)

2010-09-21

references have been used: Eliasson B., Kogelschatz U., J. de Chimie Physique. 1986. V.83. P.279. Maetzing H. Chemical Kinetics of Flue Gas Cleaning by...Person J.C., Ham D.O. Radiat. Phys. Chem. 1988. V. 31. N.1-3. P. Eliasson B., Kogelschatz U., J. de Chimie Physique. 1986. V.83. P.279. Mukkavilli

40 CFR 271.26 - Requirements for used oil management.

Science.gov (United States)

2010-07-01

... to EPA under § 271.5) EPA to allow the use of used oil (that is not mixed with hazardous waste and... part 271, state programs shall have standards for the marketing and burning of used oil for energy...) and (b) Sec. 279.66(b) Sec. 279.72(b) 1 Contains additional new definitions that were not included in...

Dicty_cDB: CFI279 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available fvymni**ikhnknxiiyifivtlyeylkigkhflkigkhy*kkk*idf*l*kk--- ---xxxxxxxxxxxxxxxxxxxxxxxaxfxxvxxvyxxxxxxxxx...lxxxlxlxxxlxlxl xxxllxxpllqplpqlq Frame C: lfi*tfnk*ntikxilfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxcmxxxxxxxxxsxcxxxcxxxcxxxc xxxcyxxrysnrypns Homology vs CS

40 CFR 279.31 - Used oil collection centers.

Science.gov (United States)

2010-07-01

... (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Collection Centers and.../aggregates and stores used oil collected from used oil generators regulated under subpart C of this part who...

7 CFR 2.79 - Administrator, Agricultural Marketing Service.

Science.gov (United States)

2010-01-01

... Foods Research and Nutrition Education Act (7 U.S.C. 3401-3417), except as delegated in § 2.43(a)(24... into the environment; (ii) Sections 104(e)-(h) of the Act (42 U.S.C. 9604(e)-(h)), with respect to... wage and labor standards applicable to covered work; and emergency procurement powers; (iii) Section...

30 CFR 27.9 - Date for conducting tests.

Science.gov (United States)

2010-07-01

... Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND... completing such other test work as may be in progress. [31 FR 10607, Aug. 9, 1966, as amended at 70 FR 46343.... The date of receipt of an application will determine the order of precedence for investigation and...

Isothermal phase (vapour + liquid) equilibrium data for binary mixtures of propene (R1270) with either 1,1,2,3,3,3-hexafluoro-1-propene (R1216) or 2,2,3-trifluoro-3-(trifluoromethyl)oxirane in the temperature range of (279 to 318) K

International Nuclear Information System (INIS)

Subramoney, Shalendra Clinton; Nelson, Wayne Michael; Courtial, Xavier; Naidoo, Paramespri; Coquelet, Christophe; Richon, Dominique; Ramjugernath, Deresh

2015-01-01

Highlights: • Phase equilibrium data for propene and hexafluoropropylene. • Phase equilibrium data for propene and hexafluoropropylene oxide. • Systems exhibit pressure-maximum azeotropes. • Data well correlated by Peng–Robinson equation of state with the Wong–Sandler mixing rule. - Abstract: Isothermal (vapour + liquid) equilibrium data (P–x–y) are presented for the 1-propene 1,1,2,3,3,3-hexafluoro-1-propene and the 1-propene + 2,2,3-trifluoro-3-(trifluoromethyl)oxirane binary systems. Both binary systems were studied at five temperatures, ranging from (279.36 to 318.09) K, at pressures up to 2 MPa. The experimental (vapour + liquid) equilibrium data were measured using an apparatus based on the “(static + analytic)” method incorporating a single movable Rapid On-Line Sampler-Injector to sample the liquid and vapour phases at equilibrium. The expanded uncertainties are approximated on average as T = 0.07 K, 0.008 MPa, and 0.007 and 0.009 for the temperature, pressure, and the liquid and vapour mole fractions, respectively. A homogenous maximum-pressure azeotrope was observed for both binary systems at all temperatures studied. The experimental data were correlated with the Peng–Robinson equation of state using the Mathias–Copeman alpha function, paired with the Wong–Sandler mixing rule and the Non-Random Two Liquid activity coefficient model. The model provided satisfactory representation of the phase equilibrium data measured

10th Annual Small Business Conference

Science.gov (United States)

2006-11-02

for Navy ships supra and Navy aircraft at NAVAIR in Washington, DC, i.e., OV-10 Broncos , T-2 training jets, KFIR aircraft manufactured by the Israeli...Contractors: 38,000+ Total AMC in SWA – 57,279 rese ce: cati s – 149 tates – 43 tries – 55 ers el : 53,181 tract rs: 38,000+ tal i – 57,279 4UNCLASSIFIED

When Democracy Is Not Enough

DEFF Research Database (Denmark)

Charron, Nicholas

2014-01-01

Book review of: Making Democratic Governance Work: How Regimes Shape Prosperity, Welfare, and Peace. By Pippa Norris. New York: Cambridge University Press, 2012. 279 pp., $30.99 paperback (ISBN-13: 978-1-107-60269-4).......Book review of: Making Democratic Governance Work: How Regimes Shape Prosperity, Welfare, and Peace. By Pippa Norris. New York: Cambridge University Press, 2012. 279 pp., $30.99 paperback (ISBN-13: 978-1-107-60269-4)....

279 Department of Agronomy/Sugar Research Institute, University of ...

African Journals Online (AJOL)

Osondu

2014-04-09

Apr 9, 2014 ... collected on weed density, weed biomass, sugarcane tiller count and cane yield. Our results ... marginal productivity of their farm land and high cost of inputs ..... Pakistan reported similar results between number of tillers and ...

279 Department of Agronomy/Sugar Research Institute, University of ...

African Journals Online (AJOL)

Osondu

2014-04-09

Apr 9, 2014 ... sugarcane production in Nigeria. The competition for water, light, nutrients and space between weeds and the crop can reduce sugarcane stalk population and yield. Weed interference is a major biotic constraint to optimal crop production. Singh et al. (1980) reported that weed. - crop competition is effective ...

All projects related to | Page 279 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Program: Canadian International Food Security Research Fund ... two regions of the Peruvian Andes (Cusco and Cajamarca) known for their high biodiversity and active farmers' associations. ... Obesity rates are on the rise in the Caribbean.

Determining gold content

International Nuclear Information System (INIS)

Clayton, C.G.; Wormald, M.R.

1981-01-01

A method for determining the gold content of a material, comprises irradiating a body of the material with neutrons and determining the intensity of γ-rays having an energy of 279 keV arising from the reaction 179 Au(nn') 179 Au → 279 keV. The apparatus has means for conveying the materials past an assembly, which has a neutron source, which does not produce neutrons having sufficient energy to excite fast neutron reactions in non-auriferous constituents. (author)

Postreplication repair gap filling in an Escherichia coli strain deficient in dnaB gene product

International Nuclear Information System (INIS)

Johnson, R.C.

1975-01-01

Gaps in daughter-strand DNA synthesized after exposure of Escherichia coli E279 to ultraviolet light are filled during reincubation at 30 0 C for 20 min. Escherichia coli E279 is phenotypically DnaB - when incubated at 43 0 C. Cells incubated at 43 0 C were tested for their ability to complete postreplication repair gap filling. It is concluded that the dnaB gene product is essential for postreplication repair gap filling and that the inhibition seen is not initially the result of degradation

ORF Alignment: NC_003028 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 279 ... Query: 27 ... GKLNIVTTFYPVYEFTKQVAGDTANVELLIGAGTEPHEYEPSAKAVAKIQDADTFVYENE 86 ... ... ... GKLNIVTTFYPVYEFTKQVAGDTANVELLIGAGTEPHEYEPSAKAVAKIQDADTFVYENE Sbjct: 1 ... GKLNIVTTFYPVYEFTKQVAGDTANVEL

Is the Universe More Transparent to Gamma Rays than Previously Thought?

Science.gov (United States)

Stecker, Floyd W.; Scully, Sean T.

2009-01-01

The MAGIC collaboration has recently reported the detection of the strong gamma-ray blazar 3C279 during a 1-2 day flare. They have used their spectral observations to draw conclusions regarding upper limits on the opacity of the Universe to high energy gamma-rays and, by implication, upper limits on the extragalactic mid-infrared background radiation. In this paper we examine the effect of gamma-ray absorption by the extragalactic infrared radiation on intrinsic spectra for this blazar and compare our results with the observational data on 3C279. We find agreement with our previous results, contrary to the recent assertion of the MAGIC group that the Universe is more transparent to gamma-rays than our calculations indicate. Our analysis indicates that in the energy range between approx. 80 and approx. 500 GeV, 3C279 has a best-fit intrinsic spectrum with a spectral index approx. 1.78 using our fast evolution model and approx. 2.19 using our baseline model. However, we also find that spectral indices in the range of 1.0 to 3.0 are almost as equally acceptable as the best fit spectral indices. Assuming the same intrinsic spectral index for this flare as for the 1991 flare from 3C279 observed by EGRET, viz., 2.02, which lies between our best fit indeces, we estimate that the MAGIC flare was approx.3 times brighter than the EGRET flare observed 15 years earlier.

ORF Alignment: NC_003318 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 70 ... Query: 220 DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 279 ... DKLKRALEAERSFTANSAHEL...RTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR Sbjct: 1 ... DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 60 ...

ORF Alignment: NC_003424 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available KLPFLKLA 180 ... Query: 279 SRGSNQLASSSLVGDTAINVWDITRPYIPYRTVSCHDSIVSTMHWASTELLWSCSK...DGIF 338 ... SRGSNQLASSSLVGDTAINVWDITRPYIPYRTVSCHDSIVSTMHWASTELLWSCSKDGIF Sbjct: 241 SRGSNQLASSSLVGDTAINVWDITRPYIPYRTVSCHDSIVSTMHWASTELLWSCSKDGIF 300 ...

In-vitro inhibition of IFNγ+ iTreg mediated by monoclonal antibodies against cell surface determinants essential for iTreg function

Directory of Open Access Journals (Sweden)

Daniel Volker

2012-08-01

Full Text Available Abstract Background IFNγ-producing CD4+CD25+Foxp3+ PBL represent a subtype of iTreg that are associated with good long-term graft outcome in renal transplant recipients and suppress alloresponses in-vitro. To study the mechanism of immunosuppression, we attempted to block cell surface receptors and thereby inhibited the function of this iTreg subset in-vitro using monoclonal antibodies and recombinant proteins. Methods PBL of healthy control individuals were stimulated polyclonally in-vitro in the presence of monoclonal antibodies or recombinant proteins against/of CD178, CD152, CD279, CD28, CD95, and HLA-DR. Induction of IFNγ+ iTreg and proliferation of effector cells was determined using four-color fluorescence flow cytometry. Blockade of iTreg function was analyzed using polyclonally stimulated co-cultures with separated CD4+CD25+CD127-IFNγ+ PBL. Results High monoclonal antibody concentrations inhibited the induction of CD4+CD25+Foxp3+IFNγ+ PBL (anti-CD152, anti-CD279, anti-CD95: p +CD25+CD127-IFNγ+ PBL (anti-CD178, anti-CD152, anti-CD279, anti-CD95: p +CD25+Foxp3+IFNγ+ PBL (rCD152 and rCD95: p +CD25+CD127-IFNγ+ PBL showed lower cell proliferation than co-cultures with CD4+CD25+CD127-IFNγ- PBL (p +CD25+CD127-IFNγ- PBL-containing co-cultures in the presence of monoclonal antibody (anti-CD28, anti-CD152, anti-CD279: p +CD25+CD127-IFNγ+ PBL (with the exception anti-CD28 monoclonal antibody: p +CD25+CD127-IFNγ- PBL but do not efficiently block suppressive iTreg function in co-cultures with CD4+CD25+CD127-IFNγ+ PBL. Conclusions CD178, CD152, CD279, CD28, CD95, and HLA-DR determinants are important for induction and suppressive function of IFNγ+ iTreg.

Two secondary carbohydrate binding sites on the surface of barley alpha-amylase 1 have distinct functions and display synergy in hydrolysis of starch granules.

Science.gov (United States)

Nielsen, Morten M; Bozonnet, Sophie; Seo, Eun-Seong; Mótyán, János A; Andersen, Joakim M; Dilokpimol, Adiphol; Abou Hachem, Maher; Gyémánt, Gyöngyi; Naested, Henrik; Kandra, Lili; Sigurskjold, Bent W; Svensson, Birte

2009-08-18

Some polysaccharide processing enzymes possess secondary carbohydrate binding sites situated on the surface far from the active site. In barley alpha-amylase 1 (AMY1), two such sites, SBS1 and SBS2, are found on the catalytic (beta/alpha)(8)-barrel and the noncatalytic C-terminal domain, respectively. Site-directed mutagenesis of Trp(278) and Trp(279), stacking onto adjacent ligand glucosyl residues at SBS1, and of Tyr(380) and His(395), making numerous ligand contacts at SBS2, suggested that SBS1 and SBS2 act synergistically in degradation of starch granules. While SBS1 makes the major contribution to binding and hydrolysis of starch granules, SBS2 exhibits a higher affinity for the starch mimic beta-cyclodextrin. Compared to that of wild-type AMY1, the K(d) of starch granule binding by the SBS1 W278A, W279A, and W278A/W279A mutants thus increased 15-35 times; furthermore, the k(cat)/K(m) of W278A/W279A was 2%, whereas both affinity and activity for Y380A at SBS2 were 10% of the wild-type values. Dual site double and triple SBS1/SBS2 substitutions eliminated binding to starch granules, and the k(cat)/K(m) of W278A/W279A/Y380A AMY1 was only 0.4% of the wild-type value. Surface plasmon resonance analysis of mutants showed that beta-cyclodextrin binds to SBS2 and SBS1 with K(d,1) and K(d,2) values of 0.07 and 1.40 mM, respectively. A model that accounts for the observed synergy in starch hydrolysis, where SBS1 and SBS2 bind ordered and free alpha-glucan chains, respectively, thus targeting the enzyme to single alpha-glucan chains accessible for hydrolysis, is proposed. SBS1 and SBS2 also influence the kinetics of hydrolysis for amylose and maltooligosaccharides, the degree of multiple attack on amylose, and subsite binding energies.

A novel lipoprotein lipase gene missense mutation in Chinese patients with severe hypertriglyceridemia and pancreatitis

Science.gov (United States)

2014-01-01

Background Alterations or mutations in the lipoprotein lipase (LPL) gene contribute to severe hypertriglyceridemia (HTG). This study reported on two patients in a Chinese family with LPL gene mutations and severe HTG and acute pancreatitis. Methods Two patients with other five family members were included in this study for DNA-sequences of hyperlipidemia-related genes (such as LPL, APOC2, APOA5, LMF1, and GPIHBP1) and 43 healthy individuals and 70 HTG subjects were included for the screening of LPL gene mutations. Results Both patients were found to have a compound heterozygote for a novel LPL gene mutation (L279V) and a known mutation (A98T). Furthermore, one HTG subject out of 70 was found to carry this novel LPL L279V mutation. Conclusions The data from this study showed that compound heterozygote mutations of A98T and L279V inactivate lipoprotein lipase enzymatic activity and contribute to severe HTG and acute pancreatitis in two Chinese patients. Further study will investigate how these LPL gene mutations genetically inactivate the LPL enzyme. PMID:24646025

The evolution of IRRR nuclear standards from the single failure criterion and their impact on system design

International Nuclear Information System (INIS)

Clark, D.H.

1978-01-01

One of the first industry standards developed in the United States to meet regulatory agency criteria for the design and installation of nuclear power plant control and instrumentation systems was prepared by the Institute of Electrical and Electronics Engineers, Inc., abbreviated IEEE. This was IEEE Std. 279, first issued in 1968. It was subsequently revised and reissued as IEEE Std. 279-1971 ''IEEE Standard: Criteria for Protection Systems for Nuclear Power Generating Stations''. Not only has the implementation of this standard had a tremendous impact on nuclear power plant design in the United States, it has been the base document from which subsequent IEEE nuclear standards have been developed. Three major concepts which are addressed by IEEE 279, and which have had a major impact upon control and instrumentation systems in nuclear power plants are the following : 1) Single failure criterion. 2) Equipment qualification. 3) Channel independence. Each of these concepts has resulted in the development of subsequent IEEE Nuclear Standards. The impact of some of these on control and instrumentation systems are discussed. (author)

People and things. CERN Courier, Nov 1987, v. 27(9)

Energy Technology Data Exchange (ETDEWEB)

Anon.

1987-11-15

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 1988 CERN School of Physics will be organized jointly by the Nuclear Research Centre 'Demokritos', Athens and CERN. Its basic aim is to teach various aspects of high energy physics, but especially theoretical physics, to young experimental physicists, mainly from the Member States of CERN. It will be held in Lefkada, Greece, from 18 September to 1 October 1988. The first and highly successful Asia-Pacific Workshop on High Energy Physics, devoted to Superstrings, Anomalies and Field Theory, was held in Singapore this summer.

People and things. CERN Courier, Nov 1987, v. 27(9)

International Nuclear Information System (INIS)

Anon.

1987-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 1988 CERN School of Physics will be organized jointly by the Nuclear Research Centre 'Demokritos', Athens and CERN. Its basic aim is to teach various aspects of high energy physics, but especially theoretical physics, to young experimental physicists, mainly from the Member States of CERN. It will be held in Lefkada, Greece, from 18 September to 1 October 1988. The first and highly successful Asia-Pacific Workshop on High Energy Physics, devoted to Superstrings, Anomalies and Field Theory, was held in Singapore this summer

IAEA Newsbriefs. V. 13, no. 2(79). Apr-May 1998

International Nuclear Information System (INIS)

1998-01-01

This issue gives brief information on the following topics: IAEA Board Meetings Set in May and June, Database of the IAEA's International Nuclear Information Systems (INIS) is being made available over the Internet free of charge, Senior Expert Group Starts Review of IAEA Programmes, IAEA Reports to Security Council on Nuclear Inspections in Iraq, Parties Consider Extending Fusion Research through the ITER Project, Status of Joint Safety and Nuclear Liability Conventions, Proposed Global Convention Against Nuclear Terrorism, Upcoming Symposia and Conferences, New IAEA Books, Nuclear Data File, and other short information

5 CFR 532.279 - Special wage schedules for printing positions.

Science.gov (United States)

2010-01-01

... the printing survey as follows: (1) The lead agency must include North American Industry... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special wage schedules for printing... printing positions. (a) The lead agency in a special printing schedule area listed in paragraph (j) of this...

ORF Alignment: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available M279) [Caenorhabditis elegans] ... Length = 77 ... Query: 133 SDSIITRSEVNMHCSEDDCWIIVGNYVYDVTKFVDLHPGGPEI...LLEFAGGDATDAFESVG 192 ... SDSIITRSEVNMHCSEDDCWIIVGNYVYDVTKFVDLHPGGPEILLEFAGGDATDAFESVG Sbjct: 1 ... SDSIITRSEVNMHCSEDDCWIIVGNYVYDVTKFVDLHPGGPEILLEFAGGDATDAFESVG 60 ...

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s thaliana] ... Length = 311 ... Query: 279 YAKCGSLDYARALFDEMSEKDSVTYGAIISGYMAHGLVKEAMALFSEMESI...GLSTWNAMI 338 ... YAKCGSLDYARALFDEMSEKDSVTYGAIISGYMAHGLVKEAMALFSEMESIGLSTWNAMI Sbjc...t: 1 ... YAKCGSLDYARALFDEMSEKDSVTYGAIISGYMAHGLVKEAMALFSEMESIGLSTWNAMI 60 ... Query: 399 NNIYVTTSIIDNYAKLGFLLGAQRV

Expansion of lymph node metastasis in mixed-type submucosal invasive gastric cancer.

Science.gov (United States)

Mikami, Koji; Hirano, Yukiko; Futami, Kitaro; Maekawa, Takafumi

2017-07-18

Mixed-type early gastric cancer (differentiated and undifferentiated components) incurs a higher risk of lymph node metastasis than pure-type early gastric cancer (only differentiated or only undifferentiated components). Therefore, we investigated the expansion of lymph node metastasis in mixed-type submucosal invasive gastric cancer in order to establish the most appropriate treatment for mixed-type cancer. We retrospectively analyzed 279 consecutive patients with submucosal invasive gastric cancer who underwent curative gastrectomy for gastric cancer between 1996 and 2015. We classified the patients into the mixed-type and pure-type groups according to histologic examination and evaluated the expansion of lymph node metastasis. The rate of lymph node metastasis was 23.7% (66/279) in the total patients, 36.4% (36/99) in the mixed-type group, and 16.6% (30/180) in the pure-type group. The significant independent risk factors for lymph node metastasis were tumor size ≥2.0 cm (P = 0.014), mixed-type gastric cancer (P mixed-type group. The rates of no. 7 lymph node metastasis in the total patients and mixed-type group were 2.9% (8/279) and 5.1% (5/99), respectively; the rates of no. 8a lymph node metastasis were 1.4% (4/279) and 4.0% (4/99), respectively. Mixed histological type is an independent risk factor for lymph node metastasis. Lymph node metastasis in mixed-type gastric cancer involves expansion to the no. 7 and no. 8a lymph nodes. Therefore, lymphadenectomy for mixed-type submucosal invasive gastric cancer requires D1+ or D2 dissection. Copyright © 2017. Published by Elsevier Taiwan.

ORF Alignment: NC_005004 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... epidermidis ATCC 12228] ... Length = 258 ... Query: 159 PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGY...FISFEAPNAQNTALTLHQ 218 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFE...APNAQNTALTLHQ Sbjct: 1 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFEAPNAQNTALTLHQ 60 ... Query: 279 FQTVNQT

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ongatus ... BP-1] ... Length = 279 ... Query: 25 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDLX 84 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDL ... Sbjct: 1 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPEAVDLA 60 ... Query: 145 CLGVMCPPTGLNA

High temperature cement raw meal flowability

DEFF Research Database (Denmark)

Maarup, Claus; Hjuler, Klaus; Dam-Johansen, Kim

2014-01-01

The flowability of cement raw meal is investigated at temperatures up to 850°C in a specially designed monoaxial shear tester. Consolidation stresses of 0.94, 1.87 and 2.79kPa are applied. The results show that the flowability is reduced as temperature is increased above 550°C, indicated by incre......The flowability of cement raw meal is investigated at temperatures up to 850°C in a specially designed monoaxial shear tester. Consolidation stresses of 0.94, 1.87 and 2.79kPa are applied. The results show that the flowability is reduced as temperature is increased above 550°C, indicated...

Content analysis of tobacco, alcohol, and other drugs in popular music.

Science.gov (United States)

Primack, Brian A; Dalton, Madeline A; Carroll, Mary V; Agarwal, Aaron A; Fine, Michael J

2008-02-01

To perform a comprehensive content analysis of substance use in contemporary popular music. We analyzed the 279 most popular songs of 2005 according to Billboard magazine. Two coders working independently used a standardized data collection instrument to code portrayals of substance use. Presence and explicit use of substances and motivations for, associations with, and consequences of substance use. Of the 279 songs, 93 (33.3%) portrayed substance use, with an average of 35.2 substance references per song-hour. Portrayal of substance use varied significantly (P musical genre. The substance use depicted in popular music is frequently motivated by peer acceptance and sex, and it has highly positive associations and consequences.

ORF Alignment: NC_006156 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ma and ... tau [Borrelia garinii PBi] ... Length = 279 ... Query: 22 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK 81 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK Sbjct: 1 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARCLNCKNGPTVMPCGECNNCK 60 ... Quer

Clinicopathological and biological significance of aberrant activation of glycogen synthase kinase-3 in ovarian cancer

Directory of Open Access Journals (Sweden)

Fu Y

2014-06-01

Full Text Available Yunfeng Fu,1 Xinyu Wang,1 Xiaodong Cheng,1 Feng Ye,2 Xing Xie,1,2 Weiguo Lu1,2 1Department of Gynecologic Oncology, Women's Hospital, School of Medicine, Zhejiang University, 2Women's Reproduction and Health Laboratory of Zhejiang Province, Hangzhou, People's Republic of China Background: Glycogen synthase kinase-3 (GSK-3 plays an important role in human cancer. The aim of this study is to evaluate the clinicopathological significance of expression of GSK-3α/β and pGSK-3α/βTyr279/216 in patients with epithelial ovarian cancer and to investigate whether GSK-3 inhibition can influence cell viability and tumor growth of ovarian cancer. Methods: Immunohistochemistry was used to examine expression of GSK-3α/β and pGSK-3α/βTyr279/216 in 71 human epithelial ovarian cancer tissues and correlations between protein expression, and clinicopathological factors were analyzed. Cell viability was determined by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay following exposure of ovarian carcinoma cells to pharmacological inhibitors of GSK-3 or GSK-3 small interfering RNA. In vivo validation of tumor growth inhibition was performed with xenograft mice. Results: The expression levels of GSK-3α/β and pGSK-3α/βTyr279/216 in ovarian cancers were significantly higher than those in benign tumors. High expression of GSK-3α/β was more likely to be found in patients with advanced International Federation of Gynecology and Obstetrics (FIGO stages and high serum cancer antigen 125. Higher expression of pGSK-3α/βTyr279/216 was associated with advanced FIGO stages, residual tumor mass, high serum cancer antigen 125, and poor chemoresponse. Worse overall survival was revealed by Kaplan–Meier survival curves in patients with high expression of GSK-3α/β or pGSK-3α/βTyr279/216. Multivariate analysis indicated that FIGO stage, GSK-3α/β expression, and pGSK-3α/βTyr279/216 expression were independent prognostic factors for overall

Global surveillance of cancer survival 1995-2009: analysis of individual data for 25,676,887 patients from 279 population-based registries in 67 countries (CONCORD-2).

Science.gov (United States)

Allemani, Claudia; Weir, Hannah K; Carreira, Helena; Harewood, Rhea; Spika, Devon; Wang, Xiao-Si; Bannon, Finian; Ahn, Jane V; Johnson, Christopher J; Bonaventure, Audrey; Marcos-Gragera, Rafael; Stiller, Charles; Azevedo e Silva, Gulnar; Chen, Wan-Qing; Ogunbiyi, Olufemi J; Rachet, Bernard; Soeberg, Matthew J; You, Hui; Matsuda, Tomohiro; Bielska-Lasota, Magdalena; Storm, Hans; Tucker, Thomas C; Coleman, Michel P

2015-03-14

Worldwide data for cancer survival are scarce. We aimed to initiate worldwide surveillance of cancer survival by central analysis of population-based registry data, as a metric of the effectiveness of health systems, and to inform global policy on cancer control. Individual tumour records were submitted by 279 population-based cancer registries in 67 countries for 25·7 million adults (age 15-99 years) and 75,000 children (age 0-14 years) diagnosed with cancer during 1995-2009 and followed up to Dec 31, 2009, or later. We looked at cancers of the stomach, colon, rectum, liver, lung, breast (women), cervix, ovary, and prostate in adults, and adult and childhood leukaemia. Standardised quality control procedures were applied; errors were corrected by the registry concerned. We estimated 5-year net survival, adjusted for background mortality in every country or region by age (single year), sex, and calendar year, and by race or ethnic origin in some countries. Estimates were age-standardised with the International Cancer Survival Standard weights. 5-year survival from colon, rectal, and breast cancers has increased steadily in most developed countries. For patients diagnosed during 2005-09, survival for colon and rectal cancer reached 60% or more in 22 countries around the world; for breast cancer, 5-year survival rose to 85% or higher in 17 countries worldwide. Liver and lung cancer remain lethal in all nations: for both cancers, 5-year survival is below 20% everywhere in Europe, in the range 15-19% in North America, and as low as 7-9% in Mongolia and Thailand. Striking rises in 5-year survival from prostate cancer have occurred in many countries: survival rose by 10-20% between 1995-99 and 2005-09 in 22 countries in South America, Asia, and Europe, but survival still varies widely around the world, from less than 60% in Bulgaria and Thailand to 95% or more in Brazil, Puerto Rico, and the USA. For cervical cancer, national estimates of 5-year survival range from less

Aromatic residues located close to the active center are essential for the catalytic reaction of flap endonuclease-1 from hyperthermophilic archaeon Pyrococcus horikoshii.

Science.gov (United States)

Matsui, Eriko; Abe, Junko; Yokoyama, Hideshi; Matsui, Ikuo

2004-04-16

Flap endonuclease-1 (FEN-1) possessing 5'-flap endonuclease and 5'-->3' exonuclease activity plays important roles in DNA replication and repair. In this study, the kinetic parameters of mutants at highly conserved aromatic residues, Tyr33, Phe35, Phe79, and Phe278-Phe279, in the vicinity of the catalytic centers of FEN-1 were examined. The substitution of these aromatic residues with alanine led to a large reduction in kcat values, although these mutants retained Km values similar to that of the wild-type enzyme. Notably, the kcat of Y33A and F79A decreased 333-fold and 71-fold, respectively, compared with that of the wild-type enzyme. The aromatic residues Tyr33 and Phe79, and the aromatic cluster Phe278-Phe279 mainly contributed to the recognition of the substrates without the 3' projection of the upstream strand (the nick, 5'-recess-end, single-flap, and pseudo-Y substrates) for the both exo- and endo-activities, but played minor roles in recognizing the substrates with the 3' projection (the double flap substrate and the nick substrate with the 3' projection). The replacement of Tyr33, Phe79, and Phe278-Phe279, with non-charged aromatic residues, but not with aliphatic hydrophobic residues, recovered the kcat values almost fully for the substrates without the 3' projection of the upstream strand, suggesting that the aromatic groups of Tyr33, Phe79, and Phe278-Phe279 might be involved in the catalytic reaction, probably via multiple stacking interactions with nucleotide bases. The stacking interactions of Tyr33 and Phe79 might play important roles in fixing the template strand and the downstream strand, respectively, in close proximity to the active center to achieve the productive transient state leading to the hydrolysis.

77 FR 35418 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2012-06-13

... Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

Sud du Sahara | Page 279 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Lors de sa visite en Afrique occidentale, en août, l'honorable Marie-Claude Bibeau, ... recognizable from the cluster of red grains emerging from between its leaves; ... Un projet financé par le CRDI mise sur la technologie des textos pour lutter ...

40 CFR 279.30 - Do-it-yourselfer used oil collection centers.

Science.gov (United States)

2010-07-01

... WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Collection Centers and... collection center is any site or facility that accepts/aggregates and stores used oil collected only from...

The WEBT Campaign on the Blazar 3C 279 in 2006

Czech Academy of Sciences Publication Activity Database

Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berdyugin, A.; Blažek, Martin; Buemi, C.S.; Castro-Tirado, A.J.; de Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V.A.; Henson, G.; Hovatta, T.; Hudec, René; Ibrahimov, M.A.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y.Y.; Kovalev, Yu.A.; Kubánek, Petr; Kurosaki, M.; Kurtanidze, O.M.; Lähteenmäki, A.; Lanteri, L.; Larionov, V.M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H.R.; Mingaliev, M.G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.G.; Nilsson, K.; Nishiyama, S.; Ohlert, J.M.; Osterman, M.A.; Pak, S.; Pasanen, M.; Peters, C.S.; Pursimo, T.; Raiteri, C.M.; Robertson, J.; Robertson, T.; Ryle, W.T.; Sadakane, K.; Sadun, A.C.; Sigua, L.A.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L.O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J.R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vítek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, S.-H.

2007-01-01

Roč. 670, č. 2 (2007), s. 968-977 ISSN 0004-637X Grant - others:EU(XE) ESA-PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Source of funding: V - iné verejné zdroje Keywords : blazars * active galactic nuclei Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.405, year: 2007

33 CFR Appendix A to Part 279 - Sample Resource Use Objectives

Science.gov (United States)

2010-07-01

... exists a high demand for warm water fishing; that the water quality and other necessary environmental... for a water resource project. They are presented for illustrative purposes only and are not intended... its small water surface and excellent water quality is not suitable for power boating; is in a...

76 FR 7571 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-02-10

..., Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call). Contact Person....: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated...

76 FR 15329 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-03-21

.... Place: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

75 FR 80512 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2010-12-22

.... Agenda: To review and evaluate grant applications. Place: National Institutes of Health, Neuroscience... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

Effects of microwave power and irradiation time on pectin extraction from watermelon rinds (Citrullus lanatus) with acetic acid using microwave assisted extraction method

Science.gov (United States)

Sari, A. M.; Ishartani, D.; Dewanty, P. S.

2018-01-01

The aims of this research are to study the effect of microwave power (119.7 W, 199.5 W and 279.3 W) and irradiation time (6, 9 and 12 min) on pectin extraction by using Microwave Assisted Extraction (MAE) with acetic acid and to do a preliminary characterization of pectin from watermelon rinds. A randomized factorial design with two factors was used to determine the effect of microwave power and processing time on the yield, equivalent weight, degree of methoxylation (DM), galacturonic acid content (GA) and the degree of esterification (DE) of extracted pectin. The results showed that extracted pectin from watermelon rinds using MAE method have yield ranged from 3.925% to 5.766%, with equivalent weight ranged from 1249.702 to 2007.756. Extracted pectin have a DM value ranged from 3.89% to 10.81%. Galacturonic acid content that meets with IPPA standard resulted from extraction condition of 279.3-watt microwave power for 9 min and 12 min. The degree of esterification (DE) value ranged from 56.86% to 85.76%, and this value exhibited a relatively high methoxyl pectin (>50%). The best pectin properties was obtained at a microwave power of 279.3 watts for 12 min.

Global surveillance of cancer survival 1995–2009: analysis of individual data for 25 676 887 patients from 279 population-based registries in 67 countries (CONCORD-2)

Science.gov (United States)

Allemani, Claudia; Weir, Hannah K; Carreira, Helena; Harewood, Rhea; Spika, Devon; Wang, Xiao-Si; Bannon, Finian; Ahn, Jane V; Johnson, Christopher J; Bonaventure, Audrey; Marcos-Gragera, Rafael; Stiller, Charles; Silva, Gulnar Azevedo e; Chen, Wan-Qing; Ogunbiyi, Olufemi J; Rachet, Bernard; Soeberg, Matthew J; You, Hui; Matsuda, Tomohiro; Bielska-Lasota, Magdalena; Storm, Hans; Tucker, Thomas C; Coleman, Michel P

2015-01-01

Summary Background Worldwide data for cancer survival are scarce. We aimed to initiate worldwide surveillance of cancer survival by central analysis of population-based registry data, as a metric of the effectiveness of health systems, and to inform global policy on cancer control. Methods Individual tumour records were submitted by 279 population-based cancer registries in 67 countries for 25·7 million adults (age 15–99 years) and 75 000 children (age 0–14 years) diagnosed with cancer during 1995–2009 and followed up to Dec 31, 2009, or later. We looked at cancers of the stomach, colon, rectum, liver, lung, breast (women), cervix, ovary, and prostate in adults, and adult and childhood leukaemia. Standardised quality control procedures were applied; errors were corrected by the registry concerned. We estimated 5-year net survival, adjusted for background mortality in every country or region by age (single year), sex, and calendar year, and by race or ethnic origin in some countries. Estimates were age-standardised with the International Cancer Survival Standard weights. Findings 5-year survival from colon, rectal, and breast cancers has increased steadily in most developed countries. For patients diagnosed during 2005–09, survival for colon and rectal cancer reached 60% or more in 22 countries around the world; for breast cancer, 5-year survival rose to 85% or higher in 17 countries worldwide. Liver and lung cancer remain lethal in all nations: for both cancers, 5-year survival is below 20% everywhere in Europe, in the range 15–19% in North America, and as low as 7–9% in Mongolia and Thailand. Striking rises in 5-year survival from prostate cancer have occurred in many countries: survival rose by 10–20% between 1995–99 and 2005–09 in 22 countries in South America, Asia, and Europe, but survival still varies widely around the world, from less than 60% in Bulgaria and Thailand to 95% or more in Brazil, Puerto Rico, and the USA. For cervical cancer

78 FR 25460 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2013-05-01

... Emphasis Panel; SBIR Phase II Contract Review--Recovery Warrior: Behavioral Activation Video Game for... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

The Utraquist Sanctoral in Sixteenth-Century Czech-Language Gradual

Czech Academy of Sciences Publication Activity Database

Žůrek, Jiří

Suppl., č. 2 (2015), s. 279-307 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Utraquism * (Roman) Liturgy * Liturgical Calendar * Plainchant * Veneration of Saints Subject RIV: AA - Philosophy ; Religion

K významu drolerií ve středověkých rukopisech

Czech Academy of Sciences Publication Activity Database

Brodský, Pavel

39 /2009/, - (2010), s. 279-286 ISSN 0585-5691 Institutional research plan: CEZ:AV0Z80770509 Keywords : illuminated manuscripts * Middle Ages * droleries Subject RIV: AJ - Letters, Mass-media, Audiovision

75 FR 71711 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2010-11-24

... Panel E-Technology tools for Extending the Reach of Prevention Interventions in Rural and Remote.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

Sexual reproduction as a source of ploidy level variation in the model agamic complex of Pilosella bauhini and P. officinarum (Asteraceae: Lactuceae)

Czech Academy of Sciences Publication Activity Database

Rosenbaumová, R.; Krahulec, František

2015-01-01

Roč. 301, č. 1 (2015), s. 279-290 ISSN 0378-2697 Institutional support: RVO:67985939 Keywords : Pilosella * residual sexuality * hybridization Subject RIV: EF - Botanics Impact factor: 1.361, year: 2015

TMFunction data: 1539 [TMFunction[Archive

Lifescience Database Archive (English)

Full Text Available s Human Mueckler M, Makepeace C. J Biol Chem. 2004 Mar 12;279(11):10494-9 Specific activity ... GTR1_HUMAN (P11166) Helix ... cysteine; transmembrane helix; sugar permeation pathway

Politicising EU Lawmaking? The Spitzenkandidaten Experiment as a Cautionary Tale

Czech Academy of Sciences Publication Activity Database

Goldoni, Marco

2016-01-01

Roč. 22, č. 3 (2016), s. 279-295 ISSN 1351-5993 Institutional support: RVO:68378122 Keywords : European Union * national parliaments * crisis Subject RIV: AG - Legal Sciences Impact factor: 1.427, year: 2016

Meediareklaam taas kasvutrendis / Külli Esko

Index Scriptorium Estoniae

Esko, Külli

2006-01-01

TNS Emori reklaamipanuste monitooringu AdEx andmetel oli meediareklaamituru käive käesoleva aasta esimeses kvartalis 279 miljonit krooni, kasv võrreldes eelmise aastaga 17%. Diagramm: Meediatüüpide reklaamimahud

Geographic distribution of Sarcoporia polyspora and S-longitubulata sp nov

Czech Academy of Sciences Publication Activity Database

Vlasák, Josef; Vlasák, J.; Kinnunen, J.; Spirin, V.

2015-01-01

Roč. 130, č. 1 (2015), s. 279-287 ISSN 0093-4666 Institutional support: RVO:60077344 Keywords : Basidiomycota * brown rot fungi * molecular taxonomy Subject RIV: EF - Botanics Impact factor: 0.610, year: 2015

Effects of acute chlorpyrifos exposure on in vivo acetylcholine accumulation in rat striatum

International Nuclear Information System (INIS)

Karanth, Subramanya; Liu, Jing; Mirajkar, Nikita; Pope, Carey

2006-01-01

This study examined the acute effects of chlorpyrifos (CPF) on cholinesterase inhibition and acetylcholine levels in the striatum of freely moving rats using in vivo microdialysis. Adult, male Sprague-Dawley rats were treated with vehicle (peanut oil, 2 ml/kg) or CPF (84, 156 or 279 mg/kg, sc) and functional signs of toxicity, body weight and motor activity recorded. Microdialysis was conducted at 1, 4 and 7 days after CPF exposure for measurement of acetylcholine levels in striatum. Rats were then sacrificed and the contralateral striatum and diaphragm were collected for biochemical measurements. Few overt signs of cholinergic toxicity were noted in any rats. Body weight gain was significantly affected in the high-dose (279 mg/kg) group only, while motor activity (nocturnal rearing) was significantly reduced in all CPF-treated groups at one day (84 mg/kg) or from 1-4 days (156 and 279 mg/kg) after dosing. Cholinesterase activities in both diaphragm and striatum were markedly inhibited (50-92%) in a time-dependent manner, but there were relatively minimal dose-related changes. In contrast, time- and dose-dependent changes in striatal acetylcholine levels were noted, with significantly higher levels noted in the high-dose group compared to other groups. Maximal increases in striatal acetylcholine levels were observed at 4-7 days after dosing (84 mg/kg, 7-9-fold; 156 mg/kg, 10-13-fold; 279 mg/kg, 35-57-fold). Substantially higher acetylcholine levels were noted when an exogenous cholinesterase inhibitor was included in the perfusion buffer, but CPF treatment-related differences were substantially lower in magnitude under those conditions. The results suggest that marked differences in acetylcholine accumulation can occur with dosages of CPF eliciting relatively similar degrees of cholinesterase inhibition. Furthermore, the minimal expression of classic signs of cholinergic toxicity in the presence of extensive brain acetylcholine accumulation suggests that some

Solvent effects on dopant-free pH-falling polymerization of aniline

Czech Academy of Sciences Publication Activity Database

Rakić, A. A.; Vukomanović, M.; Trifunovic, S.; Travas-Sejdic, J.; Chaudhary, O. J.; Horský, Jiří; Ciric-Marjanovic, G.

2015-01-01

Roč. 209, November (2015), s. 279-296 ISSN 0379-6779 Institutional support: RVO:61389013 Keywords : dopant-free template -free method * nanostructures * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.299, year: 2015

Chemicky aktivované a roubované substráty a jejich analýza

Czech Academy of Sciences Publication Activity Database

Benkocká, M.; Knapová, T.; Braborec, Jakub; Matoušek, J.; Černá, H.; Londesborough, Michael Geoffrey Stephen; Švorčík, V.; Kolská, Z.

2015-01-01

Roč. 109, č. 12 (2015), s. 960-964 ISSN 0009-2770 Institutional support: RVO:61388980 Keywords : surface activation * piranha solution * surface grafting Subject RIV: JJ - Other Materials Impact factor: 0.279, year: 2015

78 FR 42531 - Prospective Grant of Exclusive License: Ophthalmic Diagnostic Devices

Science.gov (United States)

2013-07-16

... (HHS Ref. No. E-279-2006/0) to OptoBiometrics Designs, Inc., a company incorporated under the laws of the State of California having its headquarters in Pleasant Hill, California. The United States of...

High/low nitrogen adapted hybrid of rice cultivars and their ...

African Journals Online (AJOL)

User

2011-05-09

May 9, 2011 ... Other four types were lying in the middle with moderate adaptability of ... nitrogen, to reduce environmental pollution and the waste. *Corresponding ...... controls nutrient-induced changes in root architecture．Science.279：.

Moebius syndrome with macular hyperpigmentation, skeletal ...

African Journals Online (AJOL)

Rabah M. Shawky

2014-11-08

Nov 8, 2014 ... Moebius syndrome is a congenital, nonprogressive complete or partial facial nerve .... Moebius syndrome with its associated anomalies in an Egyptian child. 279 ... or absence of middle cerebellar peduncles, depression of the.

South African Journal of Education - Vol 25, No 4 (2005)

African Journals Online (AJOL)

Effects of transformational leadership on human resource management in primary schools · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prakash Singh, Kari Lokotsch, 279-286 ...

Lepingute suhtes kohaldatava seaduse küsimusi Euroopa Liidus : [bakalaureusetöö] / Tarvo Lindma ; Tartu Ülikool, õigusteaduskond ; juhendaja: Heiki Pisuke

Index Scriptorium Estoniae

Lindma, Tarvo, 1974-

1996-01-01

Lepinguõiguse unifitseerimine; Rooma 1980. a. lepingulistele suhetele kohaldatava seaduse konventsioon; ostu-müügileping (Haagi konventsioonid); esindus; usaldusleping; Beneluxi leping; konventsioonide kohaldatavus liikmesriikides. Vt. ka: Juridica (1996) nr. 6, lk. 275-279

Synthesis and characterization of perovskite-type Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} (0.63≤x<1.0) and Sr{sub 0.75}Y{sub 0.25}Fe{sub 1−y}M{sub y}O{sub 3−δ} (M=Cr, Mn, Ni), (y=0.2, 0.33, 0.5)

Energy Technology Data Exchange (ETDEWEB)

Biendicho, J.J. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); The ISIS Facility, STFC Rutherford Appleton Laboratory, Didcot, OX11 0QX Oxfordshire (United Kingdom); Shafeie, S. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Frenck, L. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Université Pierre et Marie Curie, 75005 Paris (France); Gavrilova, D. [M.V. Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Böhme, S. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Technische Universität Chemnitz, Institut für Chemie, Straße der Nationen 62, D-09111 Chemnitz (Germany); Bettanini, A.M. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Department of Molecular Sciences and Nanosystems, University Ca’ Foscari of Venice, 30123 Venice (Italy); Svedlindh, P. [Department of Engineering Sciences, Uppsala University, Box 534, SE-751 21 Uppsala (Sweden); Hull, S. [The ISIS Facility, STFC Rutherford Appleton Laboratory, Didcot, OX11 0QX Oxfordshire (United Kingdom); Zhao, Z. [School of Industrial Engineering and Management, Royal Institute of Technology, SE-100 44 Stockholm (Sweden); Istomin, S.Ya., E-mail: istomin@icr.chem.msu.ru [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); M.V. Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Grins, J.; Svensson, G. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden)

2013-04-15

Oxygen-deficient ferrates with the cubic perovskite structure Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} were prepared in air (0.71≤x≤0.91) as well as in N{sub 2} (x=0.75 and 0.79) at 1573 K. The oxygen content of the compounds prepared in air increases with increasing strontium content from 3−δ=2.79(2) for x=0.75 to 3−δ=2.83(2) for x=0.91. Refinement of the crystal structure of Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} using TOF neutron powder diffraction (NPD) data shows high anisotropic atomic displacement parameter (ADP) for the oxygen atom resulting from a substantial cation and anion disorder. Electron diffraction (ED) and high-resolution electron microscopy (HREM) studies of Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} reveal a modulation along 〈1 0 0〉{sub p} with G± ∼0.4〈1 0 0〉{sub p} indicating a local ordering of oxygen vacancies. Magnetic susceptibility measurements at 5–390 K show spin-glass behaviour with dominating antiferromagnetic coupling between the magnetic moments of Fe cations. Among the studied compositions, Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} shows the lowest thermal expansion coefficient (TEC) of 10.5 ppm/K in air at 298–673 K. At 773–1173 K TEC increases up to 17.2 ppm/K due to substantial reduction of oxygen content. The latter also results in a dramatic decrease of the electrical conductivity in air above 673 K. Partial substitution of Fe by Cr, Mn and Ni according to the formula Sr{sub 0.75}Y{sub 0.25}Fe{sub 1−y}M{sub y}O{sub 3−δ} (y=0.2, 0.33, 0.5) leads to cubic perovskites for all substituents with y=0.2. Their TECs are higher in comparison with un-doped Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79}. Only M=Ni has increased electrical conductivity compared to un-doped Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79}. - Graphical abstract: Oxygen-deficient ferrates with the cubic perovskite structure Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} were prepared both in air (0.71≤x≤0.91) and N{sub 2} (x=0.75 and 0.79) at 1573 K. Refinement of the

Catalogue of type specimens of beetles (Coleoptera)deposited in the National Museum, Prague, Czech Republic. Scarabaeoidea: Lucanidae and Passalidae

Czech Academy of Sciences Publication Activity Database

Bezděk, Aleš; Boucher, S.; Hájek, J.

2017-01-01

Roč. 57, č. 1 (2017), s. 279-293 ISSN 0374-1036 Institutional support: RVO:60077344 Keywords : catalogue * types * National Museum Prague Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.632, year: 2016

40 CFR 279.32 - Used oil aggregation points owned by the generator.

Science.gov (United States)

2010-07-01

... (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil... aggregation point is any site or facility that accepts, aggregates, and/or stores used oil collected only from...

Fulltext PDF

Indian Academy of Sciences (India)

Unknown

studies with adult stem cells have shown reprogramming of the stem cell in response ... cells, suggesting the presence of an ectodermal (brain) stem cell capable of .... regeneration by bone marrow-derived myogenic progenitors; Science 279 ...

College Drinking

Science.gov (United States)

... range of counseling options and policies related to sales and access. Yet, while school officials should be ... 18–24: changes from 1998 to 2001. Annual Review of Public Health 26: 259–279, 2005. PMID: ...

Regulace vesnického osídlení a krajiny ve středověké a novověké severní Evropě

Czech Academy of Sciences Publication Activity Database

Dohnal, Martin

2009-01-01

Roč. 96, č. 3 (2009), s. 279-308 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : villages * historical geography * Scandinavia * middle ages * land settlement * landscape Subject RIV: AC - Archeology, Anthropology, Ethnology

Je mihule ukrajinská ještě součástí naší fauny?

Czech Academy of Sciences Publication Activity Database

Hanel, L.; Lusk, Stanislav

2013-01-01

Roč. 61, č. 6 (2013), s. 279-281 ISSN 0044-4812 Institutional support: RVO:68081766 Keywords : lamprey Subject RIV: EG - Zoology http://ziva.avcr.cz/2013-6/je-mihule-ukrajinska-jeste-soucasti-nasi-fauny.html

Variation in sperm morphology among Afrotropical sunbirds

Czech Academy of Sciences Publication Activity Database

Omotoriogun, T. C.; Laskemoen, T.; Rowe, M.; Albrecht, Tomáš; Bowie, R. C. K.; Sedláček, O.; Hořák, D.; Ottosson, U.; Lifjeld, J. T.

2016-01-01

Roč. 158, č. 1 (2016), s. 155-166 ISSN 0019-1019 Institutional support: RVO:68081766 Keywords : comparative analysis * Nectariniidae * phylogenetic signal * sperm competition * sperm size Subject RIV: EG - Zoology Impact factor: 2.279, year: 2016

The Elements of Business Process Change

African Journals Online (AJOL)

user

and are actually derived; and the impact of BPC endeavors on business processes and on ..... it also helps improve relationships with customers and suppliers, empower employees, and improve ..... Reduced budget consumption. 2.79. 1.1. 8.

Zelená kapalinová chromatografie pro jednoduché aplikace

Czech Academy of Sciences Publication Activity Database

Šesták, Jozef; Kahle, Vladislav

2015-01-01

Roč. 109, č. 6 (2015), s. 470-474 ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : green analytical chemistry * green liquid chromatography * nanocolumns Subject RIV: CB - Analytical Chemistry , Separation Impact factor: 0.279, year: 2015

The Spatial and Temporal Dynamics of Remotely-sensed Vegetation Phenology in Central Asia in the 1982-2011 Period

Czech Academy of Sciences Publication Activity Database

Bohovič, Roman; Dobrovolný, Petr; Klein, D.

2016-01-01

Roč. 2016, č. 49 (2016), s. 279-299 ISSN 2279-7254 Institutional support: RVO:67179843 Keywords : Phenology * vegetation dynamics * NDVI * GIMMS * Central Asia * SOS Subject RIV: EH - Ecology, Behaviour Impact factor: 1.533, year: 2016

Agrese a sebevědomí

Czech Academy of Sciences Publication Activity Database

Šolcová, Iva

2006-01-01

Roč. 50, č. 3 (2006), s. 231-237 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : aggression * self - esteem * egotism Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

Survey of ethno-veterinary medicinal plants in Melkabello District ...

African Journals Online (AJOL)

An ethno botanical survey was conducted from November 2014 to April 2015 in ... (27.9%) were the most commonly used habits of the plants by traditional healers. .... summarized using descriptive statistical methods such as frequency and.

Is Rorty a linguistic idealist?

Czech Academy of Sciences Publication Activity Database

Marvan, Tomáš

2011-01-01

Roč. 21, č. 3 (2011), s. 272-279 ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion

76 FR 23828 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-04-28

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis..., National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001 Executive Boulevard, Bethesda, MD....279, Drug Abuse and [[Page 23829

Cyanocohniella calida gen. et sp. nov. (Cyanobacteria: Aphanizomenonaceae) a new cyanobacterium from the thermal springs from Karlovy Vary, Czech Republic

Czech Academy of Sciences Publication Activity Database

Kaštovský, J.; Berrendero Gomez, E.; Hladil, Jindřich; Johansen, J. R.

2014-01-01

Roč. 181, č. 5 (2014), s. 279-292 ISSN 1179-3155 Institutional support: RVO:67985831 Keywords : Cyanobacteria * new genus * polyphasic approach * thermal springs * Karlovy Vary Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.318, year: 2014

75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

Science.gov (United States)

2010-05-11

... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

Global stability of the coexistence equilibrium for a general class of models of facultative mutualism

Czech Academy of Sciences Publication Activity Database

Maxin, D.; Georgescu, P.; Sega, L.; Berec, Luděk

2017-01-01

Roč. 11, č. 1 (2017), s. 339-364 ISSN 1751-3758 Institutional support: RVO:60077344 Keywords : mutualistic interaction * global stability * Lyapunov functional Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.279, year: 2016

Dovedně zvládnutá přítomnost přináší příjemnou budoucnost: Sociální reprezentace smrti na Srí Lance u Theravádových mnichů a jejich podpůrců

Czech Academy of Sciences Publication Activity Database

Hytych, Roman

2006-01-01

Roč. 50, č. 3 (2006), s. 273-284 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : social representations * death * cultural psychology Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

Age-Adjusted Percentage of Adults Aged 18 Years or Older with Diagnosed Diabetes Performing Daily Self-Monitoring of ...

Science.gov (United States)

... Years or Older with Diagnosed Diabetes Performing Daily Self-Monitoring of Blood Glucose, United States, 1994–2010 From ... years or older with diagnosed diabetes performing daily self-monitoring of blood glucose increased by 27.9 points, ...

Limestone Quarries as Refuges for European Xerophilous Butterflies

Czech Academy of Sciences Publication Activity Database

Beneš, Jiří; Kepka, Pavel; Konvička, Martin

2003-01-01

Roč. 17, č. 4 (2003), s. 1058-1069 ISSN 0888-8892 Institutional research plan: CEZ:AV0Z5007907 Keywords : Central southern Britain * Brithis butterlies Subject RIV: EH - Ecology, Behaviour Impact factor: 3.279, year: 2003

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... NIDA/NIH) 145,279 views 2:03 Teen discussion on drug abuse and addiction with Dr. Volkow ... NIDA/NIH) 6,391 views 1:28 Language: English Location: United States Restricted Mode: Off History Help ...

Radikálová syntéza nukleových bází z formamidu v impaktním plazmatu

Czech Academy of Sciences Publication Activity Database

Ferus, Martin; Knížek, Antonín; Šponer, Jiří; Šponer, Judit E.; Civiš, Svatopluk

2015-01-01

Roč. 109, č. 6 (2015), s. 406-414 ISSN 0009-2770 Institutional support: RVO:61388955 ; RVO:68081707 Keywords : Formamide * Laser-induced dielectric breakdown * Nucleobases Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.279, year: 2015

Complete moment convergence of weighted sums for processes ...

Indian Academy of Sciences (India)

Proc. Indian Acad. Sci. (Math. Sci.) Vol. 124, No. 2, May 2014, pp. 267–279. c Indian Academy of ... College of Mathematics and Statistics, Chongqing Technology and Business. University ...... (1995) (Oxford: Clarendon Press). [14] Wang X J ...

Neudržitelná lehkost bytí v globálním vsádkovém bioreaktoru

Czech Academy of Sciences Publication Activity Database

Hanika, Jiří

2015-01-01

Roč. 109, č. 7 (2015), s. 515-517 ISSN 0009-2770 Institutional support: RVO:67985858 Keywords : global bioreactor * unsustainable growth * future of human race Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.279, year: 2015

Resonance journal of science education

Indian Academy of Sciences (India)

sriranga

. The Rise of Modern Medicine. T Padmanabhan. REFLECTIONS. 279 Darshana Jolts. Sound: The Vehicle for Speech and Music. V V Raman. On a General. Method of Describing. Plane Curves of the nth degree by. Linkwork. A B Kempe.

A new species complex including Claviceps fusiformis and Claviceps hirtella

Czech Academy of Sciences Publication Activity Database

Pažoutová, Sylvie; Kolařík, Miroslav; Odvody, G.; Frederickson, D. E.; Olšovská, Jana; Man, Petr

2008-01-01

Roč. 31, - (2008), s. 95-110 ISSN 1560-2745 Grant - others:US(US) Intsormil Institutional research plan: CEZ:AV0Z50200510 Keywords : alkaloids * cenchrus * claviceps Subject RIV: EE - Microbiology, Virology Impact factor: 2.279, year: 2008

78 FR 4421 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2013-01-22

...: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852... contract proposals. Place: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

Syntetické modely metaloenzymů katalyzující štěpení fosfodiesterové vazby

Czech Academy of Sciences Publication Activity Database

Bím, Daniel; Rulíšek, Lubomír; Hodačová, J.

2015-01-01

Roč. 109, č. 9 (2015), s. 658-665 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : synthetic models of phosphodiesterases * metalloenzymes * phosphate ester bond cleavage Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.279, year: 2015

Elaboration of standards referred to human exposure to electromagnetic fields in the range of 9kHz to 300GHz in the National System of Health, Brazil

International Nuclear Information System (INIS)

Souza, Joao Henrique Campos de; Giacomet, Andrea Fatima; Cunha, Tarcisio; Drumond, Ivens; Sa, Fabiana O.; Mendes, Paula

2005-01-01

The Portaria of the Ministry of Health no. 279 (Ordinance 279), of February 22, 2005, establishes a Working Group-GT with the purpose to elaborate standards relating to human exposure to electromagnetic fields in the range of 9 kHz to 300 GHz in the Sistema Unico de Saude (National System of Health), Brazil. Since then, we have conducted several studies on the biological effects of radiation exposure in this spectral range. The GT proposes the use of the geographical instruments coupled information systems to define an alternative pattern of surveillance, based on the determination of Areas of Risks. Each source of electromagnetic radiation is associated with territorial boundaries that surround it using progressively larger distances, thus determining areas of influence whose intensity is attenuated as the distance to the source increases. This paper presents the main results obtained by the Working Group

Female-biased sex ratios in marine pelagic copepods: Comment on Gusmao et al. (2013)

DEFF Research Database (Denmark)

Hirst, Andrew G.; Bonnet, D; Conway, DVP

2013-01-01

Gusmao et al. (2013; Mar Ecol Prog Ser 482:279-298) review causes of sex ratio skew in pelagic copepods and in doing so repeatedly dispute the paper of Hirst et al. (2010) ‘Does predation control adult sex ratios and longevities in marine pelagic copepods?’ Here we respond to some important error...... in their citation of our paper and briefly highlight where future work is needed in order to attribute the causes of strong sex ratio skew seen in some copepod families......Gusmao et al. (2013; Mar Ecol Prog Ser 482:279-298) review causes of sex ratio skew in pelagic copepods and in doing so repeatedly dispute the paper of Hirst et al. (2010) ‘Does predation control adult sex ratios and longevities in marine pelagic copepods?’ Here we respond to some important errors...

Measurement of patient radiation doses in certain urography procedures

International Nuclear Information System (INIS)

Sulieman, A.; Barakat, H.; Zailae, A.; Abuderman, A.; Theodorou, K.

2015-01-01

Patients are exposed to significant radiation doses during diagnostic and interventional urological procedures. This study aimed to measure patient entrance surface air kerma (ESAK) and to estimate the effective dose during intravenous urography (IVU), extracorporeal shock-wave lithotripsy (ESWL), and ascending urethrogram (ASU) procedures. ESAK was measured in patients using calibrated thermo luminance dosimeters, GR200A). Effective doses (E) were calculated using the National Radiological Protection Board (NRPB) software. A total of 179 procedures were investigated. 27.9 % of the patients underwent IVU procedures, 27.9 % underwent ESWL procedures and 44.2 % underwent ASU procedures. The mean ESAK was 2.1, 4.18 and 4.9 mGy for IVU, ESWL, and ASU procedures, respectively. Differences in patient ESAK for the same procedure were observed. The mean ESAK values were comparable with those in previous studies. (authors)

Sigmund Freud a první aplikace psychoanalýzy na literární dílo

Czech Academy of Sciences Publication Activity Database

Švanda, Martin

2005-01-01

Roč. 49, č. 3 (2005), s. 272-279 ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

Gorlin‑Goltz Syndrome

African Journals Online (AJOL)

Annals of Medical and Health Sciences Research | Mar-Apr 2014 | Vol 4 | Issue 2 |. 279. Address for ... Introduction. Gorlin-Goltz syndrome (GGS) is an uncommon autosomal ... This case report draws attention of the valuable role of dentist in ...

Tai Chi and Qi Gong

Science.gov (United States)

... of Grants and Contracts General Award Mechanisms Small Business Research Grant Program (SBIR) Funding for: Natural Product Research ... tai chi and qigong in older adults. Western Journal of Nursing Research. 2009;31(2):245–279. Saeed SA, Antonacci ...

77 FR 63843 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2012-10-17

...: To review and evaluate grant applications. Place: National Institutes of Health, Neuroscience Center... of Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

77 FR 75179 - National Institute on Drug Abuse Notice of Closed Meetings

Science.gov (United States)

2012-12-19

... Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call... review and evaluate grant applications. Place: National Institutes of Health, Neuroscience Center, 6001... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

REVIEWS OF BOOKS : BOEKRFSENSIES

African Journals Online (AJOL)

Ill. Examination and Diagnosis. IV. Methods of Treatment. V. Techniques of Treatment. VI. ... C. drugs, y tematicaUy pr nted under indi idual tit! , ..... 265), wrong vowels in residuum and vitamin (pages 268 and 279), .... Cancer of the Stomach.

A prospective comparison of transvaginal ultrasonography and diagnostic hysteroscopy in the evaluation of patients with abnormal uterine bleeding: clinical implications

NARCIS (Netherlands)

Emanuel, M. H.; Verdel, M. J.; Wamsteker, K.; Lammes, F. B.

1995-01-01

We determined the diagnostic value of transvaginal ultrasonography for endometrial and intrauterine abnormalities in patients with abnormal uterine bleeding. Between June 1, 1992, and June 1, 1993, 279 consecutive patients underwent transvaginal ultrasonography. Findings were compared with the final

Dotazník proaktivního zvládání životních nároků

Czech Academy of Sciences Publication Activity Database

Šolcová, Iva; Lukavský, Jiří; Greenglass, E.

2006-01-01

Roč. 50, č. 2 (2006), s. 148-162 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : Proactive coping Inventory * psychometric properties * Czech adaptation Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

Characterization of monoclonal antibodies against glutamate carboxypeptidase II, the diagnostic and potential therapeutic prostate cancer marker, via the method of surface plasmon resonance

Czech Academy of Sciences Publication Activity Database

Tykvart, Jan; Šácha, Pavel; Konvalinka, Jan

2012-01-01

Roč. 279, SI suppl. 1 (2012), s. 90-90 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II Subject RIV: CE - Biochemistry

Ethnic identity and acculturation of Turkish-Bulgarian adolescents

NARCIS (Netherlands)

Dimitrova, R.; Bender, M.; Chasiotis, A.; van de Vijver, A.J.R.

2013-01-01

We investigated associations of ethnic identity, acculturation orientations, and acculturation outcomes (psychological well-being and socio-cultural adjustment) in a sample of 279 Turkish-Bulgarian adolescents through self-reports and parent reports. This group has a long history of discrimination

Identity of non-self-evident nation: Czech national identity after the break-up of Czechoslovakia and before accession to the European Union

Czech Academy of Sciences Publication Activity Database

Vlachová, Klára; Řeháková, Blanka

2009-01-01

Roč. 15, č. 2 (2009), s. 254-279 ISSN 1354-5078 R&D Projects: GA ČR GA403/02/1500 Institutional research plan: CEZ:AV0Z70280505 Keywords : European Union * ISSP * Czech Republic Subject RIV: AO - Sociology, Demography

International Journal of Health Research

African Journals Online (AJOL)

Erah

(27.9%) and 17.0% for general/teaching hospitals and only. 12.3% for primary ... and that within the public sector, the higher levels of health facilities are ... health facilities attributed mostly to issues of easy access ..... and tertiary education.

Book Review: Patologías de la realidad virtual. Cibercultra y ciencia ficción

Directory of Open Access Journals (Sweden)

Miguel Carrera Garrido

2016-06-01

Full Text Available Reseña: López-Pellisa, T. (2015 Patologías de la realidad virtual. Cibercultra y ciencia ficción. Madrid/México D. F.: Fondo de Cultura Económica. ISBN: 9788437507316, 279 pgs.

ALEXANDRU POPA,UNTERSUCHUNGEN ZU DEN RÖMISCH-BARBARISCHEN KONTAKTEN ÖSTLICH DER RÖMISCHEN PROVINZ DACIA

Directory of Open Access Journals (Sweden)

Vasile Iarmulschi

2016-11-01

Full Text Available ABHNADLUNGEN ZUR VOR-UND FRÜHGESCHICHTE, ZUR KLASSICHEN UND PROVINZIAL-RÖMISCHEN ARCHÄOLOGIE UND ZUR GESCHICHTE DES ALTERTUMS, Band 47, Bonn 2015: Dr. Rudolf Habelt,279 pgs., 130 figures, 58 plates, ISBN 978-3-7749-3884-7

Thermodynamic study of selected monoterpenes II

Czech Academy of Sciences Publication Activity Database

Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.

2014-01-01

Roč. 79, Dec (2014), 272-279 ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014

76 FR 24893 - National Institute on Drug Abuse; Notice of Meeting

Science.gov (United States)

2011-05-03

... applications. Place: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard, Conference... developments in the drug abuse field. Place: National Institutes of Health, Neuroscience Center, 6001 Executive... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

77 FR 35411 - National Institute on Drug Abuse-Notice of Closed Meetings

Science.gov (United States)

2012-06-13

..., Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call). Contact Person.... Agenda: To review and evaluate contract proposals. Place: National Institutes of Health, Neuroscience....nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

Tropical Trametes lactinea is widely distributed in the eastern USA

Czech Academy of Sciences Publication Activity Database

Vlasák, Josef; Kout, J.

2011-01-01

Roč. 115, č. 1 (2011), s. 271-279 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Keywords : Basidiomycota, USA new record, taxonomy * USA new record * taxonomy Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

ORF Alignment: NC_002940 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

Experiment list: SRX1427026 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available of offspring produced at one birth by a viviparous animal. 22029930,97.6,9.8,279 GSM1937509: Input for SHP ChIP-seq with vehicle...ver || age=8-12 week || genotype=wildtype || treatment=vehicle || chip antibody=n

Towards an ontological model defining the social engineering domain

CSIR Research Space (South Africa)

Mouton, F

2014-08-01

Full Text Available -1 ICT and Society IFIP Advances in Information and Communication Technology Volume 431, 2014, pp 266- 279 Towards an Ontological Model Defining the Social Engineering Domain Francois Mouton 1 , Louise Leenen 1 , Mercia M. Malan 2 , and H...

Ruth Benedictová v Československu (léto 1948)

Czech Academy of Sciences Publication Activity Database

Kubáčková, Patricie

2015-01-01

Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics

25 CFR 700.277 - Requests for access to records: Submission.

Science.gov (United States)

2010-04-01

..., both on the envelope and on the face of the request, with the legend “PRIVACY ACT REQUEST FOR ACCESS... further notified that under § 700.279(d) the failure to state willingness to pay fees as high as are...

Predictors of 1-year visual outcome in neovascular age-related macular degeneration following intravitreal ranibizumab treatment

DEFF Research Database (Denmark)

Bloch, Sara Brandi; la Cour, Morten; Sander, Birgit

2013-01-01

Purpose: To describe predictors of visual outcome in patients treated with intravitreal ranibizumab for choroidal neovascularisation (CNV) in age-related macular degeneration (AMD). Methods: Retrospective review of 279 patients with CNV in AMD who fulfilled MARINA/ANCHOR study eligibility criteria...

Pattern of abdominal wall herniae in females: a retrospective analysis.

African Journals Online (AJOL)

Result: There were 181 female patients with 184 hernias representing 27.9% of the total ... It is not unexpected to find variations in the pattern of hernia presentation and outcome of man- .... with majority typically found in elderly females with a.

Relighting Character Motion for Photoreal Simulations

Science.gov (United States)

2006-11-01

Southern California Cinema -Television Interactive Media Division, LA, CA 90089 ABSTRACT. We present a fully image-based approach for...Graphics Proceedings, Annual Conference Series, 279–288. DEBEVEC, P. E., TAYLOR, C. J., AND MALIK, J. 1996. Modeling and rendering architecture from

Analytical results for the Sznajd model of opinion formation

Czech Academy of Sciences Publication Activity Database

Slanina, František; Lavička, H.

2003-01-01

Roč. 35, - (2003), s. 279-288 ISSN 1434-6028 R&D Projects: GA ČR GA202/01/1091 Institutional research plan: CEZ:AV0Z1010914 Keywords : agent models * sociophysics Subject RIV: BE - Theoretical Physics Impact factor: 1.457, year: 2003

Nález barokního kordu z Habřiny na Jaroměřsku ve východních Čechách

Czech Academy of Sciences Publication Activity Database

Žákovský, Petr; Drnovský, P.

2017-01-01

Roč. 42, č. 1 (2017), s. 279-295 ISSN 0231-5823 Institutional support: RVO:68081758 Keywords : rapier * finds from watercourses * Thirty Years' War * Passau * Solingen Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://hdl.handle.net/11222.digilib/136545

ISSN 2073-9990 East Cent. Afr. J. surg. (Online)

African Journals Online (AJOL)

Hp 630 Dual Core

Alcohol use was reported in 38.9% cases 33.9% reported smoking. NSAID ... not, Fisherss exact test: 0.304; and in both the Smokers and Non Smokers (Fisherss exact test. 0.279). ... commonly affected are those younger than 60 years. In this ...

75 FR 9420 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-03-02

.... lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction... Abuse; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory Committee Act, as... unwarranted invasion of personal privacy. [[Page 9421

78 FR 43890 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-07-22

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

African Journal of AIDS Research - Vol 7, No 3 (2008)

African Journals Online (AJOL)

Bridging the gap between VCT and HIV/AIDS treatment uptake: perspectives from a mining-sector workplace in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Anil Bhagwanjee, Inge Petersen, Olagoke Akintola, Gavin George, 271-279.

EJOTMAS 23

African Journals Online (AJOL)

AUNTY TEE

people as well as other peoples in Nigeria and the world over. These cultural ... This very popular global story connects us, the Benin people, to other parts of ..... for Local History, Cultural Heritage and Folk Studies, 6 (2), 259-. 279. Omoera ...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Chemical Sciences. Dhurairajan senthilnathan. Articles written in Journal of Chemical Sciences. Volume 123 Issue 3 May 2011 pp 279-290. Biocatalysis of azidolysis of epoxides: Computational evidences on the role of halohydrin dehalogenase (HheC) · Dhurairajan senthilnathan ...

Rare-gas implantation and damage of fullerene at high fluence

Czech Academy of Sciences Publication Activity Database

Hnatowicz, Vladimír; Vacík, Jiří; Fink, D.; Klett, R.

2000-01-01

Roč. 8, - (2000), s. 279-287 ISSN 1064-122X R&D Projects: GA ČR GA202/96/0077; GA AV ČR KSK1048601 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.846, year: 2000

Monoclonal antibodies specific for the empty conformation of HLA-DR1 reveal aspects of the conformational change associated with peptide binding

Czech Academy of Sciences Publication Activity Database

Carven, G. J.; Chitta, S.; Hilgert, Ivan; Rushe, M. M.; Baggio, R. F.; Palmer, M.; Arenas, J. E.; Strominger, J. L.; Hořejší, Václav; Santambrogio, L.; Stern, L. J.

2004-01-01

Roč. 279, č. 16 (2004), s. 16561-16570 ISSN 0021-9258 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : immunoreceptor * signalling Subject RIV: EC - Immunology Impact factor: 6.355, year: 2004

Excessive Alcohol Use and Risks to Women's Health

Science.gov (United States)

... on Cancer Monograph Working Group. Carcinogenicity of alcoholic beverages . Lancet Oncol 2007;8:292–293 Smith-Warner SA, et al. Alcohol and breast cancer in women: A pooled analysis of cohort studies . JAMA 1998;279(7):535–540. Thun MJ, ...

Analysis of cigarette demand in Argentina: the impact of price changes on consumption and government revenues

Directory of Open Access Journals (Sweden)

German Rodríguez-Iglesias

2017-01-01

Full Text Available Objective. To estimate cigarette demand and to simulate a tax policy targeted to reduce tobacco consumption. Materials and methods. Demand was estimated using a vector error correction model. Simulation exercises present the impact of a tax increase on consumption and revenues. Results. Changes in real income and the real price of cigarettes affect the demand for cigarettes in Argentina. The long term price elasticity is 0.279 (a 10% increase in real prices reduces cigarette consumption by 2.79% per quarter and the long term income elasticity is 0.411 (a 10% increase in real income raises consumption by 4.11% per quarter. Even in a conservative scenario, imulations show that increasing the price of cigarettes by 100% using excise taxes would maximize revenues and reduce cigarette consumption. Conclusion. There is sufficient room to increase taxes, reducing cigarette consumption, while still increasing tax revenues.

Crystal structures of Mycobacterium tuberculosis GlgE and complexes with non-covalent inhibitors

Energy Technology Data Exchange (ETDEWEB)

Lindenberger, Jared J.; Veleti, Sri Kumar; Wilson, Brittney N.; Sucheck, Steven J.; Ronning, Donald R. (Toledo)

2015-08-06

GlgE is a bacterial maltosyltransferase that catalyzes the elongation of a cytosolic, branched α-glucan. In Mycobacterium tuberculosis (M. tb), inactivation of GlgE (Mtb GlgE) results in the rapid death of the organism due to a toxic accumulation of the maltosyl donor, maltose-1-phosphate (M1P), suggesting that GlgE is an intriguing target for inhibitor design. In this study, the crystal structures of the Mtb GlgE in a binary complex with maltose and a ternary complex with maltose and a maltosyl-acceptor molecule, maltohexaose, were solved to 3.3 Å and 4.0 Å, respectively. The maltohexaose structure reveals a dominant site for α-glucan binding. To obtain more detailed interactions between first generation, non-covalent inhibitors and GlgE, a variant Streptomyces coelicolor GlgEI (Sco GlgEI-V279S) was made to better emulate the Mtb GlgE M1P binding site. The structure of Sco GlgEI-V279S complexed with α-maltose-C-phosphonate (MCP), a non-hydrolyzable substrate analogue, was solved to 1.9 Å resolution, and the structure of Sco GlgEI-V279S complexed with 2,5-dideoxy-3-O-α-D-glucopyranosyl-2,5-imino-D-mannitol (DDGIM), an oxocarbenium mimic, was solved to 2.5 Å resolution. These structures detail important interactions that contribute to the inhibitory activity of these compounds, and provide information on future designs that may be exploited to improve upon these first generation GlgE inhibitors.

Prevalence antisociálního chování českých adolescentů z městských oblastí

Czech Academy of Sciences Publication Activity Database

Blatný, Marek; Hrdlička, M.; Sobotková, Veronika; Jelínek, Martin; Květon, Petr; Vobořil, Dalibor

2006-01-01

Roč. 50, č. 4 (2006), s. 297-310 ISSN 0009-062X R&D Projects: GA AV ČR IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : antisocial behavior * adolescence * theory Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

Gradient Space under Orthography and Perspective

Science.gov (United States)

1982-05-24

surfaceorientation to image geometry [8, 9, 10, 13, 15]. The descriptions of important gradient space properties, however, have been scattered throughout...Kanade, T. A Theory of Origami World. Artificial Intelligence 13:279-311, 1980. *[8] Kanade, T. and Kender, J. Mapping Image Properies into Shape

Confining strings revisited - a short comment

International Nuclear Information System (INIS)

Botelho, Luiz C.L.

2000-03-01

We show that Polyakov's confining string Nucl. Phys. B486, (1997) 23, is the author's previously proposed self-avoiding extrinsic strings (Luiz C.L. Botelho), Rev. Bras. Fis. 16, 279, (1986); CALTECH-preprint 68, 1444, (1987); J. Math. Phys. 30 (9), (1989), 2160). (author)

Psychosocial factors associated with smoking behavior among ...

African Journals Online (AJOL)

Psychosocial factors associated with smoking behavior among secondary school adolescents in Ibadan Metropolis. AO Taiwo, PO Olapegba, GA Adejuwon. Abstract. No Abstract. African Journal for the Psychological Study of Social Issues Vol. 8(2) 2005: 264-279. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT

Acidic and catalytic properties of hierarchical zeolites and hybrid ordered mesoporous materials assembled from MFI protozeolitic units

Czech Academy of Sciences Publication Activity Database

Serrano, D. P.; García, R. A.; Vicente, G.; Linares, M.; Vitvarová, Dana; Čejka, Jiří

2011-01-01

Roč. 279, č. 2 (2011), s. 366-380 ISSN 0021-9517 Institutional research plan: CEZ:AV0Z40400503 Keywords : hierarchical zeolites * hybrid zeolitic-mesostructured materials * Bronsted and Lewis acid centres Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.002, year: 2011

Low methanol-permeable polyaniline/Nafion composite membrane for direct methanol fuel cells

Czech Academy of Sciences Publication Activity Database

Wang, C. H.; Chen, C. C.; Hsu, H. C.; Du, H. Y.; Chen, C. P.; Hwang, J. Y.; Chen, L. C.; Shih, H. C.; Stejskal, Jaroslav; Chen, K. H.

2009-01-01

Roč. 190, č. 2 (2009), s. 279-284 ISSN 0378-7753 R&D Projects: GA AV ČR IAA4050313 Institutional research plan: CEZ:AV0Z40500505 Keywords : DMFC * methanol crossover * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.792, year: 2009

Occupational lung cancer risk among men in the Netherlands

NARCIS (Netherlands)

Preller, L.; Balder, H.F.; Tielemans, E.; Brandt, P.A. van den; Goldbohm, R.A.

2008-01-01

Objectives: To assess male lung cancer risks for industrial sectors in the Netherlands and to estimate the proportion of lung cancer attributed to working in specific industrial sectors. Methods: Associations were studied among men aged 55-69 years (n = 58 279) from the prospective Netherlands

Pojetí výslovnosti v českých výkladových slovnících (výzva k diskusi)

Czech Academy of Sciences Publication Activity Database

Štěpánová, Veronika

2013-01-01

Roč. 74, č. 4 (2013), s. 279-297 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA13-00372S Institutional support: RVO:68378092 Keywords : pronunciation * Czech monolingual dictionaries * phonetic transcription * lexicography Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

Časná znalost jazyka: vývoj receptivní znalosti jazyka v prvních dvou letech života

Czech Academy of Sciences Publication Activity Database

Smolík, Filip

2006-01-01

Roč. 50, č. 3 (2006), s. 238-250 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : knowledge and language * receptive knowledge of language * development of knowledge of language Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

75 FR 63498 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-10-15

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Statistical... Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401, 6101 Executive Boulevard... Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated...

76 FR 59415 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-09-26

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Multisites... Administrator, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4234, MSC 9550... funding cycle. (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

78 FR 63994 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-10-25

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Substance Use...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

78 FR 40755 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-07-08

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIH Summer...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

77 FR 27075 - National Institute on Drug Abuse Notice of Closed Meeting

Science.gov (United States)

2012-05-08

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Regulatory..., Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001... Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes...

78 FR 37835 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-06-24

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIH Summer...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

78 FR 73866 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-12-09

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIDA Center... Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

77 FR 22581 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2012-04-16

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel Multi-site... Branch, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001 Executive Blvd... Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes...

75 FR 14175 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-03-24

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401... Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National...

76 FR 35227 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-06-16

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, SecuRX..., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228....nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

75 FR 9606 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-03-03

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Furr, Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH....gov . (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research...

77 FR 3481 - National Institute on Drug Abuse Notice of Closed Meeting

Science.gov (United States)

2012-01-24

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4234, MSC 9550, 6001 Executive Blvd., Bethesda... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

78 FR 22892 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-04-17

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228, MSC 9550, 6001 Executive Blvd.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

76 FR 22715 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-04-22

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIDA Blending..., Training and Special Projects Review Branch, Office of Extramural Affairs, National Institute on Drug Abuse... Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

76 FR 31968 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-06-02

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Technical... Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

Targeting Family Risk Factors in the Context of Treating Youth Depression: A Survey of Psychologists

Science.gov (United States)

Parra, Gilbert R.; Buckholdt, Kelly E.; Olsen, James P.; Jobe-Shields, Lisa; Davis, Genevieve L.; Gamble, Heather L.

2011-01-01

This study investigated the practices and perceptions of psychologists related to targeting family risk factors when treating youth depression. Participants were practicing psychologists recruited through the National Register of Health Service Providers in Psychology (N = 279). Psychologists completed a brief anonymous survey about addressing…

Effect of Genetically Modified Pseudomonas putida WCS358r on the Fungal Rhizosphere Microflora of Field-Grown Wheat

NARCIS (Netherlands)

Glandorf, D.C.M.; Verheggen, Patrick; Jansen, Timo; Jorritsma, J.-W.; Smit, Eric; Leeflang, Paula; Wernars, Karel; Thomashow, L.S.; Laureijs, Eric; Thomas-Oates, J.E.; Bakker, P.A.H.M.; Loon, L.C. van

2001-01-01

We released genetically modified Pseudomonas putida WCS358r into the rhizospheres of wheat plants. The two genetically modified derivatives, genetically modified microorganism (GMM) 2 and GMM 8, carried the phz biosynthetic gene locus of strain P. fluorescens 2-79 and constitutively produced the

Effects of a Rape Awareness Program on College Women: Increasing Bystander Efficacy and Willingness to Intervene

Science.gov (United States)

Foubert, John D.; Langhinrichsen-Rohling, Jennifer; Brasfield, Hope; Hill, Brent

2010-01-01

An experimental study evaluated the efficacy of a sexual assault risk-reduction program on 279 college women that focused on learning characteristics of male perpetrators and teaching bystander intervention techniques. After seeing The Women's Program, participants reported significantly greater bystander efficacy and significantly greater…

A new species of Chaetosphaeria with Menispora ciliata and phialophora-like

Czech Academy of Sciences Publication Activity Database

Réblová, Martina; Seifert, K. A.

2008-01-01

Roč. 29, - (2008), s. 99-105 ISSN 1560-2745 R&D Projects: GA ČR(CZ) GA206/06/1806 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chaetosphaeriales * phialidic conidiogenesis * cultivation Subject RIV: EF - Botanics Impact factor: 2.279, year: 2008

About Military Sexual Trauma

Medline Plus

Full Text Available ... 279 views 3:38 Coping With Depression - Duration: 4:50. Veterans Health Administration 7,515 views 4:50 Prolonged Exposure for PTSD - Duration: 2:45. ... Medical Care - Duration: 3:03. Veterans Health Administration 4,065 views 3:03 Veterans Crisis Line -- After ...

Changes in the moss layer in Czech fens indicate early succession triggered by nutrient enrichment

Czech Academy of Sciences Publication Activity Database

Hájek, M.; Jiroušek, M.; Navrátilová, Jana; Horodyská, E.; Peterka, T.; Plesková, Z.; Navrátil, J.; Hájková, Petra; Hájek, Tomáš

2015-01-01

Roč. 87, č. 3 (2015), s. 279-301 ISSN 0032-7786 R&D Projects: GA ČR GAP505/10/0638 Institutional support: RVO:67985939 Keywords : decline of threatened species * nutrients * vegetation change Subject RIV: EF - Botanics Impact factor: 2.711, year: 2015

Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

Energy Technology Data Exchange (ETDEWEB)

Even, Julia

2011-12-13

synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

Research Library Issues: A Quarterly Report from ARL, CNI, and SPARC. RLI 279

Science.gov (United States)

Baughman, M. Sue, Ed.

2012-01-01

"Research Library Issues" ("RLI") is a quarterly report from ARL (Association of Research Libraries), CNI (Coalition of Networked Information), and SPARC (Scholarly Publishing and Academic Resources Coalition). This issue includes the following articles: (1) Digitization of Special Collections and Archives: Legal and Contractual Issues (Peter B.…

SU-F-T-279: Impact of Beam Energy Drifts On IMRT Delivery Accuracy

International Nuclear Information System (INIS)

Goddu, S; Kamal, G; Herman, A; Edwards, S; Cai, B; Yaddanapudi, S; Oddiraju, S; Rangaraj, D; Mutic, S

2016-01-01

Purpose: According to TG-40 percent-depth-dose (PDD) tolerance is ±2% but TG-142 is ±1%. Now the question is, which one is relevant in IMRT era? The primary objective of this study is to evaluate dosimetric impact of beam-energy-drifts on IMRT-delivery. Methods: Beam-energy drifts were simulated by adjusting Linac’s bending-magnet-current (BMC) followed by tuning the pulse-forming network and adjusting gun-current. PDD change of −0.6% and +1.2% were tested. Planar-dosimetry measurements were performed using an ionization-chamber-array in solid-water phantoms. Study includes 10-head-and-neck and 3-breast cancer patients. en-face beam-deliveries were also tested at 1.3cm and 5.3cm depths. Composite and single-field dose-distributions were compared against the plans to determine %Gamma pass-rates (%GPRs). For plan dose comparisons, changes in %Gamma pass-rates (cPGPRs) were computed/reported to exclude the differences between dose-computation and delivery. Dose distributions of the drifted-energies were compared against their baseline measurements to determine the% GPRs. A Gamma criteria of 3%/3mm was considered for plan-dose comparisons while 3%/1mm used for measured dose intercomparisons. Results: For composite-dose delivery, average cPGPRs were 0.41%±2.48% and −2.54%±3.65% for low-energy (LE) and high-energy (HE) drifts, respectively. For measured dose inter-comparisons, the average%GPRs were 98.4%±2.2% (LE-drift) and 95.8%±4.0 (HE-drift). The average %GPR of 92.6%±4.3% was noted for the worst-case scenario comparing LE-drift to HE-drift. All en-face beams at 5.3 cm depth have cPGPRs within ±4% of the baseline-energy measurements. However, greater variations were noted for 1.3cm depth. Average %GPRs for drifted energies were >99% at 5.3cm and >97% at 1.3cm depths. However, for the worst-case scenario (LE-drift to HE-drift) these numbers dropped to 95.2% at 5.3cm and 93.1% at 1.3cm depths. Conclusion: The dosimetric impact of beam-energy drifts was found to be within clinically acceptable tolerance. However, this study includes a single energy with limited range of PDD change. Further studies are on going and the results will be presented. Received funding from Varian Medical Systems, Palo Alto, CA

Ultrastructure of embryonated eggs of the cestode Gyrocotyle urna (Gyrocotylidea) using cryo-methods

Czech Academy of Sciences Publication Activity Database

Levron, Céline; Scholz, Tomáš; Vancová, Marie; Kuchta, Roman; Conn, D. B.

2016-01-01

Roč. 135, č. 3 (2016), s. 279-289 ISSN 0720-213X R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Gyrocotylidea * Ultrastructure * Embryonic * Cryo-technique * Cestoda Subject RIV: EG - Zoology Impact factor: 1.038, year: 2016

PŘÍRODNÍ LÁTKY KYSELÉ CHUTI

Czech Academy of Sciences Publication Activity Database

Lapčík, O.; Wimmer, Zdeněk; Opletal, L.; Moravcová, J.; Čopíková, J.; Drašar, P.

2015-01-01

Roč. 109, č. 7 (2015), s. 488-491 ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : natural compound * sour taste/perception * food supplement Subject RIV: GM - Food Processing Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_07_488-491.pdf

G A Adebayo

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. G A Adebayo. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. L A Hussain. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

Data of evolutionary structure change: 1BRYY-1RTCA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1BRYY-1RTCA 1BRY 1RTC Y A --------DVSFRLSGATTTSYGVFIKNLREAL-PYERKVYNIPLLRSS--ISGSGRYTLLHLTNYADETISVAVDVTNVYIMGYLAGDVSYF...48 1RTC A 1RTCA THR CA 279 1RTC A 1RTCA...ryChain> 1RTC A 1RTCA SALYYYSTGGT...285 LEU CA 308 1RTC A 1RTCA

Surface Collisions of the Acetonitrile Molecular Ion: Evidence for Isomerization of CD3CN center dot+ to the Ketenimine Cation CD2=C=ND center dot+

Czech Academy of Sciences Publication Activity Database

Mair, C.; Roithová, Jana; Fedor, J.; Lezius, M.; Herman, Zdeněk; Märk, T. D.

223-224, 1/3 (2003), s. 279-290 ISSN 1387-3806 R&D Projects: GA ČR GA203/00/0632 Institutional research plan: CEZ:AV0Z4040901 Keywords : acetonitrile cation * surface reactions * isomerization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.361, year: 2003

Kirjandus ja riigikirjand / Maia Madisso

Index Scriptorium Estoniae

Madisso, Maia

2001-01-01

2001.a. riigieksami kirjandite analüüs, milles vaadeldakse, kuivõrd on töödes tuginetud kirjandusteostele. 2001.a. riigikirjand oli esimene omataoline, mille puhul kirjandusele toetumine ei olnud ühegi teema puhul obligatoorne. Analüüsiks kasutati 279 kirjandist koosnevat juhuslikku valikut.

Sensitivity of Pseudomonas fluorescens to gamma irradiation following surface inoculations on romaine lettuce and baby spinach

Science.gov (United States)

Irradiation of fresh fruits and vegetables is a post-harvest intervention measure often used to inactivate pathogenic food-borne microbes. We evaluated the sensitivity of Pseudomonas fluorescens strains (2-79, Q8R1, Q287) to gamma irradiation following surface inoculations on romaine lettuce and spi...

75 FR 7303 - Union Pacific Railroad Company-Abandonment Exemption-in Polk County, IA

Science.gov (United States)

2010-02-18

... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Docket No. AB-33 (Sub-No. 279X)] Union Pacific Railroad Company--Abandonment Exemption--in Polk County, IA Union Pacific Railroad Company... milepost 10.70 in Ankeny, in Polk County, IA. The line traverses United States Postal Service Zip Code...

The effect of temperature on the phenology of germination of Isoëtes lacustris

Czech Academy of Sciences Publication Activity Database

Čtvrtlíková, Martina; Znachor, P.; Vrba, J.

2014-01-01

Roč. 86, č. 3 (2014), 279-292 ISSN 0032-7786 R&D Projects: GA ČR GAP504/10/0781; GA AV ČR KJB600050704 Institutional support: RVO:67985939 Keywords : aquatic lycopod * reproduction * early ontogeny Subject RIV: EF - Botanics Impact factor: 4.104, year: 2014

Temporal variation of trace elements in waters polluted by municipal solid waste landfill leachate

Czech Academy of Sciences Publication Activity Database

Ettler, V.; Mihaljevič, M.; Matura, M.; Skalková, M.; Šebek, O.; Bezdička, Petr

2008-01-01

Roč. 80, č. 3 (2008), s. 274-279 ISSN 0007-4861 R&D Projects: GA AV ČR KJB3111402 Institutional research plan: CEZ:AV0Z40320502 Keywords : trace elements * landfill leachate * temporal variation Subject RIV: DD - Geochemistry Impact factor: 0.609, year: 2008

Anthropometry in relation to prostate cancer risk in the Netherlands : cohort study

NARCIS (Netherlands)

Schuurman, A.G.; Goldbohm, R.A.; Dorant, E.; Brandt, P.A. van den

2000-01-01

In the Netherlands Cohort Study, the authors investigated whether anthropometry is associated with prostate cancer risk. At baseline in 1986, 58,279 men aged 55-69 years completed a self- administered questionnaire on diet, anthropometry, and other risk factors for cancer. After 6.3 years of

78 FR 73552 - National Institute On Alcohol Abuse and Alcoholism; National Institute On Drug Abuse; and...

Science.gov (United States)

2013-12-06

..., HHS). (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research... Alcohol Abuse and Alcoholism; National Institute On Drug Abuse; and National Cancer Institute; Notice of....), notice is hereby given of a meeting of the National Advisory Council on Alcohol Abuse and Alcoholism...

78 FR 27411 - National Institute on Drug Abuse Notice of Closed Meetings

Science.gov (United States)

2013-05-10

... funding cycle. (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... Abuse Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse...

77 FR 58855 - National Institute on Drug Abuse Notice of Closed Meetings

Science.gov (United States)

2012-09-24

....gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... Abuse Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis...

78 FR 19499 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-04-01

... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs... Abuse; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory Committee Act, as... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Profile...

75 FR 25278 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-05-07

..., MD 21224, (410) 550-1547. (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse... Abuse; Notice of Closed Meeting Pursuant to section 10(d) of the Federal Advisory Committee Act, as... conducted by the National Institute on Drug Abuse, including consideration of personnel qualifications and...

Fetal and postnatal development of T-lymphocyte subpopulations

Czech Academy of Sciences Publication Activity Database

Matalová, Eva; Kovářů, F.; Kovářů, H.; Fišerová, Anna; Zelníčková, P.; Landa, L.

2002-01-01

Roč. 71, č. 4 (2002), s. 279-282 ISSN 0001-7213 R&D Projects: GA ČR GA304/01/0850; GA AV ČR KSK6005114 Keywords : prenatal ontogenesis * pig foetuses * lymphatic organs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.370, year: 2002

75 FR 21006 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-04-22

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis..., Office of Extramural Affairs, National Institute on Drug Abuse, NIH, 6101 Executive Blvd., Rm. 213, MSC.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

75 FR 13136 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-03-18

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Institute on Drug Abuse, NIH. DHHS, Room 220, MSC 8401, 6101 Executive Boulevard, Bethesda, MD 20892- 8401... Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

76 FR 81952 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-12-29

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Training and... Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4245, MSC 9550, 6001 Executive Blvd... Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated...

75 FR 42102 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-07-20

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Research..., lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute on Drug...

78 FR 63995 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2013-10-25

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel R13 Conference... Officer, Grants Review Branch, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

77 FR 72365 - National Institute on Drug Abuse; Notice of Meeting

Science.gov (United States)

2012-12-05

... U.S.C. App.), notice is hereby given of a meeting of the National Advisory Council on Drug Abuse... administrative, legislative and program developments in the drug abuse field. Place: National Institutes of... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

77 FR 44640 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2012-07-30

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel Rodent Testing...: Lyle Furr, Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse..., lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

Praktická aplikace techniky fotochemické oxidace H2O2/UVC pro čištění kontaminovaných podzemních vod

Czech Academy of Sciences Publication Activity Database

Mašín, P.; Krystyník, Pavel; Žebrák, R.

2015-01-01

Roč. 109, č. 11 (2015), s. 885-891 ISSN 0009-2770 R&D Projects: GA MPO(CZ) FR-TI1/065 Institutional support: RVO:67985858 Keywords : photochemical oxidation * hydrogen peroxide * ultraviolet irradiation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.279, year: 2015

Search for supersymmetry in events with photons, bottom quarks, and missing transverse momentum in proton-proton collisions at a centre-of-mass energy of 7 TeV with the ATLAS detector

Czech Academy of Sciences Publication Activity Database

Aad, G.; Abajyan, T.; Abbott, B.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Vrba, Václav; Zeman, Martin

2013-01-01

Roč. 719, 4-5 (2013), s. 261-279 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional support: RVO:68378271 Keywords : ATLAS * CERN * supersymmetry * Gauge mediation * Higgs boson Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.019, year: 2013

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. O akinlade. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

Energy restriction early in life and colon carcinoma risk: Results of The Netherlands Cohort Study after 7.3 years of follow-up

NARCIS (Netherlands)

Dirx, M.J.M.; Brandt, P.A. van den; Goldbohm, R.A.; Lumey, L.H.

2003-01-01

BACKGROUND. This study evaluated the effects of severe undernutrition during adolescence and subsequent colon carcinoma risk. METHODS. The authors evaluated The Netherlands Cohort Study on Diet and Cancer (NLCS) among 62,573 women and 58,279 men aged 55-69 years at baseline. Information on diet and

Sustained Release of Vancomycin from Polyurethane Scaffolds Inhibits Infection of Bone Wounds in a Rat Femoral Segmental Defect Model

Science.gov (United States)

2010-04-09

1215 Jefferson Davis Highway, Suite 1204, Arlington VA 22202-4302 Respondents should be aware that notwithstanding any other provision of law , no person...testing for potential treatment of osteomyelitis, Clin. Orthop. Relat. Res. (2003) 279–285. [40] K. Takacsnovak, B. Noszal, M. Tokeskovesdi, G. Szasz

Reviews

NARCIS (Netherlands)

NN,

2001-01-01

ENGEL, D.H. & S. PHUMMAI. 2000. What’s that tree? A field guide to tropical plants of Asia. 279 pp. Times Editions, Singapore. ISBN 981g-204-917-7. Paperback. Numerous colour photographs. Price: USD 29.90. On-line bookstore: http://www.timesone.com.sg/te

Visualization and mass transfer with a bistable two-slot impinging jet

Czech Academy of Sciences Publication Activity Database

Trávníček, Zdeněk; Maršík, František

2003-01-01

Roč. 6, č. 4 (2003), s. 337-441 ISSN 1343-8875 R&D Projects: GA AV ČR IAA2076203 Institutional research plan: CEZ:AV0Z2076919 Keywords : visualization * mass transfer * impinging jet Subject RIV: BK - Fluid Dynamics Impact factor: 0.279, year: 2002

Spiritualita jako klíč k osobnosti a lidským vztahům

Czech Academy of Sciences Publication Activity Database

Říčan, Pavel

2006-01-01

Roč. 50, č. 2 (2006), s. 119-137 ISSN 0009-062X R&D Projects: GA ČR GA406/05/0940 Institutional research plan: CEZ:AV0Z70250504 Keywords : spiritualiy * personality * human relationships Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

75 FR 34049 - FM Table of Allotments (The Dalles, Tualatin, Eugene, Albany, Lebanon, Paisley, and Diamond Lake...

Science.gov (United States)

2010-06-16

... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [DA 10-786; MB Docket No. 05-10; RM-11279] FM Table of Allotments (The Dalles, Tualatin, Eugene, Albany, Lebanon, Paisley, and Diamond Lake, Oregon... 279C, Lebanon, Oregon, Bicoastal Media Licenses IV, LLC (``Bicoastal''), licensee of Station KACI-FM...

Cultivating the Academic Integrity of Urban Adolescents with Ethical Philosophy Programming

Science.gov (United States)

Seider, Scott; Novick, Sarah; Gomez, Jessica

2013-01-01

This mixed-methods study considered the effects of ethical philosophy programming at a high-performing, high-poverty urban high school upon the academic integrity of participating adolescents ("n" = 279). Analyses of pre-post survey data revealed that participating adolescents reported significantly higher levels of academic integrity…

Genetics Home Reference: 1q21.1 microdeletion

Science.gov (United States)

... reciprocal 1q21.1 deletions and duplications associated with microcephaly or macrocephaly and developmental and behavioral abnormalities. Nat Genet. 2008 Dec;40(12):1466-71. doi: 10.1038/ng.279. Citation on PubMed or Free article on PubMed Central Haldeman-Englert CR, Jewett T. ...

Capillary electrophoresis in an extended nanospray tip-electrospray as an electrophoretic column

Czech Academy of Sciences Publication Activity Database

Týčová, Anna; Foret, František

2015-01-01

Roč. 1388, APR (2015), s. 274-279 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : mass spectrometry * interface * separation * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015

The Effect of Reading Comprehension and Problem Solving Strategies on Classifying Elementary 4th Grade Students with High and Low Problem Solving Success

Science.gov (United States)

Ulu, Mustafa

2017-01-01

In this study, the effect of fluent reading (speed, reading accuracy percentage, prosodic reading), comprehension (literal comprehension, inferential comprehension) and problem solving strategies on classifying students with high and low problem solving success was researched. The sampling of the research is composed of 279 students at elementary…

High efficiency 40 K single-stage Stirling-type pulse tube cryocooler

Science.gov (United States)

Wu, X. L.; Chen, L. B.; Pan, C. Z.; Cui, C.; Wang, J. J.; Zhou, Y.

2017-12-01

A high efficiency single-stage Stirling-type coaxial pulse tube cryocooler (SPTC) operating at around 40 K has been designed, built and tested. The double-inlet and the inertance tubes together with the gas reservoir were adopted as the phase shifters. Under the conditions of 2.5 MPa charging pressure and 30 Hz operating frequency, the prototype has achieved a no-load temperature of 23.8 K with 330 W of electric input power at a rejection temperature of 279 K. When the input power increases to 400 W, it can achieve a cooling capacity of 4.7 W/40 K while rejecting heat at 279 K yielding an efficiency of 7.02% relative to Carnot. It achieves a cooling capacity of 5 W/40 K with an input power of 450 W. It takes 10 minutes for the SPTC to cool to its no-load temperature of 40 K from 295 K.

Bubble-assisted film evaporation correlation for saline water at sub-atmospheric pressures in horizontal-tube evaporator

KAUST Repository

Shahzad, Muhammad Wakil; Myat, Aung; Chun, Won Gee; Ng, Kim Choon

2013-01-01

film boiling on horizontal tubes, but working at low pressures of 0.93-3.60 kPa (corresponding solution saturation temperatures of 279-300 K) as well as seawater salinity of 15,000 to 90,000 mg/l or ppm. Owing to a dearth of literature on film

Effects of gamma irradiation on the survival of Pseudomonas fluorescens inoculated on romaine lettuce

Science.gov (United States)

Irradiation of fresh fruits and vegetables has been utilized as a post-harvest intervention measure for inactivation of microbial pathogens. Pseudomonas fluorescens 2-79, Q8R1, Q287 are non-plant pathogenic, non-pectolytic strains of a potential biocontrol agent. We tested the sensitivity of these s...

Animal products, calcium and protein and prostate cancer risk in the Netherlands Cohort Study

NARCIS (Netherlands)

Schuurman, A.G.; Brandt, P.A. van den; Dorant, E.; Goldbohm, R.A.

1999-01-01

Prostate cancer risk in relation to consumption of animal products, and intake of calcium and protein was investigated in the Netherlands Cohort Study. At baseline in 1986, 58,279 men aged 55-69 years completed a self-administered 150-item food frequency questionnaire and a questionnaire on other

Growth and quality of Grevillea robusta provenances in Ruhande ...

African Journals Online (AJOL)

user

seven Queensland (Australia) provenances and one land race on an oxisol at Ruhande Arboretum,. Butare, Rwanda was carried out. The species is .... could not be executed due to problems of war and genocide in 1994. Assessment procedures ..... Forest Ecology and Management 80: 279-285. 10. Kalinganire, A. 1999.

Methods for Determination of Bioaccessibility and Bioavailability of Hydrophobic Organic Pollutants

Czech Academy of Sciences Publication Activity Database

Čvančarová, Monika; Cajthaml, Tomáš

2015-01-01

Roč. 109, č. 4 (2015), s. 254-268 ISSN 0009-2770 R&D Projects: GA TA ČR TE01020218; GA ČR GA13-28283S Institutional support: RVO:61388971 Keywords : bioremediation * bioaccumulation * environmental risk assessment Subject RIV: EE - Microbiology, Virology Impact factor: 0.279, year: 2015

Vrstevnická konformita jako faktor rizikového chování mladistvých: struktura, zdroje, dopady

Czech Academy of Sciences Publication Activity Database

Jelínek, Martin; Květon, Petr; Vobořil, Dalibor; Blatný, Marek; Hrdlička, M.

2006-01-01

Roč. 50, č. 5 (2006), s. 393-404 ISSN 0009-062X R&D Projects: GA AV ČR(CZ) IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : peer conformity * peer pressure * parenting styles Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

Growth, haematological and biochemical responses of growing ...

African Journals Online (AJOL)

p2492989

Abstract. Physiological and productive responses to recombinant bovine somatotropin (rbST) injection and calcium soap of fatty acids (CSFA) supplementation were studied in post-weaning male Rahmani lambs. Male lambs (n = 20) of similar initial body weight (27.9 kg) and age (162 d) were divided randomly into four.

U.S. Army Nurse Membership, Accession and Loss Profiles (1987). Volume 1, Reserves

Science.gov (United States)

1988-12-01

34male" dominated professions. Studies by Astin et al. (1987) and Green (1987) reveal that the national economy influences student career choices. That...Nursin Ecs, 5(6), 1987, 267-279. Bureau of Labor Statistics. Industry Wace survey: Nursing and Personal Care Facilities. Ss-t~d= 1985. (Bull. 2275

Determination of the antioxidative activity of substituted 5-aminopyrimidines

Czech Academy of Sciences Publication Activity Database

Procházková, Eliška; Jansa, Petr; Dračínský, Martin; Holý, Antonín; Mertlíková-Kaiserová, Helena

2012-01-01

Roč. 46, č. 1 (2012), s. 61-67 ISSN 1071-5762 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : 5-aminopyrimidines * TEAC * lipid peroxidation * HepG2 Subject RIV: CC - Organic Chemistry Impact factor: 3.279, year: 2012

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

76 FR 35226 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2011-06-16

...-402-6626, [email protected] . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse... Abuse; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as... invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel...

77 FR 63846 - National Institute on Drug Abuse; Notice of Closed Meetings

Science.gov (United States)

2012-10-17

[email protected] . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... Abuse; Notice of Closed Meetings Pursuant to section 10(d) of the Federal Advisory Committee Act, as... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis...

Description of .i.Paratylenchus (Gracilacus) straeleni./i. (De Coninck, 1931) Oostenbrink, 1960 (Nematoda: Criconematoidea, Tylenchulidae) from hazelnut in Turkey and its comparison with other world populations

Czech Academy of Sciences Publication Activity Database

Akyazi, F.; Felek, A.F.; Čermák, V.; Čudejková, M.; Foit, J.; Yildiz, S.; Háněl, Ladislav

2015-01-01

Roč. 52, č. 3 (2015), s. 270-279 ISSN 0440-6605 Grant - others:GA MŠk(CZ) EE2.3.20.0265 Program:EE Institutional support: RVO:60077344 Keywords : Corylus avellana * multivariate analyses * phylogeny * sequencing * species complex Subject RIV: EG - Zoology Impact factor: 0.602, year: 2015

Conization of the cervix uteri. Complications in connection with plain catgut or silk suturing

DEFF Research Database (Denmark)

Holmskov, A; Qvist, N; Møller, A

1984-01-01

During a retrospective study on postoperative complications in 213 patients who had undergone conization, a (non-significant) reduction in the bleeding rate from 27.9% to 18.6% was found when using silk sutures (102 patients) instead of plain catgut (111 patients) for adaption of the edges of the...

76 FR 51381 - National Institute on Drug Abuse; Notice of Meeting

Science.gov (United States)

2011-08-18

... U.S.C. App.), notice is hereby given of a meeting of the National Advisory Council on Drug Abuse... administrative, legislative and program developments in the drug abuse field. Place: National Institutes of.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

77 FR 47654 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2012-08-09

... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse... Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001 Executive Boulevard, Bethesda, MD 20892- 9550, (301) 435-1439, lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse...

75 FR 6042 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-02-05

... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401, 6101 Executive Blvd., Bethesda, MD 20892-8401, 301... Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

76 FR 31967 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2011-06-02

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; N01DA-11-7777.... Ruiz, PhD, Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse....: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated: May 26...

78 FR 62946 - Additional Designations, Foreign Narcotics Kingpin Designation Act

Science.gov (United States)

2013-10-22

... significant foreign narcotics traffickers as identified by the President. In addition, the Secretary of the...; R.F.C. PAPA751109870 (Mexico); C.U.R.P. PAPA751109HNEDSL04 (Mexico) (individual) [SDNTK] (Linked To... No. 279, Supermanzana 50, Manzana 14, Lote 17, Residencial San Angel, Cancun, Quintana Roo, Mexico...

Current Topics in the Asymmetric Transfer Hydrogenation of Imines

Czech Academy of Sciences Publication Activity Database

Januščák, J.; Václavík, Jiří; Šot, P.; Pecháček, J.; Vilhanová, B.; Kuzma, Marek; Kačer, P.

2015-01-01

Roč. 109, č. 7 (2015), s. 492-498 ISSN 0009-2770 R&D Projects: GA ČR GAP106/12/1276; GA MŠk(CZ) LO1509 Institutional support: RVO:61388971 Keywords : asymmetric transfer hydrogenation * ruthenium * isoquinoline Subject RIV: EE - Microbiology, Virology Impact factor: 0.279, year: 2015

Use of a Modified Chaining Procedure with Textual Prompts to Establish Intraverbal Storytelling

Science.gov (United States)

Valentino, Amber L.; Conine, Daniel E.; Delfs, Caitlin H.; Furlow, Christopher M.

2015-01-01

Echoic, tact, and textual transfer procedures have been proven successful in establishing simple intraverbals (Braam and Poling "Applied Research in Mental Retardation," 4, 279-302, 1983; Luciano "Applied Research in Mental Retardation," 102, 346-357, 1986; Watkins et al. "The Analysis of Verbal Behavior," 7, 69-81,…

Motivation for treatment in substance-dependent patients. Psychometric evaluation of the TCU motivation for treatment scales

NARCIS (Netherlands)

de Weert-van Oene, Gerdien H.; Schippers, Gerard M.; de Jong, Cor A. J.; Schrijvers, Guus A. J. P.

2002-01-01

The objective of this paper is to analyze the psychometric properties of the TCU Motivation for Treatment (MfT) scale in alcohol- and drug-dependent patients in an inpatient treatment facility in the Netherlands, to see whether it is useful in European populations as well. In the study, 279

The universality of childhood emotional abuse: A meta-analysis of worldwide prevalence

NARCIS (Netherlands)

Stoltenborgh, M.; Bakermans-Kranenburg, M.J.; Alink, L.R.A.; van IJzendoorn, M.H.

2012-01-01

This comprehensive meta-analysis combined prevalence figures of child emotional abuse reported in 29 studies, including 46 independent samples with a total of 7,082,279 participants. The overall estimated prevalence was 3/1,000 for studies using informants and 363/1,000 for studies using self-report

Nonparticipation in Adult Education: From Self-Perceptions to Alternative Explanations

Science.gov (United States)

Porras-Hernandez, Laura Helena; Salinas-Amescua, Bertha

2012-01-01

In this article, the authors propose that dispositional factors do not sufficiently explain nonparticipation in adult education programs. Many nations report low participation rates, but empirical studies have usually been conducted with enrolled adults. This study, however, included 279 poorly educated mestizas and Native women in two regions of…

Temperament Constructs Related to Betrayal of Trust

Science.gov (United States)

1991-12-01

disintegrate. The interrelatedness between system trust and interpersonal trust has been noted by Durkheim (1933), who predicted a loss of trust in others...and suspicion. Journal of Conflict Resolution, 2, 265-279. Durkheim , E. (1933). The division of labor in societ’. New York: Free Press of Glencoe

Continuing Medical Education - Vol 31, No 8 (2013)

African Journals Online (AJOL)

Nuclear medicine in oncology 1: Lymphoma, and cancer of the lung, colon, and oesophagus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Ellmann, J Holness, 279-283. Nuclear medicine in oncology 2: Breast, prostate, and cervical cancer, melanoma, and ...

Breaking ground in cross-cultural research on the fear of being laughted at (gelotophobia): A multi-national study involving 73 countries

Czech Academy of Sciences Publication Activity Database

Proyer, R.T.; Ruch, W.; Ali, N.S.; Al-Olimat, H. S.; Amemiya, T.; Adal, T.A.; Ansari, S. A.; Arhar, Š.; Asem, G.; Baudin, N.; Bawab, S.; Bergen, D.; Brdar, I.; Brites, R.; Brunner-Sciarra, M.; Carrell, A.; Dios, H.C.; Celik, M.; Ceschi, G.; Chang, K.; Cheryomukhin, A.; Chik, M.P.Y.; Chlopicki, W.; Cranney, J.; Dahourou, D.; Doosje, S.; Dore, M.; El-Arousy, N.; Ficková, E.; Führ, M.; Gallivan, J.; Geling, H.; Germikova, L.; Goh, A.; Gonzáles, R.D.; Ho, S.K.; Hřebíčková, Martina; Jaime, B.; Hertzberg Kaare, B.; Kamble, S.; Kazarian, S.; Kerkkänen, P.; Klementová, M.; Kobozeva, I.M.; Kovjanic, S.; Kumaraswamy, N.; Lampert, M.; Liao, Ch.; Levesque, M.; Loizou, L.; Loving, R.D.; Lyttle, J.; Machline, V.C.; McGoldrick, S.; McRorie, M.; Min, L.; Mottus, R.; Munyae, M.; Navia, C.E.; Nkhalamba, M.; Pedrini, P.P.; Petkova, M.; Platt, T.; Popa, D-E.; Radomska, A.; Rashid, T.; Rawlings, D.; Rubio, V.J.; Samson, A.C.; Sarid, O.; Shams, S.; Sisokohm, S.; Smári, J.; Sneddon, I.; Snikhovska, I.; Stephanenko, E.A.; Stokenberga, L.; Stuer, B.; Tanoto, Y.S.R.; Tapia, L.; Taylor, J.; Thibault, P.; Thompson, A.; Thőrn, H.; Toyota, H.; Ujlaky, J.; Vanno, V.; van der Westhuizen, B.; Wijayathilake, D.; Wong, P.S.O.; Wycoff, E.B.; Yeun, E.J.

2009-01-01

Roč. 22, 1/2 (2009), s. 253-279 ISSN 0933-1719 R&D Projects: GA ČR GA406/07/1561 Institutional research plan: CEZ:AV0Z70250504 Keywords : cross -cultural comparisons * gelotophobia * humor * multi-national study Subject RIV: AN - Psychology Impact factor: 0.771, year: 2009

Development of SSR markers for the short arm of rye chromosome 1

Czech Academy of Sciences Publication Activity Database

Kofler, R.; Stift, G.; Gong, L.; Suchánková, Pavla; Šimková, Hana; Doležel, Jaroslav; Lelley, T.

2007-01-01

Roč. 71, - (2007), s. 279-281 ISSN 0723-7812 R&D Projects: GA ČR GA521/04/0607 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje Keywords : SSR markers * rye chromosome 1 Subject RIV: GE - Plant Breeding

Clinical evolution of adult, elderly and very elderly patients admitted in Intensive Care Units Evolución clínica de adultos, ancianos y muy ancianos internados en Unidades de Terapia Intensiva Evolução clínica de adultos, idosos e muito idosos internados em Unidade de Terapia Intensiva

Directory of Open Access Journals (Sweden)

Verônica Cunha Rodrigues de Oliveira

2011-12-01

Full Text Available This study compared clinical outcomes among adult, elderly and very elderly patients admitted to Intensive Care Units (ICUs located in São Paulo, Brazil. This retrospective, longitudinal and comparative study included 279 adult (≥18 and El estudio comparó la evolución clínica de adultos, ancianos y muy ancianos internados en Unidades de Terapia Intensiva localizadas en Sao Paulo, Brasil. El estudio fue retrospectivo longitudinal, del tipo comparativo. Participaron 279 adultos (≥18 y O estudo comparou a evolução clínica de adultos, idosos e muito idosos, internados em Unidades de Terapia Intensiva, localizadas em São Paulo, Brasil. Trata-se de estudo retrospectivo-longitudinal, do tipo comparativo. Participaram 279 adultos (≥18 e <60 anos, 216 idosos (≥60 e <80 anos e 105 muito idosos (≥80 anos. Os adultos diferiram dos outros grupos em relação à unidade de destino e evolução da gravidade, segundo Simplified Acute Physiology Score II. Foi mais prevalente o encaminhamento dos adultos para unidades de internação, porém, os idosos e muito idosos, sobreviventes à internação na unidade crítica, apresentaram melhora mais acentuada antes da alta. Entre adultos e idosos ocorreu diferença em relação à mortalidade, com maior taxa no grupo mais velho; entretanto, a mortalidade dos muito idosos e adultos foi similar. Em geral, os resultados indicaram que a idade mais avançada não foi fator associado aos desfechos indesejáveis da assistência intensiva.

Direct detection of carbapenemase-associated proteins of Acinetobacter baumannii using nanodiamonds coupled with matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.

Science.gov (United States)

Chang, Kai-Chih; Chung, Chin-Yi; Yeh, Chen-Hsing; Hsu, Kuo-Hsiu; Chin, Ya-Ching; Huang, Sin-Siang; Liu, Bo-Rong; Chen, Hsi-An; Hu, Anren; Soo, Po-Chi; Peng, Wen-Ping

2018-04-01

The appearance and spread of carbapenem-resistant Acinetobacter baumannii (CRAB) pose a challenge for optimization of antibiotic therapies and outbreak preventions. The carbapenemase production can be detected through culture-based methods (e.g. Modified Hodge Test-MHT) and DNA based methods (e.g. Polymerase Chain Reaction-PCR). The culture-based methods are time-consuming, whereas those of PCR assays need only a few hours but due to its specificity, can only detect known genetic targets encoding carbapenem-resistance genes. Therefore, new approaches to detect carbapenemase-producing A. baumannii are of great importance. Here, we have developed a rapid and novel method using detonation nanodiamonds (DNDs) as a platform for concentration and extraction of A. baumannii carbapenemase-associated proteins prior to matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF-MS) analysis. To concentrate and extract the A. baumannii carbapenemase-associated proteins, we tested several protein precipitation conditions and found a 0.5% trifluoroacetic acid (TFA) solution within the bacterial suspension could result in strong ion signals with DNDs. A total of 66 A. baumannii clinical-isolates including 51 carbapenem-resistant strains and 15 carbapenem-susceptible strains were tested. Our result showed that among the 51 carbapenem-resistant strains 49 strains had a signal at m/z ~40,279 (±87); among the 15 carbapenem-susceptible strains, 4 strains showed a signal at m/z ~40,279. With on-diamond digestion, we confirmed that the captured protein at m/z ~40,279 was related to ADC family extended-spectrum class C beta-lactamase, from A. baumannii. Using this ADC family protein as a biomarker (m/z ~ 40,279) for carbapenem susceptibility testing of A. baumannii, the sensitivity and the specificity could reach 96% and 73% as compared to traditional imipenem susceptibility testing (MIC results). However, the sensitivity and specificity of this method

A Study of the Participation of Women in the Health Care Industry Labor Force. Executive Summary.

Science.gov (United States)

Lebowitz, Ann, Ed.

A study was conducted to explore the relationship between socioeconomic and personal circumstances of women in health occupations and their labor market behavior. Using a conceptual framework (the Life Patterning Process), discussions were held in six states with a total of 279 women representing five health occupations: registered nurses,…

75 FR 25278 - National Institute on Drug Abuse; Notice of Closed Meeting

Science.gov (United States)

2010-05-07

... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; N44DA-10-5542... Institute on Drug Abuse, NIH, 6101 Executive Blvd., Room 220, MSC 8401, Bethesda, MD 20852, 301-435-1432, [email protected] . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and...

A new species of Australotaenia (Cestoda: Proteocephalidea) from a snake in Cambodia: host switching or postcyclic parasitism in a distant region?

Czech Academy of Sciences Publication Activity Database

de Chambrier, A.; Scholz, Tomáš

2012-01-01

Roč. 59, č. 4 (2012), s. 279-286 ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : taxonomy * zoogeography * tapeworms * helminths * Reptilia * South East Asia * Indomalayan Region Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.515, year: 2012 http://folia.paru.cas.cz/detail.php?id=22092

Nomina generica conservanda et rejicienda Spermatophytorum

NARCIS (Netherlands)

Rickett, H.W.; Stafleu, F.A.

1961-01-01

Pages 220-279 of the International Code of Botanical Nomenclature (1956) are occupied by a list of conserved and rejected names of genera of Spermatophyta. The origins and history of conservation have been discussed by Stafleu (Taxon 5: 85-95). As a result of his study it became evident that the

Cacilda Borges Do Valle

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics. Cacilda Borges Do Valle. Articles written in Journal of Genetics. Volume 83 Issue 3 December 2004 pp 279-283 Research Note. Abnormal pollen mitoses (PM I and PM II) in an interspecific hybrid of Brachiaria ruziziensis and Brachiaria decumbens (Gramineae) · Andréa Beatriz ...

gontrols of dimethyl sulphide in the f—y of feng—l during fyfwiˆE€ilot ...

Indian Academy of Sciences (India)

While the former facilitates the trapping of radiation (greenhouse effect) the latter ... does not seem to control the extent of DMS concentrations. We find ... Printed in India. 279 ... Bird CTD system was used along with a rosette to ... Water samples were analyzed for oxygen, Aerosol samples were collected at variable heights.

13 CFR 313.7 - Implementation grants for Impacted Communities.

Science.gov (United States)

2010-01-01

..., construction, rehabilitation and equipping of facilities; (2) Market or industry research and analysis; (3... improving the delivery of business services, or feasibility studies; (4) Public services; (5) Training; and... section 278 of the Trade Act or a Sector Partnership Grant under section 279A of the Trade Act while the...

76 FR 76689 - Cibola National Forest, Mount Taylor Ranger District, NM, Mount Taylor Combined Exploratory Drilling

Science.gov (United States)

2011-12-08

... National Forest, Mount Taylor Ranger District, NM, Mount Taylor Combined Exploratory Drilling AGENCY... proposed action is to approve two Plans of Operations for exploratory uranium drilling on the Cibola... San Mateo. In total, there are up to 279 drill holes that would be drilled over a period not to exceed...

Pharmacognostic evaluation of the leaves of Dissotis rotundifolia ...

African Journals Online (AJOL)

STORAGESEVER

2009-01-05

Jan 5, 2009 ... Romania, pp.17-25. Evans WC (1996). Trease and Evans Pharmacognosy. WB Saunders. Ltd. London. 14th Ed. 119-159. Harborne JB (1992). Phytochemical methods. A guide to modern technique of plant analysis. Chapman and Hill, London, p. 279. Kokwaro JC (1976). Medicinal plants of East Africa.

Hyaluronan minimizes effects of UV irradiation on human keratinocytes

Czech Academy of Sciences Publication Activity Database

Hašová, M.; Crhák, Tomáš; Šafaříková, Barbora; Dvořáková, J.; Muthný, T.; Velebný, V.; Kubala, Lukáš

2011-01-01

Roč. 303, č. 4 (2011), s. 277-284 ISSN 0340-3696 R&D Projects: GA ČR(CZ) GA305/08/1704 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : hyaluronan * keratinocyte * ultraviolet light Subject RIV: BO - Biophysics Impact factor: 2.279, year: 2011

Development and Evaluation of New Algorithms for the Retrieval of Wind and Internal Wave Parameters from Shipborne Marine Radar Data

Science.gov (United States)

2012-12-01

marine radar to survey ocean waves close to the spanish coast. In Proc. of the WMO/IOC Workshop on Operational Ocean Monitoring using Surface Based...Linear feature detection and enhancement in noisy images via the Radon transform. Pattern Recognit. Lett., 4(4):279–284, 1986. [79] A. Norris . The

Physiologic Waveform Analysis for Early Detection of Hemorrhage during Transport and Higher Echelon Medical Care of Combat Casualties

Science.gov (United States)

2011-11-01

National Center for Health Workforce Analysis. Projected supply, demand and short- ages of registered nurses : 2000–2020, 2002. 41Urzua, J., et al... paediatric crural and brachial blood pressure index. J 278 Hum Hypertens 21: 415-417, 2007. 279 7. Fung P, Dumont G, Ries C, Mott C, Ansermino M

Functional Analysis of the Beclin-1 Tumor Suppressor Interaction with hVps34 (Type-III P13’-kinase) in Breast Cancer Cells

Science.gov (United States)

2008-06-01

Methods for monitoring autophagy. Int.J Biochem.Cell Biol., 36: 2491-2502, 2004. 13. Scarlatti , F., Bauvy, C., Ventruti, A., Sala, G., Cluzeaud, F...J.Biol.Chem., 279: 18384-18391, 2004. 14. Scarlatti , F., Maffei, R., Beau, I., Codogno, P., and Ghidoni, R. Role of non-canonical Beclin 1- independent

Interrelationships among Nutrition Knowledge, Attitudes, Behaviors and Body Satisfaction

Science.gov (United States)

Dissen, Anthony R.; Policastro, Peggy; Quick, Virginia; Byrd-Bredbenner, Carol

2011-01-01

Purpose: Little is known about interrelationships among nutrition knowledge, attitude, dietary intake, and body satisfaction, which are important variables that play a role in nutrition education interventions. This paper aims to focus on these interrelationships. Design/methodology/approach: Students (n = 279; 20.12 plus or minus 1.75SD years)…

Genotoxic effect induced by hydrogen peroxide in human hepatoma ...

African Journals Online (AJOL)

2010-01-13

Jan 13, 2010 ... Sustainability and Medical Toxicology Centre, Newcastle University, Newcastle Upon Tyne, UK ... model system to study the effects of oxidative stress. ... crucial tissues, a fine balance between the activity of these ... in any medium, provided the original work is properly cited. 1 ..... Life 2000; 50: 279Á89. 6.

The Missing Piece: A Sociological Autopsy of Firearm Suicide in the United States

Science.gov (United States)

Slater, Greta Yoder

2011-01-01

Social, economic, violence, political, and gun access predictors of suicide and gun suicide were examined via sociological autopsy. The model predicting suicide rates overall had the best results, X[superscript 2](9, N = 50) = 5.279 (CMIN, the goodness of fit statistic that represents the minimum discrepancy between the unrestricted sample…

The sub-arborescent lycopsid Omphalophloios feistmantelii (O. Feistmantel) comb. nov emend. from the Middle Pennsylvanian of the Czech Republic

Czech Academy of Sciences Publication Activity Database

Bek, Jiří; Opluštil, S.; Drábková, J.; Pšenička, J.

2015-01-01

Roč. 90, č. 1 (2015), s. 227-279 ISSN 1214-1119 R&D Projects: GA ČR GAP210/12/2053 Institutional support: RVO:67985831 Keywords : lycopsids * in situ spores * Omphalophloios * Sporangiostrobus * cuticle analysis * densospores * Superbisporites * palaeoecology * Pennsylvanian Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.700, year: 2015

Over-expression of the transcription factor HlMYB3 in transgenic hop (Humulus lupulus L. cv. Tettnanger) modulates the expression of genes involved in the biosynthesis of flavonoids and phloroglucinols

Czech Academy of Sciences Publication Activity Database

Gatica-Arias, A.; Stanke, M.; Häntzschel, K.R.; Matoušek, Jaroslav; Weber, G.

2013-01-01

Roč. 113, č. 2 (2013), s. 279-289 ISSN 0167-6857 R&D Projects: GA ČR GA521/08/0740 Institutional support: RVO:60077344 Keywords : Hop * R2R3 MYB transcription factors * Genetic transformation * Flavonoid biosynthesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.612, year: 2013

Sexual regeneration on a tropical inselberg in French Guiana: an inselberg specialist versus a species with a wider ecological amplitude

Czech Academy of Sciences Publication Activity Database

Vlasáková, Blanka

2013-01-01

Roč. 214, č. 2 (2013), s. 279-290 ISSN 1385-0237 R&D Projects: GA ČR GPP505/12/P039 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Clusia * inselberg * life strategy Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013

Effects of canonical Wnt signaling on dorso-ventral specification of the mouse telencephalon

Czech Academy of Sciences Publication Activity Database

Backman, M.; Machoň, Ondřej; Mygland, L.; van den Bout, C. J.; Zhong, W.M.; Taketo, M.M.; Krauss, S.

2005-01-01

Roč. 279, č. 1 (2005), s. 155-168 ISSN 0012-1606 R&D Projects: GA ČR(CZ) GA204/04/1358 Institutional research plan: CEZ:AV0Z50520514 Keywords : beta-catenin * telencephalon * progenitor cell identity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.234, year: 2005

Newton\\'s equation of motion in the gravitational field of an oblate ...

African Journals Online (AJOL)

In this paper, we derived Newton's equation of motion for a satellite in the gravitational scalar field of a uniformly rotating, oblate spheriodal Earth using spheriodal coordinates. The resulting equation is solved for the corresponding precession and the result compared with similar ones. JONAMP Vol. 11 2007: pp. 279-286 ...

Rb–Sr and Sm–Nd isotope systematics and geochemical studies on ...

Indian Academy of Sciences (India)

assimilation of Mesoarchean continental crust (>3.3 Ga) as evident from their initial .... suggested that a mylonitized zone on the eastern margin of the Chidradurga greenstone belt formed ..... due to fractional crystallization or accumulation of ...... Petrol. 107 279–292. Balakrishnan S, Rajamani V and Hanson G 1999 U–Pb.

Stress And Strain Analysis of The Hip Joint Using FEM

Czech Academy of Sciences Publication Activity Database

Vaverka, M.; Návrat, Tomáš; Vrbka, M.; Florian, Z.; Fuis, Vladimír

2006-01-01

Roč. 14, 4-5 (2006), s. 271-279 ISSN 0928-7329 R&D Projects: GA ČR GA101/05/0136 Institutional research plan: CEZ:AV0Z20760514 Keywords : hip FEM surgace replacement pathological contact pressure stress * hip FEM surgace replacement pathological contact pressure stress Subject RIV: BO - Biophysics

Measurement of integral cross-sections of incoherent interactions of photons with K-shell electrons

Energy Technology Data Exchange (ETDEWEB)

Verma, S L; Allawadhi, K L; Sood, B S [Punjabi Univ., Patiala (India). Dept. of Physics. Nuclear Science Labs.

1981-06-01

Integral cross-sections of incoherent interactions of 145, 279, 662 and 1250 keV gamma-rays with K-shell electrons of thirty-one different elements with 26 <= Z <= 92 have been measured. The results are interpreted in terms of the photoelectric and Compton interactions and are found to agree with theory.

Inviscid incompressible limit under mild stratification: a rigorous derivation of the Euler-Boussinesq system

Czech Academy of Sciences Publication Activity Database

Feireisl, Eduard; Novotný, A.

2014-01-01

Roč. 70, č. 2 (2014), s. 279-307 ISSN 0095-4616 EU Projects: European Commission(XE) 320078 - MATHEF Keywords : compressible fluids * Navier-Stokes equations * singular limits Subject RIV: BA - General Mathematics Impact factor: 0.591, year: 2014 http://link.springer.com/article/10.1007%2Fs00245-014-9243-7

Validizační studie české verze dotazníku FAQ

Czech Academy of Sciences Publication Activity Database

Bezdíček, O.; Lukavský, Jiří; Preiss, M.

74/107, č. 1 (2011), s. 36-42 ISSN 1210-7859 Institutional research plan: CEZ:AV0Z70250504 Keywords : questionnaire * validity * activities of daily living Subject RIV: AN - Psychology Impact factor: 0.279, year: 2011 http://www.csnn.eu/ceska-slovenska-neurologie-clanek/validizacni-studie-ceske-verze-dotazniku-faq-34140

Isogeometric free vibration of an elastic block

Czech Academy of Sciences Publication Activity Database

Kolman, Radek

2012-01-01

Roč. 19, č. 4 (2012), s. 279-291 ISSN 1802-1484 R&D Projects: GA ČR GPP101/10/P376; GA ČR(CZ) GAP101/12/2315 Institutional support: RVO:61388998 Keywords : isogeometric analysis * finite element method * B-spline and NURBS basis functions Subject RIV: BI - Acoustics

Proceedings – Mathematical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Proceedings – Mathematical Sciences; Volume 124; Issue 2. Issue front cover thumbnail. Volume 124, Issue 2. May 2014, pages 127-279. pp 127-140. A Statistic on -Color Compositions and Related Sequences · Toufik Mansour Mark Shattuck · More Details Abstract Fulltext PDF. A composition of a ...

An Observational Study of a Prefrontal Convective Rainband Using Tamex Single-and Dual-Doppler Data

Science.gov (United States)

1991-01-01

integration from the surface. Other Doppler studies, e.g., Chong and Testud (1983), Lin et al. 37 (1986), etc, also showed similiar results. 4.3 Variational...Atmos. Sci., 39, 258- 279. Chong, M., and J. Testud , 1983: Three-Dimensional Wind Field Analysis from Dual-Doppler Radar Data. Part III: The Boundary

A prospective cohort study on antioxidant and folate intake and male lung cancer risk

NARCIS (Netherlands)

Voorrips, L.E.; Goldbohm, R.A.; Brants, H.A.M.; Poppel, G.A.F.C. van; Sturmans, F.; Hermus, R.J.J.; Brandt, P.A. van den

2000-01-01

Many studies have reported inverse associations between vegetable and fruit consumption and lung cancer risk. The aim of the present study was to elucidate the role of several antioxidants and folate in this relationship. In the Netherlands Cohort Study on Diet and Cancer, 58,279 men of ages 55-69

First results studying the transmutation of 129I, 237Np, 238Pu, and 239Pu in the irradiation of an extended natU/Pb-assembly with 2.52 GeV deuterons

Czech Academy of Sciences Publication Activity Database

Krivopustov, M. I.; Pavljuk, A. V.; Kovalenko, A.D.; Mariin, I.I.; Elishev, A.F.; Adam, Jindřich; Kovalík, Alojz; Batusov, Yu, A.; Kalinnikov, V. G.; Brudanin, V. B.; Čaloun, Pavel; Tsoupko-Sitnikov, V. M.; Solnyshkin, A. A.; Stegailov, V. I.; Gerbish, Sh.; Svoboda, Ondřej; Dubnická, Z.; Kala, M.; Kloc, M.; Krása, Antonín; Kugler, Andrej; Majerle, Mitja; Wagner, Vladimír; Brandt, R.; Westmeier, W.; Robotham, H.; Siemon, K.; Bielewicz, M.; Kilim, S.; Szuta, M.; Strugalska-Gola, E.; Wojeciechowski, A.; Hashemi-Nezhad, R. S.; Manolopoulou, M.; Fragopolou, M.; Stoulos, S.; Zamani-Valasiadou, M.; Jokic, S.; Katovsky, K.; Schastny, O.; Zhuk, I. V.; Potapenko, A.S.; Safronova, A.A.; Lukashevich, Zh.A.; Voronko, V.A.; Sotnikov, V.V.; Sidorenko, V.V.; Ensinger, W.; Severin, H.D.; Batsev, S.; Kostov, L.; Protokhristov, Kh.; Stoyanov, Ch,.; Yordanov, O.; Zhivkov, P.K.; Kumar, A.V.; Sharma, M.; Khilmanovich, A.M.; Marcinkevich, B.A.; Korneev, S.V.; Damdinsuren, Ts.; Togoo, Ts.; Kumawat, H.

2009-01-01

Roč. 279, č. 2 (2009), s. 567-584 ISSN 0236-5731 R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : MCNPX. * GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.631, year: 2009

Th·e Vitalograph- A Study of Its Role hI Pulmonary Function Testing ...

African Journals Online (AJOL)

Standing pulmonary function studies (FVC, FEV, and. MVV) were carried out using the Vitalograph alone on. 279 normal healthy children (140 boys and 139 girls), aged. 6 - 18 years, mean heights 156 cm and 149 cm for boys and girls respectively. The best of 4 readings were analysed, compared and presented as above.

RETARDANTY HOŘENÍ, JEJICH POUŽITÍ A VLIV NA ŽIVOTNÍ PROSTŘEDÍ

Czech Academy of Sciences Publication Activity Database

Petrová, Šárka; Soudek, Petr; Vaněk, Tomáš

2015-01-01

Roč. 109, č. 9 (2015), s. 679-686 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LD13028 Institutional support: RVO:61389030 Keywords : pollution * bioaccumulation Subject RIV: DJ - Water Pollution ; Quality Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_09_679-686.pdf

The pig as an experimental model for clinical craniofacial research

Czech Academy of Sciences Publication Activity Database

Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

2012-01-01

Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

Forensic Impact of the Child Sexual Abuse Medical Examination.

Science.gov (United States)

Myers, John E. B.

1998-01-01

This commentary on an article (EC 619 279) about research issues at the interface of medicine and law concerning medical evaluation for child sexual abuse focuses on empirically testable questions: (1) the medical history--its accuracy, interviewing issues, and elicitation and preservation of verbal evidence of abuse; and, (2) expert testimony.…

78 FR 35290 - Government-Owned Inventions; Availability for Licensing

Science.gov (United States)

2013-06-12

... surface markers: programmed cell death protein 1 (PD-1; CD279), 4-1BB (CD137), T cell Ig- and mucin-domain... lack of suitable methods for screening hundreds, or even thousands, of cells expressing such proteins...) encodes a mammalian secreted protein comprising the same amino acid sequence. Synalleles are variants of a...

The Power of Partnerships: Exploring the Relationship between Campus Career Centers and Political Science Departments

Science.gov (United States)

Despeaux, J. Michael; Knotts, H. Gibbs; Schiff, Jennifer S.

2014-01-01

Given the growing emphasis on career preparation in higher education, career centers play important roles on today's college campuses. The literature has focused on the reasons students use career services, but it has not addressed the vital linkage between career centers and academic departments. Using a survey of 279 political science…

Endogenous cytokinins in Cocos nucifera L. in vitro cultures obtained from plumular explants

Czech Academy of Sciences Publication Activity Database

Sáenz, L.; Azpeitia, A.; Oropeza, C.; Jones, L.; Fuchsová, Květoslava; Spíchal, Lukáš; Strnad, Miroslav

2010-01-01

Roč. 29, č. 11 (2010), s. 1227-1234 ISSN 0721-7714 R&D Projects: GA ČR GA301/08/1649; GA AV ČR IBS5038351 Institutional research plan: CEZ:AV0Z50380511 Keywords : Coconut palm * Somatic embryogenesis * Endogenous cytokinins Subject RIV: EF - Botanics Impact factor: 2.279, year: 2010

Church attendance and self-esteem among adolescents

OpenAIRE

Robbins, Mandy; Francis, Leslie J.; Williams, Emyr

2007-01-01

A total of 279 young people (123 males and 156 females) aged between 12 and 16 years of age attending one school in Wales completed the Coopersmith Self-Esteem Inventory alongside a measure of frequency of church attendance. The data indicate a small positive correlation (r = .18) between self-esteem and church attendance.

Vegetable and fruit consumption and prostate cancer risk: A cohort study in the Netherlands

NARCIS (Netherlands)

Schuurman, A.G.; Goldbohm, R.A.; Dorant, E.; Brandt, P.A. van den

1998-01-01

The association between 21 vegetables and eight fruits and prostate cancer risk was assessed in the Netherlands Cohort Study among 58,279 men of ages 55-69 years at baseline in 1986. After 6.3 years of follow-up, 610 cases with complete vegetable data and 642 cases with complete fruit data were

Caloplace subalpina and C. thracopontica, two new saxicolous species from the Caloplaca cerina group (Teloschistales)

Czech Academy of Sciences Publication Activity Database

Vondrák, J.; Šoun, J.; Hrouzek, Pavel; Říha, P.; Kubásek, J.; Palice, Zdeněk; Søchting, U.

2008-01-01

Roč. 40, č. 5 (2008), s. 375-386 ISSN 0024-2829 R&D Projects: GA AV ČR(CZ) KJB601410701 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60050516 Keywords : black sea * europe * lichen ized fungi Subject RIV: EE - Microbiology, Virology Impact factor: 1.279, year: 2008

Adaptivní testování - základní pojmy a principy

Czech Academy of Sciences Publication Activity Database

Jelínek, Martin; Květon, Petr; Denglerová, Denisa

2006-01-01

Roč. 50, č. 2 (2006), s. 163-173 ISSN 0009-062X R&D Projects: GA ČR(CZ) GP406/06/P396 Institutional research plan: CEZ:AV0Z70250504 Keywords : diagnostics * computer adaptive testing * item response theory (IRT) Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

882 lakes of the Cordillera Blanca: An inventory, classification, evolution and assessment of susceptibility to outburst floods

Czech Academy of Sciences Publication Activity Database

Emmer, Adam; Klimeš, Jan; Mergili, M.; Vilímek, V.; Cochachin, A.

2016-01-01

Roč. 147, DEC (2016), s. 269-279 ISSN 0341-8162 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67985891 ; RVO:67179843 Keywords : high mountain lakes * GLOFs * environmental change * natural dams * Huascarán NP Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.191, year: 2016

Sperm-related phenotypes implicated in both maintenance and breakdown of a natural species barrier in the house mouse

Czech Academy of Sciences Publication Activity Database

Albrechtová, Jana; Albrecht, Tomáš; Baird, S. J. E.; Macholán, Miloš; Rudolfsen, G.; Munclinger, P.; Tucker, P. K.; Piálek, Jaroslav

2012-01-01

Roč. 279, č. 1748 (2012), s. 4803-4810 ISSN 0962-8452 R&D Projects: GA ČR GA206/08/0640; GA MŠk LC06073 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : sperm * hybrid zone * species barrier * Y introgression * male fitness Subject RIV: EG - Zoology Impact factor: 5.683, year: 2012

Qualitative Research in Career Development: Content Analysis from 1990 to 2009

Science.gov (United States)

Stead, Graham B.; Perry, Justin C.; Munka, Linda M.; Bonnett, Heather R.; Shiban, Abbey P.; Care, Esther

2012-01-01

A content analysis of 11 journals that published career, vocational, and work-related articles from 1990 to 2009 was conducted. Of 3,279 articles analyzed, 55.9% used quantitative methods and 35.5% were theoretical/conceptual articles. Only 6.3% used qualitative research methods. Among the qualitative empirical studies, standards of academic rigor…

A Review on the Effects of Supercritical Carbon Dioxide on Enzyme Activity

Czech Academy of Sciences Publication Activity Database

Wimmer, Zdeněk; Zarevúcka, Marie

2010-01-01

Roč. 11, č. 1 (2010), s. 233-253 E-ISSN 1422-0067 R&D Projects: GA MŠk 2B06024 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : enzyme * supercritical carbon dioxide * synthesis Subject RIV: CC - Organic Chemistry Impact factor: 2.279, year: 2010

Production of Aspergillus niger β-mannosidase in Pichia pastoris

Czech Academy of Sciences Publication Activity Database

Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír

2012-01-01

Roč. 279, č. 1 (2012), s. 247-247 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline

A prospective cohort study on intake of retinol, vitamins C and E and carotenoids and prostate cancer risk (Netherlands)

NARCIS (Netherlands)

Schuurman, A.G.; Goldbohm, R.A.; Brants, H.A.M.; Brandt, P.A. van den

2002-01-01

Objectives: The roles of retinol, vitamins C and E, and carotenoids as risk factors for prostate carcinoma are still questionable. We evaluated these in the Netherlands Cohort Study. Methods: The cohort study consisted of 58,279 men ages 55-69 years at baseline in 1986. After 6.3 years of follow-up,

A Novel ,,Clip-and-link,,Activity of Repeat in Toxin (RTX) Proteins from Gram-negative Pathogens

Czech Academy of Sciences Publication Activity Database

Osička, Radim; Procházková, Kateřina; Šulc, Miroslav; Linhartová, Irena; Havlíček, Vladimír; Šebo, Peter

2004-01-01

Roč. 279, č. 24 (2004), s. 24944-24956 ISSN 0021-9258 R&D Projects: GA ČR GA310/02/1448 Grant - others:GA Howard Hughes Medical Institute International Research Scholarship Award(XX) 55000334 Keywords : frpc * rtx * d510a Subject RIV: EE - Microbiology, Virology Impact factor: 6.355, year: 2004

Strigolaktony - Struktura a funkce v rostlinách

Czech Academy of Sciences Publication Activity Database

Dvořáková, Marcela; Vaněk, Tomáš

2015-01-01

Roč. 109, č. 10 (2015), s. 762-769 ISSN 0009-2770 R&D Projects: GA MŠk LD14127 Institutional support: RVO:61389030 Keywords : strigolactones * fytohormones * arbuscular mycorrhizal fungi Subject RIV: CC - Organic Chemistry Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_10_762-769.pdf

78 FR 279 - Atlantic Highly Migratory Species; 2006 Consolidated Highly Migratory Species Fishery Management...

Science.gov (United States)

2013-01-03

... conjunction with a state stakeholder meeting being held by the Maryland Department of Natural Resources on......... Houston, TX Clear Lake City-County 5 p.m.-8 p.m Freeman Branch Library, 16616 Diana Lane, Houston, Texas...

SU-E-T-279: Realization of Three-Dimensional Conformal Dose Planning in Prostate Brachytherapy

Energy Technology Data Exchange (ETDEWEB)

Li, Z; Jiang, S; Yang, Z [Tianjin University, Tianjin (China); Bai, H; Zhang, X [Seeds biological Pharmacy Ltd, Tianjin (China)

2014-06-01

Purpose: Successful clinical treatment in prostate brachytherapy is largely dependent on the effectiveness of pre-surgery dose planning. Conventional dose planning method could hardly arrive at a satisfy result. In this abstract, a three-dimensional conformal localized dose planning method is put forward to ensure the accuracy and effectiveness of pre-implantation dose planning. Methods: Using Monte Carlo method, the pre-calculated 3-D dose map for single source is obtained. As for multiple seeds dose distribution, the maps are combined linearly to acquire the 3-D distribution. The 3-D dose distribution is exhibited in the form of isodose surface together with reconstructed 3-D organs group real-timely. Then it is possible to observe the dose exposure to target volume and normal tissues intuitively, thus achieving maximum dose irradiation to treatment target and minimum healthy tissues damage. In addition, the exfoliation display of different isodose surfaces can be realized applying multi-values contour extraction algorithm based on voxels. The needles could be displayed in the system by tracking the position of the implanted seeds in real time to conduct block research in optimizing insertion trajectory. Results: This study extends dose planning from two-dimensional to three-dimensional, realizing the three-dimensional conformal irradiation, which could eliminate the limitations of 2-D images and two-dimensional dose planning. A software platform is developed using VC++ and Visualization Toolkit (VTK) to perform dose planning. The 3-D model reconstruction time is within three seconds (on a Intel Core i5 PC). Block research could be conducted to avoid inaccurate insertion into sensitive organs or internal obstructions. Experiments on eight prostate cancer cases prove that this study could make the dose planning results more reasonable. Conclusion: The three-dimensional conformal dose planning method could improve the rationality of dose planning by safely reducing the large target margin and avoiding dose dead zones for prostate cancer treatment. 1) National Natural Science Foundation of People's Republic of China (No. 51175373); 2) New Century Educational Talents Plan of Chinese Education Ministry (NCET-10-0625); 3) Scientific and Technological Major Project, Tianjin (No. 12ZCDZSY10600)

Recurring dominant-negative mutations in the AVP-NPII gene cause neurohypophyseal diabetes insipidus

Energy Technology Data Exchange (ETDEWEB)

Repaske, D.R. [Children`s Hospital Medical Center, Cincinnati, OH (United States); Phillips, J.A.; Krishnamani, M.R.S. [Vanderbilt Univ. School of Medicine, Nashville, TN (United States)] [and others

1994-09-01

Autosomal dominant neurohypophyseal diabetes insipidus (ADNDI) is a familial form of arginine vasopressin (or antidiuretic hormone) deficiency that is usually manifest in early childhood with polyuria, polydipsia and an antidiuretic response to exogenous vasopressin or its analogs. The phenotype is postulated to arise from gliosis and depletion of the magnocellular neurons that produce vasopressin in the supraoptic and paraventricular nuclei of the hypothalamus. ADNDI is caused by heterozygosity for a variety of mutations in the AVP-NPII gene which encodes vasopressin, its carrier protein (NPII) and a glycoprotein (copeptin) of unknown function. These mutations include: (1) Ala 19{r_arrow}Thr (G279A) in AVP`s signal peptide, (2) Gly 17{r_arrow}Val (G1740T), (3) Pro 24{r_arrow}Leu (C1761T), (4) Gly 57{r_arrow}Ser (G1859A) and (5) del Glu 47({delta}AGG 1824-26), all of which occur in NPII. In characterizing the AVP-NPII mutations in five non-related ADNDI kindreds, we have detected two kindreds having mutation 1 (G279A), two having mutation 3 (C1761T) and one having mutation 4 (G1859A) without any other allelic changes being detected. Two of these recurring mutations (G279A and G1859A) are transitions that occur at CpG dinucleotides while the third (C1761T) does not. Interestingly, families with the same mutations differed in their ethnicity or in their affected AVP-NPII allele`s associated haplotype of closely linked DNA polymorphisms. Our data indicated that at least three of five known AVP-NPII mutations causing ADNDI tend to recur but the mechanisms by which these dominant-negative mutations cause variable or progressive expression of the ADNDI phenotype remain unclear.

Age structure and age-related performance of sulfur cinquefoil (Potentilla recta).

Science.gov (United States)

Dana L. Perkins; Catherine G. Parks; Kathleen A. Dwire; Bryan A. Endress; Kelsi L. Johnson

2006-01-01

Age distributions of sulfur cinquefoil populations were determined on sites that were historically grazed, cultivated, and mechanically disturbed. From 12 sites, a total of 279 reproductively active plants were collected and aged by using herbchronology (counting rings in the secondary root xylem of the root crown) to (1) estimate the age structure of the populations...

Dislocation structures, effective and internal stresses of cyclic stained ferritic stainless steel

Czech Academy of Sciences Publication Activity Database

Petrenec, Martin; Polák, Jaroslav

2001-01-01

Roč. 72, č. 279 (2001), s. 129-133 ISSN 1429-6055. [Medzynarodowe Sympozjum - Metody oceny struktury oraz wlasnosci materialów i wyrobów /16./. Komorní Lhotka, 11.12.2001-13.12.2001] Institutional research plan: CEZ:AV0Z2041904 Keywords : dislocation * cyclicling * stresses Subject RIV: JL - Materials Fatigue, Friction Mechanics

17 CFR 275.203-2 - Withdrawal from investment adviser registration.

Science.gov (United States)

2010-04-01

... application). (b) Electronic filing. Once you have filed your Form ADV (17 CFR 279.1) (or any amendments to... file must be filed with the IARD, unless you have received a hardship exemption under § 275.203-3. (c... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203-2...

Prevalence of Dental Fear and Anxiety amongst Patients in Selected Dental Clinics in Ghana

Science.gov (United States)

Ofori, Marian A.; Adu-Ababio, F.; Nyako, E. A.; Ndanu, Tom A.

2009-01-01

Objective: To find out the prevalence of dental anxiety and fear amongst patients in various selected dental clinics in Accra, Ghana. Study design: Dental patients (n = 279) who had either been exposed to dental treatments or had no prior dental exposure, attending four selected dental clinics in Accra were randomly sampled. They were interviewed…

Electron acceleration in a plane laser beam

Czech Academy of Sciences Publication Activity Database

Petržílka, Václav; Krlín, Ladislav; Tataronis, J. A.

2002-01-01

Roč. 52, supplement D (2002), s. 279-282 ISSN 0011-4626. [Symposium on Plasma Physics and Technology/20th./. Prague, 10.06.2002-13.06.2002] Institutional research plan: CEZ:AV0Z2043910 Keywords : electron acceleration, laser beam Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.311, year: 2002

Oxyhalogenidy v pitné vodě

Czech Academy of Sciences Publication Activity Database

Janda, V.; Kastl, G.; Pivokonský, Martin

2015-01-01

Roč. 109, č. 5 (2015), s. 360-363 ISSN 0009-2770 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : oxyhalides * drinking water * disinfectants Subject RIV: BK - Fluid Dynamics Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_05_360-363.pdf

Long-term changes of epiphytic lichen species composition over landscape gradients: an 18 year time series

Czech Academy of Sciences Publication Activity Database

Liška, Jiří; Herben, Tomáš

2008-01-01

Roč. 40, č. 5 (2008), s. 437-448 ISSN 0024-2829 R&D Projects: GA AV ČR(CZ) IA60560; GA AV ČR(CZ) IAA600050712 Institutional research plan: CEZ:AV0Z60050516 Keywords : air pollution * multivariate analysis * permanent recordings Subject RIV: EF - Botanics Impact factor: 1.279, year: 2008

beta-aminobutyric acid protects Brassica napus plants from infection by Leptosphaeria maculans. Resistance induction or a direct antifungal effect?

Czech Academy of Sciences Publication Activity Database

Šašek, Vladimír; Nováková, Miroslava; Dobrev, Petre; Valentová, O.; Burketová, Lenka

2012-01-01

Roč. 133, č. 1 (2012), s. 279-289 ISSN 0929-1873 R&D Projects: GA ČR GA522/08/1581; GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Antimicrobial * BTH * Gene expression Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.610, year: 2012

Degradation kinetics of a potent antifouling agent, butenolide, under various environmental conditions

KAUST Repository

Chen, Lianguo; Xu, Ying; Wang, Wenxiong; Qian, Pei-Yuan

2015-01-01

-lives were recorded for DCOIT: >64. d at 4. °C, 27.9. d at 25. °C and 4.5. d at 40. °C. Exposure to sunlight accelerated the degradation of both butenolide and DCOIT. The photolysis half-lives of butenolide and DCOIT were 5.7. d and 6.8. d, respectively

Rhizosphere competence of wild-type and genetically-engineered Pseudomonas brassicacearum is affected by the crop species

Science.gov (United States)

2,4-diacetylphloroglucinol (2,4-DAPG)-producing Pseudomonas brassicacearum Q8r1-96 is a highly effective biocontrol agent of take-all disease of wheat. Strain Z30-97, a recombinant derivative of Q8r1-96 containing the phzABCDEFG operon from P. synxantha (formerly P. fluorescens) 2-79 inserted into ...

Religiousness and Non-Hopeless Suicide Ideation

Science.gov (United States)

Simonson, Randy H.

2008-01-01

Individuals who think about suicide but do not feel suicidally hopeless tend to be less religious and can therefore entertain thoughts of suicide unabated by religiousness. Religiousness, suicide ideation, and hopelessness were surveyed among 279 Idaho college students, 37 (13%) of whom were non-hopeless suicide ideators. A total of only 21 (7%)…

Algoritmus detekující změny průběhu experimentálních dat

Czech Academy of Sciences Publication Activity Database

Zezulka, Petr

2001-01-01

Roč. 72, č. 279 (2001), s. 97-100 ISSN 1429-6055. [Międzynarodowe Sympozjum - Metody oceny struktury oraz własnosci materiałow i wyroboów /16./. Komorní Lhotka, 11.12.2001-13.12.2001] Institutional research plan: CEZ:AV0Z2041904 Keywords : algorithm Subject RIV: BA - General Mathematics

The ontogenetic shift in thermoregulatory behaviour of newt larvae: testing the "enemy-free temperatures" hypothesis

Czech Academy of Sciences Publication Activity Database

Smolinský, Radovan; Gvoždík, Lumír

2009-01-01

Roč. 279, č. 2 (2009), s. 180-186 ISSN 0952-8369 R&D Projects: GA ČR GA206/06/0953; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Aeshna * fundamental thermal niche * metamorphosis * preferred body temperatures * Triturus Subject RIV: EG - Zoology Impact factor: 1.545, year: 2009

Dolní Věstonice (okr. Břeclav). Lokalita II - cihelna. Gravettien. Kvartérně- geologický výzkum

Czech Academy of Sciences Publication Activity Database

Svoboda, Jiří

2010-01-01

Roč. 51, 1/2 (2010), s. 279-280 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Dolní Věstonice * Gravettian * stratigraphy Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://arub.avcr.cz/miranda2/export/sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV51_paleolit.pdf

76 FR 61746 - Western Digital Technologies, Inc.: Hard Drive Development Engineering Group Irvine (Formerly at...

Science.gov (United States)

2011-10-05

... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...

Optimal foraging and predator-prey dynamics III

Czech Academy of Sciences Publication Activity Database

Křivan, Vlastimil; Eisner, Jan

2003-01-01

Roč. 63, - (2003), s. 269-279 ISSN 0040-5809 R&D Projects: GA ČR GA201/03/0091; GA MŠk LA 101 Institutional research plan: CEZ:AV0Z5007907 Keywords : Optimal foraging theory * adaptive behavior * predator-prec population dynamics Subject RIV: EH - Ecology, Behaviour Impact factor: 2.261, year: 2003

The Air Force Global Reach Laydown (GRL): Using the Estimating Supplies Program to Validate Clinical Requirements

Science.gov (United States)

2006-01-11

FOR PATIENT EVACUATION 279 ARRANGE AND DOCUMENT RETURNS TO DUTY/FLIGHT STATUS 280 PATIENT DISCHARGE INSTRUCTIONS 359 INDUCE LOCAL ANESTHESIA ... CLINDAMYCIN PHOSPHATE INJECTION USP 6ML VIAL 25 VIALS/PACKAGE PG 1 0 0.294 0.012 $33.47 0 0 $0.00 H 6505010235011 CLOTRIMAZOLE CREAM USP 1% 15GM TU 3 0

Ciguatera: the detection of neurotoxins in carnivorous reef fish from ...

African Journals Online (AJOL)

Two barracuda and one snapper tested positive for a sodium-channel activator, i.e. presumptive ciguatoxin, in the N2a assay. LC/MS analyses showed that only these three samples contained high-intensity peaks, with masses of 1 222 amu and 1 279 amu. These results represent the first analytical report indicating the ...

Family Mastery Enhances Work Engagement in Chinese Nurses: A Cross-Lagged Analysis

Science.gov (United States)

Lu, Chang-qin; Siu, Oi-ling; Chen, Wei-qing; Wang, Hai-jiang

2011-01-01

Based on Greenhaus and Powell's (2006) theory of work-family enrichment and the job demands-resources (JD-R) model of work engagement (Bakker & Demerouti, 2008), this study focused on the family-to-work enrichment process by investigating the effect of family mastery on work engagement in a Chinese context. A sample of 279 Chinese female…

Book Review Remarkable Birds of South Africa By Peter le Sueur ...

African Journals Online (AJOL)

Briza Publications, PO Box 56569, Arcadia 0007, South Africa 208 pages, soft cover, 450 colour photographs. ISBN 978-1-875093-58-8. Price R230 OSTRICH 2010, 81(3): 279. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.2989/00306525.2010.

Suz12 is essential for mouse development and for EZH2 histone methyltransferase activity

DEFF Research Database (Denmark)

Pasini, Diego; Bracken, Adrian P; Jensen, Michael R

2004-01-01

SUZ12 is a recently identified Polycomb group (PcG) protein, which together with EZH2 and EED forms different Polycomb repressive complexes (PRC2/3). These complexes contain histone H3 lysine (K) 27/9 and histone H1 K26 methyltransferase activity specified by the EZH2 SET domain. Here we show...

When Introverts Ceased to Be More Religious: A Study among 12- to 16-Year-Old Pupils

Science.gov (United States)

Williams, Emyr; Robbins, Mandy; Francis, Leslie J.

2005-01-01

A sample of 279 12- to 16-year-old pupils completed the Francis Scale of Attitude toward Christianity and the short-form Junior Eysenck Personality Questionnaire Revised. Contrary to the findings of research using earlier junior versions of the Eysenck scales, the data demonstrate that introverts have ceased to be more religious. (Contains 1…

The complete mitochondrial genome of the Korean skate: Hongeo koreana (Rajiformes, Rajidae).

Science.gov (United States)

Jeong, Dageum; Kim, Sung; Kim, Choong-Gon; Lee, Youn-Ho

2014-12-01

The complete mitochondrial genome of the Korean skate, Hongeo koreana, the sole member of its genus, is investigated for the first time. The genome consists of 16,906 bp in length including 2 rRNA, 22 tRNA and 13 protein coding genes with the same gene order and structure of the genome as those of other Rajidae species. The overall nucleotide composition of the L-strand is A = 29.8%, C = 27.9%, T = 27.9% and G = 14.3%, showing a high A + T bias. The anti-G bias (6.0%) is more significant in the third codon position. Twelve of the 13 protein-coding genes use ATG as their start codon while the COX1 gene starts with GTG. For stop codon, ND3 and ND4 genes show incomplete stop codon T. The mitogenome sequence of H. koreana will provide important information on the evolution and the phylogenetic relation of the genus Hongeo in relation to the other genera of the family Rajidae.

Trends in Daily Cannabis Use Among Cigarette Smokers: United States, 2002-2014.

Science.gov (United States)

Goodwin, Renee D; Pacek, Lauren R; Copeland, Jan; Moeller, Scott J; Dierker, Lisa; Weinberger, Andrea; Gbedemah, Misato; Zvolensky, Michael J; Wall, Melanie M; Hasin, Deborah S

2018-01-01

To estimate changes in the prevalence of daily cannabis use among current, former, and never cigarette smokers from 2002 to 2014 in the United States. The National Survey on Drug Use and Health is a nationally representative cross-sectional study conducted annually among persons aged 12 years and older in the United States. Daily cannabis use occurs nearly exclusively among nondaily and daily cigarette smokers compared with former and never smokers (8.03%, 9.01%, 2.79%, 1.05%, respectively). Daily cannabis use increased over the past decade among both nondaily (8.03% [2014] vs 2.85% [2002]; linear trend P smokers (9.01% [2014]; 4.92% [2002]; linear trend P smokers (2.79% [2014] vs 0.98% [2002]; linear trend P smokers in the United States. Daily cannabis use increased among current, former, and never smokers over the past decade, with particularly rapid increases among youth and female cigarette smokers. Future research is needed to monitor the observed increase in daily cannabis use, especially among youths and adults who smoke cigarettes.

The Role of University Students' General Self-Efficacy, Depression and Psychological Well-Being in Predicting Their Exercise Behavior

Science.gov (United States)

Ersöz, Gözde

2017-01-01

The aim of this research is to examine the relationship between exercise and general self-efficacy, depression, and psychological well-being of college students. Five hundred and twenty-two university students (n[subscript male] = 273; X[subscript age] = 23.33 ± 4.36 and n[subscript female] = 279; X[subscript age] = 25.91 ± 7.11) have participated…

Final Environmental Assessment for Proposed Construction of New and Updated Training Facilities at Maxwell Air Force Base

Science.gov (United States)

2008-10-01

release is required by law. However, address information will be used ro compile rhe project mailing lisr and failure ro provide ir will result in...your name nor being included on rhe mailing lisr . 7915 Vaughn Rood · 薥-6443 "~ . AII-Ameritan -.:.,’ Chappy’s I)E;Ii· 1611 Perry Hill Rd. 279

Asymptotic normalization coefficients from proton transfer reactions and astrophysical S factors for the CNO 13C(p,gamma)14N radiative capture prosess

Czech Academy of Sciences Publication Activity Database

Mukhamedzhanov, A. M.; Azhari, A.; Burjan, Václav; Gagliardi, C. A.; Kroha, Václav; Sattarov, A.; Tang, X.; Trache, L.; Tribble, R. E.

2003-01-01

Roč. 725, č. 725 (2003), s. 279-294 ISSN 0375-9474 R&D Projects: GA ČR GA202/01/0709; GA MŠk ME 385 Institutional research plan: CEZ:AV0Z1048901 Keywords : radiative capture reaction * asymptotic normalization coefficient Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.761, year: 2003

Asymptotic normalization coefficients from proton transfer reactions and astrophysical S factors for the (CNOC)-C-13(p, gamma)N-14 radiative capture process

Czech Academy of Sciences Publication Activity Database

Mukhamedzhanov, A. M.; Azhari, A.; Burjan, Václav; Gagliardi, C. A.; Kroha, Václav; Sattarov, A.; Tang, X.; Trache, L.; Tribble, R. E.

2003-01-01

Roč. 725, č. 22 (2003), s. 279-294 ISSN 0375-9474 R&D Projects: GA ČR GA202/01/0709; GA MŠk ME 385 Institutional research plan: CEZ:AV0Z1048901 Keywords : radiative capture reaction * asymptotic normalization coefficient Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.761, year: 2003

Resonance Raman Spectra of the Transient Cl2 and Br2 Radical Anions

DEFF Research Database (Denmark)

Wilbrandt, Robert Walter; Jensen, Niels-Henrik; Sillesen, Alfred Hegaard

1984-01-01

The resonance Raman spectra of the short-lived radical anions ClImage 2− and BrImage − in aqueous solution are reported. The observed wavenumbers of 279 cm−1 for ClImage − and 177 cm−1 for BrImage − are about 10% higher than those published for the corresponding species isolated in solid argon ma...

Hispanics in Fast Food Jobs.

Science.gov (United States)

Charner, Ivan; Fraser, Bryna Shore

A study examined the employment of Hispanics in the fast-food industry. Data were obtained from a national survey of employees at 279 fast-food restaurants from seven companies in which 194 (4.2 percent) of the 4,660 respondents reported being Hispanic. Compared with the total sample, Hispanic fast-food employees were slightly less likely to be…

Are gobiid fish more susceptible to predation if parasitized by Eustrongylides excisus? An answer from robbed snakes

Czech Academy of Sciences Publication Activity Database

Sloboda, M.; Mihalca, A. D.; Falka, I.; Petrželková, Klára Judita; Carlsson, M.; Ghira, I.; Modrý, David

2010-01-01

Roč. 25, č. 2 (2010), s. 469-473 ISSN 0912-3814 R&D Projects: GA ČR GD524/03/H133 Grant - others:CNCSIS(RO) TD196/2005 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Gobiidae * Eustrongylidosis * host-parasite interaction Subject RIV: EG - Zoology Impact factor: 1.279, year: 2010

Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Yankee Rowe nuclear power plant

International Nuclear Information System (INIS)

Latorre, V.R.; Mayn, B.G.

1979-08-01

This report documents the technical evaluation of the electrical, instrumentation, and control design aspects for the low temperature overpressure protection system of the Yankee Rowe nuclear power plant. Design basis criteria used to evaluate the acceptability of the system included operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

Recent Developments in Fluorescence Correlation Spectroscopy for Diffusion Measurements in Planar Lipid Membranes

Czech Academy of Sciences Publication Activity Database

Macháň, Radek; Hof, Martin

2010-01-01

Roč. 11, č. 2 (2010), s. 427-457 E-ISSN 1422-0067 R&D Projects: GA ČR GA203/08/0114; GA AV ČR GEMEM/09/E006 Institutional research plan: CEZ:AV0Z40400503 Keywords : lateral diffusion * fluorescence fluctuation spectroscopy * confocal microscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.279, year: 2010

3D reconstruction of TMJ after resection of the cyst and the stress–strain analyses

Czech Academy of Sciences Publication Activity Database

Mahdian, N.; Dostálová, T.; Daněk, Josef; Nedoma, Jiří; Kohout, J.; Hubáček, M.; Hliňáková, P.

2013-01-01

Roč. 110, č. 3 (2013), s. 279-289 ISSN 0169-2607 Grant - others:GA MŠk(CZ) ED1.1.00/02.0090; GA MZd(CZ) NT13351 Institutional support: RVO:67985807 Keywords : maxillofacial surgery * temporomandibular joint * mathematical modeling * contact problem * linear elasticity * finite element method Subject RIV: BA - General Mathematics Impact factor: 1.093, year: 2013

Nutritive potentials and utilization of garden snail (Limicolaria aurora ...

African Journals Online (AJOL)

AJB SERVER

2006-10-16

Oct 16, 2006 ... The possibility of using garden snail (Limicolaria aurora) meat meal as a protein source in fish feeds was tested in ... garden snail meat meal was used to replace fish meal at 0%, (control diet), 25, 50, 75 and 100% inclusion ..... Randall DJ, Brett JR (eds) Fish Physiology, Academic Press, NY 8: 279-352,.

Soluble isoforms of CEACAM1 containing the A2 domain increase serum levels in patients with obstructive jaundice and differences in 3-fucosyl-N-acetyl-lactosamine moiety

Czech Academy of Sciences Publication Activity Database

Dráberová, Lubica; Černá, Helena; Brodská, H.; Watt, S. M.; Stanners, C. P.; Dráber, Petr

2000-01-01

Roč. 101, č. 2 (2000), s. 279-287 ISSN 0019-2805 R&D Projects: GA MZd PL600; GA MZd IZ3755; GA MZd NM18; GA ČR GA310/00/0205; GA ČR GA204/00/0204; GA AV ČR KSK2038602 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.292, year: 2000

The Stochastic Galerkin Method for Darcy Flow Problem with Log-Normal Random

Czech Academy of Sciences Publication Activity Database

Beres, Michal; Domesová, Simona

2017-01-01

Roč. 15, č. 2 (2017), s. 267-279 ISSN 1336-1376 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : Darcy flow * Gaussian random field * Karhunen-Loeve decomposition * polynomial chaos * Stochastic Galerkin method Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics http://advances.utc.sk/index.php/AEEE/article/view/2280

Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Maine Yankee nuclear power plant

International Nuclear Information System (INIS)

Latorre, V.R.; Mayn, B.G.

1979-08-01

This report documents the technical evaluation of the electrical, instrumentation, and control design aspects for the low temperature overpressure protection system of the Maine Yankee nuclear power plant. Design basis criteria used to evaluate the acceptability of the system included operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

7 CFR 1205.10 - Act.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1205.10 Section 1205.10 Agriculture Regulations... for Conduct of Sign-up Period Definitions § 1205.10 Act. The term Act means the Cotton Research and Promotion Act, as amended [7 U.S.C 2101-2118; Public Law 89-502, 80 Stat 279, as amended]. ...

Sadhana | Indian Academy of Sciences

Indian Academy of Sciences (India)

Volume 36 Issue 1 February 2011 pp 35-51. Numerical modelling of failure of cement concrete using a unit cell approach · M D Ghouse C ... Volume 37 Issue 2 April 2012 pp 261-279. Simulation of depth of penetration during ballistic impact on thick targets using a one-dimensional discrete element model · Rajesh P Nair C ...

Seward Park High School Project CABES, 1985-1986. OEA Evaluation Report.

Science.gov (United States)

New York City Board of Education, Brooklyn. Office of Educational Assessment.

In 1985-86, the Career Advancement through Bilingual Education Skills (CABES) project was in the final year of a three-year funding cycle at Seward Park High School in Manhattan, New York. The project's major goal was to provide career advancement skills to a population group of 279 students of limited English proficiency (LEP). Included in the…

Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Salem nuclear power plant, Unit 1

International Nuclear Information System (INIS)

Laudenbach, D.H.

1979-03-01

The technical evaluation is presented for the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Salem nuclear power plant, Unit 1. Design basis criteria used to evaluate the acceptability of the system include operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

Predicting Binge Drinking in College Students: Rational Beliefs, Stress, or Loneliness?

Science.gov (United States)

Chen, Yixin; Feeley, Thomas Hugh

2015-01-01

We proposed a conceptual model to predict binge-drinking behavior among college students, based on the theory of planned behavior and the stress-coping hypothesis. A two-wave online survey was conducted with predictors and drinking behavior measured separately over 2 weeks' time. In the Wave 1 survey, 279 students at a public university in the…

Functional SNPs in the human ficolin (FCN) genes reveal distinct geographical patterns

DEFF Research Database (Denmark)

Hummelshøj, Tina; Munthe-Fog, Lea; Madsen, Hans O

2008-01-01

-Xaa-Yaa repeats and a Trp279STOP introduces a stop codon, thereby destroying the fibrinogen-like domain of Ficolin-1. In contrast to FCN1 and FCN2, the number of SNPs in FCN3 was very low. In conclusion, large ethnic differences in the FCN genes that will affect the concentration, structure, and function...

On topological derivatives for contact problems in elasticity

Czech Academy of Sciences Publication Activity Database

Giusti, S.M.; Sokolowski, S.; Stebel, Jan

2015-01-01

Roč. 165, č. 1 (2015), s. 279-294 ISSN 0022-3239 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : topological derivative * static frictionless contact problem * asymptotic analysis Subject RIV: BA - General Mathematics Impact factor: 1.160, year: 2015 http://link.springer.com/article/10.1007%2Fs10957-014-0594-7

The Influence of Cultural Background on Parental Perceptions of Adolescent Gambling Behaviour: A Canadian Study

Science.gov (United States)

Campbell, Colin A.; Derevensky, Jeffrey L.; Meerkamper, Eric; Cutajar, Jo

2012-01-01

Considerable research has begun to address youth gambling issues from a bio-psycho-social perspective. The current Canadian national study adds to this body of knowledge by examining the cultural influences impacting parent's attitudes, behaviors and perceptions of youth gambling. A total of 3,279 parents with a child between the ages of 13 and 18…

Early Detection of At-Risk Undergraduate Students through Academic Performance Predictors

Science.gov (United States)

Rowtho, Vikash

2017-01-01

Undergraduate student dropout is gradually becoming a global problem and the 39 Small Islands Developing States (SIDS) are no exception to this trend. The purpose of this research was to develop a method that can be used for early detection of students who are at-risk of performing poorly in their undergraduate studies. A sample of 279 students…

Rapid analysis of caffeine in “smart drugs” and “energy drinks” by microemulsion electrokinetic chromatography (MEEKC)

Czech Academy of Sciences Publication Activity Database

Liotta, E.; Gottardo, R.; Seri, C.; Rimondo, C.; Mikšík, Ivan; Serpelloni, G.; Tagliaro, F.

2012-01-01

Roč. 220, 1-3 (2012), s. 279-283 ISSN 0379-0738 R&D Projects: GA ČR(CZ) GA203/08/1428 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : caffeine * energy drink * smart drug * microemulsion electrokinetic chromatography Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.307, year: 2012

S Rai

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. S Rai. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 273-279 Glasses. Structural, optical and non-linear investigation of Eu: Al(NO 3 ) 3 –SiO2 sol–gel glass · S Hazarika S Rai · More Details Abstract Fulltext PDF. Optical absorption and ...

S Hazarika

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. S Hazarika. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 273-279 Glasses. Structural, optical and non-linear investigation of Eu: Al(NO 3 ) 3 –SiO2 sol–gel glass · S Hazarika S Rai · More Details Abstract Fulltext PDF. Optical absorption and ...

Negative relationships between cellular immune response, Mhc class II heterozygosity and secondary sexual trait in the montane water vole

Czech Academy of Sciences Publication Activity Database

Charbonnel, N.; Bryja, Josef; Galan, M.; Deter, J.; Tollenaere, C.; Chaval, Y.; Morand, S.; Cosson, J.-F.

2010-01-01

Roč. 3, č. 3 (2010), s. 279-290 ISSN 1752-4571 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : abundance cycles * Dqa and Drb * immunocompetence handicap * Mhc class II genes * parasite-mediated balancing selection * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.145, year: 2010

Antibody Repertoire Development in Swine

Czech Academy of Sciences Publication Activity Database

Butler, J. E.; Wertz, N.; Šinkora, Marek

2017-01-01

Roč. 5, FEB 17 (2017), s. 255-279 ISSN 2165-8102 R&D Projects: GA ČR GA15-02274S; GA ČR(CZ) GA16-09296S Institutional support: RVO:61388971 Keywords : swine * pre-immune antibody repertoire * ileal Peyer's patches Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.708, year: 2016

Assessment of vehicle trip production rates in Ilorin (Nigeria) | Jimoh ...

African Journals Online (AJOL)

Occupation, age, gender, income lev-el, vehicle ownership, trip length and fare structure affected the total trip generation, with an average production rate of 3.5, in the range of 2.79 - 4.29. The lower rate was characteristic of school children (5 - 15 years), while the highest rate was attributed to affluent and elderly persons ...

The Relationship between Medical Students' Cognitive Method of Thinking, Their Sex Their Academic Level and the Degree of Their Creative Thinking

Science.gov (United States)

Qutami, Nayfeh

2005-01-01

The sample of the study consisted of all the students in the Faculty of Medicine. The study was conducted using 290 students. The performance of 279 students of the total were analyzed. 141 were males and 135 were females. The results showed an influence in the interaction of different variables such as sex, academic level, and the cognitive…

Sharks caught in the protective gill nets off KwaZulu-Natal, South ...

African Journals Online (AJOL)

Between 1978 and 1998, a total of 3 385 scalloped hammerhead sharks Sphyrna lewini was caught in the protective nets off KwaZulu-Natal. The mean annual catch was 166 sharks (range 60–279). There was a significant decrease in catch rate with time, but the relationship with the population size in KwaZulu-Natal waters ...

Scientometric analysis of the Ethiopian Journal of Agricultural ...

African Journals Online (AJOL)

A Scientometric analysis of the Ethiopian Journal of Agricultural Sciences from volume 1 to 24 covering 279 papers is reported. The journal was covering all areas of agriculture with most papers having single, two or three authors and; in a rare cases up to nine and twelve authors. The number of papers in agronomy, field ...

Steady flow of non-Newtonian fluids - monotonicity methods in generalized orlicz spaces

Czech Academy of Sciences Publication Activity Database

Wróblewska, Aneta

2010-01-01

Roč. 72, č. 11 (2010), s. 4136-4147 ISSN 0362-546X Institutional research plan: CEZ:AV0Z10190503 Keywords : non-Newtonian fluid * Orlicz spaces * modular convergence of symmetric gradients * generalized Minty method * smart fluids Subject RIV: BA - General Mathematics Impact factor: 1.279, year: 2010 http://www.sciencedirect.com/science/article/pii/S0362546X10000568

What's the Best Course? Evidence from Alumni on the Value of Business Presentations Preparation

Science.gov (United States)

Marcel, Mary

2015-01-01

Developing effective presentation skills is a core competence skill for business communicators. Self-report data from a survey of 1,610 2- to 12-year business alumni show that 37.1% present monthly and 27.9% present weekly in their current positions. Alumni who completed a general public speaking course, or both managerial communication and a…

Naval Research Logistics Quarterly. Volume 29, Number 4, December 1982,

Science.gov (United States)

1982-12-01

1982, pp. 247-256. HURTER, A.P., JR. and E.R. Venta , "Production-Location Problems," Vol. 29, No. 2, June 1982, pp. 279-290. JARVIS, J. and R.G...4 Hyper-Exponential and the Erland Failure Distribution," Vol. 29, No. 4, December 1982, pp. VENTA , E.R. and A.P. Hurter, Jr., "Production-Location

The Single-Item Math Anxiety Scale: An Alternative Way of Measuring Mathematical Anxiety

Science.gov (United States)

Núñez-Peña, M. Isabel; Guilera, Georgina; Suárez-Pellicioni, Macarena

2014-01-01

This study examined whether the Single-Item Math Anxiety Scale (SIMA), based on the item suggested by Ashcraft, provided valid and reliable scores of mathematical anxiety. A large sample of university students (n = 279) was administered the SIMA and the 25-item Shortened Math Anxiety Rating Scale (sMARS) to evaluate the relation between the scores…

Beta-Sitosterol: Supercritical Carbon Dioxide Extraction from Sea Buckthorn (Hippophae rhamnoides L.) Seeds

Czech Academy of Sciences Publication Activity Database

Sajfrtová, Marie; Ličková, I.; Wimmerová, Martina; Sovová, Helena; Wimmer, Zdeněk

2010-01-01

Roč. 11, č. 4 (2010), s. 1842-1850 E-ISSN 1422-0067 R&D Projects: GA MŠk 2B06024 Institutional research plan: CEZ:AV0Z40720504; CEZ:AV0Z50380511 Keywords : sea buckthorn seed * supercritical carbon dioxide * beta-sitosterol Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.279, year: 2010

Investigation of applicability of extrapolation method for sample field determination in single-yoke measuring setup

Czech Academy of Sciences Publication Activity Database

Stupakov, Oleksandr

2006-01-01

Roč. 307, - (2006), s. 279-287 ISSN 0304-8853 R&D Projects: GA AV ČR(CZ) 1QS100100508 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnetic measurement * open magnetic sample * surface field determination * single-yoke setup * magnetic non-destructive testing Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.212, year: 2006

Neurální komponenty motivačních a rozhodovacích procesů v lidském mozku

Czech Academy of Sciences Publication Activity Database

Zelinková, J.; Urbánek, Tomáš; Mareček, R.; Brázdil, M.

74/107, č. 4 (2011), s. 419-427 ISSN 1210-7859 Institutional research plan: CEZ:AV0Z70250504 Keywords : motivation * decision-making processes * functional magnetic resonance imaging Subject RIV: AN - Psychology Impact factor: 0.279, year: 2011 http://www.csnn.eu/ceska-slovenska-neurologie-clanek/ neural ni-komponenty-motivacnich-a-rozhodovacich-procesu-v-lidskem-mozku-35788

High School Students' Approaches to Learning Physics with Relationship to Epistemic Views on Physics and Conceptions of Learning Physics

Science.gov (United States)

Chiou, Guo-Li; Lee, Min-Hsien; Tsai, Chin-Chung

2013-01-01

Background and purpose: Knowing how students learn physics is a central goal of physics education. The major purpose of this study is to examine the strength of the predictive power of students' epistemic views and conceptions of learning in terms of their approaches to learning in physics. Sample, design and method: A total of 279 Taiwanese high…

Alternative Fuels Data Center: Vermont Transportation Data for Alternative

Science.gov (United States)

alternative fuels Fuel Public Private Biodiesel (B20 and above) 3 0 Compressed Natural Gas (CNG) 1 2 Electric Recycled Cooking Oil Powers Biodiesel Vehicles in Vermont Recycled Cooking Oil Powers Biodiesel Vehicles in sold per GGE Biodiesel (B20) $2.79/gallon $2.54/GGE $2.84/gallon $2.58/GGE Biodiesel (B99-B100) $2.47

AJOL

African Journals Online (AJOL)

fat and 27.9'~ 29.5% bone (Table 1) .. The higher' : the influence of androge.n hormones, which are proportiondf muscle than other tissues in goats" required tq complete the full patterns of:muscle carcasses .found in the present study is in agree-· .. ' growth both in amount and distribution.' More- ment with the findings by ...

Adsorpce peptidů produkovaných fytoplanktonem na aktivním uhlí

Czech Academy of Sciences Publication Activity Database

Čermáková, Lenka; Pivokonská, Lenka; Kopecká, Ivana; Pivokonský, Martin; Janda, V.

2015-01-01

Roč. 109, č. 3 (2015), s. 176-179 ISSN 0009-2770 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : activated carbon * adsorption * algal organic matter * peptides Subject RIV: DJ - Water Pollution ; Quality Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_03_176-179.pdf

Guillain-Barré syndrome in children: clinic, laboratorial and epidemiologic study of 61 patients Síndrome de Guillain-Barré em crianças: estudo clínico, laboratorial e epidemiologico em 61 pacientes

Directory of Open Access Journals (Sweden)

Vanessa van der Linden

2010-02-01

Full Text Available The aim of the study was to analyze the epidemiologic, clinical, laboratory and development profile of Guillain-Barré syndrome series studied at the Child Institute, between 1989 and 2000. From the 61 patients that fulfilled the selection criteria, aged between 7 months and 13 years old, no sexual or seasonal variation was observed. Clinical events prior to neurological symptoms (with an average time gap of 20.7 days were observed in 62.3%, 55% had cranial nerve disturbances, 27.9% dysautonomic symptoms, and 27.9% respiratory dysfunction. Installation time varied from 2-40 days, plateau from 0-28 days and recuperation from 30-480 days; 94% of patients had a complete clinical recuperation. Electrophysiology in 20 patients disclosed an abnormal demyelination pattern in 15, an exclusively motor axonal pattern in 4 and a mixed pattern in 1 patient. The results obtained did not differ from those in the literature but it was observed that boys and older children had a longer recuperation time. It was not possible to correlate electroneurography with clinical abnormalities and evolution due to the reduced number of patients.O objetivo do estudo foi analisar retrospectivamente, quanto ao perfil clínico, laboratorial, epidemiológico e evolutivo a casuística da síndrome de Guillain-Barré no Instituto da Criança, entre 1989 e 2000. Preencheram os critérios de seleção 61 pacientes, com idades entre 7 meses e 13 anos, e não se observou variação entre sexos nem sazonal. Em 62,3% houve uma afecção precedendo o quadro neurológico, num tempo médio de 20,7 dias; 55% apresentaram acometimento de nervos cranianos, 27,9% distúrbios disautonômicos e 27,9% comprometimento respiratório. A fase de progressão variou de 2 a 40 dias, a de platô de 0 a 28 dias e a de recuperação de 30 a 480 dias e 94% tiveram recuperação total. A eletroneurografia, em 20 pacientes, mostrou padrão desmielinizante em 15, padrão axonal puramente motor em 4 e padr

Study of association between genetic polymorphisms of phospholipase A2 enzymes and Alzheimer's disease Associação entre polimorfismos das enzimas fosfolipases A2 e doença de Alzheimer

Directory of Open Access Journals (Sweden)

Quirino Cordeiro

2010-04-01

Full Text Available Several genes have been related to late-onset Alzheimer's disease (LOAD. Phospholipases A2 (PLA2 influence the processing and secretion of the amyloid precursor protein, which gives rise to the beta-amyloid peptide, the major component of the amyloid plaque in AD. Hence, in the present study, polymorphisms of three genes encoding PLA2 enzymes group (cytosolic PLA2: BanI cPLA2 polymorphism; calcium-independent PLA2: AvrII iPLA2 polymorphism; PAFAH: Val279Phe PAFAH polymorphism were analysed in a case-control sample using 58 patients with LOAD and 107 matched healthy controls. There was a genotypic association between the BanI cPLA2 polymorphism and LOAD (χ2=6.25, 2df, p=0.04, however there was no allelic association. There were no associations between AvrII iPLA2 and Val279Phe PAFAH polymorphisms and LOAD. These data suggest that the BanI cPLA2 polymorphism may play a role in the susceptibility for LOAD in our Brazilian sample.Vários genes têm sido investigados como fatores de risco para o desenvolvimento da doença de Alzheimer (DA de início tardio. As fosfolipases A2 (PLA2 influenciam o processamento e secreção da proteína precursora do amilóide, que dá origem ao peptídeo meta-amilóide, o principal componente da placa amilóide na DA. Assim, no presente estudo, foram analisados três polimorfismos genéticos que codificam enzimas do grupo das PLA2 (PLA2 citosólica: polimorfismo BanI cPLA2; PLA2 cálcio-independente: polimorfismo AvrII iPLA2; PAFAH: polimorfismo Val279Phe PAFAH em 58 pacientes com DA de início tardio e 107 controles saudáveis pareados. Houve associação genotípica entre o polimorfismo BanI cPLA2 e DA de início tardio (χ2=6,25, 2df, p=0,04; no entanto não foi observada associação alélica. Não houve associação entre os polimorfismos AvrII iPLA2 e Val279Phe PAFAH com a doença. Tais dados sugerem que o polimorfismo BanI cPLA2 pode estar envolvido como fator de susceptibilidade para DA de início tardio em

The higher phylogeny of Leptophlebiidae (Insecta: Ephemeroptera), with description of a new species of Calliarcys Eaton, 1881

Czech Academy of Sciences Publication Activity Database

Godunko, Roman J.; Sroka, Pavel; Soldán, Tomáš; Bojková, J.

2015-01-01

Roč. 73, č. 2 (2015), s. 259-280 ISSN 1863-7221 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : Calliarcyinae * systematics * phylogeny Subject RIV: EG - Zoology Impact factor: 1.655, year: 2015 http://www.senckenberg.de/files/content/forschung/publikationen/arthropodsystematics/asp_73_2/03_asp_73_2_godunko_259-279.pdf

Hyalomma aegyptium as dominant tick in tortoises of the genus Testudo in Balkan countries, with notes on its host preferences

Czech Academy of Sciences Publication Activity Database

Široký, P.; Petrželková, Klára Judita; Kamler, M.; Mihalca, A. D.; Modrý, David

2006-01-01

Roč. 40, 3-4 (2006), s. 279-290 ISSN 0168-8162 R&D Projects: GA ČR GD524/03/H133; GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Testudo ssp. * Balkan * Hyalomma aegyptium host preferences Subject RIV: EG - Zoology Impact factor: 0.716, year: 2006

Direct plasma potential measurements by ball-pen probe and self-emitting langmuir probe on COMPASS and ASDEX upgrade

Czech Academy of Sciences Publication Activity Database

Adámek, Jiří; Horáček, Jan; Seidl, Jakub; Müller, H.W.; Schrittwieser, R.; Mehlmann, F.; Vondráček, Petr; Pták, Svatopluk

2014-01-01

Roč. 54, č. 3 (2014), s. 279-284 ISSN 0863-1042 R&D Projects: GA ČR(CZ) GAP205/12/2327 Institutional support: RVO:61389021 ; RVO:61388998 Keywords : Tokamak * ball- pen probe * emissive probe * L-mode * plasma potential Subject RIV: BL - Plasma and Gas Discharge Physics; BL - Plasma and Gas Discharge Physics (UT-L) Impact factor: 0.838, year: 2014

Attitude toward Christianity and paranormal belief among 13- to 16-yr.-old students.

Science.gov (United States)

Williams, Emyr; Francis, Leslie J; Robbins, Mandy

2006-08-01

A small but statistically significant positive correlation (r = .17) was found in a sample of 279 13- to 16-yr.-old students in Wales between scores on the Francis Scale of Attitude toward Christianity and on a new Index of Paranormal Belief. These data suggest that there is little common variance between attitude toward Christianity and belief in the paranormal.

Ultrafine manganese dioxide nanowire network for high-performance supercapacitors.

Science.gov (United States)

Jiang, Hao; Zhao, Ting; Ma, Jan; Yan, Chaoyi; Li, Chunzhong

2011-01-28

Ultrafine MnO(2) nanowires with sub-10 nm diameters have been synthesized by a simple process of hydrothermal treatment with subsequent calcinations to form networks that exhibit an enhanced specific capacitance (279 F g(-1) at 1 A g(-1)), high rate capability (54.5% retention at 20 A g(-1)) and good cycling stability (1.7% loss after 1000 cycles).

Fast Food Jobs. National Study of Fast Food Employment.

Science.gov (United States)

Charner, Ivan; Fraser, Bryna Shore

A study examined employment in the fast-food industry. The national survey collected data from employees at 279 fast-food restaurants from seven companies. Female employees outnumbered males by two to one. The ages of those fast-food employees in the survey sample ranged from 14 to 71, with fully 70 percent being in the 16- to 20-year-old age…

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Earth System Science. V V S S Sarma. Articles written in Journal of Earth System Science. Volume 109 Issue 2 June 2000 pp 279-283. Controls of dimethyl sulphide in the Bay of Bengal during BOBMEX-Pilot cruise 1998 · D M Shenoy M Dileep Kumar V V S S Sarma · More Details Abstract ...

Steady flow of non-Newtonian fluids - monotonicity methods in generalized orlicz spaces

Czech Academy of Sciences Publication Activity Database

Wróblewska, Aneta

2010-01-01

Roč. 72, č. 11 (2010), s. 4136-4147 ISSN 0362-546X Institutional research plan: CEZ:AV0Z10190503 Keywords : non-Newtonian fluid * Orlicz spaces * modular convergence of symmetric gradients * general ized Minty method * smart fluids Subject RIV: BA - General Mathematics Impact factor: 1.279, year: 2010 http://www.sciencedirect.com/science/article/pii/S0362546X10000568

Stability result for Navier-Stokes equations with entropy transport

Czech Academy of Sciences Publication Activity Database

Michálek, Martin

2015-01-01

Roč. 17, č. 2 (2015), s. 279-285 ISSN 1422-6928 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes system * entropy transport * effective viscous flux Subject RIV: BA - General Mathematics Impact factor: 1.023, year: 2015 http://link.springer.com/article/10.1007%2Fs00021-015-0205-x

Smooth dependence on data of solutions and contact regions for a Signorini problem

Czech Academy of Sciences Publication Activity Database

Eisner, Jan; Kučera, Milan; Recke, L.

2010-01-01

Roč. 72, 3-4 (2010), s. 1358-1378 ISSN 0362-546X R&D Projects: GA AV ČR IAA100190506 Institutional research plan: CEZ:AV0Z10190503 Keywords : smooth dependence on date * Signorini problem * variational inequality Subject RIV: BA - General Mathematics Impact factor: 1.279, year: 2010 http://www.sciencedirect.com/science/article/pii/S0362546X09009808

Bringing Benefits and Warding off Blights in Due Commandment (Analytic Study Compared with the Jordanian Law)

Science.gov (United States)

Al Etoum, Niebal Mohd Ibrahim; Mowafi, Hanan Sami Mohammad; Al Zubaidi, Faraj Hamad Salem

2016-01-01

The study aims to highlight the benefits and blights of the due commandment (intestate law) under Jordanian law for the year (2010) in the article (279). The study came in two sections, the first one dealt with the concept of due commandment, its legitimacy, verdict and terms; in the second section, I've dealt with the persons entitled to due…

Misky s omfalem v živote barbarských společností doby římské

Czech Academy of Sciences Publication Activity Database

Knápek, Radka; Šedo, Ondrej

2016-01-01

Roč. 110, prosinec (2016), s. 221-279 ISSN 1336-6637 Institutional support: RVO:68081758 Keywords : Sun cults * Bronze age * Roman period * Germanic ceramics * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://www.snm.sk/swift_data/source/archeologicke_muzeum/zborniky/z_26/23.%20Knapek%20-%20Sedo.pdf?59351c81a4d18

Baťov 1940 – první český empiricky podložený výzkum v oblasti sociologie práce

Czech Academy of Sciences Publication Activity Database

Nešpor, Zdeněk

2015-01-01

Roč. 51, č. 2 (2015), s. 279-297 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA14-15008S Institutional support: RVO:68378025 Keywords : sociology of work * work qualification * sociological research Subject RIV: AO - Sociology, Demography Impact factor: 0.262, year: 2015 http://sreview.soc.cas.cz/cs/issue/176-sociologicky-casopis-czech-sociological-review-2-2015/3514

Overlap functions

Czech Academy of Sciences Publication Activity Database

Bustince, H.; Fernández, J.; Mesiar, Radko; Montero, J.; Orduna, R.

2010-01-01

Roč. 72, 3-4 (2010), s. 1488-1499 ISSN 0362-546X R&D Projects: GA ČR GA402/08/0618 Institutional research plan: CEZ:AV0Z10750506 Keywords : t-norm * Migrative property * Homogeneity property * Overlap function Subject RIV: BA - General Mathematics Impact factor: 1.279, year: 2010 http://library.utia.cas.cz/separaty/2009/E/mesiar-overlap functions.pdf

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

It has been inferred that the Kharsali earthquake occurred due to a northerly dipping low angle thrust fault at a depth of 14 km taking strike N279°E, dip 14° and rake 117°. There are two regions on the fault surface which have larger slip amplitudes (asperities)and the rupture which has been considered as circular in nature ...

Voltage enhancement in dye-sensitized solar cell using (001)-oriented anatase TiO2 nanosheets

Czech Academy of Sciences Publication Activity Database

Lásková, Barbora; Zukalová, Markéta; Kavan, Ladislav; Chou, A.; Liska, P.; Wei, Z.; Bin, L.; Kubát, Pavel; Ghadiri, E.; Moser, J. E.; Grätzel, M.

2012-01-01

Roč. 16, č. 9 (2012), s. 2993-3001 ISSN 1432-8488 R&D Projects: GA AV ČR IAA400400804; GA AV ČR KAN200100801; GA ČR(CZ) GAP108/12/0814 Institutional research plan: CEZ:AV0Z40400503 Keywords : titanium dioxide * anatase * dye-sensitized solar cell Subject RIV: CG - Electrochemistry Impact factor: 2.279, year: 2012

Symptom Recognition to Diagnosis of Autism in Nepal

Science.gov (United States)

Shrestha, Merina; Shrestha, Rena

2014-01-01

Awareness and knowledge about autism is almost non-existent in Nepal. Children who eventually get the diagnosis often miss their opportunity for early intervention. The current study shows that medical help was seeked at mean age of 27.9 + 14.5 months and most of them were for delayed language and the first preference for parents were…

An Analysis of Music Fan towards Music Streaming Purchase Intention of Thailand's Music Industry

Science.gov (United States)

Sanitnarathorn, Pannawit

2018-01-01

Digital music streaming are climbing but overall music revenue is declining with digital music piracy being blamed as the culprit. In a 10 year period from 2003 to 2013, global music sales dropped from $US23.3 to $US15 billion dollars with Thailand's music industry following the trend dropping from $US 304 million in 2010 to $US 279 million in…

VLIV NANOČÁSTIC NA ROSTLINY

Czech Academy of Sciences Publication Activity Database

Cyrusová, Tereza; Podlipná, Radka; Vaněk, Tomáš

2015-01-01

Roč. 109, č. 4 (2015), s. 276-280 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LH11047; GA MŠk(CZ) LD14100 Institutional support: RVO:61389030 Keywords : nanoparticles * nanomaterials * phytotoxicity Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_04_276-280.pdf

105K West Isolation Barrier Acceptance Test results

International Nuclear Information System (INIS)

McCracken, K.J.; Irwin, J.J.

1995-01-01

The objective of this document is to report and interpret the findings of the isolation barrier acceptance tests performed in 105KW/100K. The tests were performed in accordance with the test plan and acceptance test procedure. The test report contains the test data. This document compares the test data against the criteria. A discussion of the leak rate analytical characterization describes how the flow characteristics flow rate will be determined using the test data from the test report. Two modes of water loss were considered; basin and/or discharge chute leakage, and evaporation. An initial test established baseline leakage data and instrumentation performance. Test 2 evaluated the sealing performance of the isolation barrier by inducing an 11 in. (27.9 cm) level differential across the barrier. The leak rate at this 11 in. (27.9 cm) level is extrapolated to the 16 ft. (4.9 m) level differential postulated in the DBE post seismic event. If the leak rate, adjusted for evaporation and basin leakage (determined from Test 1), is less than the SAR limit of 1,500 gph (5,680 lph) at a 16 ft (4.9 m) level differential, the barriers pass the acceptance test

Oral heparin delivery: design and in vivo evaluation of a stomach-targeted mucoadhesive delivery system.

Science.gov (United States)

Schmitz, Thierry; Leitner, Verena M; Bernkop-Schnürch, Andreas

2005-05-01

Low molecular weight heparin (LMWH) is an agent of choice in the anti-coagulant therapy and prophylaxis of thrombosis and coronary syndromes. However, the therapeutic use is partially limited due to a poor oral bioavailability. It was therefore the aim of this study to design and evaluate a highly efficient stomach-targeted oral delivery system for LMWH. In order to appraise the influence of the molecular weight on the oral bioavailability, mini-tablets comprising 3 kDa (279 IU) and 6 kDa (300 IU) LMWH, respectively, were generated and tested in vivo in rats. The potential of the test formulations based on thiolated polycarbophil, was evaluated in comparison to hydroxyethylcellulose (HEC) as control carrier matrix. The plasma levels of LMWH after oral versus subcutaneous administration were determined in order to calculate the relative bioavailability. With the delivery system containing 3 kDa LMWH (279 IU) a relative bioavailability of 19.1% was achieved, offering a significantly (p thiolated polymers are a promising tool for the non-invasive stomach-targeted systemic delivery of LMWH as model for a hydrophilic macromolecular polysaccharide. Copyright 2005 Wiley-Liss, Inc

Structural Determinants for the Binding of Morphinan Agonists to the μ-Opioid Receptor.

Directory of Open Access Journals (Sweden)

Xiaojing Cong

Full Text Available Atomistic descriptions of the μ-opioid receptor (μOR noncovalently binding with two of its prototypical morphinan agonists, morphine (MOP and hydromorphone (HMP, are investigated using molecular dynamics (MD simulations. Subtle differences between the binding modes and hydration properties of MOP and HMP emerge from the calculations. Alchemical free energy perturbation calculations show qualitative agreement with in vitro experiments performed in this work: indeed, the binding free energy difference between MOP and HMP computed by forward and backward alchemical transformation is 1.2±1.1 and 0.8±0.8 kcal/mol, respectively, to be compared with 0.4±0.3 kcal/mol from experiment. Comparison with an MD simulation of μOR covalently bound with the antagonist β-funaltrexamine hints to agonist-induced conformational changes associated with an early event of the receptor's activation: a shift of the transmembrane helix 6 relative to the transmembrane helix 3 and a consequent loss of the key R165-T279 interhelical hydrogen bond. This finding is consistent with a previous proposal suggesting that the R165-T279 hydrogen bond between these two helices indicates an inactive receptor conformation.

Role models and occupational ambitions of in-school male adolescents

Directory of Open Access Journals (Sweden)

Suhail Ahmad Azmi

2014-01-01

Full Text Available Background: A role model is perceived as worthy of imitation, their selection can indicate significant elements of psychosocial health and self-projection in adolescents. Patterns of behavior and lifestyle choices established during adolescence can have immediate and lasting effects on health. Materials and Methods: Cross-sectional study was undertaken in the schools of Aligarh, Uttar Pradesh, India. The sample frame was 2347, out of which a sample of 390 students was studied. Data collected were entered and analyzed by SPSS for Windows version 10%. Results: Majority (62.7% of adolescents revealed that their role models were Film Star (34.8% and their Teachers (27.9%, Parents (14.3%, Sportsman (12.0%. Politicians as the role models were opted by least proportion (1.2%. Desire of future occupation was Businessmen (27.9%, Doctor (18.6, and Engineer (14.4%. Conclusion: Nearly all adolescents had a role model. There is greater impact of cinema on the minds of adolescents, which resulted in choosing film actors as their role model. Aspiration of future occupation was not related to the characteristics of the role model.

The prognostic and predictive value of sstr_2-immunohistochemistry and sstr_2-targeted imaging in neuroendocrine tumors

International Nuclear Information System (INIS)

Brunner, Philippe; Joerg, Ann-Catherine; Mueller-Brand, Jan; Glatz, Katharina; Bubendorf, Lukas; Radojewski, Piotr; Umlauft, Maria; Spanjol, Petar-Marko; Krause, Thomas; Dumont, Rebecca A.; Walter, Martin A.; Marincek, Nicolas; Maecke, Helmut R.; Briel, Matthias; Schmitt, Anja; Perren, Aurel

2017-01-01

Our aim was to assess the prognostic and predictive value of somatostatin receptor 2 (sstr_2) in neuroendocrine tumors (NETs). We established a tissue microarray and imaging database from NET patients that received sstr_2-targeted radiopeptide therapy with yttrium-90-DOTATOC, lutetium-177-DOTATOC or alternative treatment. We used univariate and multivariate analyses to identify prognostic and predictive markers for overall survival, including sstr_2-imaging and sstr_2-immunohistochemistry. We included a total of 279 patients. In these patients, sstr_2-immunohistochemistry was an independent prognostic marker for overall survival (HR: 0.82, 95 % CI: 0.67 - 0.99, n = 279, p = 0.037). In DOTATOC patients, sstr_2-expression on immunohistochemistry correlated with tumor uptake on sstr_2-imaging (n = 170, p < 0.001); however, sstr_2-imaging showed a higher prognostic accuracy (positive predictive value: +27 %, 95 % CI: 3 - 56 %, p = 0.025). Sstr_2-expression did not predict a benefit of DOTATOC over alternative treatment (p = 0.93). Our results suggest sstr_2 as an independent prognostic marker in NETs. Sstr_2-immunohistochemistry correlates with sstr_2-imaging; however, sstr_2-imaging is more accurate for determining the individual prognosis. (orig.)

Výpočty fázových diagramů multikomponentních soustav Fe-Cr-V-Mo-C-Mn-Ni-Si(-W) a jejich využití

Czech Academy of Sciences Publication Activity Database

Unucka, P.; Kroupa, Aleš; Foret, R.; Svoboda, Milan

2002-01-01

Roč. 72, č. 279 (2002), s. 145-148 ISSN 1429-6055. [mezinárodní sympozium Struktura a vlastnosti konstrukčních materiálů /16./. Komorní Lhotka, 11.12.2001-13.12.2001] R&D Projects: GA ČR GA106/00/0855 Institutional research plan: CEZ:AV0Z2041904 Keywords : thermodynamic calculations * phase diagrams * steels Subject RIV: BJ - Thermodynamics

Hodnocení strukturní stability nízkolegovaných žáropevných ocelí

Czech Academy of Sciences Publication Activity Database

Foret, R.; Stránský, K.; Krumpos, J.; Kroupa, Aleš

2001-01-01

Roč. 72, č. 279 (2001), s. 101-106 ISSN 1429-6055. [mezinárodní sympozium Struktura a vlastnosti konstrukčních materiálů /16./. Komorní Lhotka, 11.12.2001-13.12.2001] R&D Projects: GA ČR GA106/00/0855 Institutional research plan: CEZ:AV0Z2041904 Keywords : heat-resistant steels * structural stability Subject RIV: BJ - Thermodynamics