WorldWideScience

Sample records for meitnerium 279

  1. 33 CFR 279.3 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 279.3 Section 279.3 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE RESOURCE USE: ESTABLISHMENT OF OBJECTIVES § 279.3 References. (a) Pub. L. 89-72, “Federal Water Project...

  2. 40 CFR 279.74 - Tracking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Tracking. 279.74 Section 279.74 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Fuel Marketers § 279.74 Tracking. (a) Off...

  3. 40 CFR 279.56 - Tracking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Tracking. 279.56 Section 279.56 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Processors and Re-Refiners § 279.56 Tracking. (a...

  4. 40 CFR 279.65 - Tracking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Tracking. 279.65 Section 279.65 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR... Energy Recovery § 279.65 Tracking. (a) Acceptance. Used oil burners must keep a record of each used oil...

  5. 40 CFR 279.40 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability. 279.40 Section 279.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Transporter and Transfer Facilities § 279.40...

  6. 32 CFR 279.6 - Reporting.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Reporting. 279.6 Section 279.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS RETROACTIVE STOP LOSS SPECIAL PAY COMPENSATION § 279.6 Reporting. The Department of Defense shall provide a...

  7. 26 CFR 1.279-6 - Application of section 279 to certain affiliated groups.

    Science.gov (United States)

    2010-04-01

    ... the date described in section 279(c)(1): (1) The amount of intercompany accounts payable, (2) The... corporation under section 279(c)(3), there shall be taken into account only the earnings and profits of such...

  8. 40 CFR 279.46 - Tracking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Tracking. 279.46 Section 279.46 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR... Tracking. (a) Acceptance. Used oil transporters must keep a record of each used oil shipment accepted for...

  9. 33 CFR 279.9 - Objective rationale.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Objective rationale. 279.9... DEFENSE RESOURCE USE: ESTABLISHMENT OF OBJECTIVES § 279.9 Objective rationale. (a) Statement of objectives... objective(s) and providing the rationale, impact, and basic management measures for their accomplishment...

  10. 40 CFR 279.12 - Prohibitions.

    Science.gov (United States)

    2010-07-01

    ... THE MANAGEMENT OF USED OIL Applicability § 279.12 Prohibitions. (a) Surface impoundment prohibition... located on the site of a facility engaged in a manufacturing process where substances are transformed into.... (3) Hazardous waste incinerators subject to regulation under subpart O of parts 264 or 265 of this...

  11. 49 CFR 27.9 - Assurance required.

    Science.gov (United States)

    2010-10-01

    ... OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 27.9 Assurance required. (a) General... requirements of this part for so long as the property is used for the purpose for which the Federal financial assistance was provided or for a similar purpose. (2) When Federal financial assistance is used by a...

  12. 7 CFR 279.1 - Jurisdiction and authority.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Jurisdiction and authority. 279.1 Section 279.1... FOOD WHOLESALERS Administrative Review § 279.1 Jurisdiction and authority. A food retailer or wholesale... specified in § 278.6(e)(1) of this chapter. (a) Jurisdiction. Reviewers designated by the Secretary shall...

  13. 30 CFR 27.9 - Date for conducting tests.

    Science.gov (United States)

    2010-07-01

    ... APPROVAL OF MINING PRODUCTS METHANE-MONITORING SYSTEMS General Provisions § 27.9 Date for conducting tests. The date of receipt of an application will determine the order of precedence for investigation and... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Date for conducting tests. 27.9 Section 27.9...

  14. 17 CFR 279.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 279.0-1 Section 279.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE INVESTMENT ADVISERS ACT OF 1940 § 279.0-1 Availability of forms. (a) This part...

  15. 40 CFR 279.67 - Management of residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Management of residues. 279.67 Section... for Energy Recovery § 279.67 Management of residues. Burners who generate residues from the storage or burning of used oil must manage the residues as specified in § 279.10(e). ...

  16. 47 CFR 25.279 - Inter-satellite service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Inter-satellite service. 25.279 Section 25.279 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.279 Inter-satellite service. (a) Any satellite communicating with other space...

  17. 7 CFR 27.9 - Marketing Services Offices; Grading Section.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Marketing Services Offices; Grading Section. 27.9 Section 27.9 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE....9 Marketing Services Offices; Grading Section. Marketing Services Offices shall be maintained at...

  18. 40 CFR 279.47 - Management of residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Management of residues. 279.47 Section... Management of residues. Transporters who generate residues from the storage or transport of used oil must manage the residues as specified in § 279.10(e). ...

  19. 40 CFR 279.59 - Management of residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Management of residues. 279.59 Section... Management of residues. Owners and operators who generate residues from the storage, processing, or re-refining of used oil must manage the residues as specified in § 279.10(e). ...

  20. Multiwavelength Variability Analysis of 3C 279

    Directory of Open Access Journals (Sweden)

    Víctor M. Patiño-Álvarez

    2017-11-01

    Full Text Available We present a multifrequency analysis of the variability in the flat-spectrum radio quasar 3C 279 from 2008 to 2014. Our multiwavelength datasets range from 1 mm to gamma-rays, with additional optical polarimetry. Cross-correlation analysis shows a significant correlation between the UV continuum emission, the optical and NIR bands, at a delay consistent with zero, implying co-spatial emission regions. We also find a correlation between the UV continuum and the 1 mm data, which implies that the dominant process in producing the UV continuum is synchrotron emission. Based on the behavior of the gamma-ray light curve with respect to other bands, we identified three different activity periods. During period A we find a significant correlation at zero delay between the UV continuum and the gamma-rays, implying co-spatial emission regions which points toward synchrotron self-Compton as dominant gamma-ray emission mechanism. During period C we find a delay between the UV continuum and the gamma-rays, as well as a correlation at zero delay between X-rays and gamma-rays, both results implying that external inverse Compton is the dominant gamma-ray emission mechanism. During period B there are multiple flares in the bands from 1 mm to UV, however, none of these show a counterpart in the gamma-rays band. We propose that this is caused by an increase in the gamma-ray opacity due to electron-positron pair production.

  1. 26 CFR 1.279-1 - General rule; purpose.

    Science.gov (United States)

    2010-04-01

    ... limitations on the deductibility of interest paid or incurred on obligations which have certain equity... 279 as to whether a particular instrument labeled a bond, debenture, note, or other evidence of...

  2. The recent NIR Flare of the Blazar 3C279

    Science.gov (United States)

    Carrasco, L.; Recillas, E.; Porras, A.; Escobedo, G.; Chavushyan, V.

    2018-02-01

    In our monitoring campaign of AGNs we found the Blazar 3C279 flaring in the NIR on January 27th,2018. this source is cross identified with the quasar HB891253-055 and the Gamma-ray source 3FGLJ1256.1-054.

  3. 40 CFR 279.61 - Restrictions on burning.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) STANDARDS FOR THE MANAGEMENT OF USED OIL Standards for Used Oil Burners Who Burn Off... substances are transformed into new products, including the component parts of products, by mechanical or... provisions of § 279.23; or (3) Hazardous waste incinerators subject to regulation under subpart O of parts...

  4. 26 CFR 1.279-3 - Corporate acquisition indebtedness.

    Science.gov (United States)

    2010-04-01

    ... of an obligation of Z Corporation, a wholly owned subsidiary of X Corporation, this section will... acquired corporation, owned by members of the affiliated group, shall be aggregated in determining whether...) Corporate acquisition indebtedness. For purposes of section 279, the term corporate acquisition indebtedness...

  5. 7 CFR 279.5 - Determination of the designated reviewer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Determination of the designated reviewer. 279.5... reviewer. (a) Basis for designated reviewer determination. The designated reviewer shall make a... the designated reviewer from any other person having relevant information. (b) Review of denial or...

  6. 27 CFR 24.279 - Tax adjustments related to wine credit.

    Science.gov (United States)

    2010-04-01

    ... wine credit. 24.279 Section 24.279 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Removal, Return and Receipt of Wine Taxpaid Removals § 24.279 Tax adjustments related to wine credit. (a) Increasing adjustments. Persons who produce...

  7. 26 CFR 1.279-2 - Amount of disallowance of interest on corporate acquisition indebtedness.

    Science.gov (United States)

    2010-04-01

    ... acquisition indebtedness. 1.279-2 Section 1.279-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE... disallowance of interest on corporate acquisition indebtedness. (a) In general. Under section 279(a), no... to its corporate acquisition indebtedness to the extent that such interest exceeds: (1) $5 million...

  8. 40 CFR 279.32 - Used oil aggregation points owned by the generator.

    Science.gov (United States)

    2010-07-01

    ... the generator. 279.32 Section 279.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Collection Centers and Aggregation Points § 279.32 Used oil aggregation points owned by the generator. (a... aggregation points must comply with the generator standards in subpart C of this part. ...

  9. On-going optical activity of 3C 279

    Science.gov (United States)

    Reinhart, David; Ledermann, Jens; Scherbantin, Adrian; Kopp, Michael; Hienz, Sebastian; Schilling, Christoph; Feige, Martin; Lorey, Christian; Mannheim, Karl; Elsaesser, Dominik

    2018-02-01

    Regular photometric monitoring of the flat-spectrum radio quasar 3C 279 (FK5 coordinates: RA 12 56 11.167, DEC -05 47 21.52 (J2000); Redshift 0.5632 (Marziani et al. 1996, ApJS, 104, 37)) is done as part of the long-term AGN monitoring program of the Naturwissenschaftliches Labor fuer Schueler am Friedrich-Koenig-Gymnasium (FKG) and the Universitaet Wuerzburg with the 0.5m telescope at the Hans-Haffner-Sternwarte in Hettstadt (Germany).

  10. Optical Flaring of the quasar 3C279

    Science.gov (United States)

    Jorstad, S.; Grishina, T.; Troitskaya, Y.; Troitsky, I.; Nikiforova, A.; Larionova, V.

    2018-03-01

    The quasar 3C279 shows a significant increase of optical activity during the last 10 days. According to monitoring at the Perkins telescope, (Flagstaff, AZ), AZT-8 (Crimean Astrophysical Obs.), and LX-200 (St.Petersburg Univ., Russia) telescopes the magnitude in R band has changed from 15 to 13.8 and the degree of polarization (P) has risen from 3% to 30%, while the position angle of polarization (EVPA) rotates: observations on March 11 at the AZT-8 telescope are (R=14.936+- 0.002 P= 6.66+-0.23% EVPA= 99.7+- 1.0deg), on March 17 at the LX telescope are (R=15.117+- 0.011 P= 3.2+-0.72% EVPA= 150.8+- 6.2deg), and at the Perkins telescope on March 21 and 22 - (R=14.413+- 0.008 P= 19.4+-0.23% EVPA= 28.7+- 0.3deg) and (R=13.845+- 0.013 P= 30.2+-0.35% EVPA= 31.4+- 0.3deg), respectively.

  11. 279 Watt Metal-Wrap-Through module using industrial processes

    Energy Technology Data Exchange (ETDEWEB)

    Guillevin, N.; Heurtault, B.; Geerligs, L.J.; Anker, J.; Van Aken, B.B.; Bennett, I.J.; Jansen, M.J.; Berkeveld, L.D.; Weeber, A.W.; Bultman, J.H. [ECN Solar Energy, PO Box 1, 1755 ZG Petten (Netherlands); Wenchao, Zhao; Jianming, Wang; Ziqian, Wang; Yingle, Chen; Yanlong, Shen; Zhiyan, Hu; Gaofei, Li; Jianhui, Chen; Bo, Yu; Shuquan, Tian; Jingfeng, Xiong [Yingli Solar, 3399 Chaoyang North Street, Baoding (China)

    2012-09-15

    This paper describes results of metal wrap through (MWT) cells produced from n-type Czochralski silicon wafers, and modules produced from those cells. The use of n-type silicon as base material allows for high efficiencies: for front emitter contacted industrial cells, efficiencies up to 20% have been reported. MWT cells allow even higher cell efficiency due to reduced front metal coverage, and additionally full back-contacting of the MWT cells in a module results in reduced cell to module (CTM) fill factor losses. MWT cells were produced by industrial process technologies. The efficiency of the MWT cells reproducibly exceeds the efficiency of front contact cells based on the same technology by about 0.2-0.3%, and routes for further improvement are analyzed. 60-cell modules were produced from both types of cells (MWT and H-pattern front emitter). In a direct module performance comparison, the MWT module, based on integrated backfoil, produced 3% higher power output than the comparable tabbed front emitter contact module. CTM current differences arise from the higher packing density, and in this experiment from a lower reflectance of the backfoil, in MWT modules. CTM FF differences are related to resistive losses in copper circuitry on the backfoil versus tabs. The CTM FF loss of the MWT module was reduced by 2.2%abs compared to the tabbed front emitter contact module. Finally, simple process optimizations were tested to improve the n-type MWT cell and module efficiency. A module made using MWT cells of 19.6% average efficiency resulted in a power output of 279W. The cell and module results are analyzed and routes for improvements are discussed.

  12. Diazene JK-279 induces apoptosis-like cell death in human cervical carcinoma cells.

    Science.gov (United States)

    Jakopec, S; Dubravcic, K; Polanc, S; Kosmrlj, J; Osmak, M

    2006-03-01

    Diazene N-phenyl-2-(2-pyridinyl)diazenecarboxamide (JK-279) is a newly synthesized compound, cytotoxic for several tumor cell lines and their drug-resistant sublines. In human cervical carcinoma cells (HeLa), this compound reduced intracellular glutathione content and increased sensitivity to cisplatin. The aim of the present study was to elucidate the molecular mechanisms involved in the cytotoxic effect of diazene JK-279 on HeLa cells. Cytotoxicity was determined by the MTT method. Flow cytometry analysis showed that diazene JK-279 induces G(2)/M phase arrest, mediated by the increase in p21 expression, and accompanied by an alteration in the expression of survivin. The highest concentration of JK-279 altered nuclear morphology in intact cells, showing "apoptosis-like" features. No cleavage of procaspase-3, procaspase-9 and PARP, or altered expression of apoptotic proteins Bcl-2 and Bax were detected. At the same time, PS externalization and internucleosomal DNA cleavage were observed. Partial necrosis was detected as well. Our results demonstrate that cytotoxicity of diazene JK-279 is mostly the consequence of caspase-independent cell death, which is in some aspects "apoptosis-like". Taking into account the multiplicity of mechanisms used by cancer cells to prevent apoptosis, the drugs (like diazene JK-279) that would activate alternative cell death pathways could provide a useful tool for new types of cancer therapy.

  13. Energy and intensity distributions of 279 keV multiply scattered ...

    Indian Academy of Sciences (India)

    Abstract. An inverse response matrix converts the observed pulse-height distribution of a NaI(Tl) scintillation detector to a true photon spectrum. This also results in extrac- tion of intensity and energy distributions of multiply scattered events originating from interactions of 279 keV photons with thick targets of bronze.

  14. 40 CFR 279.41 - Restrictions on transporters who are not also processors or re-refiners.

    Science.gov (United States)

    2010-07-01

    ... not also processors or re-refiners. 279.41 Section 279.41 Protection of Environment ENVIRONMENTAL... processors or re-refiners. (a) Used oil transporters may consolidate or aggregate loads of used oil for... transporters may not process used oil unless they also comply with the requirements for processors/re-refiners...

  15. Interplanetary scintillations of the 3C 279 radiosource from RATAN-600 observations

    International Nuclear Information System (INIS)

    Shishova, T.D.; Mingaliev, M.G.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)

    1980-01-01

    In 1976 and 1977 observations of interplanetary scintillations of the 3C 279 radiosource were carred out at the RATAN-600 at centimeter wavelengths. At Lambda=3.9 cm the index of scintillations gets suturated at the distance R approximately equal to 4 Rsub(Sun) from the Sun. The estimation of solar wind velocity is approximately 140 km/s at R=5Rsub(Sun); it grows up to approximately 400 km/s at R approximately equal to 10 Rsub(Sun)

  16. A missense mutation (Q279R) in the fumarylacetoacetate hydrolase gene, responsible for hereditary tyrosinemia, acts as a splicing mutation.

    Science.gov (United States)

    Dreumont, N; Poudrier, J A; Bergeron, A; Levy, H L; Baklouti, F; Tanguay, R M

    2001-01-01

    Tyrosinemia type I, the most severe disease of the tyrosine catabolic pathway is caused by a deficiency in fumarylacetoacetate hydrolase (FAH). A patient showing few of the symptoms associated with the disease, was found to be a compound heterozygote for a splice mutation, IVS6-1g->t, and a putative missense mutation, Q279R. Analysis of FAH expression in liver sections obtained after resection for hepatocellular carcinoma revealed a mosaic pattern of expression. No FAH was found in tumor regions while a healthy region contained enzyme-expressing nodules. Analysis of DNA from a FAH expressing region showed that the expression of the protein was due to correction of the Q279R mutation. RT-PCR was used to assess if Q279R RNA was produced in the liver cells and in fibroblasts from the patient. Normal mRNA was found in the liver region where the mutation had reverted while splicing intermediates were found in non-expressing regions suggesting that the Q279R mutation acted as a splicing mutation in vivo. Sequence of transcripts showed skipping of exon 8 alone or together with exon 9. Using minigenes in transfection assays, the Q279R mutation was shown to induce skipping of exon 9 when placed in a constitutive splicing environment. These data suggest that the putative missense mutation Q279R in the FAH gene acts as a splicing mutation in vivo. Moreover FAH expression can be partially restored in certain liver cells as a result of a reversion of the Q279R mutation and expansion of the corrected cells.

  17. Earliest stone-tipped projectiles from the Ethiopian rift date to >279,000 years ago.

    Directory of Open Access Journals (Sweden)

    Yonatan Sahle

    Full Text Available Projectile weapons (i.e. those delivered from a distance enhanced prehistoric hunting efficiency by enabling higher impact delivery and hunting of a broader range of animals while reducing confrontations with dangerous prey species. Projectiles therefore provided a significant advantage over thrusting spears. Composite projectile technologies are considered indicative of complex behavior and pivotal to the successful spread of Homo sapiens. Direct evidence for such projectiles is thus far unknown from >80,000 years ago. Data from velocity-dependent microfracture features, diagnostic damage patterns, and artifact shape reported here indicate that pointed stone artifacts from Ethiopia were used as projectile weapons (in the form of hafted javelin tips as early as >279,000 years ago. In combination with the existing archaeological, fossil and genetic evidence, these data isolate eastern Africa as a source of modern cultures and biology.

  18. Meeting the Challenge from Bright and Fast Gamma-Ray Flares of 3C 279

    Science.gov (United States)

    Vittorini, V.; Tavani, M.; Cavaliere, A.

    2017-07-01

    Bright and fast gamma-ray flares with hard spectra have been recently detected from the blazar 3C 279, with apparent GeV luminosities up to 1049 erg s-1. The source is observed to flicker on timescales of minutes with no comparable optical-UV counterparts. Such observations challenge current models of high-energy emissions from 3C 279 and similar blazar sources that are dominated by relativistic jets along our line of sight with bulk Lorentz factors up to Γ ˜ 20 launched by supermassive black holes. We compute and discuss a model based on a clumpy jet comprising strings of compact plasmoids as indicated by radio observations. We follow the path of the synchrotron radiations emitted in the optical-UV bands by relativistic electrons accelerated around the plasmoids to isotropic Lorentz factors γ ˜ {10}3. These primary emissions are partly reflected back by a leading member in the string that acts as a moving mirror for the approaching companions. Around the plasmoids, shrinking gap transient overdensities of seed photons build up. These are upscattered into the GeV range by inverse Compton interactions with the relativistic electrons accelerated in situ. We show that such a combined process produces bright gamma-ray flares with minor optical to X-ray enhancements. Main features of our model include: bright gamma-ray flares with risetimes as short as a few minutes, occurring at distances of order 1018 cm from the central black hole; Compton dominance at GeV energies by factors up to some 102; minimal reabsorption from local photon-photon interactions.

  19. A HARD GAMMA-RAY FLARE FROM 3C 279 IN 2013 DECEMBER

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S.; Stalin, C. S. [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India); Diltz, Chris; Böttcher, Markus [Astrophysical Institute, Department of Physics and Astronomy, Ohio University, Athens, OH 45701 (United States); Buckley, David, E-mail: vaidehi@iiap.res.in [South African Astronomical Observatory, P.O. Box 9, Observatory 7935, Cape Town (South Africa)

    2016-01-20

    The blazar 3C 279 exhibited twin γ-ray flares of similar intensity in 2013 December and 2014 April. In this work, we present a detailed multi-wavelength analysis of the 2013 December flaring event. Multi-frequency observations reveal the uncorrelated variability patterns with X-ray and optical–UV fluxes peaking after the γ-ray maximum. The broadband spectral energy distribution (SED) at the peak of the γ-ray activity shows a rising γ-ray spectrum but a declining optical–UV flux. This observation along with the detection of uncorrelated variability behavior rules out the one-zone leptonic emission scenario. We, therefore, adopt two independent methodologies to explain the SED: a time-dependent lepto-hadronic modeling and a two-zone leptonic radiative modeling approach. In the lepto-hadronic modeling, a distribution of electrons and protons subjected to a randomly orientated magnetic field produces synchrotron radiation. Electron synchrotron is used to explain the IR to UV emission while proton synchrotron emission is used to explain the high-energy γ-ray emission. A combination of both electron synchrotron self-Compton emission and proton synchrotron emission is used to explain the X-ray spectral break seen during the later stage of the flare. In the two-zone modeling, we assume a large emission region emitting primarily in IR to X-rays and γ-rays to come primarily from a fast-moving compact emission region. We conclude by noting that within a span of four months, 3C 279 has shown the dominance of a variety of radiative processes over each other and this reflects the complexity involved in understanding the physical properties of blazar jets in general.

  20. Saccharomyces cerevisiae-based mutational analysis of the bc1 complex Qo site residue 279 to study the trade-off between atovaquone resistance and function.

    Science.gov (United States)

    Song, Zehua; Clain, Jérôme; Iorga, Bogdan I; Yi, Zhou; Fisher, Nicholas; Meunier, Brigitte

    2015-07-01

    The bc1 complex is central to mitochondrial bioenergetics and the target of the antimalarial drug atovaquone that binds in the quinol oxidation (Qo) site of the complex. Structural analysis has shown that the Qo site residue Y279 (Y268 in Plasmodium falciparum) is key for atovaquone binding. Consequently, atovaquone resistance can be acquired by mutation of that residue. In addition to the probability of amino acid substitution, the level of atovaquone resistance and the loss of bc1 complex activity that are associated with the novel amino acid would restrict the nature of resistance-driven mutations occurring on atovaquone exposure in native parasite populations. Using the yeast model, we characterized the effect of all the amino acid replacements resulting from a single nucleotide substitution at codon 279: Y279C, Y279D, Y279F, Y279H, Y279N, and Y279S (Y279C, D, F, H, N, and S). Two residue changes that required a double nucleotide substitution, Y279A and W, were added to the series. We found that mutations Y279A, C, and S conferred high atovaquone resistance but decreased the catalytic activity. Y279F had wild-type enzymatic activity and sensitivity to atovaquone, while the other substitutions caused a dramatic respiratory defect. The results obtained with the yeast model were examined in regard to atomic structure and compared to the reported data on the evolution of acquired atovaquone resistance in P. falciparum. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  1. Milli-arcsecond structure of 3C 84, 3C 273, and 3C 279 at 2 centimeter wavelength

    International Nuclear Information System (INIS)

    Niell, A.E.; Kellermann, K.I.; Clark, B.G.; Shaffer, D.B.

    1975-01-01

    Long baseline interferometer observations of 3C 84, 3C 273, and 3C 279 show structure on a scale of 1 milli-arcsec which is more complex than can be described by any simple one- or two-component models. Furthermore, for 3C 84 and 3C 273 the structure is not collinear

  2. 78 FR 49469 - Stephen Glen Guerra, Inmate #98595-279, FCI Yazoo City Medium, Federal Correctional Institution...

    Science.gov (United States)

    2013-08-14

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security Stephen Glen Guerra, Inmate 98595-279, FCI... Glen Guerra (``Guerra''), was convicted of violating Section 38 of the Arms Export Control Act (22 U.S.C. 2778 (2006 & Supp. IV 2010)) (``AECA''). Specifically, Guerra was convicted of intentionally and...

  3. Recent rapid optical rebrightening down to R=14.0 of the flaring blazar 3C 279

    Science.gov (United States)

    Marchini, Alessandro; Bonnoli, Giacomo; Millucci, Vincenzo; Trefoloni, Bartolomeo; Da Vela, Paolo

    2018-03-01

    We observed last night the z=0.5362 (Marziani et al. 1996, ApJS, 104, 37) flat-spectrum radio quasar 3C 279 (at FK5 coordinates RA 12 56 11.167 Dec -05 47 21.52 J2000.0) with the 0.3 m telescope at the Astronomical Observatory of the University of Siena.

  4. The WEBT Campaign on the Blazar 3C 279 in 2006

    Science.gov (United States)

    Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berduygin, A.; Blaek, M.; Buemi, C.; Castro-Tirado, A. J.; De Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V. A.; Henson, G.; Hovatta, T.; Hudec, R.; Ibrahimov, M.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y. Y.; Kovalev, Yu. A.; Kubánek, P.; Kurosaki, M.; Kurtanidze, O.; Lähteenmäki, A.; Lanteri, L.; Larionov, V. M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H. R.; Mingaliev, M. G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.; Nilsson, K.; Nishiyama, S.; Ohlert, J.; Osterman, M. A.; Pak, S.; Pasanen, M.; Peters, C. S.; Pursimo, T.; Raiteri, C. M.; Robertson, J.; Robertson, T.; Ryle, W. T.; Sadakane, K.; Sadun, A.; Sigua, L.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L. O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J. R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vitek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, H.-S.

    2007-12-01

    The quasar 3C 279 was the target of an extensive multiwavelength monitoring campaign from 2006 January through April. An optical-IR-radio monitoring campaign by the Whole Earth Blazar Telescope (WEBT) collaboration was organized around target-of-opportunity X-ray and soft γ-ray observations with Chandra and INTEGRAL in 2006 mid-January, with additional X-ray coverage by RXTE and Swift XRT. In this paper we focus on the results of the WEBT campaign. The source exhibited substantial variability of optical flux and spectral shape, with a characteristic timescale of a few days. The variability patterns throughout the optical BVRI bands were very closely correlated with each other, while there was no obvious correlation between the optical and radio variability. After the ToO trigger, the optical flux underwent a remarkably clean quasi-exponential decay by about 1 mag, with a decay timescale of τd~12.8 days. In intriguing contrast to other (in particular, BL Lac type) blazars, we find a lag of shorter wavelength behind longer wavelength variability throughout the RVB wavelength ranges, with a time delay increasing with increasing frequency. Spectral hardening during flares appears delayed with respect to a rising optical flux. This, in combination with the very steep IR-optical continuum spectral index of α0~1.5-2.0, may indicate a highly oblique magnetic field configuration near the base of the jet, leading to inefficient particle acceleration and a very steep electron injection spectrum. An alternative explanation through a slow (timescale of several days) acceleration mechanism would require an unusually low magnetic field of B<~0.2 G, about an order of magnitude lower than inferred from previous analyses of simultaneous SEDs of 3C 279 and other flat-spectrum radio quasars with similar properties. For questions regarding the availability of the data from the WEBT campaign presented in this paper, please contact the WEBT President Massimo Villata at villata@oato.inaf.it.

  5. Telomerase variant A279T induces telomere dysfunction and inhibits non-canonical telomerase activity in esophageal carcinomas.

    Directory of Open Access Journals (Sweden)

    Yuwei Zhang

    Full Text Available Although implicated in the pathogenesis of several chronic inflammatory disorders and hematologic malignancies, telomerase mutations have not been thoroughly characterized in human cancers. The present study was performed to examine the frequency and potential clinical relevance of telomerase mutations in esophageal carcinomas.Sequencing techniques were used to evaluate mutational status of telomerase reverse transcriptase (TERT and telomerase RNA component (TERC in neoplastic and adjacent normal mucosa from 143 esophageal cancer (EsC patients. MTS, flow cytometry, time lapse microscopy, and murine xenograft techniques were used to assess proliferation, apoptosis, chemotaxis, and tumorigenicity of EsC cells expressing either wtTERT or TERT variants. Immunoprecipitation, immunoblot, immunofluorescence, promoter-reporter and qRT-PCR techniques were used to evaluate interactions of TERT and several TERT variants with BRG-1 and β-catenin, and to assess expression of cytoskeletal proteins, and cell signaling. Fluorescence in-situ hybridization and spectral karyotyping techniques were used to examine telomere length and chromosomal stability.Sequencing analysis revealed one deletion involving TERC (TERC del 341-360, and two non-synonymous TERT variants [A279T (2 homozygous, 9 heterozygous; A1062T (4 heterozygous]. The minor allele frequency of the A279T variant was five-fold higher in EsC patients compared to healthy blood donors (p<0.01. Relative to wtTERT, A279T decreased telomere length, destabilized TERT-BRG-1-β-catenin complex, markedly depleted β-catenin, and down-regulated canonical Wnt signaling in cancer cells; these phenomena coincided with decreased proliferation, depletion of additional cytoskeletal proteins, impaired chemotaxis, increased chemosensitivity, and significantly decreased tumorigenicity of EsC cells. A279T expression significantly increased chromosomal aberrations in mouse embryonic fibroblasts (MEFs following Zeocin

  6. A Missense Mutation (Q279R) in the Fumarylacetoacetate Hydrolase Gene, Responsible for Hereditary Tyrosinemia, Acts as a Splicing Mutation

    OpenAIRE

    Dreumont, Natacha; Poudrier, Jacques A; Bergeron, Anne; Baklouti, Faouzi; Tanguay, Robert M; Levy, Harvey Louis

    2001-01-01

    Abstract Background Tyrosinemia type I, the most severe disease of the tyrosine catabolic pathway is caused by a deficiency in fumarylacetoacetate hydrolase (FAH). A patient showing few of the symptoms associated with the disease, was found to be a compound heterozygote for a splice mutation, IVS6-1g->t, and a putative missense mutation, Q279R. Analysis of FAH expression in liver sections obtained after resection for hepatocellular carcinoma revealed a mosaic pattern of expression. No FAH was...

  7. Wild-type catalase peroxidase vs G279D mutant type: Molecular basis of Isoniazid drug resistance in Mycobacterium tuberculosis.

    Science.gov (United States)

    Singh, Aishwarya; Singh, Aditi; Grover, Sonam; Pandey, Bharati; Kumari, Anchala; Grover, Abhinav

    2018-01-30

    Mycobacterium tuberculosis katG gene is responsible for production of an enzyme catalase peroxidase that peroxidises and activates the prodrug Isoniazid (INH), a first-line antitubercular agent. INH interacts with catalase peroxidase enzyme within its heme pocket and gets converted to an active form. Mutations occurring in katG gene are often linked to reduced conversion rates for INH. This study is focussed on one such mutation occurring at residue 279, where glycine often mutates to aspartic acid (G279D). In the present study, several structural analyses were performed to study the effect of this mutation on functionality of KatG protein. On comparison, mutant protein exhibited a lower docking score, smaller binding cavity and reduced affinity towards INH. Molecular dynamics analysis revealed the mutant to be more rigid and less compact than the native protein. Essential dynamics analysis determined correlated motions of residues within the protein structure. G279D mutant was found to have many residues that showed related motions and an undesirable effect on the functionality of protein. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. The Gpn3 Q279* cancer-associated mutant inhibits Gpn1 nuclear export and is deficient in RNA polymerase II nuclear targeting.

    Science.gov (United States)

    Barbosa-Camacho, Angel A; Méndez-Hernández, Lucía E; Lara-Chacón, Bárbara; Peña-Gómez, Sonia G; Romero, Violeta; González-González, Rogelio; Guerra-Moreno, José A; Robledo-Rivera, Angélica Y; Sánchez-Olea, Roberto; Calera, Mónica R

    2017-11-01

    Gpn3 is required for RNA polymerase II (RNAPII) nuclear targeting. Here, we investigated the effect of a cancer-associated Q279* nonsense mutation in Gpn3 cellular function. Employing RNAi, we replaced endogenous Gpn3 by wt or Q279* RNAi-resistant Gpn3R in epithelial model cells. RNAPII nuclear accumulation and transcriptional activity were markedly decreased in cells expressing only Gpn3R Q279*. Wild-type Gpn3R localized to the cytoplasm but a fraction of Gpn3R Q279* entered the cell nucleus and inhibited Gpn1-EYFP nuclear export. This property and the transcriptional deficit in Gpn3R Q279*-expressing cells required a PDZ-binding motif generated by the Q279* mutation. We conclude that an acquired PDZ-binding motif in Gpn3 Q279* caused Gpn3 nuclear entry, and inhibited Gpn1 nuclear export and Gpn3-mediated RNAPII nuclear targeting. © 2017 Federation of European Biochemical Societies.

  9. The small molecule inhibitor YK-4-279 disrupts mitotic progression of neuroblastoma cells, overcomes drug resistance and synergizes with inhibitors of mitosis.

    Science.gov (United States)

    Kollareddy, Madhu; Sherrard, Alice; Park, Ji Hyun; Szemes, Marianna; Gallacher, Kelli; Melegh, Zsombor; Oltean, Sebastian; Michaelis, Martin; Cinatl, Jindrich; Kaidi, Abderrahmane; Malik, Karim

    2017-09-10

    Neuroblastoma is a biologically and clinically heterogeneous pediatric malignancy that includes a high-risk subset for which new therapeutic agents are urgently required. As well as MYCN amplification, activating point mutations of ALK and NRAS are associated with high-risk and relapsing neuroblastoma. As both ALK and RAS signal through the MEK/ERK pathway, we sought to evaluate two previously reported inhibitors of ETS-related transcription factors, which are transcriptional mediators of the Ras-MEK/ERK pathway in other cancers. Here we show that YK-4-279 suppressed growth and triggered apoptosis in nine neuroblastoma cell lines, while BRD32048, another ETV1 inhibitor, was ineffective. These results suggest that YK-4-279 acts independently of ETS-related transcription factors. Further analysis reveals that YK-4-279 induces mitotic arrest in prometaphase, resulting in subsequent cell death. Mechanistically, we show that YK-4-279 inhibits the formation of kinetochore microtubules, with treated cells showing a broad range of abnormalities including multipolar, fragmented and unseparated spindles, together leading to disrupted progression through mitosis. Notably, YK-4-279 does not affect microtubule acetylation, unlike the conventional mitotic poisons paclitaxel and vincristine. Consistent with this, we demonstrate that YK-4-279 overcomes vincristine-induced resistance in two neuroblastoma cell-line models. Furthermore, combinations of YK-4-279 with vincristine, paclitaxel or the Aurora kinase A inhibitor MLN8237/Alisertib show strong synergy, particularly at low doses. Thus, YK-4-279 could potentially be used as a single-agent or in combination therapies for the treatment of high-risk and relapsing neuroblastoma, as well as other cancers. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

  10. The microRNA ame-miR-279a regulates sucrose responsiveness of forager honey bees (Apis mellifera).

    Science.gov (United States)

    Liu, Fang; Shi, Tengfei; Yin, Wei; Su, Xin; Qi, Lei; Huang, Zachary Y; Zhang, Shaowu; Yu, Linsheng

    2017-11-01

    Increasing evidence demonstrates that microRNAs (miRNA) play an important role in the regulation of animal behaviours. Honey bees (Apis mellifera) are eusocial insects, with honey bee workers displaying age-dependent behavioural maturation. Many different miRNAs have been implicated in the change of behaviours in honey bees and ame-miR-279a was previously shown to be more highly expressed in nurse bee heads than in those of foragers. However, it was not clear whether this difference in expression was associated with age or task performance. Here we show that ame-miR-279a shows significantly higher expression in the brains of nurse bees relative to forager bees regardless of their ages, and that ame-miR-279a is primarily localized in the Kenyon cells of the mushroom body in both foragers and nurses. Overexpression of ame-miR-279a attenuates the sucrose responsiveness of foragers, while its absence enhances their sucrose responsiveness. Lastly, we determined that ame-miR-279a directly target the mRNA of Mblk-1. These findings suggest that ame-miR-279a plays important roles in regulating honey bee division of labour. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. 3C 279 IN OUTBURST IN 2015 JUNE: A BROADBAND SED STUDY BASED ON THE INTEGRAL DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Bottacini, Eugenio [W.W. Hansen Experimental Physics Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, Stanford University (United States); Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2531 (South Africa); Pian, Elena [INAF, Istituto di Astrofisica Spaziale e Fisica Cosmica, via P. Gobetti 101, I-40129 Bologna (Italy); Collmar, Werner, E-mail: eugenio.bottacini@stanford.edu [Max-Planck-Institut für extraterrestrische Physik, Giessenbach, D-85748 Garching (Germany)

    2016-11-20

    Blazars radiate from radio through gamma-ray frequencies and thereby make ideal targets for multifrequency studies. Such studies allow the properties of the emitting jet to be constrained. 3C 279 is among the most notable blazars and therefore subject to extensive multifrequency campaigns. We report the results of a campaign ranging from near-IR to gamma-ray energies that targeted an outburst of 3C 279 in 2015 June. The campaign pivots around the detection in only 50 ks by INTEGRAL , whose IBIS/ISGRI data pin down the high-energy component of the spectral energy distribution (SED) between Swift -XRT data and Fermi -LAT data. The overall SED from near-IR to gamma rays can be well represented by either a leptonic or a lepto-hadronic radiation transfer model. Even though the data are equally well represented by the two models, their inferred parameters challenge the physical conditions in the jet. In fact, the leptonic model requires parameters with a magnetic field far below equipartition with the relativistic particle energy density. In contrast, equipartition may be achieved with the lepto-hadronic model, although this implies an extreme total jet power close to the Eddington luminosity.

  12. Modified single-port minilaparoscopic extraperitoneal repair for pediatric hydrocele: a single-center experience with 279 surgeries.

    Science.gov (United States)

    Wang, Zhifeng; Xu, Le; Chen, Zhi; Yao, Cong; Su, Zexuan

    2014-12-01

    The purpose of the study is to introduce our experience of a modified single-port minilaparoscopic technique for the treatment of pediatric hydrocele. Between June 2008 and May 2012, 279 boys (115 communicating hydrocele and 164 "non-communicating" hydrocele, diagnosis based on preoperative physical examination and scrotal ultrasound) underwent the modified single-port minilaparoscopic repair in our institution. During surgery, a 3-mm laparoscope was inserted into the abdomen through a mini-umbilical incision. The hydrocele sac orifice was closed by an extraperitoneal purse-string suture placed around the internal ring with an ordinary taper needle and an endoclose needle. Of all the 279 patients, 16 (5.7 %) were found to have a potential patent processus vaginalis (PPV) on the contralateral side. Of the 164 boys diagnosed with "non-communicating" hydrocele preoperatively, 5 (3.0 %) had no PPV identified in laparoscope and the other 159 (97.0 %) had PPV actually. A total of 274 single-port minilaparoscopic procedures were performed, and all cases were successful without serious complications. The mean operative time was 19.5 and 24.8 min for unilateral and bilateral operations, respectively. Postoperative complications were noted in 4 cases, 2 (0.7 %) patients with scrotal edema, 1 (0.4 %) patient experienced an umbilical hernia, and 1 (0.4 %) patient with suture site abscess. During a median follow-up period of 9 months (range 6-24 months), postoperative hydrocele recurrence was seen in 2 patients (0.7 %). This modified single-port minilaparoscopic technique is a safe, effective, and reliable procedure for pediatric hydroceles.

  13. Preliminary Investigation of Myo-Inositol Phosphates Produced by ASUIA279 Phytase on MCF-7 Cancer Cells

    Directory of Open Access Journals (Sweden)

    N. Mohd. Yusoff

    2011-12-01

    Full Text Available Phytate or myo-inositol hexakisphosphates (IP6 is widely distributed in plants like rice brans. The production of myo-inositol phosphate intermediates has received much attention due to the remarkable potential health benefits offered by the compounds. In this study, the cytotoxicity of the partially purified myo-inositol phosphate fractions and commercial IP1 and IP6 were investigated against MCF-7 breast cancer cell lines. The study showed that the commercial standard IP1 and IP6 showed good inhibition towards the MCF-7 cell line. The MCF-7 cells growth was inhibited in minimum concentration of myo-inositol phosphates (<1000 µg/ml. However, no inhibition observed on the MCF-7 cell line by the myo-inositol phosphates fractions partially purified from rice bran at concentration <1000 ?g/ml. The inhibition of MCF-7 was only observed at concentration more than 30 mg/ml with more than 40% cells were inhibited. This indicates that the partially purified rice bran myo-inositol phosphates degraded by ASUIA279 phytase on MCF-7 breast cancer cells exhibit positive results towards the inhibition of cancer cells growth at relatively high concentration..KEYWORDS: myo-inositol phosphates, phytase, MCF-7,  cancerABSTRAK: Fitat atau myo-inositol hexakisphosphate (IP6 dikenali umum teragih di dalam tumbuhan seperti dedak padi. Penghasilan perantaraan fosfat myo-inositol mendapat perhatian memandangkan ia berpotensi tinggi dalam kesihatan. Dalam kajian ini, kesitotoksikan sebahagian daripada fosfat myo-inositol separa tulen, IP1 komersil dan IP6 komersil dikaji terhadap produk yang berupa sel kekal (cell lines kanser payu dara MCF-7. Tumbesaran sel MCF-7 direncatkan dalam pekatan minima fosfat myo-inositol (<1000 μg/ml. Tetapi, tidak ada perencatan dilihat terhadap sel kekal MCF-7 oleh sebahagian fosfat myo-inositol separa tulen daripada dedak padi pada kepekatan <1000 mg/ml. Perencatan MCF-7 hanya dilihat pada kepekatan lebih daripada 30 mg/ml dengan lebih

  14. A Steady-state Spectral Model for Electron Acceleration and Cooling in Blazar Jets: Application to 3C 279

    Science.gov (United States)

    Lewis, Tiffany R.; Finke, Justin D.; Becker, Peter A.

    2018-01-01

    We introduce a new theoretical model to describe the emitting region in a blazar jet. We adopt a one-zone leptonic picture and construct the particle transport equation for a plasma blob experiencing low-energy, monoenergetic particle injection, energy-dependent particle escape, shock acceleration, adiabatic expansion, stochastic acceleration, synchrotron radiation, and external Compton radiation from the dust torus and broad-line region (BLR). We demonstrate that a one-zone leptonic model is able to explain the IR though γ -ray spectrum for 3C 279 in 2008–2009. We determine that the BLR seed photons cannot be adequately described by a single average distribution, but rather we find that a stratified BLR provides an improvement in the estimation of the distance of the emitting region from the black hole. We calculate that the jet is not always in equipartition between the particles and magnetic field and find that stochastic acceleration provides more energy to the particles than does shock acceleration, where the latter is also overshadowed by adiabatic losses. We further introduce a novel technique to implement numerical boundary conditions and determine the global normalization for the electron distribution, based on analysis of stiff ordinary differential equations. Our astrophysical results are compared with those obtained by previous authors.

  15. Periprocedural safety of Pipeline therapy for unruptured cerebral aneurysms: Analysis of 279 Patients in a multihospital database.

    Science.gov (United States)

    McDonald, Robert J; McDonald, Jennifer S; Kallmes, David F; Lanzino, Giuseppe; Cloft, Harry J

    2015-02-01

    The relative safety of unruptured aneurysm treatment with coiling versus flow diversion therapy is unknown. Most data available on flow diversion reflect highly focused patient groups and very experienced operators. We evaluated a national, multihospital patient database to examine periprocedural morbidity and mortality in patients treated with endovascular flow diversion therapy. The Premier Perspective database was used to identify patients hospitalized between May 2011 and March 2013 for unruptured aneurysm who underwent flow diversion therapy with a Pipeline embolization device. The risk of in-hospital mortality and morbidity was determined using ICD 9 codes. A total of 279 unruptured aneurysm patients at 18 medical centers underwent endovascular therapy with a Pipeline device. Adverse outcomes included in-hospital mortality in two cases (0.7%), discharge to long-term care in 22 cases (7.9%), ischemic complications in 14 cases (5.0%), hemorrhagic complications in four cases (1.4%), and postoperative neurological complications in nine cases (3.2%). This study of a large cohort of patient hospitalizations in the United States provides preliminary data on flow diversion in a "real world" scenario and demonstrates that the periprocedural morbidity and mortality is not negligible and must be considered in the context of the natural history of the aneurysms that are being treated. © The Author(s) 2015 Reprints and permissions:]br]sagepub.co.uk/journalsPermissions.nav.

  16. X-ray/UV Observing Campaign on the Mrk 279 AGN Outflow: A Global Fitting Analysis of the UV Absorption

    Energy Technology Data Exchange (ETDEWEB)

    Gabel, J.

    2005-03-17

    We present an analysis of the intrinsic UV absorption in the Seyfert 1 galaxy Mrk 279 based on simultaneous long observations with the ''Hubble Space Telescope'' (41 ks) and the ''Far Ultraviolet Spectroscopic Explorer'' (91 ks). To extract the line-of-sight covering factors and ionic column densities, we separately fit two groups of absorption lines: the Lyman series and the CNO lithium-like doublets. For the CNO doublets we assume that all three ions share the same covering factors. The fitting method applied here overcomes some limitations of the traditional method using individual doublet pairs; it allows for the treatment of more complex, physically realistic scenarios for the absorption-emission geometry and eliminates systematic errors that we show are introduced by spectral noise. We derive velocity-dependent solutions based on two models of geometrical covering--a single covering factor for all background emission sources, and separate covering factors for the continuum and emission lines. Although both models give good statistical fits to the observed absorption, we favor the model with two covering factors because: (a) the best-fit covering factors for both emission sources are similar for the independent Lyman series and CNO doublet fits; (b) the fits are consistent with full coverage of the continuum source and partial coverage of the emission lines by the absorbers, as expected from the relative sizes of the nuclear emission components; and (c) it provides a natural explanation for variability in the Lya absorption detected in an earlier epoch. We also explore physical and geometrical constraints on the outflow from these results.

  17. Experimental investigation of the multiple scatter peak of gamma rays in portland cement in the energy range 279-1332 keV

    International Nuclear Information System (INIS)

    Singh, Tejbir; Singh, Parjit S

    2011-01-01

    The pulse height spectra for different thicknesses of portland cement in the reflected geometry has been recorded with the help of a NaI(Tl) scintillator detector and 2 K MCA card using different gamma-ray sources such as Hg 203 (279 keV), Cs 137 (662 keV) and Co 60 (1173 and 1332 keV). It has been observed that the multiple scatter peak for portland cement appears at 110 (±7) keV in all the spectra irrespective of different incident photon energies in the range 279-1332 keV from different gamma-ray sources. Further, the variation in the intensity of the multiple scatter peak with the thickness of portland cement in the backward semi-cylinders has been investigated.

  18. Rational Design of Bacillus coagulans NL01 l-Arabinose Isomerase and Use of Its F279I Variant in d-Tagatose Production.

    Science.gov (United States)

    Zheng, Zhaojuan; Mei, Wending; Xia, Meijuan; He, Qin; Ouyang, Jia

    2017-06-14

    d-Tagatose is a prospective functional sweetener that can be produced by l-arabinose isomerase (AI) from d-galactose. To improve the activity of AI toward d-galactose, the AI of Bacillus coagulans was rationally designed on the basis of molecular modeling and docking. After alanine scanning and site-saturation mutagenesis, variant F279I that exhibited improved activity toward d-galactose was obtained. The optimal temperature and pH of F279I were determined to be 50 °C and 8.0, respectively. This variant possessed 1.4-fold catalytic efficiency compared with the wild-type (WT) enzyme. The recombinant Escherichia coli overexpressing F279I also showed obvious advantages over the WT in biotransformation. Under optimal conditions, 67.5 and 88.4 g L -1 d-tagatose could be produced from 150 and 250 g L -1 d-galactose, respectively, in 15 h. The biocatalyst constructed in this study presents a promising alternative for large-scale d-tagatose production.

  19. Antibody production of wild-type and enzyme V279F variants of PAF-AH as a risk factor for Cardiovascular disease

    Science.gov (United States)

    Ramadhani, Anggia N.; Puspitarini, Sapti; Sari, Anissa N.; Widodo

    2017-11-01

    Coronary artery disease (CAD) has emerged as a leading cause of death in Indonesia nowadays. WHO data in 2012 revealed that 37% of the Indonesian population died from this disease. CAD occurs because of endothelial dysfunction in the arteries. Lipoprotein-associated phospholipase A2 (Lp-PLA2), also known as platelet-activating factor acetylhydrolase (PAF-AH), is a phospholipase A2 enzyme, encoded by the PLA2G7 gene. This protein is predicted to be involved in inflammatory phospholipid metabolism so it can be used as a biomarker of CAD in the early phase. Thus, the purpose of this research is to discover the difference in antibody production between wild-type and mutant V279F. The PAF-AH enzyme was isolated from mice lymphocyte cells in order to develop this enzyme as a biomarker of cardiovascular disease. PAF-AH migrates at 55kDa according to SDS-PAGE analysis. Flow cytometry analysis showed that mutant PAF-AH (V279F) is more antigenic than wild-type PAF-AH. The missense mutation of V279F PAF-AH means this enzyme cannot catabolize the acetyl group at the sn-2 position of PAF.

  20. Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

    Science.gov (United States)

    Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

    2018-01-01

    Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

  1. Possible alternative to European Pharmacopoeia's method of analysis Test for Fc Function of Immunoglobulin (2.7.9) by using tetanus toxoid as antigen.

    Science.gov (United States)

    Perez-del-Pulgar, S; Lopez, M; Gensana, M; Jorquera, J I

    2006-08-01

    Preparations of intravenous immunoglobulins must keep functional integrity throughout the purification process. In order to assess Fc fragment functionality, the European Pharmacopoeia proposes the Test for Fc function of immunoglobulin (2.7.9), which is based on a rubella antigen of high titre. Sometimes, such antigen is difficult to obtain. In the present study, we develop the same assay using tetanus toxoid instead of rubella antigen, adapting the procedure for the use of tetanus toxoid. The comparison between rubella-based and tetanus-based assays showed that the slopes of the haemolysis curves were higher if red blood cells had been sensitised with the rubella antigen than with tetanus toxoid. Nonetheless, the tetanus-based assay gave satisfactory results and it could be a good alternative antigen target.

  2. MINUTE-TIMESCALE >100 MeV γ -RAY VARIABILITY DURING THE GIANT OUTBURST OF QUASAR 3C 279 OBSERVED BY FERMI -LAT IN 2015 JUNE

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.; Buehler, R. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Anantua, R.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A.; Cameron, R. A. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Asano, K. [Institute for Cosmic-Ray Research, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba, 277-8582 (Japan); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Gonzalez, J. Becerra [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Bellazzini, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bissaldi, E.; Caragiulo, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, I-70126 Bari (Italy); Bonino, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Bruel, P. [Laboratoire Leprince-Ringuet, École polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Caraveo, P. A. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica, I-20133 Milano (Italy); Cavazzuti, E. [Agenzia Spaziale Italiana (ASI) Science Data Center, I-00133 Roma (Italy); and others

    2016-06-20

    On 2015 June 16, Fermi -LAT observed a giant outburst from the flat spectrum radio quasar 3C 279 with a peak >100 MeV flux of ∼3.6 × 10{sup −5} photons cm{sup −2} s{sup −1}, averaged over orbital period intervals. It is historically the highest γ -ray flux observed from the source, including past EGRET observations, with the γ -ray isotropic luminosity reaching ∼10{sup 49} erg s{sup −1}. During the outburst, the Fermi spacecraft, which has an orbital period of 95.4 minutes, was operated in a special pointing mode to optimize the exposure for 3C 279. For the first time, significant flux variability at sub-orbital timescales was found in blazar observations by Fermi -LAT. The source flux variability was resolved down to 2-minute binned timescales, with flux doubling times of less than 5 minutes. The observed minute-scale variability suggests a very compact emission region at hundreds of Schwarzschild radii from the central engine in conical jet models. A minimum bulk jet Lorentz factor (Γ) of 35 is necessary to avoid both internal γ -ray absorption and super-Eddington jet power. In the standard external radiation Comptonization scenario, Γ should be at least 50 to avoid overproducing the synchrotron self-Compton component. However, this predicts extremely low magnetization (∼5 × 10{sup −4}). Equipartition requires Γ as high as 120, unless the emitting region is a small fraction of the dissipation region. Alternatively, we consider γ rays originating as synchrotron radiation of γ {sub e} ∼ 1.6 × 10{sup 6} electrons, in a magnetic field B ∼ 1.3 kG, accelerated by strong electric fields E ∼ B in the process of magnetoluminescence. At such short distance scales, one cannot immediately exclude the production of γ -rays in hadronic processes.

  3. Smoking, diabetes, blood hypertension: possible etiologic role for Peyronie’s disease? Analysis in 279 patients with a control group in Sicily

    Directory of Open Access Journals (Sweden)

    Carlo Pavone

    2015-03-01

    Full Text Available Objective: To assess the proportion of patients with Peyronie’s Disease (PD and the possible association with its potential risk factors in the general population of the central and western Sicily in our weekly andrological outpatient clinic. Materials and methods: We recruited a sample of 279 consecutive patients consulting our andrological outpatient clinic. Two arms were created: the first one composed by PD patients (men with symptoms suggestive for PD, the second one composed by patients with other andrological diseases (control arm. For each patient we evaluated the age, cigarette smoking, diabetes, blood hypertension and erectile function. In the PD arm we administered validated questionnaires to determine the erectile function status by the International Index of Erectile Function 5 (IIEF-5 and the pain status during erection by the Visual Analogue Scale (VAS. A univariate analysis was conducted using R software. Results: We enrolled 279 consecutive patients. The number of PD patients was 97 (34,7%. The univariate analysis showed a correlation between PD and cigarette smoking (p = 0.0242, blood hypertension (p < 0.001, erectile dysfunction (p < 0.001. No significant association was observed between diabetes and PD (p = 0.358. The median age of PD arm was 60 years and the median age of the control arm was 63,5 years; therefore the median age of PD arm resulted lower than the median age of the control arm (p = 0,031. Conclusions: Peyronie’s disease is more common than we might think; furthermore it can be diagnosed among young patients. According to our results, cigarette smoking and blood hypertension may be considered statically significant risk factors for developing PD. On the contrary diabetes seems not to be a risk factor for PD. According to our results PD should be sought also in young patients. Further studies are necessary to confirm that removing the indicated risk factors may reduce the incidence of PD.

  4. Residual heat deposition in dental enamel during IR laser ablation at 2.79, 2.94, 9.6, and 10.6 microm.

    Science.gov (United States)

    Fried, D; Ragadio, J; Champion, A

    2001-01-01

    The principal factor limiting the rate of laser ablation of dental hard tissue is the risk of excessive heat accumulation in the tooth. Excessive heat deposition or accumulation may result in unacceptable damage to the pulp. The objective of this study was to measure the residual heat deposition during the laser ablation of dental enamel at those IR laser wavelengths well suited for the removal of dental caries. Optimal laser ablation systems minimize the residual heat deposition in the tooth by efficiently transferring the deposited laser energy to kinetic and internal energy of ejected tissue components. The residual heat deposition in dental enamel was measured at laser wavelengths of 2.79, 2.94, 9.6, and 10.6 microm and pulse widths of 150 nsec -150 microsec using bovine block "calorimeters." Water droplets were applied to the surface before ablation with 150 microsec Er:YAG laser pulses to determine the influence of an optically thick water layer on reducing heat deposition. The residual heat was at a minimum for fluences well above the ablation threshold where measured values ranged from 25-70% depending on pulse duration and wavelength for the systems investigated. The lowest values of the residual heat were measured for short (Droplets of water applied to the surface before ablation significantly reduced the residual heat deposition during ablation with 150 microsec Er:YAG laser pulses. Residual heat deposition can be markedly reduced by using CO(2) laser pulses of less than 20 microsec duration and shorter Q-switched Er:YAG and Er:YSGG laser pulses for enamel ablation. Copyright 2001 Wiley-Liss, Inc.

  5. Liver fat content, non-alcoholic fatty liver disease, and ischaemic heart disease: Mendelian randomization and meta-analysis of 279 013 individuals.

    Science.gov (United States)

    Lauridsen, Bo Kobberø; Stender, Stefan; Kristensen, Thomas Skårup; Kofoed, Klaus Fuglsang; Køber, Lars; Nordestgaard, Børge G; Tybjærg-Hansen, Anne

    2018-02-01

    In observational studies, non-alcoholic fatty liver disease (NAFLD) is associated with high risk of ischaemic heart disease (IHD). We tested the hypothesis that a high liver fat content or a diagnosis of NAFLD is a causal risk factor for IHD. In a cohort study of the Danish general population (n = 94 708/IHD = 10 897), we first tested whether a high liver fat content or a diagnosis of NAFLD was associated observationally with IHD. Subsequently, using Mendelian randomization, we tested whether a genetic variant in the gene encoding the protein patatin-like phospholipase domain containing 3 protein (PNPLA3), I148M (rs738409), a strong and specific cause of high liver fat content and NAFLD, was causally associated with the risk of IHD. We found that the risk of IHD increased stepwise with increasing liver fat content (in quartiles) up to an odds ratio (OR) of 2.41 (1.28-4.51)(P-trend = 0.004). The corresponding OR for IHD in individuals with vs. without NAFLD was 1.65 (1.34-2.04)(P = 3×10-6). PNPLA3 I148M was associated with a stepwise increase in liver fat content of up to 28% in MM vs. II-homozygotes (P-trend = 0.0001) and with ORs of 2.03 (1.52-2.70) for NAFLD (P = 3×10-7), 3.28 (2.37-4.54) for cirrhosis (P = 4×10-12), and 0.95 (0.86-1.04) for IHD (P = 0.46). In agreement, in meta-analysis (N = 279 013/IHD = 71 698), the OR for IHD was 0.98 (0.96-1.00) per M-allele vs. I-allele. The OR for IHD per M-allele higher genetically determined liver fat content was 0.98 (0.94-1.03) vs. an observational estimate of 1.05 (1.02-1.09)(P for comparison = 0.02). Despite confirming the known observational association of liver fat content and NAFLD with IHD, lifelong, genetically high liver fat content was not causally associated with risk of IHD. These results suggest that the observational association is due to confounding or reverse causation. Published on behalf of the European Society of Cardiology. All rights reserved.

  6. Global surveillance of cancer survival 1995–2009: analysis of individual data for 25 676 887 patients from 279 population-based registries in 67 countries (CONCORD-2)

    Science.gov (United States)

    Allemani, Claudia; Weir, Hannah K; Carreira, Helena; Harewood, Rhea; Spika, Devon; Wang, Xiao-Si; Bannon, Finian; Ahn, Jane V; Johnson, Christopher J; Bonaventure, Audrey; Marcos-Gragera, Rafael; Stiller, Charles; Silva, Gulnar Azevedo e; Chen, Wan-Qing; Ogunbiyi, Olufemi J; Rachet, Bernard; Soeberg, Matthew J; You, Hui; Matsuda, Tomohiro; Bielska-Lasota, Magdalena; Storm, Hans; Tucker, Thomas C; Coleman, Michel P

    2015-01-01

    Summary Background Worldwide data for cancer survival are scarce. We aimed to initiate worldwide surveillance of cancer survival by central analysis of population-based registry data, as a metric of the effectiveness of health systems, and to inform global policy on cancer control. Methods Individual tumour records were submitted by 279 population-based cancer registries in 67 countries for 25·7 million adults (age 15–99 years) and 75 000 children (age 0–14 years) diagnosed with cancer during 1995–2009 and followed up to Dec 31, 2009, or later. We looked at cancers of the stomach, colon, rectum, liver, lung, breast (women), cervix, ovary, and prostate in adults, and adult and childhood leukaemia. Standardised quality control procedures were applied; errors were corrected by the registry concerned. We estimated 5-year net survival, adjusted for background mortality in every country or region by age (single year), sex, and calendar year, and by race or ethnic origin in some countries. Estimates were age-standardised with the International Cancer Survival Standard weights. Findings 5-year survival from colon, rectal, and breast cancers has increased steadily in most developed countries. For patients diagnosed during 2005–09, survival for colon and rectal cancer reached 60% or more in 22 countries around the world; for breast cancer, 5-year survival rose to 85% or higher in 17 countries worldwide. Liver and lung cancer remain lethal in all nations: for both cancers, 5-year survival is below 20% everywhere in Europe, in the range 15–19% in North America, and as low as 7–9% in Mongolia and Thailand. Striking rises in 5-year survival from prostate cancer have occurred in many countries: survival rose by 10–20% between 1995–99 and 2005–09 in 22 countries in South America, Asia, and Europe, but survival still varies widely around the world, from less than 60% in Bulgaria and Thailand to 95% or more in Brazil, Puerto Rico, and the USA. For cervical cancer

  7. The 2-79 keV X-ray spectrum of the circinus galaxy with NuSTAR, XMM-Newton, and Chandra: a fully compton-thick active galactic nucleus

    DEFF Research Database (Denmark)

    Arévalo, P.; Bauer, F. E.; Puccetti, S.

    2014-01-01

    The Circinus galaxy is one of the closest obscured active galactic nuclei (AGNs), making it an ideal target for detailed study. Combining archival Chandra and XMM-Newton data with new NuSTAR observations, we model the 2-79 keV spectrum to constrain the primary AGN continuum and to derive physical...... by an optically thick torus, where the intrinsic spectrum is a power law of photon index Γ = 2.2-2.4, the torus has an equatorial column density of NH = (6-10) × 1024 cm-2, and the intrinsic AGN 2-10 keV luminosity is (2.3-5.1) × 1042 erg s-1. These values place Circinus along the same relations as unobscured...

  8. Synthesis of 2-deoxy-2,2-difluoro-α-maltosyl fluoride and its X-ray structure in complex with Streptomyces coelicolor GlgEI-V279S

    Energy Technology Data Exchange (ETDEWEB)

    Thanna, Sandeep; Lindenberger, Jared J.; Gaitonde, Vishwanath V.; Ronning, Donald R.; Sucheck, Steven J. (Toledo)

    2015-06-05

    Streptomyces coelicolor (Sco) GlgEI is a glycoside hydrolase involved in α-glucan biosynthesis and can be used as a model enzyme for structure-based inhibitor design targeting Mycobacterium tuberculosis (Mtb) GlgE. The latter is a genetically validated drug target for the development of anti-Tuberculosis (TB) treatments. Inhibition of Mtb GlgE results in a lethal buildup of the GlgE substrate maltose-1-phosphate (M1P). However, Mtb GlgE is difficult to crystallize and affords lower resolution X-ray structures. Sco GlgEI-V279S on the other hand crystallizes readily, produces high resolution X-ray data, and has active site topology identical to Mtb GlgE. We report the X-ray structure of Sco GlgEI-V279S in complex with 2-deoxy-2,2-difluoro-α-maltosyl fluoride (α-MTF, 5) at 2.3 Å resolution. α-MTF was designed as a non-hydrolysable mimic of M1P to probe the active site of GlgE1 prior to covalent bond formation without disruption of catalytic residues. The α-MTF complex revealed hydrogen bonding between Glu423 and the C1F which provides evidence that Glu423 functions as proton donor during catalysis. Further, hydrogen bonding between Arg392 and the axial C2 difluoromethylene moiety of α-MTF was observed suggesting that the C2 position tolerates substitution with hydrogen bond acceptors. The key step in the synthesis of α-MDF was transformation of peracetylated 2-fluoro-maltal 1 into peracetylated 2,2-difluoro-α-maltosyl fluoride 2 in a single step via the use of Selectfluor®

  9. Retrospective and Prospective Human Intravenous and Oral Pharmacokinetic Projection of Dipeptidyl peptidase-IV Inhibitors Using Simple Allometric Principles - Case Studies of ABT-279, ABT-341, Alogliptin, Carmegliptin, Sitagliptin and Vildagliptin.

    Science.gov (United States)

    Gilibili, Ravindranath R; Bhamidipati, Ravi Kanth; Mullangi, Ramesh; Srinivas, Nuggehally R

    2015-01-01

    The purpose of this exercise was to explore the utility of allometric scaling approach for the prediction of intravenous and oral pharmacokinetics of six dipeptidy peptidase-IV (DPP-IV) inhibitors viz. ABT-279, ABT-341, alogliptin, carmegliptin, sitagliptin and vildagliptin. The availability of intravenous and oral pharmacokinetic data in animals enabled the allometry scaling of 6 DPP-IV inhibitors. The relationship between the main pharmacokinetic parameters [viz. volume of distribution (Vd) and clearance (CL)] and body weight was studied across three or four mammalian species, using double logarithmic plots to predict the human pharmacokinetic parameters of CL and Vd using simple allometry. A simply allometry relationship: Y = aWb was found to be adequate for the prediction of intravenous and oral human clearance/volume of distribution for DPP-IV inhibitors. The allometric equations for alogliptin, carmegliptin, sitagliptin, vildagliptin, ABT-279 and ABT-341 were 1.867W0.780, 1.170W0.756, 2.020W0.529, 1.959 W0.847, 0.672 W1.016, 1.077W 0.649, respectively, to predict intravenous clearance (CL) and the corresponding equations to predict intravenous volume of distribution (Vd) were: 3.313W0.987, 6.096W0.992, 7.140W0.805, 2.742W0.941, 1.299W0.695 and 5.370W0.803. With the exception of a few discordant values the exponent rule appeared to hold for CL (0.75) and Vd (1.0) for the predictions of various DPP-IV inhibitors. Regardless of the routes, the predicted values were within 2-3 fold of observed values and intravenous allometry was better than oral allometry. Simple allometry retrospectively predicted with reasonable accuracy the human reported values of gliptins and could be used as a prospective tool for this class of drugs.

  10. 279-IJBCS-Article-Gbombele Soro

    African Journals Online (AJOL)

    User

    3 Centre Universitaire de Recherche et d'Application en Télédétection (CURAT), Université de Cocody,. 22 B.P. 801 Abidjan 22, Côte d'Ivoire. ..... C'est un outil de choix en hydrochimie, puisque les paramètres chimiques sont ..... n'interviennent pas dans la définition des deux axes principaux et ayant des teneurs en.

  11. Publications | Page 279 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    CASE STUDY: Nepal — Discovering diversity in the hills of Nepal. Farmers and researchers work together to improve rice and maize. The local cereal varieties found in the upland regions of Nepal show great promise for improving the food supply, but have long been ignored by the.

  12. 40 CFR 279.10 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... drippings from pumps, machinery, pipes, and other similar equipment during normal operations or small amounts of oil lost to the wastewater treatment system during washing or draining operations. This...

  13. 40 CFR 279.55 - Analysis plan.

    Science.gov (United States)

    2010-07-01

    .... Owners or operators of used oil processing and re-refining facilities must develop and follow a written... whether the analysis will be performed on-site or off-site; and (iii) The methods used to analyze used oil... used oil will be sampled and analyzed prior to or after any processing/re-refining; (iii) The frequency...

  14. BDML Metadata: 279 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available wt_N2_030131_01.zip http://ssbd.qbic.riken.jp/data/bdml/Ce_KK_P002/wt_N2_030131_01.bdml0.18.xml... http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/searc

  15. 32 CFR 279.4 - Claims process.

    Science.gov (United States)

    2010-07-01

    ... to: (i) DD 214 Form, Certificate of Release or Discharge from Active Duty and/or DD 215, Correction... to the former Service member or estate. Standards and Compliance will build and route reports for OSD...

  16. 40 CFR 279.50 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... oil. Processing means chemical or physical operations designed to produce from used oil, or to make used oil more amenable for production of, fuel oils, lubricants, or other used oil-derived products... oils to meet the fuel specification, filtration, simple distillation, chemical or physical separation...

  17. Publications | Page 279 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Revitalizing Chile's Mapuche communities. Indigenous people around the world are among the planet's poorest and most marginalized. They are also the most dependent on sustainable, healthy environments for their well-being. In Chile, researchers and Mapuche... CASE STUDY: Ecuador — Mining, contamination, and ...

  18. LC-MS/MS determination of 2-(4-((2-(2S,5R)-2-Cyano-5-ethynyl-1-pyrrolidinyl)-2-oxoethylamino)-4-methyl-1-piperidinyl)-4-pyridinecarboxylic acid (ABT-279) in dog plasma with high-throughput protein precipitation sample preparation.

    Science.gov (United States)

    Kim, Joseph; Flick, Jeanette; Reimer, Michael T; Rodila, Ramona; Wang, Perry G; Zhang, Jun; Ji, Qin C; El-Shourbagy, Tawakol A

    2007-11-01

    As an effective DPP-IV inhibitor, 2-(4-((2-(2S,5R)-2-Cyano-5-ethynyl-1-pyrrolidinyl)-2-oxoethylamino)-4-methyl-1-piperidinyl)-4-pyridinecarboxylic acid (ABT-279), is an investigational drug candidate under development at Abbott Laboratories for potential treatment of type 2 diabetes. In order to support the development of ABT-279, multiple analytical methods for an accurate, precise and selective concentration determination of ABT-279 in different matrices were developed and validated in accordance with the US Food and Drug Administration Guidance on Bioanalytical Method Validation. The analytical method for ABT-279 in dog plasma was validated in parallel to other validations for ABT-279 determination in different matrices. In order to shorten the sample preparation time and increase method precision, an automated multi-channel liquid handler was used to perform high-throughput protein precipitation and all other liquid transfers. The separation was performed through a Waters YMC ODS-AQ column (2.0 x 150 mm, 5 microm, 120 A) with a mobile phase of 20 mm ammonium acetate in 20% acetonitrile at a flow rate of 0.3 mL/min. Data collection started at 2.2 min and continued for 2.0 min. The validated linear dynamic range in dog plasma was between 3.05 and 2033.64 ng/mL using a 50 microL sample volume. The achieved r(2) coefficient of determination from three consecutive runs was between 0.998625 and 0.999085. The mean bias was between -4.1 and 4.3% for all calibration standards including lower limit of quantitation. The mean bias was between -8.0 and 0.4% for the quality control samples. The precision, expressed as a coefficient of variation (CV), was < or =4.1% for all levels of quality control samples. The validation results demonstrated that the high-throughput method was accurate, precise and selective for the determination of ABT-279 in dog plasma. The validated method was also employed to support two toxicology studies. The passing rate was 100% for all 49 runs from

  19. Global surveillance of cancer survival 1995-2009: analysis of individual data for 25,676,887 patients from 279 population-based registries in 67 countries (CONCORD-2).

    Science.gov (United States)

    Allemani, Claudia; Weir, Hannah K; Carreira, Helena; Harewood, Rhea; Spika, Devon; Wang, Xiao-Si; Bannon, Finian; Ahn, Jane V; Johnson, Christopher J; Bonaventure, Audrey; Marcos-Gragera, Rafael; Stiller, Charles; Azevedo e Silva, Gulnar; Chen, Wan-Qing; Ogunbiyi, Olufemi J; Rachet, Bernard; Soeberg, Matthew J; You, Hui; Matsuda, Tomohiro; Bielska-Lasota, Magdalena; Storm, Hans; Tucker, Thomas C; Coleman, Michel P

    2015-03-14

    Worldwide data for cancer survival are scarce. We aimed to initiate worldwide surveillance of cancer survival by central analysis of population-based registry data, as a metric of the effectiveness of health systems, and to inform global policy on cancer control. Individual tumour records were submitted by 279 population-based cancer registries in 67 countries for 25·7 million adults (age 15-99 years) and 75,000 children (age 0-14 years) diagnosed with cancer during 1995-2009 and followed up to Dec 31, 2009, or later. We looked at cancers of the stomach, colon, rectum, liver, lung, breast (women), cervix, ovary, and prostate in adults, and adult and childhood leukaemia. Standardised quality control procedures were applied; errors were corrected by the registry concerned. We estimated 5-year net survival, adjusted for background mortality in every country or region by age (single year), sex, and calendar year, and by race or ethnic origin in some countries. Estimates were age-standardised with the International Cancer Survival Standard weights. 5-year survival from colon, rectal, and breast cancers has increased steadily in most developed countries. For patients diagnosed during 2005-09, survival for colon and rectal cancer reached 60% or more in 22 countries around the world; for breast cancer, 5-year survival rose to 85% or higher in 17 countries worldwide. Liver and lung cancer remain lethal in all nations: for both cancers, 5-year survival is below 20% everywhere in Europe, in the range 15-19% in North America, and as low as 7-9% in Mongolia and Thailand. Striking rises in 5-year survival from prostate cancer have occurred in many countries: survival rose by 10-20% between 1995-99 and 2005-09 in 22 countries in South America, Asia, and Europe, but survival still varies widely around the world, from less than 60% in Bulgaria and Thailand to 95% or more in Brazil, Puerto Rico, and the USA. For cervical cancer, national estimates of 5-year survival range from less

  20. 26 CFR 1.279-5 - Rules for application of section 279(b).

    Science.gov (United States)

    2010-04-01

    ... with generally accepted accounting principles. Thus, for example, the indebtedness of a corporation...) Special rules for banks and lending or finance companies—(1) Debt to equity and projected earnings. Under... primarily engaged in a lending or finance business, the following rules are to be applied: (i) In...

  1. 279 Department of Agronomy/Sugar Research Institute, University of ...

    African Journals Online (AJOL)

    Osondu

    2014-04-09

    Apr 9, 2014 ... sugarcane crop is affected by 20-25 percent (%) due to weed infestation (Khan et al., 2004). Weed management therefore in sugarcane accounts for over 35% ..... Indian. Journal of Weed Science 34(3-4): 320-321. USRI (2009). Unilorin Sugar Research Institute: Report of Research activities (2005-2009).

  2. 40 CFR 279.64 - Used oil storage.

    Science.gov (United States)

    2010-07-01

    ...) The secondary containment system must consist of, at a minimum: (i) Dikes, berms or retaining walls; and (ii) A floor. The floor must cover the entire area within the dike, berm, or retaining wall. (2... walls; and (ii) A floor. The floor must cover the entire area within the dike, berm, or retaining wall...

  3. 40 CFR 279.54 - Used oil management.

    Science.gov (United States)

    2010-07-01

    ... consist of, at a minimum: (i) Dikes, berms or retaining walls; and (ii) A floor. The floor must cover the entire area within the dike, berm, or retaining wall; or (iii) An equivalent secondary containment system..., at a minimum: (i) Dikes, berms or retaining walls; and (ii) A floor. The floor must cover the entire...

  4. The V279F polymorphism might change protein character and ...

    African Journals Online (AJOL)

    Widodo

    2017-08-18

    Aug 18, 2017 ... a Biology Department, Faculty of Mathematics and Natural Sciences, Brawijaya University, Jl. Veteran, Malang, Indonesia b Pusat Study ... c Department of Biology, Faculty of Mathematics and Science Education, UPI, Bandung, Indonesia d Department of ..... smartphones to workstations. Bioinformatics ...

  5. Dicty_cDB: VHA279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-14 4 EC388462 |EC388462.1 C05_C05gm3n9_pDNRf_491526 Myzus persicae, line G006, whole aphid library Myzus... persicae cDNA clone C05_C05gm3n9_pDNRf_491526, mRNA sequence. 58 4e-13 3 EC388376 |EC388376.1 B10_B10gm2a20_pDNRf_490797 Myzus... persicae, line G006, whole aphid library Myzus persicae cDNA clone B10_B10gm2a20_pDNRf_4

  6. 40 CFR 279.24 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....24 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED...-transportation of small amounts to approved collection centers. Generators may transport, without an EPA identification number, used oil that is generated at the generator's site and used oil collected from household...

  7. 7 CFR 2.79 - Administrator, Agricultural Marketing Service.

    Science.gov (United States)

    2010-01-01

    ... Foods Research and Nutrition Education Act (7 U.S.C. 3401-3417), except as delegated in § 2.43(a)(24... specified in § 2.43(a)(24); and (lvii) The Fresh Cut Flowers and Fresh Cut Greens Promotion and Consumer...

  8. Dicty_cDB: CFI279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fvymni**ikhnknxiiyifivtlyeylkigkhflkigkhy*kkk*idf*l*kk--- ---xxxxxxxxxxxxxxxxxxxxxxxaxfxxvxxvyxxxxxxxxx...lxxxlxlxxxlxlxl xxxllxxpllqplpqlq Frame C: lfi*tfnk*ntikxilfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxcmxxxxxxxxxsxcxxxcxxxcxxxc xxxcyxxrysnrypns Homology vs CS

  9. 33 CFR 279.8 - Synthesis and analysis.

    Science.gov (United States)

    2010-07-01

    ... fishing and passive recreation use such as hiking trails, nature, and ecological study areas. (c... (and non-point sources of pollution) as prescribed by section 208, Federal Water Pollution Control Act...

  10. 42 CFR 423.279 - National average monthly bid amount.

    Science.gov (United States)

    2010-10-01

    ... number of Part D eligible individuals enrolled in the plan in the reference month (as defined in § 422... individuals enrolled in a reference month in all Part D plans except MSA plans, fallbacks, MA private fee-for... for Part D plans will be adjusted to take into account differences in prices for Part D drugs among...

  11. All projects related to | Page 279 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-05-12

    Strengthening the Knowledge Base for Public Interest Intellectual Property Policy. Project. Rigid intellectual property norms and intensified enforcement have prompted media and medicine suppliers alike to price their products beyond the reach of all but the most affluent segment of the population. Start Date: May 12, 2011.

  12. : tous les projets | Page 279 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les pays en développement en général font face à une pénurie d'intellectuels capables d'orienter les politiques et la réglementation en faveur de la croissance économique et de la réduction de la pauvreté. Date de début : 1 juillet 2010. End Date: 1 juillet 2014. Sujet: International cooperation, POLICY MAKING, TRAINEES ...

  13. The WEBT Campaign on the Blazar 3C 279 in 2006

    Czech Academy of Sciences Publication Activity Database

    Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berdyugin, A.; Blažek, Martin; Buemi, C.S.; Castro-Tirado, A.J.; de Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V.A.; Henson, G.; Hovatta, T.; Hudec, René; Ibrahimov, M.A.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y.Y.; Kovalev, Yu.A.; Kubánek, Petr; Kurosaki, M.; Kurtanidze, O.M.; Lähteenmäki, A.; Lanteri, L.; Larionov, V.M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H.R.; Mingaliev, M.G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.G.; Nilsson, K.; Nishiyama, S.; Ohlert, J.M.; Osterman, M.A.; Pak, S.; Pasanen, M.; Peters, C.S.; Pursimo, T.; Raiteri, C.M.; Robertson, J.; Robertson, T.; Ryle, W.T.; Sadakane, K.; Sadun, A.C.; Sigua, L.A.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L.O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J.R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vítek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, S.-H.

    2007-01-01

    Roč. 670, č. 2 (2007), s. 968-977 ISSN 0004-637X Grant - others:EU(XE) ESA-PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Source of funding: V - iné verejné zdroje Keywords : blazars * active galactic nuclei Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.405, year: 2007

  14. 40 CFR 279.45 - Used oil storage at transfer facilities.

    Science.gov (United States)

    2010-07-01

    ...) The secondary containment system must consist of, at a minimum: (i) Dikes, berms or retaining walls; and (ii) A floor. The floor must cover the entire area within the dikes, berms, or retaining walls; or... consist of, at a minimum: (i) Dikes, berms or retaining walls; and (ii) A floor. The floor must cover the...

  15. 47 CFR 90.279 - Power limitations applicable to the 421-430 MHz band.

    Science.gov (United States)

    2010-10-01

    ... the 421-430 MHz band will be subject to Effective Radiated Power (ERP) and Effective Antenna Height (EAH) limitations as shown in the table below. ERP is defined as the product of the power supplied to... height above mean sea level. Limits of Effective Radiated Power (ERP) Corresponding to Effective Antenna...

  16. People and things. CERN Courier, Nov 1987, v. 27(9)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 1988 CERN School of Physics will be organized jointly by the Nuclear Research Centre 'Demokritos', Athens and CERN. Its basic aim is to teach various aspects of high energy physics, but especially theoretical physics, to young experimental physicists, mainly from the Member States of CERN. It will be held in Lefkada, Greece, from 18 September to 1 October 1988. The first and highly successful Asia-Pacific Workshop on High Energy Physics, devoted to Superstrings, Anomalies and Field Theory, was held in Singapore this summer

  17. SU-F-T-279: Impact of Beam Energy Drifts On IMRT Delivery Accuracy

    Energy Technology Data Exchange (ETDEWEB)

    Goddu, S [Washington University, St. Louis, MO (United States); Kamal, G; Herman, A; Edwards, S; Cai, B [Washington University School of Medicine, St. Louis, MO (United States); Yaddanapudi, S [Washington University in St. Louis, St. Louis, MO (United States); Oddiraju, S [Baylor Scot & White, Temple, TX (United States); Rangaraj, D [Baylor Scott & White Health, Temple, TX (United States); Mutic, S [Washington University School of Medicine, Saint Louis, MO (United States)

    2016-06-15

    Purpose: According to TG-40 percent-depth-dose (PDD) tolerance is ±2% but TG-142 is ±1%. Now the question is, which one is relevant in IMRT era? The primary objective of this study is to evaluate dosimetric impact of beam-energy-drifts on IMRT-delivery. Methods: Beam-energy drifts were simulated by adjusting Linac’s bending-magnet-current (BMC) followed by tuning the pulse-forming network and adjusting gun-current. PDD change of −0.6% and +1.2% were tested. Planar-dosimetry measurements were performed using an ionization-chamber-array in solid-water phantoms. Study includes 10-head-and-neck and 3-breast cancer patients. en-face beam-deliveries were also tested at 1.3cm and 5.3cm depths. Composite and single-field dose-distributions were compared against the plans to determine %Gamma pass-rates (%GPRs). For plan dose comparisons, changes in %Gamma pass-rates (cPGPRs) were computed/reported to exclude the differences between dose-computation and delivery. Dose distributions of the drifted-energies were compared against their baseline measurements to determine the% GPRs. A Gamma criteria of 3%/3mm was considered for plan-dose comparisons while 3%/1mm used for measured dose intercomparisons. Results: For composite-dose delivery, average cPGPRs were 0.41%±2.48% and −2.54%±3.65% for low-energy (LE) and high-energy (HE) drifts, respectively. For measured dose inter-comparisons, the average%GPRs were 98.4%±2.2% (LE-drift) and 95.8%±4.0 (HE-drift). The average %GPR of 92.6%±4.3% was noted for the worst-case scenario comparing LE-drift to HE-drift. All en-face beams at 5.3 cm depth have cPGPRs within ±4% of the baseline-energy measurements. However, greater variations were noted for 1.3cm depth. Average %GPRs for drifted energies were >99% at 5.3cm and >97% at 1.3cm depths. However, for the worst-case scenario (LE-drift to HE-drift) these numbers dropped to 95.2% at 5.3cm and 93.1% at 1.3cm depths. Conclusion: The dosimetric impact of beam-energy drifts was found to be within clinically acceptable tolerance. However, this study includes a single energy with limited range of PDD change. Further studies are on going and the results will be presented. Received funding from Varian Medical Systems, Palo Alto, CA.

  18. IAEA Newsbriefs. V. 13, no. 2(79). Apr-May 1998

    International Nuclear Information System (INIS)

    1998-01-01

    This issue gives brief information on the following topics: IAEA Board Meetings Set in May and June, Database of the IAEA's International Nuclear Information Systems (INIS) is being made available over the Internet free of charge, Senior Expert Group Starts Review of IAEA Programmes, IAEA Reports to Security Council on Nuclear Inspections in Iraq, Parties Consider Extending Fusion Research through the ITER Project, Status of Joint Safety and Nuclear Liability Conventions, Proposed Global Convention Against Nuclear Terrorism, Upcoming Symposia and Conferences, New IAEA Books, Nuclear Data File, and other short information

  19. SU-F-T-279: Impact of Beam Energy Drifts On IMRT Delivery Accuracy

    International Nuclear Information System (INIS)

    Goddu, S; Kamal, G; Herman, A; Edwards, S; Cai, B; Yaddanapudi, S; Oddiraju, S; Rangaraj, D; Mutic, S

    2016-01-01

    Purpose: According to TG-40 percent-depth-dose (PDD) tolerance is ±2% but TG-142 is ±1%. Now the question is, which one is relevant in IMRT era? The primary objective of this study is to evaluate dosimetric impact of beam-energy-drifts on IMRT-delivery. Methods: Beam-energy drifts were simulated by adjusting Linac’s bending-magnet-current (BMC) followed by tuning the pulse-forming network and adjusting gun-current. PDD change of −0.6% and +1.2% were tested. Planar-dosimetry measurements were performed using an ionization-chamber-array in solid-water phantoms. Study includes 10-head-and-neck and 3-breast cancer patients. en-face beam-deliveries were also tested at 1.3cm and 5.3cm depths. Composite and single-field dose-distributions were compared against the plans to determine %Gamma pass-rates (%GPRs). For plan dose comparisons, changes in %Gamma pass-rates (cPGPRs) were computed/reported to exclude the differences between dose-computation and delivery. Dose distributions of the drifted-energies were compared against their baseline measurements to determine the% GPRs. A Gamma criteria of 3%/3mm was considered for plan-dose comparisons while 3%/1mm used for measured dose intercomparisons. Results: For composite-dose delivery, average cPGPRs were 0.41%±2.48% and −2.54%±3.65% for low-energy (LE) and high-energy (HE) drifts, respectively. For measured dose inter-comparisons, the average%GPRs were 98.4%±2.2% (LE-drift) and 95.8%±4.0 (HE-drift). The average %GPR of 92.6%±4.3% was noted for the worst-case scenario comparing LE-drift to HE-drift. All en-face beams at 5.3 cm depth have cPGPRs within ±4% of the baseline-energy measurements. However, greater variations were noted for 1.3cm depth. Average %GPRs for drifted energies were >99% at 5.3cm and >97% at 1.3cm depths. However, for the worst-case scenario (LE-drift to HE-drift) these numbers dropped to 95.2% at 5.3cm and 93.1% at 1.3cm depths. Conclusion: The dosimetric impact of beam-energy drifts was found to be within clinically acceptable tolerance. However, this study includes a single energy with limited range of PDD change. Further studies are on going and the results will be presented. Received funding from Varian Medical Systems, Palo Alto, CA

  20. 33 CFR Appendix A to Part 279 - Sample Resource Use Objectives

    Science.gov (United States)

    2010-07-01

    ... exists a high demand for warm water fishing; that the water quality and other necessary environmental... for a water resource project. They are presented for illustrative purposes only and are not intended... its small water surface and excellent water quality is not suitable for power boating; is in a...

  1. 5 CFR 532.279 - Special wage schedules for printing positions.

    Science.gov (United States)

    2010-01-01

    ... the printing survey as follows: (1) The lead agency must include North American Industry... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special wage schedules for printing... printing positions. (a) The lead agency in a special printing schedule area listed in paragraph (j) of this...

  2. Sud du Sahara | Page 279 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    exécution de chaque programme. Ces examens constituent le principal outil de reddition de comptes du Centre, car ils permettent de démontrer les résultats obtenus grâce aux dépenses de programme, et donc l'efficacité et la pertinence de ces ...

  3. Trust, Engagement, and Technology Transfer: Underpinnings for U.S.-Brazil Defense Cooperation (Strategic Forum, no. 279)

    Science.gov (United States)

    2012-08-01

    Political Sci- ence Review, no. 30 (2009), 122–124, 130. 7 Mauricio Pazini Brandão, “Ciência, Tecnologia , Inovação e a Defesa Nacional,” 3ª Conferência...Nacional de Ciência, Tecnologia e Inovação, October 2005, 798, available at <http://cncti3.cgee.org. br/Documentos/Seminariosartigos/Areasinternacional

  4. 77 FR 279 - Brea Generation LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request...

    Science.gov (United States)

    2012-01-04

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER12-673-000] Brea Generation LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket... Generation LLC's application for market-based rate authority, with an accompanying rate tariff, noting that...

  5. 78 FR 37791 - In the Matter of: Jose Guadalupe Reyes-Martinez, Inmate Number #85993-279, CI Adams County...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security In the Matter of: Jose Guadalupe Reyes... the Internal Security Act of 1950 (50 U.S.C. 783(b)), or section 38 of the Arms Export Control Act (22... 750.8 of the Regulations states that the Bureau of Industry and Security's Office of Exporter Services...

  6. 78 FR 37793 - In the Matter of: Jose Arturo Ramon-Herrada, Inmate Number #90903-279, CI Willacy County...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security In the Matter of: Jose Arturo Ramon-Herrada... Secretary of Commerce for Industry and Security. The appeal must be filed within 45 days from the date of....S.C. 793, 794 or 798; section 4(b) of the Internal Security Act of 1950 (50 U.S.C. 783(b)), or...

  7. 78 FR 37792 - Mario Julian Martinez-Bernache, Inmate Number #95749-279, CI Big Spring, Corrections Institution...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security Mario Julian Martinez-Bernache, Inmate... Order with the Under Secretary of Commerce for Industry and Security. The appeal must be filed within 45... the Internal Security Act of 1950 (50 U.S.C. 783(b)), or section 38 of the Arms Export Control Act (22...

  8. 78 FR 37789 - Juan Narcizo Oyervides-Campos, Inmate Number #86526-279, Correctional Institution Reeves I & II...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security Juan Narcizo Oyervides-Campos, Inmate... Order with the Under Secretary of Commerce for Industry and Security. The appeal must be filed within 45... the Internal Security Act of 1950 (50 U.S.C. 783(b)), or section 38 of the Arms Export Control Act (22...

  9. American Recovery and Reinvestment Act (ARRA) Federal Energy Management Program Technical Assistance Project 279 IMCOM-Southeast Region: Redstone Arsenal

    Energy Technology Data Exchange (ETDEWEB)

    Hatley, Darrel D.; Goddard, James K.

    2010-09-30

    Report describing a building retuning workshop presented to staff at Redstone Arsenal. Document includes issues identified during building audits and recommendations for future activities to reduce energy use at the site.

  10. Information, communication and anthropology of knowledge - DOI: 10.3395/reciis.v3i3.279en

    Directory of Open Access Journals (Sweden)

    Annette Béguin-Verbrugge

    2009-09-01

    Full Text Available In Lille, ICS (Information and Communication Sciences research revolves around the concept of anthropology of knowledge, and is strongly supported by textual sciences. Since the bond between communication and information was a core concern, the ideas of “text” or “enunciation” were used with a very broad meaning, according to a pragmatic approach that takes into consideration semiotic, social and technical contexts. At this moment of widespreadcomputerization, researchers become more centered on evolutionary rather than mediatic principles, always reaching new levels and acquiring new shapes. It is about studying the constitution, circulation and appropriation of knowledge under a perspective that is both systemic and phenomenologic.

  11. CONSIDERATIONS ON AMENDING AND SUPPLEMENTING LAW NO. 279/2005 ON APPRENTICESHIP AT WORK BY LAW NO. 179/2013

    Directory of Open Access Journals (Sweden)

    Brîndușa Oana Vartolomei

    2013-11-01

    Full Text Available Changes and additions made to the Law on apprenticeship contract and call into question the manner in which the Romanian legislator understands that give efficiency to this legal institutions. The scientific research aims to identify substantive changes made to the legal text by Law no. 179/2013 and to explore opportunities in the current context of national and European legislation.

  12. A Change in the Optical Polarization Associated with a Gamma-Ray Flare in the Blazar 3C 279

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A.A.

    2011-08-19

    It is widely accepted that strong and variable radiation detected over all accessible energy bands in a number of active galaxies arises from a relativistic, Doppler-boosted jet pointing close to our line of sight. The size of the emitting zone and the location of this region relative to the central supermassive black hole are, however, poorly known, with estimates ranging from light-hours to a light-year or more. Here we report the coincidence of a gamma ({gamma})-ray flare with a dramatic change of optical polarization angle. This provides evidence for co-spatiality of optical and {gamma}-ray emission regions and indicates a highly ordered jet magnetic field. The results also require a non-axisymmetric structure of the emission zone, implying a curved trajectory for the emitting material within the jet, with the dissipation region located at a considerable distance from the black hole, at about 10{sup 5} gravitational radii.

  13. 279. El derrame pericárdico postoperatorio en cirugía cardíaca: Incidencia e impacto en los resultados quirúrgicos

    Directory of Open Access Journals (Sweden)

    E. Sandoval

    2012-04-01

    Conclusión: La ecocardiografía es una exploración inocua que permite el diagnóstico rápido de DP potencialmente letal, que tiene un componente medicolegal. Debe realizarse a todo postoperado de cirugía cardíaca.

  14. Do educational requirements in vacancies match the educational attainments of job-holders? An analysis of web-based data for 279 occupations in the Czech Republic

    NARCIS (Netherlands)

    Tijdens, K.; Beblavý, M.; Thum-Thysen, A.

    2015-01-01

    European labour market policies aim to develop an early-warning tool for mismatches by monitoring job vacancies. Few studies have been able to measure these mismatches, among others because systematic information on educational requirements in vacancies is lacking. Our study explores mismatch for

  15. 78 FR 37790 - In the Matter of: Mario Salinas-Lucio, Inmate Number #61687-279, FCI La Tuna, Federal Corrections...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security In the Matter of: Mario Salinas-Lucio... Order with the Under Secretary of Commerce for Industry and Security. The appeal must be filed within 45....S.C. 793, 794 or 798; section 4(b) of the Internal Security Act of 1950 (50 U.S.C. 783(b)), or...

  16. HALİFE MU'TAZID DÖNEMİNDE (279-289/892-902 ABBSÃŽ-TOLUNOĞULLARI İLİŞKİLERİ

    Directory of Open Access Journals (Sweden)

    Saim YILMAZ

    2005-06-01

    Full Text Available This article aims to deal with Caliph al-Mu'tadid's political and military relations withTulunids, which constituted the base for his western policy. Al-Mu'tadid who reigned forapproximately ten years has made contracts with Tulunids two times. The first one was thecontract with Humarawayh right after al-Mu'tadid ascended the throne. Through thiscontract which made it possible to begin a new period in the political and military relationsbetween these states, Mousul and Djazira were secured again by Abbasids. As for theAbbasid rule of Kınnesrin, Awasım and Sughur regions, it was realized after the secondcontract with Harun b. Khumarawayh who was the fourth amir of Tulunids.

  17. Multibeam collection for TN279: Multibeam data collected aboard Thomas G. Thompson from 2012-04-26 to 2012-04-30, San Diego, CA to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. National Dam Inspection Program. Graceton Dam (NDI ID Number PA-279, DER ID Number 32-25) Ohio River Basin, Unnamed Tributary of Two Lick Creek, Indiana County, Pennsylvania. Phase I Inspection Report.

    Science.gov (United States)

    1980-06-18

    built for industrial water supply. Presently, the dam is reportedly serving a single customer, a farm approximately 1000 feet downstream from the dam. g...are available via a farm located about 1000 feet from the dam. 4.5 Evaluation. The visual observations indicate that the dam is essentially abandoned...I ? 4 . q tS~,edld .rytth eler. thn bdlar len er. S l t ecUce " l,*t ce-I’etel. I tec ,, h el ,.,r , u peer~n. e itt e le at teondetc.l and fDekr o Te

  19. Rapid variability of blazar 3C 279 during flaring states in 2013-2014 with joint FERMI-LAT, NuSTAR, swift, and ground-based multi-wavelength observations

    DEFF Research Database (Denmark)

    Hayashida, M.; Nalewajko, K.; Madejski, G. M.

    2015-01-01

    reaching the highest flux level measured in this object since the beginning of the Fermi mission, with F (E> 100 MeV) of 10-5 photons cm-2 s-1, and with a flux-doubling time scale as short as 2 hr. The y-ray spectrum during one of the flares was very hard, with an index of Γγ = 1.7 ± 0.1, which is rarely...... seen in flat-spectrum radio quasars. The lack of concurrent optical variability implies a very high Compton dominance parameter Lγ/Lsyn > 300. Two 1 day NuSTAR observations with accompanying Swift pointings were separated by 2 weeks, probing different levels of source activity. While the 0.5-70 keV X-ray......) extremely low jet magnetization with LB/Lj 10-4. ≲ - We also find that single-zone models that match the observed γ-ray and optical spectra cannot satisfactorily explain the production of X-ray emission....

  20. Macé, J. F. y Martínez Zauner, M. (Eds.. (2016. Pasado de violencia política. Memoria, discurso y puesta en escena. Madrid, MD: Anexo. 279 pp.

    Directory of Open Access Journals (Sweden)

    Maria P. Chiara Bianchini

    2016-06-01

    Full Text Available Pasado de violencia política es una obra colectiva, conformada por diez ensayos de jóvenes investigadores e investigadoras, procedentes de distintas disciplinas: historia, ciencias políticas, antropología, arqueología, filosofía, filología, historia del arte. Esta convergencia responde al carácter eminentemente interdisciplinario del ámbito al que adscribe el libro ―lo estudios de memoria― y de la Asociación que da vida a este proyecto, Memorias en Red. Sin embargo, en este caso, la recolección de ensayos no apunta a establecer comparaciones interdisciplinarias sobre algún objeto específico ―que es el enfoque más común de este tipo de obras― sino que su objetivo fundamental es discutir sobre la memoria en sí, sus dinámicas, funciones y manifestaciones. Persiguiendo este objetivo, el libro presenta un recorrido a través de objetos y contextos muy distintos: exhumaciones de fosas comunes, manifestaciones callejeras, ex centros de detención y tortura, prácticas de disidencia asociadas a la estética y la ética del cuerpo, procesamientos internacionales de derechos humanos y redes de activismo ciudadano. [...

  1. Diffusion equation representation of multiple-scatter gamma ray flux for 59.5, 122.1 and 279.2 keV point sources through water and graphite media

    International Nuclear Information System (INIS)

    Swarup, J.; Peshori, L.H.

    1986-01-01

    The transmitted γ fluxes for three sources, namely, 241 Am, 57 Co and 203 Hg, for the total spectrum as well as for the multiple-scatter peak, for different thicknesses of the water and graphite media have been represented by the diffusion formula, I=S/(4πDx esup(kx)), and compared with the earlier representation, I=I 0 esup(-ax). It is found that both the representations are equally good for the medium thicknesses taken in these measurements. (author)

  2. 2013 Review of Neutron and Non-Neutron Nuclear Data

    Science.gov (United States)

    Holden, N. E.

    2016-02-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  3. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  4. Decline in Reference Transactions with Few Questions Referred to Librarian when the Reference Desk is Staffed by a Paraprofessional. A Review of: Dinkins, D., & Ryan, S. M. (2010. Measuring referrals: The use of paraprofessionals at the reference desk. The Journal of Academic Librarianship, 36(4, 279-286.

    Directory of Open Access Journals (Sweden)

    Diana K. Wakimoto

    2011-03-01

    Full Text Available Objective — To determine the type and percentage of questions referred to a librarian by a paraprofessional (i.e., an individual without an MLIS staffing the reference desk, whether the percentage of referrals would decrease over time, and any consequences from having a paraprofessional rather than a librarian staffing the desk.Design — Quantitative analysis of reference desk transaction statistics.Setting — Reference desk at the main library of Stetson University, a private university in the United States of America with approximately 2,500 FTE (full-time equivalent students.Subjects — A total of 486 reference desk transactions recorded by a paraprofessional staffing the reference desk during the Fall and Spring semesters of the 2008-2009 academic year.Methods — The first year that he worked in the Library at Stetson University, a paraprofessional recorded all reference desk transactions during his shift from 10:00am to 12:00pm, four days a week, for the Fall and Spring semesters of the 2008-2009 academic year. This paraprofessional, with computer expertise, received "relatively minimal" (p. 281 training on "reference desk policies and procedures… the use of the catalogue and the subscription databases" (p. 281. For each transaction, the paraprofessional categorized the question as "direction, " "reference, " or "machine. " He was instructed to contact a librarian if he could not answer a reference question. The paraprofessional also completed a questionnaire regarding his level of comfort answering questions and his thoughts on the training at the end of his first year of staffing the reference desk.Main Results — In the Fall semester, 9.5% of all reference desk transactions were referred to a librarian. This decreased to 4.2% of the total transactions during the Spring semester. The percentage of reference questions referred to a librarian in the Fall semester was 21.9% and only 5.0% in the Spring semester. There was a 49.5% decrease in the number of reference desk transactions during the paraprofessional's hours on the desk compared to the previous year when the desk was staffed by professional librarians. Overall, reference desk transactions for all hours decreased 4.1% compared to the previous year. The results from the questionnaire on his experiences at the reference desk showed that the paraprofessional was satisfied with his training, comfortable with referring questions to the librarians, did not use the print reference collection extensively, thought the "interface for searching the library's catalogue/databases is dated at best" (p. 285, and felt that being close in age to many of the students was a disadvantage while working at the reference desk.Conclusion — The authors concluded that staffing the reference desk with a paraprofessional was a success and that the "referrals to librarians had been made appropriately and when necessary" (p. 285. The results corroborated previous studies that showed only a "small percentage of reference desk transactions would need to be referred to a librarian" (p. 285. In part, because of the success of staffing the desk with a paraprofessional, the authors suggest that reference desk staffing configurations at academic libraries should be reevaluated. Librarians freed from duties at the physical reference desk could use this time to "develop virtual reference services" and expand information literacy programs (p. 286.To explain the decrease in number of transactions during the paraprofessional's time on the reference desk, the authors surmised four possibilities: patrons' reluctance to ask questions of someone new on the desk, their dissatisfaction with the paraprofessional's answers, the similarity in age between the paraprofessional and the "age of the student population" (p. 284, or the librarians being more conscientious in tallying every transaction. However, the authors doubted that users perceived the paraprofessional's answers as "less satisfactory" as "patrons likely got a higher level of service on computer-related queries from

  5. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  6. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2011-05-27

    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  7. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available jct: 121 LKRWPGTSADLADAVHDGRLAMALVRLPVSDPALEIIEVMRERLGAAVPADRFAGRASVT 180 ... Query: 242 MLSPESPMHLYRLDNVVVLPVE...DFQPALVTGLLFRRDR 279 ... MLSPESPMHLYRLDNVVVLPVEDFQPALVTGLLFRRDR Sbjct: 241 MLSPESPMHLYRLDNVVVLPVEDFQPALVTGLLFRRDR 278

  8. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ongatus ... BP-1] ... Length = 279 ... Query: 25 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDLX 84 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDL ... Sbjct: 1 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPEAVDLA 60 ... Query: 145 CLGVMCPPTGLNA

  9. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ma and ... tau [Borrelia garinii PBi] ... Length = 279 ... Query: 22 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK 81 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARC...LNCKNGPTVMPCGECNNCK Sbjct: 1 ... QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARCLNCKNGPTVMPCGECNNCK 60 ... Quer

  10. Iron is a signal for Stenotrophomonas maltophilia biofilm formation, oxidative stress response, OMPs expression and virulence

    Directory of Open Access Journals (Sweden)

    Carlos Adrian Garcia

    2015-09-01

    Full Text Available Stenotrophomonas maltophilia is an emerging nosocomial pathogen. In many bacteria iron availability regulates, trough the Fur system, not only iron homeostasis but also virulence. The aim of this work was to assess the role of iron on S. maltophilia biofilm formation, EPS production, oxidative stress response, OMPs regulation, quorum sensing (QS, and virulence. Studies were done on K279 and its isogenic fur mutant F60 cultured in the presence or absence of dipyridyl. This is the first report of spontaneous fur mutants obtained in S. maltophilia. F60 produced higher amounts of biofilms than K279a and CLSM analysis demonstrated improved adherence and biofilm organization. Under iron restricted conditions, K279a produced biofilms with more biomass and enhanced thickness. In addition, F60 produced higher amounts of EPS than K279a but with a similar composition, as revealed by ATR-FTIR spectroscopy. With respect to the oxidative stress response, MnSOD was the only SOD isoenzyme detected in K279a. F60 presented higher SOD activity than the wt strain in planktonic and biofilm cultures, and iron deprivation increased K279a SOD activity. Under iron starvation, SDS-PAGE profile from K279a presented two iron-repressed proteins. Mass spectrometry analysis revealed homology with FepA and another putative TonB-dependent siderophore receptor of K279a. In silico analysis allowed the detection of potential Fur boxes in the respective coding genes. K279a encodes the QS diffusible signal factor (DSF. Under iron restriction K279a produced higher amounts of DSF than under iron rich condition. Finally, F60 was more virulent than K279a in the Galleria mellonella killing assay. These results put in evidence that iron levels regulate, likely through the Fur system, S. maltophilia biofilm formation, oxidative stress response, OMPs expression, DSF production and virulence.

  11. Bioeconomic synergy between tactics for insect eradication in the presence of Allee effects

    Czech Academy of Sciences Publication Activity Database

    Blackwood, J. C.; Berec, Luděk; Yamanaka, T.; Epanchin-Niell, R. S.; Hastings, A.; Liebhold, A. M.

    2012-01-01

    Roč. 279, č. 1739 (2012), s. 2807-2815 ISSN 0962-8452 Grant - others:National Science Foundation(US) EF-0553768 Institutional research plan: CEZ:AV0Z50070508 Keywords : Allee effect * eradication * management cost Subject RIV: EH - Ecology , Behaviour Impact factor: 5.683, year: 2012 http://rspb.royalsocietypublishing.org/content/279/1739/2807.full

  12. 78 FR 37520 - Order Denying Export Privileges

    Science.gov (United States)

    2013-06-21

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security Order Denying Export Privileges In the Matter of: Placido Molina, Jr., Inmate Number 90986-279, USP Pollock, U.S. Penitentiary, P.O. Box 2099... address at: Inmate Number 90986-279, USP Pollock, U.S. Penitentiary, P.O. Box 2099, Pollock, LA 71467, and...

  13. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 26; Issue 3. Issue front cover thumbnail. Volume 26, Issue 3. April 2003, pages 279-364. pp 279-281 Synthesis. An improved process for the synthesis of VPI-5 molecular sieve · N Venkatathri · More Details Abstract Fulltext PDF. VPI-5 was synthesized with lesser time ...

  14. A first record of Perccottus glenii (Perciformes: Odontobutidae) in the Danube River in Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Jurajda, Pavel; Vassilev, M.; Polačik, Matej; Trichkova, T.

    2006-01-01

    Roč. 58, č. 2 (2006), s. 279-282 ISSN 0324-0770 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : exotic species * Amur sleeper * Danube basin Subject RIV: EH - Ecology, Behaviour http://www.acta-zoologica-bulgarica.eu/downloads/acta-zoologica-bulgarica/2006/58-2-279-282.pdf

  15. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 32; Issue 4. Issue front cover thumbnail. Volume 32, Issue 4. August 2007, pages 279-478. Transportation Research - Safety and Sustainability. pp 279-283. Foreword · Dinesh Mohan · More Details Fulltext PDF. pp 285-292. Health burden of urban transport: The technical challenge.

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 26; Issue 3. Issue front cover thumbnail. Volume 26, Issue 3. April 2003, pages 279-364. pp 279-281 Synthesis. An improved process for the synthesis of VPI-5 molecular sieve · N Venkatathri · More Details Abstract Fulltext PDF. VPI-5 was synthesized with lesser time ...

  17. Environmental stability and seasonality of a harpacticoid copepod community

    Digital Repository Service at National Institute of Oceanography (India)

    Ansari, Z.A.; Parulekar, A.H.

    stream_size 8 stream_content_type text/plain stream_name Mar_Biol_115_279.pdf.txt stream_source_info Mar_Biol_115_279.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. Comparison of the long-term trends in stratospheric dynamics of four reanalyses

    Czech Academy of Sciences Publication Activity Database

    Kozubek, Michal; Križan, Peter; Laštovička, Jan

    2017-01-01

    Roč. 35, č. 2 (2017), s. 279-294 ISSN 0992-7689 R&D Projects: GA ČR(CZ) GA15-03909S; GA ČR(CZ) GA15-24688S Institutional support: RVO:68378289 Keywords : climatology * general circulation * middle atmosphere dynamic Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 1.610, year: 2016 http://www.ann-geophys.net/35/279/2017/angeo-35-279-2017.html

  19. Is Rorty a linguistic idealist?

    Czech Academy of Sciences Publication Activity Database

    Marvan, Tomáš

    2011-01-01

    Roč. 21, č. 3 (2011), s. 272-279 ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion

  20. Zelená kapalinová chromatografie pro jednoduché aplikace

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Kahle, Vladislav

    2015-01-01

    Roč. 109, č. 6 (2015), s. 470-474 ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : green analytical chemistry * green liquid chromatography * nanocolumns Subject RIV: CB - Analytical Chemistry , Separation Impact factor: 0.279, year: 2015

  1. Binge Drinking

    Medline Plus

    Full Text Available ... Binge Drinking Transcript High resolution [27.9 MB] Open Captioned [12.6 MB] Request a higher resolution ... INFO U.S. Department of Health & Human Services HHS/Open USA.gov TOP

  2. 78 FR 73552 - National Institute On Alcohol Abuse and Alcoholism; National Institute On Drug Abuse; and...

    Science.gov (United States)

    2013-12-06

    ..., National Institutes of Health, Shady Grove West, 9609 Medical Center Drive, Rockville, MD 20892, 240-276..., HHS). (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research...

  3. Die Nutzung extrinsischer und intrinsischer Qualitätssignale in Abhängigkeit vom Vorabwissen

    OpenAIRE

    Satzinger, Michaela

    2000-01-01

    Die Nutzung extrinsischer und intrinsischer Qualitätssignale in Abhängigkeit vom Vorabwissen / Heribert Gierl ; Michaela Satzinger. - In: Jahrbuch der Absatz- und Verbrauchsforschung. 46. 2000. S. 261-279

  4. Age-Adjusted Percentage of Adults Aged 18 Years or Older with Diagnosed Diabetes Performing Daily Self-Monitoring of ...

    Science.gov (United States)

    ... Years or Older with Diagnosed Diabetes Performing Daily Self-Monitoring of Blood Glucose, United States, 1994–2010 From ... years or older with diagnosed diabetes performing daily self-monitoring of blood glucose increased by 27.9 points, ...

  5. Self-assembled nanoparticles of glycol chitosan – Ergocalciferol succinate conjugate, for controlled release

    DEFF Research Database (Denmark)

    Quinones, Javier Perez; Gothelf, Kurt Vesterager; Kjems, Jørgen

    2012-01-01

    Glycol chitosan was linked to vitamin D2 hemisuccinate (ergocalciferol hemisuccinate) for controlled release through water-soluble carbodiimide activation. The resulting conjugate formed self-assembled nanoparticles in aqueous solution with particle size of 279 nm and ergocalciferol hemisuccinate...

  6. Chemicky aktivované a roubované substráty a jejich analýza

    Czech Academy of Sciences Publication Activity Database

    Benkocká, M.; Knapová, T.; Braborec, Jakub; Matoušek, J.; Černá, H.; Londesborough, Michael Geoffrey Stephen; Švorčík, V.; Kolská, Z.

    2015-01-01

    Roč. 109, č. 12 (2015), s. 960-964 ISSN 0009-2770 Institutional support: RVO:61388980 Keywords : surface activation * piranha solution * surface grafting Subject RIV: JJ - Other Materials Impact factor: 0.279, year: 2015

  7. Politicising EU Lawmaking? The Spitzenkandidaten Experiment as a Cautionary Tale

    Czech Academy of Sciences Publication Activity Database

    Goldoni, Marco

    2016-01-01

    Roč. 22, č. 3 (2016), s. 279-295 ISSN 1351-5993 Institutional support: RVO:68378122 Keywords : European Union * national parliaments * crisis Subject RIV: AG - Legal Sciences Impact factor: 1.427, year: 2016

  8. New Uropodine mites from Tanzania (Acari: Mesostigmata)

    Czech Academy of Sciences Publication Activity Database

    Kontschán, J.; Starý, Josef

    2013-01-01

    Roč. 3683, č. 3 (2013), s. 267-279 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Acari * Mesostigmata * Uropodina * new genus * new species * Tanzania Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  9. Intracranial EEG Connectivity Analysis and Result Imaging

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Petr; Janeček, Jiří; Jurák, Pavel; Halámek, Josef; Chládek, Jan; Brázdil, M.

    2012-01-01

    Roč. 2, č. 4 (2012), s. 275-279 ISSN 2010-3638 Institutional support: RVO:68081731 Keywords : Connectivity * Correlation * Intracranial EEG * Signal Processing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  10. Solvent effects on dopant-free pH-falling polymerization of aniline

    Czech Academy of Sciences Publication Activity Database

    Rakić, A. A.; Vukomanović, M.; Trifunovic, S.; Travas-Sejdic, J.; Chaudhary, O. J.; Horský, Jiří; Ciric-Marjanovic, G.

    2015-01-01

    Roč. 209, November (2015), s. 279-296 ISSN 0379-6779 Institutional support: RVO:61389013 Keywords : dopant-free template -free method * nanostructures * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.299, year: 2015

  11. Binge Drinking

    Medline Plus

    Full Text Available ... Health Our Cultures Are Our Source of Health (9:02) Our Cultures Are Our Source of Health (: ... Binge Drinking Binge Drinking Transcript High resolution [27.9 MB] Open Captioned [12.6 MB] Request a ...

  12. Zelená kapalinová chromatografie pro jednoduché aplikace

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Kahle, Vladislav

    2015-01-01

    Roč. 109, č. 6 (2015), s. 470-474 ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : green analytical chemistry * green liquid chromatography * nanocolumns Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.279, year: 2015

  13. Geographic distribution of Sarcoporia polyspora and S-longitubulata sp nov

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Vlasák, J.; Kinnunen, J.; Spirin, V.

    2015-01-01

    Roč. 130, č. 1 (2015), s. 279-287 ISSN 0093-4666 Institutional support: RVO:60077344 Keywords : Basidiomycota * brown rot fungi * molecular taxonomy Subject RIV: EF - Botanics Impact factor: 0.610, year: 2015

  14. South African Journal of Education - Vol 25, No 4 (2005)

    African Journals Online (AJOL)

    Effects of transformational leadership on human resource management in primary schools · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prakash Singh, Kari Lokotsch, 279-286 ...

  15. Variation in sperm morphology among Afrotropical sunbirds

    Czech Academy of Sciences Publication Activity Database

    Omotoriogun, T. C.; Laskemoen, T.; Rowe, M.; Albrecht, Tomáš; Bowie, R. C. K.; Sedláček, O.; Hořák, D.; Ottosson, U.; Lifjeld, J. T.

    2016-01-01

    Roč. 158, č. 1 (2016), s. 155-166 ISSN 0019-1019 Institutional support: RVO:68081766 Keywords : comparative analysis * Nectariniidae * phylogenetic signal * sperm competition * sperm size Subject RIV: EG - Zoology Impact factor: 2.279, year: 2016

  16. SERIES ARTICLES

    Indian Academy of Sciences (India)

    sriranga

    . The Rise of Modern Medicine. T Padmanabhan. REFLECTIONS. 279 Darshana Jolts. Sound: The Vehicle for Speech and Music. V V Raman. On a General. Method of Describing. Plane Curves of the nth degree by. Linkwork. A B Kempe.

  17. 78 FR 25460 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2013-05-01

    ... Contract Review--Recovery Warrior: Behavioral Activation Video Game for Substance Abuse (Topic 141). Date... Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS...

  18. 76 FR 23828 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-04-28

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis..., National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001 Executive Boulevard, Bethesda, MD....279, Drug Abuse and [[Page 23829

  19. Genetics Home Reference: Boucher-Neuhäuser syndrome

    Science.gov (United States)

    ... encoding gene in development and neurodevelopmental toxicity. Chem Biol Interact. 2016 Jul 28. pii: S0009-2797(16) ... degrade phosphatidylcholine to glycerophosphocholine in living cells. J Biol Chem. 2004 Jun 4;279(23):24024-33. ...

  20. Nezbývá než souhlasit!

    Czech Academy of Sciences Publication Activity Database

    Woitsch, Jiří

    2004-01-01

    Roč. 91, č. 3 (2004), s. 279-287 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z9058907 Keywords : social and cultural anthropology * historical anthropology * theory and methodology Subject RIV: AC - Archeology, Anthropology , Ethnology

  1. K významu drolerií ve středověkých rukopisech

    Czech Academy of Sciences Publication Activity Database

    Brodský, Pavel

    39 /2009/, - (2010), s. 279-286 ISSN 0585-5691 Institutional research plan: CEZ:AV0Z80770509 Keywords : illuminated manuscripts * Middle Ages * droleries Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Regulace vesnického osídlení a krajiny ve středověké a novověké severní Evropě

    Czech Academy of Sciences Publication Activity Database

    Dohnal, Martin

    2009-01-01

    Roč. 96, č. 3 (2009), s. 279-308 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : villages * historical geography * Scandinavia * middle ages * land settlement * landscape Subject RIV: AC - Archeology, Anthropology, Ethnology

  3. Binge Drinking

    Medline Plus

    Full Text Available ... children, parents, and public health professionals. More > Binge Drinking (4:23) Recommend on Facebook Tweet Share Compartir Binge Drinking Binge Drinking Transcript High resolution [27.9 MB] Open Captioned [ ...

  4. A prospective comparison of transvaginal ultrasonography and diagnostic hysteroscopy in the evaluation of patients with abnormal uterine bleeding: clinical implications

    NARCIS (Netherlands)

    Emanuel, M. H.; Verdel, M. J.; Wamsteker, K.; Lammes, F. B.

    1995-01-01

    We determined the diagnostic value of transvaginal ultrasonography for endometrial and intrauterine abnormalities in patients with abnormal uterine bleeding. Between June 1, 1992, and June 1, 1993, 279 consecutive patients underwent transvaginal ultrasonography. Findings were compared with the final

  5. 75 FR 3239 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-01-20

    ... Panel; Rapid Assessment for Drug Abuse and Risky Sex (5556). Date: February 16, 2010. Time: 1:30 p.m. to... . (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs...

  6. Sexual reproduction as a source of ploidy level variation in the model agamic complex of Pilosella bauhini and P. officinarum (Asteraceae: Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Rosenbaumová, R.; Krahulec, František

    2015-01-01

    Roč. 301, č. 1 (2015), s. 279-290 ISSN 0378-2697 Institutional support: RVO:67985939 Keywords : Pilosella * residual sexuality * hybridization Subject RIV: EF - Botanics Impact factor: 1.361, year: 2015

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    dimensional spatial inhomogeneity is parallel to the direction of propagation. pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  8. Lepingute suhtes kohaldatava seaduse küsimusi Euroopa Liidus : [bakalaureusetöö] / Tarvo Lindma ; Tartu Ülikool, õigusteaduskond ; juhendaja: Heiki Pisuke

    Index Scriptorium Estoniae

    Lindma, Tarvo, 1974-

    1996-01-01

    Lepinguõiguse unifitseerimine; Rooma 1980. a. lepingulistele suhetele kohaldatava seaduse konventsioon; ostu-müügileping (Haagi konventsioonid); esindus; usaldusleping; Beneluxi leping; konventsioonide kohaldatavus liikmesriikides. Vt. ka: Juridica (1996) nr. 6, lk. 275-279

  9. Meediareklaam taas kasvutrendis / Külli Esko

    Index Scriptorium Estoniae

    Esko, Külli

    2006-01-01

    TNS Emori reklaamipanuste monitooringu AdEx andmetel oli meediareklaamituru käive käesoleva aasta esimeses kvartalis 279 miljonit krooni, kasv võrreldes eelmise aastaga 17%. Diagramm: Meediatüüpide reklaamimahud

  10. The Spatial and Temporal Dynamics of Remotely-sensed Vegetation Phenology in Central Asia in the 1982-2011 Period

    Czech Academy of Sciences Publication Activity Database

    Bohovič, Roman; Dobrovolný, Petr; Klein, D.

    2016-01-01

    Roč. 2016, č. 49 (2016), s. 279-299 ISSN 2279-7254 Institutional support: RVO:67179843 Keywords : Phenology * vegetation dynamics * NDVI * GIMMS * Central Asia * SOS Subject RIV: EH - Ecology, Behaviour Impact factor: 1.533, year: 2016

  11. Quaestiones Mathematicae - Vol 26, No 3 (2003)

    African Journals Online (AJOL)

    On Carleson embeddings of star-invariant supspaces · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Joseph A. Cima, Alec L. Matheson, 279-288. http://dx.doi.org/10.2989/16073600309486059 ...

  12. Assessment of genetic diversity using RAPD analysis in a germplasm collection of sea buckthorn

    Czech Academy of Sciences Publication Activity Database

    Bartish, G.; Jeppsson, N.; Bartish, Igor; Nybom, H.

    2000-01-01

    Roč. 9, - (2000), s. 279-289 ISSN 1239-0992 Institutional research plan: CEZ:AV0Z6005908 Keywords : Hippophae rhamnoides * genetic diversity * hybridization Subject RIV: EF - Botanics Impact factor: 0.387, year: 2000

  13. South African Journal of Education - Vol 25, No 4 (2005)

    African Journals Online (AJOL)

    Effects of transformational leadership on human resource management in primary schools · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prakash Singh, Kari Lokotsch, 279-286 ...

  14. Catalogue of type specimens of beetles (Coleoptera)deposited in the National Museum, Prague, Czech Republic. Scarabaeoidea: Lucanidae and Passalidae

    Czech Academy of Sciences Publication Activity Database

    Bezděk, Aleš; Boucher, S.; Hájek, J.

    2017-01-01

    Roč. 57, č. 1 (2017), s. 279-293 ISSN 0374-1036 Institutional support: RVO:60077344 Keywords : catalogue * types * National Museum Prague Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.632, year: 2016

  15. Afican Health Sciences Vol 9 No 3.pmd

    African Journals Online (AJOL)

    Administrator

    [1.37 – 2.79], obesity OR=5.07 [2.79 - 9.21], female sex OR=1.44 [1.03 - 2.06], having attained tertiary education OR=1.91. [1.03 – 3.56], and older age OR=1.42 [1.27 ... among Makerere University students showed prevalence of systolic blood ..... Haslett C, Chilvers E, Boon A, College R. Davidson's Principles and Practice ...

  16. When Democracy Is Not Enough

    DEFF Research Database (Denmark)

    Charron, Nicholas

    2014-01-01

    Book review of: Making Democratic Governance Work: How Regimes Shape Prosperity, Welfare, and Peace. By Pippa Norris. New York: Cambridge University Press, 2012. 279 pp., $30.99 paperback (ISBN-13: 978-1-107-60269-4).......Book review of: Making Democratic Governance Work: How Regimes Shape Prosperity, Welfare, and Peace. By Pippa Norris. New York: Cambridge University Press, 2012. 279 pp., $30.99 paperback (ISBN-13: 978-1-107-60269-4)....

  17. A comparison of the impact of direct and indirect benefits of mating decisions in the rose bitterling (Rhodeus ocellatus)

    Czech Academy of Sciences Publication Activity Database

    Agbali, M.; Spence, R.; Reichard, Martin; Smith, C.

    2012-01-01

    Roč. 58, č. 4 (2012), s. 279-288 ISSN 1565-9801 R&D Projects: GA ČR GA206/09/1163 Institutional support: RVO:68081766 Keywords : bitterling * direct selection * indirect selection * mate choice * oviposition * Rhodeus ocellatus Subject RIV: EG - Zoology Impact factor: 0.444, year: 2012 http://www.tandfonline.com/doi/abs/10.1560/IJEE.58.4.279

  18. Estimation in continuous-time stochastic| volatility models using nonlinear filters

    DEFF Research Database (Denmark)

    Nielsen, Jan Nygaard; Vestergaard, M.; Madsen, Henrik

    2000-01-01

    Presents a correction to the authorship of the article 'Estimation in Continuous-Time Stochastic Volatility Models Using Nonlinear Filters,' published in the periodical 'International Journal of Theoretical and Applied Finance,' Vol. 3, No. 2., pp. 279-308.......Presents a correction to the authorship of the article 'Estimation in Continuous-Time Stochastic Volatility Models Using Nonlinear Filters,' published in the periodical 'International Journal of Theoretical and Applied Finance,' Vol. 3, No. 2., pp. 279-308....

  19. The complete mitochondrial genome of Eremias przewalskii (Squamata: Lacertidae).

    Science.gov (United States)

    Du, Yu; Qiu, Qing-Bo; Tong, Qing-Lin; Lin, Long-Hui

    2016-05-01

    In this paper, the complete mitochondrial genome of Eremias przewalskii (Squamata: Lacertidae) is reported, which is a circular molecule of 18,225 bp in size. The base composition of mtDNA is as follows: 30.3% A, 27.9% T, 27.9% C and 13.9% G. The genome consists of 13 protein coding genes, 22 transfer RNAs, 2 ribosomal RNA genes and one putative control region.

  20. 78 FR 54437 - Interagency Cooperation-Endangered Species Act of 1973, as Amended; Incidental Take Statements

    Science.gov (United States)

    2013-09-04

    .... 2001); Natural Res. Def. Council, Inc. v. Evans, 279 F. Supp. 2d 1129, 1184-85 (N.D. Cal. 2003); Ctr... demonstrated (i.e., the number of burrows affected or a quantitative loss of cover, food, water quality, or... Biological Diversity v. Salazar, 695 F.3d 893 (9th Cir. 2012); NRDC v. Evans, 279 F.Supp.2d 1129 (N.D. Cal...

  1. Role of Pakistan in War against Terrorism with Particular Emphasis on its Tribal Area

    Science.gov (United States)

    2009-01-01

    2.370 35.505 Fluorite 90 Mohmand North Wazirislan OraIQai Total 3.377 140’ 31,830 142,725 178,370 35.207 29,759 29,759 2.360 5.012 279 279 90 Source...building Total Rehabilitation of surface Irrigation schemes Rivertrulnl ng, flood protection Source: FATA Sustainable Development Plan (SDP) 2006-2015

  2. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  3. P2X1 Receptor Antagonists Inhibit HIV-1 Fusion by Blocking Virus-Coreceptor Interactions

    Science.gov (United States)

    Giroud, Charline; Marin, Mariana; Hammonds, Jason; Spearman, Paul

    2015-01-01

    ABSTRACT HIV-1 Env glycoprotein-mediated fusion is initiated upon sequential binding of Env to CD4 and the coreceptor CXCR4 or CCR5. Whereas these interactions are thought to be necessary and sufficient to promote HIV-1 fusion, other host factors can modulate this process. Previous studies reported potent inhibition of HIV-1 fusion by selective P2X1 receptor antagonists, including NF279, and suggested that these receptors play a role in HIV-1 entry. Here we investigated the mechanism of antiviral activity of NF279 and found that this compound does not inhibit HIV-1 fusion by preventing the activation of P2X1 channels but effectively blocks the binding of the virus to CXCR4 or CCR5. The notion of an off-target effect of NF279 on HIV-1 fusion is supported by the lack of detectable expression of P2X1 receptors in cells used in fusion experiments and by the fact that the addition of ATP or the enzymatic depletion of ATP in culture medium does not modulate viral fusion. Importantly, NF279 fails to inhibit HIV-1 fusion with cell lines and primary macrophages when added at an intermediate stage downstream of Env-CD4-coreceptor engagement. Conversely, in the presence of NF279, HIV-1 fusion is arrested downstream of CD4 binding but prior to coreceptor engagement. NF279 also antagonizes the signaling function of CCR5, CXCR4, and another chemokine receptor, as evidenced by the suppression of calcium responses elicited by specific ligands and by recombinant gp120. Collectively, our results demonstrate that NF279 is a dual HIV-1 coreceptor inhibitor that interferes with the functional engagement of CCR5 and CXCR4 by Env. IMPORTANCE Inhibition of P2X receptor activity suppresses HIV-1 fusion and replication, suggesting that P2X signaling is involved in HIV-1 entry. However, mechanistic experiments conducted in this study imply that P2X1 receptor is not expressed in target cells or involved in viral fusion. Instead, we found that inhibition of HIV-1 fusion by a specific P2X1

  4. Tanker Fuel Efficiency: Saving Through Receiver Fuel Planning

    Science.gov (United States)

    2014-06-13

    901059.70 $3,153,708.96 9660 10043 104.0% 29.1 239 13.2% F22 $3.50 455 2448.6 5.38 365462.69 $1,279,119.40 2441 2501 102.5% 33.7 56 12.3% USN $3.50...2246.7 4.59 335328.4 $1,173,649.25 11180.37 201.0 2400 3077 128.2% F22 127 27.9% 834 6.57 124477.6 $435,671.64 11800.02 70.7 611 727 119.0% USN 147

  5. Postreplication repair gap filling in an Escherichia coli strain deficient in dnaB gene product

    International Nuclear Information System (INIS)

    Johnson, R.C.

    1975-01-01

    Gaps in daughter-strand DNA synthesized after exposure of Escherichia coli E279 to ultraviolet light are filled during reincubation at 30 0 C for 20 min. Escherichia coli E279 is phenotypically DnaB - when incubated at 43 0 C. Cells incubated at 43 0 C were tested for their ability to complete postreplication repair gap filling. It is concluded that the dnaB gene product is essential for postreplication repair gap filling and that the inhibition seen is not initially the result of degradation

  6. Dynamic Failure of Integrated Durable Hot Structure for Space Access Vehicles

    Science.gov (United States)

    2009-08-01

    hopkinson pressure bar loaded instrumented charpy impact test ,” Engineering Fracture Mechanics, vol. 71, pp. 279–287, 2004. 111 [13] J. Dally and D...instrumented charpy impact test ,” Engineering Fracture Mechanics, vol. 71, pp. 279–287, 2004. Jiang, C.P. Zou, Z. Z. W. D. and Liu, Y. W., “A discussion...Determination of dynamic fracture-initiation toughness using a novel impact bend test procedure,” ASME J Pressure Vessel Technology, vol. 115, pp. 389

  7. Playing with partial knowledge in membrane systems: A logical approach

    DEFF Research Database (Denmark)

    Cavaliere, Matteo; Mardare, Radu Iulian

    2006-01-01

    M. Cavaliere, R. Mardare. Playing with partial knowledge in membrane systems: A logical approach. In Proc. of the seventh Workshop on Membrane Computing - At the Crossroads of Cell Biology and Computation (WMC2006), Lecture Notes in Computer Science 4361:279-297, Springer, 2006......M. Cavaliere, R. Mardare. Playing with partial knowledge in membrane systems: A logical approach. In Proc. of the seventh Workshop on Membrane Computing - At the Crossroads of Cell Biology and Computation (WMC2006), Lecture Notes in Computer Science 4361:279-297, Springer, 2006...

  8. Production of the Antibiotic Phenazine-1-Carboxylic Acid by Fluorescent Pseudomonas Species in the Rhizosphere of Wheat

    OpenAIRE

    Thomashow, Linda S.; Weller, David M.; Bonsall, Robert F.; Pierson, Leland S.

    1990-01-01

    Pseudomonas fluorescens 2-79 and P. aureofaciens 30-84 produce the antibiotic phenazine-1-carboxylic acid and suppress take-all, an important root disease of wheat caused by Gaeumannomyces graminis var. tritici. To determine whether the antibiotic is produced in situ, wheat seeds were treated with strain 2-79 or 30-84 or with phenazine-nonproducing mutants or were left untreated and then were sown in natural or steamed soil in the field or growth chamber. The antibiotic was isolated only from...

  9. Determining gold content

    International Nuclear Information System (INIS)

    Clayton, C.G.; Wormald, M.R.

    1981-01-01

    A method for determining the gold content of a material, comprises irradiating a body of the material with neutrons and determining the intensity of γ-rays having an energy of 279 keV arising from the reaction 179 Au(nn') 179 Au → 279 keV. The apparatus has means for conveying the materials past an assembly, which has a neutron source, which does not produce neutrons having sufficient energy to excite fast neutron reactions in non-auriferous constituents. (author)

  10. Church attendance and self-esteem among adolescents

    OpenAIRE

    Robbins, Mandy; Francis, Leslie J.; Williams, Emyr

    2007-01-01

    A total of 279 young people (123 males and 156 females) aged between 12 and 16 years of age attending one school in Wales completed the Coopersmith Self-Esteem Inventory alongside a measure of frequency of church attendance. The data indicate a small positive correlation (r = .18) between self-esteem and church attendance.

  11. 75 FR 26312 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-05-11

    .... 220 DTV DIRECTV. 279 DHI DR Horton Inc. 223 WMB Williams Cos Inc/The. 280 ADBE Adobe Systems Inc. 225.... Corp. 239 MJN Mead Johnson 289 CREE Cree Inc. Nutrition Co. 240 ALL Allstate Corp/The. 290 SIRI Sirius... national market system and, in general, to protect investors and the public interest, by identifying the...

  12. Assessing the Relationship between the Perceived Business ...

    African Journals Online (AJOL)

    Drawing from the three dimensions of entrepreneurial orientation (3D of EO) perspectives, the paper examined the entrepreneurial orientation and performance of small and medium enterprises (SMEs) vis-à-vis the environmental embeddedness. Using multi-stage sampling technique, a total 279 firms were selected for the ...

  13. 76 FR 4204 - Marketing Order Regulating the Handling of Spearmint Oil Produced in the Far West; Revision of...

    Science.gov (United States)

    2011-01-25

    ... 2009-2010 marketing year. When the revised total allotment base of 2,279,439 pounds is applied to the... Agricultural Marketing Service 7 CFR Part 985 Marketing Order Regulating the Handling of Spearmint Oil Produced...) Spearmint Oil for the 2010-2011 Marketing Year AGENCY: Agricultural Marketing Service, USDA. ACTION: Interim...

  14. Affected by Interstellar Scintillation?

    Indian Academy of Sciences (India)

    2007, Astron. Astrophys., 470, 83. Healey, S. E., Romani, R. W., Taylor, G. B. et al. 2007, Astrophys. J. Suppl., 171, 61. Kraus, A., Krichbaum, T. P., Wegner, R. et al. 2003, Astron. Astrophys., 401, 161. Lovell, J. E. J., Jauncey, D. L., Senkbeil, C. et al. 2007, ASPC, 365, 279. Ott, M., Witzel, A., Quirrenbach, A. et al. 1994, Astron.

  15. School Transitions among Youth at Risk for Substance Abuse.

    Science.gov (United States)

    Linney, Jean Ann; Brondino, Michael J.

    Using data from a larger intervention study of youth at risk for substance abuse, this study examined the impact of school transition on middle school and high school youth at high risk for alcohol and other drug abuse. Subjects for the larger study were 279 students from 30 secondary schools; approximately 10 students from each school were…

  16. Coping Skills Training with Adolescents at Risk for Substance Abuse.

    Science.gov (United States)

    Brondino, Michael J.; And Others

    Primary prevention programs aimed at helping adolescents develop personal and social coping skills have received empirical support as methods capable of reducing the incidence of substance use. This study examined the effectiveness of school-based coping skills training with adolescents at high-risk for substance abuse. Students (N=279) at 29…

  17. Determination of chromosomal ploidy in Agave ssp.

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... ces sscri200716). The authors wish to thank Associate. Professor Wenzhao Zhou for providing materials. REFERENCES. Agnieszka M, Hitoshi M, Keiichi O (2006). The origin of Darwin hybrid tulips analyzed by flow cytometry, karyotype analyses and genomic in situ hybridization. Euphytica, 151: 279-290.

  18. Newton\\'s equation of motion in the gravitational field of an oblate ...

    African Journals Online (AJOL)

    In this paper, we derived Newton's equation of motion for a satellite in the gravitational scalar field of a uniformly rotating, oblate spheriodal Earth using spheriodal coordinates. The resulting equation is solved for the corresponding precession and the result compared with similar ones. JONAMP Vol. 11 2007: pp. 279-286 ...

  19. Influence of Steroids on Oxidant Generation in Activated Human Granulocytes and Mononuclear Leukocytes

    Science.gov (United States)

    2003-07-01

    diurnal variation. J Clin Endocrinol Metabol 17:1051–1062, 1957. 30. Barroso-Aranda J, Schmid-Schonbein GW, Zweifach BW, Engler RL: Granu- locytes and...early immu- nologic effectors in hemorrhage-or endotoxemia -induced acute lung injury. Am J Physiol Lung Mol Physiol 279:L1137–L1145, 2000. 32. Weusten

  20. Dovedně zvládnutá přítomnost přináší příjemnou budoucnost: Sociální reprezentace smrti na Srí Lance u Theravádových mnichů a jejich podpůrců

    Czech Academy of Sciences Publication Activity Database

    Hytych, Roman

    2006-01-01

    Roč. 50, č. 3 (2006), s. 273-284 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : social representations * death * cultural psychology Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  1. The pig as an experimental model for clinical craniofacial research

    Czech Academy of Sciences Publication Activity Database

    Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

    2012-01-01

    Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

  2. Oxyhalogenidy v pitné vodě

    Czech Academy of Sciences Publication Activity Database

    Janda, V.; Kastl, G.; Pivokonský, Martin

    2015-01-01

    Roč. 109, č. 5 (2015), s. 360-363 ISSN 0009-2770 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : oxyhalides * drinking water * disinfectants Subject RIV: BK - Fluid Dynamics Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_05_360-363.pdf

  3. Download this PDF file

    African Journals Online (AJOL)

    Rickham PP. The swing of the pendulum: The indications for operating on meningomyelocele. Med J Aust 1976; 2: 743—746. 5. Lorber J. Results of treatment of myelomeningocele: An analy- sis of 524 unselected cases, with special reference to possible selection for treatment. Dev. Med. Child Neurol 1971; 13: 279—. 303.

  4. Changes in the moss layer in Czech fens indicate early succession triggered by nutrient enrichment

    Czech Academy of Sciences Publication Activity Database

    Hájek, M.; Jiroušek, M.; Navrátilová, Jana; Horodyská, E.; Peterka, T.; Plesková, Z.; Navrátil, J.; Hájková, Petra; Hájek, Tomáš

    2015-01-01

    Roč. 87, č. 3 (2015), s. 279-301 ISSN 0032-7786 R&D Projects: GA ČR GAP505/10/0638 Institutional support: RVO:67985939 Keywords : decline of threatened species * nutrients * vegetation change Subject RIV: EF - Botanics Impact factor: 2.711, year: 2015

  5. Reading habit and level of utilization of agricultural information ...

    African Journals Online (AJOL)

    Reading habit and level of utilization of agricultural information among farmers in Saki West Local Government Area of Oyo State. MF Siyanbola, PO Eniola, OA Olaniyi. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 275-279. http://dx.doi.org/10.4314/ijotafs.v1i3.

  6. 75 FR 63491 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2010-10-15

    ... Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Review Administrator, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 220...

  7. 77 FR 27075 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2012-05-08

    [email protected] . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel....D., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH...

  8. 77 FR 35411 - National Institute on Drug Abuse-Notice of Closed Meetings

    Science.gov (United States)

    2012-06-13

    ....nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel...: Lyle Furr, Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse...

  9. 77 FR 47654 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2012-08-09

    ... Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel Collaborative Clinical Trials in Drug Abuse--PAR 10- 099. Date: October 4, 2012. Time: 11 a.m. to...

  10. 78 FR 4421 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2013-01-22

    ... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001 Executive Blvd., Room 4238...

  11. 76 FR 11252 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2011-03-01

    ... Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS... invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Initial Review Group..., Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4245, MSC 9550, 6001...

  12. 75 FR 54348 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2010-09-07

    ....: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated: August... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse.... [email protected] . Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, NIDA B/Start...

  13. 75 FR 11552 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2010-03-11

    ... . (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs... unwarranted invasion of person al privacy. Name of Committee: National Institute on Drug Abuse Special..., Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room...

  14. 77 FR 27075 - National Institute on Drug Abuse Notice of Closed Meeting

    Science.gov (United States)

    2012-05-08

    ... Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Regulatory..., Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001...

  15. 77 FR 75179 - National Institute on Drug Abuse Notice of Closed Meetings

    Science.gov (United States)

    2012-12-19

    ... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse... Institute on Drug Abuse, NIH, Room 4228, MSC 9550, 6001 Executive Blvd., Bethesda, MD 20892-9550, (301) 451...

  16. 75 FR 71711 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2010-11-24

    .... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401, 6101 Executive Boulevard, Bethesda, MD 20892-8401...

  17. Ciguatera: the detection of neurotoxins in carnivorous reef fish from ...

    African Journals Online (AJOL)

    Two barracuda and one snapper tested positive for a sodium-channel activator, i.e. presumptive ciguatoxin, in the N2a assay. LC/MS analyses showed that only these three samples contained high-intensity peaks, with masses of 1 222 amu and 1 279 amu. These results represent the first analytical report indicating the ...

  18. Thermodynamic study of selected monoterpenes II

    Czech Academy of Sciences Publication Activity Database

    Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.

    2014-01-01

    Roč. 79, Dec (2014), 272-279 ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014

  19. Predicting Binge Drinking in College Students: Rational Beliefs, Stress, or Loneliness?

    Science.gov (United States)

    Chen, Yixin; Feeley, Thomas Hugh

    2015-01-01

    We proposed a conceptual model to predict binge-drinking behavior among college students, based on the theory of planned behavior and the stress-coping hypothesis. A two-wave online survey was conducted with predictors and drinking behavior measured separately over 2 weeks' time. In the Wave 1 survey, 279 students at a public university in the…

  20. Variation in coumarin accumulation by stem age in Dendrobium ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-06

    Mar 6, 2009 ... King RG, Delancy PM (1994). Confocal microscopy in pharmacological research. Trends Pharmacol. Sci, 15(8): 275-279. Perez-de-Luque A, Lozano MD, Cubero JI, Gonzalez-Melendi P,. Risueno MC, Rubiales D (2006). Mucilage production during the incompatible interaction between Orobanche crenata ...

  1. 75 FR 52932 - Notice of Commission Meeting and Public Hearing

    Science.gov (United States)

    2010-08-30

    ... existing 0.279 mgd discharge from the Chapel Hill WWTP to an unnamed tributary of Southampton Creek at River Mile 109.75-16.1-0.71-0.5 (Delaware River-Pennypack Creek-Southampton Creek-UNT). The Chapel Hill..., Kent County, Delaware. 14. Reading Area Water Authority--Maiden Creek, D-2010-009 CP-1. An application...

  2. Subjektivní zdraví: současný stav poznatků a výsledky dvou českých studií

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva; Kebza, V.

    2006-01-01

    Roč. 50, č. 1 (2006), s. 1-15 ISSN 0009-062X R&D Projects: GA ČR(CZ) GA406/03/1168 Institutional research plan: CEZ:AV0Z70250504 Keywords : Self-rated health * age * SES * physical activity * negative affectivity * resilience factors Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  3. Vibration analysis of a thin circular plate influenced by liquid/gas interaction in a cylindrical cavity

    Czech Academy of Sciences Publication Activity Database

    Gorman, D. G.; Lee, Ch. K.; Reese, J. M.; Horáček, Jaromír

    2005-01-01

    Roč. 279, 3-5 (2005), s. 601-618 ISSN 0022-460X R&D Projects: GA AV ČR IAA2076101 Institutional research plan: CEZ:AV0Z20760514 Keywords : vibroacoustics * ANSYS * fluid-structure interaction Subject RIV: BI - Acoustics Impact factor: 0.898, year: 2005

  4. ALEXANDRU POPA,UNTERSUCHUNGEN ZU DEN RÖMISCH-BARBARISCHEN KONTAKTEN ÖSTLICH DER RÖMISCHEN PROVINZ DACIA

    Directory of Open Access Journals (Sweden)

    Vasile Iarmulschi

    2016-11-01

    Full Text Available ABHNADLUNGEN ZUR VOR-UND FRÜHGESCHICHTE, ZUR KLASSICHEN UND PROVINZIAL-RÖMISCHEN ARCHÄOLOGIE UND ZUR GESCHICHTE DES ALTERTUMS, Band 47, Bonn 2015: Dr. Rudolf Habelt,279 pgs., 130 figures, 58 plates, ISBN 978-3-7749-3884-7

  5. An Exploratory Investigation of College Students' Views of Marketing Internships

    Science.gov (United States)

    Dommeyer, Curt J.; Gross, Barbara L.; Ackerman, David S.

    2016-01-01

    The authors explore college students' views of marketing internships. Students who completed a marketing internship (n = 279) were surveyed with a comprehensive questionnaire about their internship experiences, including what they liked and disliked, surprises, problems, and suggestions. Students also responded to 50 belief statements concerning…

  6. South African Journal of Education - Vol 26, No 2 (2006)

    African Journals Online (AJOL)

    Die ontwikkeling van lees- en speltoetse vir Sesotho-sprekende leerders in die grondslagfase · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marëtte Koen, Karel Esterhuyse, Mohlomi Moleleki, 267-279 ...

  7. Neudržitelná lehkost bytí v globálním vsádkovém bioreaktoru

    Czech Academy of Sciences Publication Activity Database

    Hanika, Jiří

    2015-01-01

    Roč. 109, č. 7 (2015), s. 515-517 ISSN 0009-2770 Institutional support: RVO:67985858 Keywords : global bioreactor * unsustainable growth * future of human race Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.279, year: 2015

  8. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Dhurairajan senthilnathan. Articles written in Journal of Chemical Sciences. Volume 123 Issue 3 May 2011 pp 279-290. Biocatalysis of azidolysis of epoxides: Computational evidences on the role of halohydrin dehalogenase (HheC) · Dhurairajan senthilnathan ...

  9. Perceived Health System Causes of Obstetric Fistula from Accounts ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    Health Policy Plan. 2009; 24: 279-88. 47. Otis KE and Brett JA. Barriers to hospital births: why do many Bolivian women give birth at home? Revista. Panamericana de Salud Pública. 2008; 24: 46-53. 48. Physicians for Human Rights. Deadly Delays: Maternal. Mortality in Peru. A Rights-Based Approach to Safe. Motherhood.

  10. The Missing Piece: A Sociological Autopsy of Firearm Suicide in the United States

    Science.gov (United States)

    Slater, Greta Yoder

    2011-01-01

    Social, economic, violence, political, and gun access predictors of suicide and gun suicide were examined via sociological autopsy. The model predicting suicide rates overall had the best results, X[superscript 2](9, N = 50) = 5.279 (CMIN, the goodness of fit statistic that represents the minimum discrepancy between the unrestricted sample…

  11. Criminal Law Study Guide

    Science.gov (United States)

    1989-03-01

    of a value of about $150.00, the property of Seaman E. Z. Marque , U.S. Navy. K. Instructions. See Military Judges’ Benchbook, DA Pam 27-9 (1982...at/on board (location)], on or about [date], unlawfully strike Thomas R. Sade , a child under the age of sixteen years, on the back with a whip. 5

  12. Criminal Law Study Guide. Revision

    Science.gov (United States)

    1990-05-01

    of Seaman E. Z. Marque , U.S. Navy. K. Instructions. See Military Judges’ Benchbook, DA Pam 27-9 (1982), Inst. No. 3-2. Notice that, similar to the...and personal jurisdiction data], did, [at/on board (location)], on or about [date], unlawfully strike Thomas R. Sade , a child under the age of

  13. 76 FR 61746 - Western Digital Technologies, Inc.: Hard Drive Development Engineering Group Irvine (Formerly at...

    Science.gov (United States)

    2011-10-05

    ... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...

  14. Theoretical Framework for the Design and Development of a Personal Identity Profile fostering Interpersonal Trust in Virtual Project teams

    NARCIS (Netherlands)

    Rusman, Ellen; Van Bruggen, Jan; Koper, Rob

    2007-01-01

    Rusman, E., Van Bruggen, J., & Koper, R. (2007). Theoretical framework for the design and development of a personal identity profile fostering interpersonal trust in virtual project teams. Proceedings of the 6th workshop on social intelligence design (pp. 279-286). July, 2-4, 2007, Trento, Italy,

  15. 882 lakes of the Cordillera Blanca: An inventory, classification, evolution and assessment of susceptibility to outburst floods

    Czech Academy of Sciences Publication Activity Database

    Emmer, Adam; Klimeš, Jan; Mergili, M.; Vilímek, V.; Cochachin, A.

    2016-01-01

    Roč. 147, DEC (2016), s. 269-279 ISSN 0341-8162 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67985891 ; RVO:67179843 Keywords : high mountain lakes * GLOFs * environmental change * natural dams * Huascarán NP Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.191, year: 2016

  16. TMFunction data: 2301 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available M483 ... Yes enzymatic activity; substrate binding; cross linking TM1 CD39 ... Grinthal A, Guidotti G Biochemist...ry. 2007 Jan 9;46(1):279-90 gel analysis ... Helix ... CD39; dynamic rotational motions; enzymatic activity; substrate binding; elasticity

  17. TMFunction data: 2300 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available L482 ... Yes enzymatic activity; substrate binding; cross linking TM1 CD39 ... Grinthal A, Guidotti G Biochemist...ry. 2007 Jan 9;46(1):279-90 gel analysis 30 cross linking rates (s) ... Helix ... CD39

  18. Sigmund Freud a první aplikace psychoanalýzy na literární dílo

    Czech Academy of Sciences Publication Activity Database

    Švanda, Martin

    2005-01-01

    Roč. 49, č. 3 (2005), s. 272-279 ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

  19. Comprehensive decay law for emission of charged particles and ...

    Indian Academy of Sciences (India)

    2014-04-07

    Apr 7, 2014 ... [4] H F Zhang and G Royer, Phys. Rev. C 77, 054318 (2008). [5] R Bonetti and Guglielmetti, Romanian Rep. Phys. 59, 301 (2007). [6] Y Ren and Z Ren, Phys. Rev. C 85, 044608 (2012). [7] G Royer, Nucl. Phys. A 848, 279 (2010). [8] M Balasubramaniam and N Arunachalam, Phys. Rev. C 71, 014603 (2005).

  20. Interaction between arbuscular mycorrhizal fungi and cellulose in growth substrate

    Czech Academy of Sciences Publication Activity Database

    Gryndler, Milan; Vosátka, Miroslav; Hršelová, Hana; Chvátalová, Irena; Jansa, Jan

    2002-01-01

    Roč. 19, - (2002), s. 279-288 ISSN 0929-1393 R&D Projects: GA ČR GA526/99/0895 Institutional research plan: CEZ:AV0Z5020903 Keywords : arbuscular mycorrhiza * sporulation * cellulose Subject RIV: EE - Microbiology, Virology Impact factor: 1.000, year: 2002

  1. Targeting Family Risk Factors in the Context of Treating Youth Depression: A Survey of Psychologists

    Science.gov (United States)

    Parra, Gilbert R.; Buckholdt, Kelly E.; Olsen, James P.; Jobe-Shields, Lisa; Davis, Genevieve L.; Gamble, Heather L.

    2011-01-01

    This study investigated the practices and perceptions of psychologists related to targeting family risk factors when treating youth depression. Participants were practicing psychologists recruited through the National Register of Health Service Providers in Psychology (N = 279). Psychologists completed a brief anonymous survey about addressing…

  2. Temperature and magnetic field dependence of the soft X-ray magnetic circular dichroism intensity for the Mn-L3 edge of MnFeP0.78Ge0.22

    NARCIS (Netherlands)

    Tsunekawa, M.; Imada, S.; Matsumoto, A.; Yamasaki, A.; Suga, S.; Schmid, B.; Higashimichi, H.; Hattori, Y.; Nakamura, T.; Brück, E.

    2007-01-01

    Soft X-ray magnetic circular dichroism (XMCD) measurements were performed at the L3 edge of manganese for MnFeP0.78Ge0.22 at 290 and 279 K. Temperature and magnetic field dependence of the XMCD intensity was clearly observed, which is consistent with that of the magnetization measurements as

  3. Geometrical constraints in the scaling relationships between genome size, cell size and cell cycle length in herbaceous plants

    Czech Academy of Sciences Publication Activity Database

    Šímová, I.; Herben, Tomáš

    2012-01-01

    Roč. 279, č. 1730 (2012), s. 861-875 ISSN 0962-8452 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985939 Keywords : nuclear DNA content * growtht-rate * metabolic-rate Subject RIV: EF - Botanics Impact factor: 5.683, year: 2012

  4. Measuring Leader Attributes in the Army Reconnaissance Course

    Science.gov (United States)

    2016-01-01

    derived from research by Nielsen and Mack (1994) and Tognazzini (2003) that represent tool usability . Collectively, these heuristics or design...environments: The SPOTLITE method. Military Psychology, 25, 266-279. Nielsen , J., & Mack, R. L. (1994). Usability Inspection Methods. New York...13 APPENDICES APPENDIX A: STANDARD USABILITY QUESTIONNAIRE FOR THE LEADER

  5. Vrstevnická konformita jako faktor rizikového chování mladistvých: struktura, zdroje, dopady

    Czech Academy of Sciences Publication Activity Database

    Jelínek, Martin; Květon, Petr; Vobořil, Dalibor; Blatný, Marek; Hrdlička, M.

    2006-01-01

    Roč. 50, č. 5 (2006), s. 393-404 ISSN 0009-062X R&D Projects: GA AV ČR(CZ) IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : peer conformity * peer pressure * parenting styles Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  6. Ignition, Combustion and Tuning of Nanocomposite Thermites

    Science.gov (United States)

    2010-01-01

    oxygen and nitrogen, the thermal conductivity as a function of temperature is given in Incropera and DeWitt144 up to 3000 K, and we extrapolate it...Meeting, 1998; 1998. 143. M. L. Hobbs; M. R. Baer; B. C. McGee, Propellants, Explosives, Pyrotechnics 1999, 24, (5), 269-279. 144. F. P. Incropera ; D

  7. How do type and size of natural environments relate to physical activity behavior?

    NARCIS (Netherlands)

    Jansen, F. M.; Ettema, D. F.; Kamphuis, C. B.M.; Pierik, Frank H.; Dijst, M. J.

    2017-01-01

    Natural environments (NE) are promoted as places that support physical activity (PA), but evidence on PA distribution across various types and sizes of NE is lacking. Accelerometers and GPS-devices measured PA of Dutch general population adults aged 45–65 years (N=279). Five NE types were

  8. Bringing Benefits and Warding off Blights in Due Commandment (Analytic Study Compared with the Jordanian Law)

    Science.gov (United States)

    Al Etoum, Niebal Mohd Ibrahim; Mowafi, Hanan Sami Mohammad; Al Zubaidi, Faraj Hamad Salem

    2016-01-01

    The study aims to highlight the benefits and blights of the due commandment (intestate law) under Jordanian law for the year (2010) in the article (279). The study came in two sections, the first one dealt with the concept of due commandment, its legitimacy, verdict and terms; in the second section, I've dealt with the persons entitled to due…

  9. G A Adebayo

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. G A Adebayo. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  10. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. O akinlade. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. L A Hussain. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  12. The dynamics of age structures on Agropyron michnoi and Leymus ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-30

    Nov 30, 2011 ... Abstracta Botanica, 19: 115–127. Preston KA (1998). Architectural constraint on flower number in a photoperiodic annual. Oikos, 81: 279-288. Silva JF, Raventos J, Caswell H (1991). Fire and fire exclusion effects on the growth and survival of two savanna grasses. Acta Oecologica,. 11: 783-800. Silvertown ...

  13. 75 FR 77051 - Rules Implementing Amendments to the Investment Advisers Act of 1940

    Science.gov (United States)

    2010-12-10

    ...) pension consultants; (iii) investment advisers affiliated with an adviser registered with the Commission... Exchange Commission 31 Parts 275 and 279 Rules Implementing Amendments to the Investment Advisers Act of... Implementing Amendments to the Investment Advisers Act of 1940 AGENCY: Securities and Exchange Commission...

  14. Surface Collisions of the Acetonitrile Molecular Ion: Evidence for Isomerization of CD3CN center dot+ to the Ketenimine Cation CD2=C=ND center dot+

    Czech Academy of Sciences Publication Activity Database

    Mair, C.; Roithová, Jana; Fedor, J.; Lezius, M.; Herman, Zdeněk; Märk, T. D.

    223-224, 1/3 (2003), s. 279-290 ISSN 1387-3806 R&D Projects: GA ČR GA203/00/0632 Institutional research plan: CEZ:AV0Z4040901 Keywords : acetonitrile cation * surface reactions * isomerization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.361, year: 2003

  15. Trajectories of Behavioral Adjustment Following Early Placement in Foster Care: Predicting Stability and Change over 8 Years

    Science.gov (United States)

    Proctor, Laura J.; Skriner, Laura C.; Roesch, Scott; Litrownik, Alan J.

    2010-01-01

    Objective: To identify trajectories of behavioral adjustment from age 6 through 14 years for youth placed in early foster care, and to examine links between trajectories and early cognitive ability and social competence, caregiver stability, and frequency, timing, and type of maltreatment. Method: Participants were 279 youth from the Southwest…

  16. Low methanol-permeable polyaniline/Nafion composite membrane for direct methanol fuel cells

    Czech Academy of Sciences Publication Activity Database

    Wang, C. H.; Chen, C. C.; Hsu, H. C.; Du, H. Y.; Chen, C. P.; Hwang, J. Y.; Chen, L. C.; Shih, H. C.; Stejskal, Jaroslav; Chen, K. H.

    2009-01-01

    Roč. 190, č. 2 (2009), s. 279-284 ISSN 0378-7753 R&D Projects: GA AV ČR IAA4050313 Institutional research plan: CEZ:AV0Z40500505 Keywords : DMFC * methanol crossover * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.792, year: 2009

  17. PŘÍRODNÍ LÁTKY KYSELÉ CHUTI

    Czech Academy of Sciences Publication Activity Database

    Lapčík, O.; Wimmer, Zdeněk; Opletal, L.; Moravcová, J.; Čopíková, J.; Drašar, P.

    2015-01-01

    Roč. 109, č. 7 (2015), s. 488-491 ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : natural compound * sour taste/perception * food supplement Subject RIV: GM - Food Processing Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_07_488-491.pdf

  18. Data of evolutionary structure change: 1BRYY-1RTCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BRYY-1RTCA 1BRY 1RTC Y A --------DVSFRLSGATTTSYGVFIKNLREAL-PYERKVYNIPLLRSS--ISGSGRYTLLHLTNYADETISVAVDVTNVYIMGYLAGDVSYF...48 1RTC A 1RTCA THR CA 279 1RTC A 1RTCA...ryChain> 1RTC A 1RTCA SALYYYSTGGT...285 LEU CA 308 1RTC A 1RTCA

  19. Dislocation structures, effective and internal stresses of cyclic stained ferritic stainless steel

    Czech Academy of Sciences Publication Activity Database

    Petrenec, Martin; Polák, Jaroslav

    2001-01-01

    Roč. 72, č. 279 (2001), s. 129-133 ISSN 1429-6055. [Medzynarodowe Sympozjum - Metody oceny struktury oraz wlasnosci materialów i wyrobów /16./. Komorní Lhotka, 11.12.2001-13.12.2001] Institutional research plan: CEZ:AV0Z2041904 Keywords : dislocation * cyclicling * stresses Subject RIV: JL - Materials Fatigue, Friction Mechanics

  20. JPRS Report, Soviet Union, World Economy & International Relations, No. 3, March 1987

    Science.gov (United States)

    1987-06-15

    diseases (A. Sasson , "Biotechnologies: Challenges and Promises," Paris, 1984, p 279). In the United States altogether 46 percent of biotechnology firms...Currency-Finance and Credit Relations," Moscow, 1984, p 212. 2. See MEMO No 11, 1981, p 98. 3. Quoted from F. David , "Le commerce international a

  1. Environmental Education in Macedonian Schools: A Comparative Analysis of Textbooks

    Science.gov (United States)

    Srbinovski, Mile

    2013-01-01

    The purpose of this article is to describe and discuss an analysis of the extent to which environmental issues are addressed in the textbooks in the schools of the Republic of Macedonia. Research has analyzed a range of textbooks (279) published in the past 15 years. Our fundamental conclusion is that the inclusion of environmental issues in the…

  2. Je mihule ukrajinská ještě součástí naší fauny?

    Czech Academy of Sciences Publication Activity Database

    Hanel, L.; Lusk, Stanislav

    2013-01-01

    Roč. 61, č. 6 (2013), s. 279-281 ISSN 0044-4812 Institutional support: RVO:68081766 Keywords : lamprey Subject RIV: EG - Zoology http://ziva.avcr.cz/2013-6/je-mihule-ukrajinska-jeste-soucasti-nasi-fauny.html

  3. Elastic properties of granulite facies rocks of Mahabalipuram, Tamil ...

    Indian Academy of Sciences (India)

    and density, and velocity and attenuation properties of the rocks. The acidic granulites show lower velocities and higher attenuation than the intermediate and basic granulites. The average values of the Poisson's ratio of acidic, intermediate and basic granulites have been found to be 0.210, 0.241 and 0.279 respectively.

  4. Sex-specific cardiovascular structure and function in heart failure with preserved ejection fraction

    NARCIS (Netherlands)

    Gori, Mauro; Lam, Carolyn S. P.; Gupta, Deepak K.; Santos, Angela B. S.; Cheng, Susan; Shah, Amil M.; Claggett, Brian; Zile, Michael R.; Kraigher-Krainer, Elisabeth; Pieske, Burkert; Voors, Adriaan A.; Packer, Milton; Bransford, Toni; Lefkowitz, Martin; McMurray, John J. V.; Solomon, Scott D.

    Aims Women are more likely to develop heart failure with preserved ejection fraction (HFpEF) than men. We studied the relationship between sex and cardiovascular structure and function in patients with HFpEF. Methods and resultsThe study included 279 participants from the PARAMOUNT study (57% women)

  5. Are You Thinking about Suicide? How to Stay Safe and Find Treatment

    Science.gov (United States)

    ... care physician. Mayo Clinic Proceedings. 2011;8:792. Suicide prevention. Depression and Bipolar Support Alliance. http://www.dbsalliance.org/ ... of exercise on suicide risk: Examining pathways through depression, PTSD, and ... of veterans. Suicide and Life-Threatening Behavior. 2013;43:279. Mok ...

  6. Assay of Serum Gonadotropic Hormones during Estrous Cycle in ...

    African Journals Online (AJOL)

    ml versus 4.65 ng/ml for the non-supplemented animals (p<0.05). The same pattern was observed for follicle stimulating hormone (FSH) (2.94 miu/ml versus 2.79 miu/ml) (p<0.05). The highest values of LH were observed during the period of ...

  7. A Review on the Effects of Supercritical Carbon Dioxide on Enzyme Activity

    Czech Academy of Sciences Publication Activity Database

    Wimmer, Zdeněk; Zarevúcka, Marie

    2010-01-01

    Roč. 11, č. 1 (2010), s. 233-253 E-ISSN 1422-0067 R&D Projects: GA MŠk 2B06024 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Keywords : enzyme * supercritical carbon dioxide * synthesis Subject RIV: CC - Organic Chemistry Impact factor: 2.279, year: 2010

  8. Over-expression of the transcription factor HlMYB3 in transgenic hop (Humulus lupulus L. cv. Tettnanger) modulates the expression of genes involved in the biosynthesis of flavonoids and phloroglucinols

    Czech Academy of Sciences Publication Activity Database

    Gatica-Arias, A.; Stanke, M.; Häntzschel, K.R.; Matoušek, Jaroslav; Weber, G.

    2013-01-01

    Roč. 113, č. 2 (2013), s. 279-289 ISSN 0167-6857 R&D Projects: GA ČR GA521/08/0740 Institutional support: RVO:60077344 Keywords : Hop * R2R3 MYB transcription factors * Genetic transformation * Flavonoid biosynthesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.612, year: 2013

  9. Gemeenskapsbetrokkenheid ter bevordering van onderwys in skole

    African Journals Online (AJOL)

    Marks ML 1997. Consulting in mergers and acquisitions. Journal of Organisational. Change Management, 10:267-279. National Plan for Higher Education (NPHE) 2001. Pretoria: Ministry of Education. O'Flaherty C & Conway N 1990. Merging icebergs. Marketing Mix, 8:24-26. Pereira P 1999. Winds of change blow Asmal's ...

  10. Fetal and postnatal development of T-lymphocyte subpopulations

    Czech Academy of Sciences Publication Activity Database

    Matalová, Eva; Kovářů, F.; Kovářů, H.; Fišerová, Anna; Zelníčková, P.; Landa, L.

    2002-01-01

    Roč. 71, č. 4 (2002), s. 279-282 ISSN 0001-7213 R&D Projects: GA ČR GA304/01/0850; GA AV ČR KSK6005114 Keywords : prenatal ontogenesis * pig foetuses * lymphatic organs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.370, year: 2002

  11. ASSESSMENT OF CLINICAL CASE-DEFINITION FOR HIV/AIDS IN ...

    African Journals Online (AJOL)

    hi-tech

    2004-05-05

    May 5, 2004 ... Studied criteria*. Positive. Negative. Yes. 173. 12. 185. No. 300. 116. 416. 473. 128. 601. * Two major criteria and one minor criterion or a diagnosis of Kaposi's sarcoma or cryptococcal meningitis. Sensitivity= 36.6%, Specificity= 90.6%, Positive predictive value = 93.5%, Negative predictive value = 27.9% ...

  12. High School Students' Approaches to Learning Physics with Relationship to Epistemic Views on Physics and Conceptions of Learning Physics

    Science.gov (United States)

    Chiou, Guo-Li; Lee, Min-Hsien; Tsai, Chin-Chung

    2013-01-01

    Background and purpose: Knowing how students learn physics is a central goal of physics education. The major purpose of this study is to examine the strength of the predictive power of students' epistemic views and conceptions of learning in terms of their approaches to learning in physics. Sample, design and method: A total of 279 Taiwanese high…

  13. Radikálová syntéza nukleových bází z formamidu v impaktním plazmatu

    Czech Academy of Sciences Publication Activity Database

    Ferus, Martin; Knížek, Antonín; Šponer, Jiří; Šponer, Judit E.; Civiš, Svatopluk

    2015-01-01

    Roč. 109, č. 6 (2015), s. 406 -414 ISSN 0009-2770 Institutional support: RVO:61388955 ; RVO:68081707 Keywords : Formamide * Laser-induced dielectric breakdown * Nucleobases Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.279, year: 2015

  14. Early Detection of At-Risk Undergraduate Students through Academic Performance Predictors

    Science.gov (United States)

    Rowtho, Vikash

    2017-01-01

    Undergraduate student dropout is gradually becoming a global problem and the 39 Small Islands Developing States (SIDS) are no exception to this trend. The purpose of this research was to develop a method that can be used for early detection of students who are at-risk of performing poorly in their undergraduate studies. A sample of 279 students…

  15. Participation in organized leisure-time activities and risk behaviors in Czech adolescents

    NARCIS (Netherlands)

    Badura, Petr; Sigmundova, Dagmar; Sigmund, Erik; Geckova, Andrea Madarasova; van Dijk, Jitse P.; Reijneveld, Sijmen A.

    The study aimed to assess the associations between participation in organized leisure-time activities (OLTA) and risk behaviors, and whether the associations differed by gender, age, and pattern of OLTA involvement. Data from the 2013/2014 Health Behaviour in School-Aged Children study on 10,279

  16. Nález barokního kordu z Habřiny na Jaroměřsku ve východních Čechách

    Czech Academy of Sciences Publication Activity Database

    Žákovský, Petr; Drnovský, P.

    2017-01-01

    Roč. 42, č. 1 (2017), s. 279-295 ISSN 0231-5823 Institutional support: RVO:68081758 Keywords : rapier * finds from watercourses * Thirty Years' War * Passau * Solingen Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://hdl.handle.net/11222.digilib/136545

  17. The sub-arborescent lycopsid Omphalophloios feistmantelii (O. Feistmantel) comb. nov emend. from the Middle Pennsylvanian of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bek, Jiří; Opluštil, S.; Drábková, J.; Pšenička, J.

    2015-01-01

    Roč. 90, č. 1 (2015), s. 227-279 ISSN 1214-1119 R&D Projects: GA ČR GAP210/12/2053 Institutional support: RVO:67985831 Keywords : lycopsids * in situ spores * Omphalophloios * Sporangiostrobus * cuticle analysis * densospores * Superbisporites * palaeoecology * Pennsylvanian Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.700, year: 2015

  18. The Relationship between Adolescent Depression and a History of Sexual Abuse

    Science.gov (United States)

    Buzi, Ruth S.; Weinman, Maxine L.; Smith, Peggy B.

    2007-01-01

    The purpose of this study was to examine the occurrence of depression among adolescents attending family planning clinics, and to determine the relationship among depression, a history of sexual abuse, and other risk behaviors. The sample consisted of 279 minority females. Results of the study indicated that 40 adolescents (14.3%) scored at or…

  19. Can a Canine Companion Modify Cardiac Autonomic Reactivity and Tone in PTSD

    Science.gov (United States)

    2016-01-01

    without pets (Allen, Blascovich, & Mendes, 2002) and extrapolating to a 4-5 BPM decrease in basal HR believed to be cardiologically significant (Jouven...American Journal of Cardiology , 103(2), 279-283. doi:S0002- 9149(08)01585-3 Jouven, X., Zureik, M., Desnos, M., Guerot, C., & Ducimetiere, P. (2001

  20. Spiritualita jako klíč k osobnosti a lidským vztahům

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2006-01-01

    Roč. 50, č. 2 (2006), s. 119-137 ISSN 0009-062X R&D Projects: GA ČR GA406/05/0940 Institutional research plan: CEZ:AV0Z70250504 Keywords : spiritualiy * personality * human relationships Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  1. Tropical Trametes lactinea is widely distributed in the eastern USA

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Kout, J.

    2011-01-01

    Roč. 115, č. 1 (2011), s. 271-279 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Keywords : Basidiomycota, USA new record, taxonomy * USA new record * taxonomy Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  2. Hidden Markov model-based approach for generation of Pitman ...

    Indian Academy of Sciences (India)

    Speech is one of the most basic means of human communication. ... human beings is carried out with the aid of communication and has facilitated the development ... Hidden Markov model-based approach for generation of PSL symbols. 279. Table 1. PSL basic strokes and English consonants. English consonant.

  3. Temporal variation of trace elements in waters polluted by municipal solid waste landfill leachate

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Matura, M.; Skalková, M.; Šebek, O.; Bezdička, Petr

    2008-01-01

    Roč. 80, č. 3 (2008), s. 274-279 ISSN 0007-4861 R&D Projects: GA AV ČR KJB3111402 Institutional research plan: CEZ:AV0Z40320502 Keywords : trace elements * landfill leachate * temporal variation Subject RIV: DD - Geochemistry Impact factor: 0.609, year: 2008

  4. Caloplace subalpina and C. thracopontica, two new saxicolous species from the Caloplaca cerina group (Teloschistales)

    Czech Academy of Sciences Publication Activity Database

    Vondrák, J.; Šoun, J.; Hrouzek, Pavel; Říha, P.; Kubásek, J.; Palice, Zdeněk; Søchting, U.

    2008-01-01

    Roč. 40, č. 5 (2008), s. 375-386 ISSN 0024-2829 R&D Projects: GA AV ČR(CZ) KJB601410701 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60050516 Keywords : black sea * europe * lichen ized fungi Subject RIV: EE - Microbiology, Virology Impact factor: 1.279, year: 2008

  5. Ethnic identity and acculturation of Turkish-Bulgarian adolescents

    NARCIS (Netherlands)

    Dimitrova, R.; Bender, M.; Chasiotis, A.; van de Vijver, A.J.R.

    2013-01-01

    We investigated associations of ethnic identity, acculturation orientations, and acculturation outcomes (psychological well-being and socio-cultural adjustment) in a sample of 279 Turkish-Bulgarian adolescents through self-reports and parent reports. This group has a long history of discrimination

  6. Monoclonal antibodies specific for the empty conformation of HLA-DR1 reveal aspects of the conformational change associated with peptide binding

    Czech Academy of Sciences Publication Activity Database

    Carven, G. J.; Chitta, S.; Hilgert, Ivan; Rushe, M. M.; Baggio, R. F.; Palmer, M.; Arenas, J. E.; Strominger, J. L.; Hořejší, Václav; Santambrogio, L.; Stern, L. J.

    2004-01-01

    Roč. 279, č. 16 (2004), s. 16561-16570 ISSN 0021-9258 R&D Projects: GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5052915 Keywords : immunoreceptor * signalling Subject RIV: EC - Immunology Impact factor: 6.355, year: 2004

  7. Marker-trait association study for protein content in chickpea (Cicer ...

    Indian Academy of Sciences (India)

    2015-06-08

    Jun 8, 2015 ... programme for nutritional quality improvement. [Jadhav A. A., Rayate S. J., Mhase L. B., Thudi M., Chitikineni A., Harer P. N., Jadhav A. S., Varshney R. K. and Kulwal P. L. 2015. Marker-trait association study for protein content in chickpea (Cicer arietinum L.). J. Genet. 94, 279–286]. Introduction. Chickpea ...

  8. Fine-structure energy levels, oscillator strengths and lifetimes of ...

    Indian Academy of Sciences (India)

    with the experimental results compiled in the NIST Data Base. Many new lines have been ... As accurate atomic data are needed for the interpretation of spectra observed by space mission in terms of physical ..... 279–284. [2] The Opacity Project Team, The Opacity Project (Institute of Physics Publishing,. Bristol, 1995) vol. 1.

  9. Visualization and mass transfer with a bistable two-slot impinging jet

    Czech Academy of Sciences Publication Activity Database

    Trávníček, Zdeněk; Maršík, František

    2003-01-01

    Roč. 6, č. 4 (2003), s. 337-441 ISSN 1343-8875 R&D Projects: GA AV ČR IAA2076203 Institutional research plan: CEZ:AV0Z2076919 Keywords : visualization * mass transfer * impinging jet Subject RIV: BK - Fluid Dynamics Impact factor: 0.279, year: 2002

  10. TMFunction data: 1539 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available s Human Mueckler M, Makepeace C. J Biol Chem. 2004 Mar 12;279(11):10494-9 Specific activity ... GTR1_HUMAN (P11166) Helix ... cysteine; transmembrane helix; sugar permeation pathway ... T318C ... yes reduced transport activity TM8 Glucose transporter 1; GLUT1 Homo sapien

  11. Computer Use as a Tool in Vocational Preparation and Adult Basic Educational Curriculums.

    Science.gov (United States)

    Harmon, Marguerite; Frantz, Matthew

    A 3-year project has helped deaf workers and students acquire basic computer operating skills. Local labor market aspects were assessed through an Index Rating System with 113 different employers and 279 job profiles. Research was conducted regarding academic achievement for the hearing impaired and adult basic education population. Specific…

  12. Beyond HDL-cholesterol increase: phospholipid enrichment and shift from HDL3 to HDL2 in alcohol consumers

    DEFF Research Database (Denmark)

    Schäfer, C.; Parlesak, Alexandr; Eckoldt, J.

    2007-01-01

    . In 279 healthy men, alcohol and nutrient consumption were evaluated. Groups 1 (n=62), 2 (n=172), and 3 (n=45) comprised subjects with alcohol consumption of 0-5.0, 5.1-30.0, and 30.1-75 g/day, respectively. Lipid analysis was performed in nonfractionated and fractionated plasma, including subfractions...

  13. 17 CFR 275.203-3 - Hardship exemptions.

    Science.gov (United States)

    2010-04-01

    ... ADV-H (17 CFR 279.3) in paper format with no later than one business day after the filing that is the...-H at least ten business days before a filing is due. The Commission will grant or deny your application within ten business days after you file Form ADV-H. (3) Effective date—upon approval. You are not...

  14. Dietary patterns associated with male lung cancer risk in the Netherlands Cohort Study

    NARCIS (Netherlands)

    Balder, H.F.; Goldbohm, R.A.; Brandt, P.A. van den

    2005-01-01

    The objective of this article was to study the association between dietary patterns and lung cancer incidence in the Netherlands Cohort Study on Diet and Cancer. The baseline measurement of this prospective case cohort study that was completed by 58,279 men in 1986 included a self-administered

  15. Water stress induced changes in antioxidant enzymes, membrane ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-01

    Dec 1, 2009 ... reduction in chloroplasts (Robinson and Bunce, 2000). In fact it has been reported that much of the injury to plants caused by exposure to various ...... stress on soybean and spinach leaf ascorbate-dehydroascorbate level and redox status. Int. J. Plant Sci. 161:271-279. Sairam RK (1994). Effect of moisture ...

  16. Download this PDF file

    African Journals Online (AJOL)

    STORAGESEVER

    2009-11-02

    Nov 2, 2009 ... ascorbate specific peroxidase in spinach chloroplasts. Plant Cell. Physiol. 22: 867-880. Noctor G, Foyer CH (1998). Ascorbate and glutathione: Keeping active oxygen under control. Annu. Rev. Plant Physiol. Plant Mol. Biol. 49: 249-279. Rehman S, Harris PJC, Bourne WF, Wilkin J (1996). The effect of.

  17. Desiccation-induced changes in viability, lipid peroxidation and ...

    African Journals Online (AJOL)

    user

    2012-05-31

    May 31, 2012 ... ascorbate peroxidase in spinach chloroplasts. Plant Cell Physiol., 22: 867-880. Noctor G, Foyer CH (1998) Ascorbate and glutathione: keeping active oxygen under control. Annu. Rev. Plant Physiol. Plant Mol. Biol., 49: 249-279. Oliver AE, Leprince O, Wolkers WF, Hincha DK, Heyer AG, Growe JH. (2001).

  18. A new species complex including Claviceps fusiformis and Claviceps hirtella

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie; Kolařík, Miroslav; Odvody, G.; Frederickson, D. E.; Olšovská, Jana; Man, Petr

    2008-01-01

    Roč. 31, - (2008), s. 95-110 ISSN 1560-2745 Grant - others:US(US) Intsormil Institutional research plan: CEZ:AV0Z50200510 Keywords : alkaloids * cenchrus * claviceps Subject RIV: EE - Microbiology, Virology Impact factor: 2.279, year: 2008

  19. Biocatalysis of azidolysis of epoxides: Computational evidences on ...

    Indian Academy of Sciences (India)

    279–290. c Indian Academy of Sciences. Biocatalysis of azidolysis of epoxides: Computational evidences on the role of halohydrin dehalogenase (HheC). DHURAIRAJAN SENTHILNATHANa, VENKATACHALAM TAMILMANIb and. PONNAMBALAM VENUVANALINGAMa,∗. aSchool of Chemistry, Bharathidasan University ...

  20. Optimal foraging and predator-prey dynamics III

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil; Eisner, Jan

    2003-01-01

    Roč. 63, - (2003), s. 269-279 ISSN 0040-5809 R&D Projects: GA ČR GA201/03/0091; GA MŠk LA 101 Institutional research plan: CEZ:AV0Z5007907 Keywords : Optimal foraging theory * adaptive behavior * predator-prec population dynamics Subject RIV: EH - Ecology, Behaviour Impact factor: 2.261, year: 2003

  1. Digital rotational microphotometer of the module conception with optical separation of control signals for measurement of granularity of the colour photographic films

    Czech Academy of Sciences Publication Activity Database

    Hrdý, J.; Pospíšil, Jaroslav

    2003-01-01

    Roč. 114, č. 6 (2003), s. 279-288 ISSN 0030-4026 Institutional research plan: CEZ:AV0Z1010921 Keywords : colour photographic granularity * digital rotational microphotometrical granulometer * low- speed scaning * modul conception of microphotometer * optical separation of control signals Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.534, year: 2003

  2. Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Salem nuclear power plant, Unit 1

    International Nuclear Information System (INIS)

    Laudenbach, D.H.

    1979-03-01

    The technical evaluation is presented for the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Salem nuclear power plant, Unit 1. Design basis criteria used to evaluate the acceptability of the system include operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

  3. Determination of the antioxidative activity of substituted 5-aminopyrimidines

    Czech Academy of Sciences Publication Activity Database

    Procházková, Eliška; Jansa, Petr; Dračínský, Martin; Holý, Antonín; Mertlíková-Kaiserová, Helena

    2012-01-01

    Roč. 46, č. 1 (2012), s. 61-67 ISSN 1071-5762 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : 5-aminopyrimidines * TEAC * lipid peroxidation * HepG2 Subject RIV: CC - Organic Chemistry Impact factor: 3.279, year: 2012

  4. Association of -308 TNF-alpha promoter polymorphism with viral ...

    African Journals Online (AJOL)

    2012-06-02

    Jun 2, 2012 ... Genetic restriction of AIDS pathogenesis by an SDF-1 chemokine gene variant. Science. 1998;279(5349):389-393. 10. Bergamini A, Faggioli E, Bolacchi F, et al. Enhanced production of tumor necrosis factor-alpha and interleukin-6 due to prolonged response to lipopolysaccharide in human macrophages ...

  5. 75 FR 7303 - Union Pacific Railroad Company-Abandonment Exemption-in Polk County, IA

    Science.gov (United States)

    2010-02-18

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Docket No. AB-33 (Sub-No. 279X)] Union Pacific Railroad Company--Abandonment Exemption--in Polk County, IA Union Pacific Railroad Company... milepost 10.70 in Ankeny, in Polk County, IA. The line traverses United States Postal Service Zip Code...

  6. Long-term consequences of prenatal exposure to LPS or Poly I:C: effect on behavioural pattern and level of cytokines in adult rats and changes induced by chronic clozapine administration

    Czech Academy of Sciences Publication Activity Database

    Tejkalová, H.; Klaschka, Jan; Růžičková, Šárka

    2012-01-01

    Roč. 279, Suppl. s1 (2012), s. 366-366 E-ISSN 1742-4658 R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985807 ; RVO:86652036 Keywords : LPS * Poly I:C * clozapine * cytokines * rats Subject RIV: FH - Neurology

  7. Pojetí výslovnosti v českých výkladových slovnících (výzva k diskusi)

    Czech Academy of Sciences Publication Activity Database

    Štěpánová, Veronika

    2013-01-01

    Roč. 74, č. 4 (2013), s. 279-297 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA13-00372S Institutional support: RVO:68378092 Keywords : pronunciation * Czech monolingual dictionaries * phonetic transcription * lexicography Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

  8. A study on the dermatoglyphic patterns of Okrika and Ikwerre ethnic ...

    African Journals Online (AJOL)

    This study was carried out to compare the dermatoglyphic patterns of Okrika and Ikwerre ethnic groups. Dermatoglyphic analysis of five hundred and ten (510) subjects comprising of two hundred and seventy nine (279) Okrika indigenes and two hundred and thirty one (231) Ikwerre indigenes between the ages of 15- 70 ...

  9. Annual Report (12th) of Accomplishments Under the Airport Improvement Program. Fiscal Year 1993

    Science.gov (United States)

    1993-01-01

    SAFETY AREA PENSACOLA REGIONAL (PRIMARY) 18 $279,000 INSTALL TAXIWAY SIGNS 19 $349,200 ACQUIRE LAND FOR APPROACHES PUNTA GORDA 09 $172,000 INSTALL...POROUS FRICTION COURSE; CONSTRUCT SIERRA BLANCA REGIONAL TAXIWAYS AND APRON; INSTALL TAXIWAY (GENERAL AVIATION) SIGNS SPJITA FE 09 $403,000 IMPROVE

  10. SUBJECT INDEX

    Indian Academy of Sciences (India)

    255. Diurnal variability of upper ocean temperature and heat budget in the southern Bay of Bengal during October--. November, 1998 (BOBMEX-Pilot). 267. Controls of dimethyl sulphide in the Bay of Bengal during BOBMEX-Pilot cruise 1998. 279. Bio-physical model. 4D-Var data assimilation system for a coupled physical-.

  11. 76 FR 69252 - Combined Notice of Filings #1

    Science.gov (United States)

    2011-11-08

    ...: ER12-279-000. Applicants: Jersey Central Power & Light. Description: Jersey Central Power & Light..., LLC, Nissequogue Cogen Partners, Otay Mesa Energy Center, LLC, ] Pastoria Energy Center, LLC, PCF2..., Inc., Red Mesa Wind, LLC, Sky River LLC, Somerset Windpower, LLC, Story Wind, LLC, Vasco Winds, LLC...

  12. Typologie osob: aplikace shlukové analýzy v Neo osobnostním inventáři

    Czech Academy of Sciences Publication Activity Database

    Hřebíčková, Martina; Urbánek, Tomáš

    2006-01-01

    Roč. 50, č. 5 (2006), s. 405-418 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : personality types * Five Factor Model of Personality * Resilients Subject RIV: AN - Psychology Impact factor : 0.279, year: 2006

  13. Resonance journal of science education

    Indian Academy of Sciences (India)

    sriranga

    Resonance journal of science education. March 2011 Volume 16 Number 3. GENERAL ARTICLES. 204 Sir Alfred ... Anupam Saxena. 238 Graphene – An Exciting Two-Dimensional. Material for Science and Technology ... The Rise of Modern Medicine. T Padmanabhan. REFLECTIONS. 279 Darshana Jolts. Sound: The ...

  14. Untitled

    Indian Academy of Sciences (India)

    Ann. Chem., 1852, 83, 257; 1856, 98, 213. Z. anorg, allgem. Chem., 1952, 269, 279. Rec. Trav, Chem., 1957, 76, 1005. Jour. Sci, and Ind. Res., 1959, 18 B, No. 12, 537–539. Larsen, E. M., Howatson, J., J. Am. Chem. Soc., 1952, 74, 3489. Gammill, A. M. and. Wittenberg, L. Venkataraman, K. N. and. Vasudeva Murthy, A. R..

  15. Effet du compost et de Trichoderma harzianum sur la suppression ...

    African Journals Online (AJOL)

    SARAH

    31 oct. 2013 ... harzianum T39 biocontrol of Botrytis cinerea. Eur. J. Plant Pathol., 104, 279-286. Diab H. G., Hu S. et Benson D. M. 2003. Suppression of. Rhizoctonia solani on impatiens by enhanced microbial activity in composted swine waste- amended potting mixes. Phytopathol., 93, 1115-. 1123. Douira A. et Lahlou H.

  16. A Brief Survey of the Mosquitoes of South Sulawesi, Indonesia, with Special Reference to the Identity of ’Anopheles barbirostris’ (Diptera: Culicidae) from the Margolembo Area

    Science.gov (United States)

    1977-06-20

    Bonne-Wepster, 1947 : 187. Culex (Culex) tritaeniorhyuchus summ orosus Dyar , 1920 As Cr. ttitneniorhync&, Brug, 1931: 35.-Barraud, 1934: 406...Swellengrebel de Graaf, 1919 ( 1920 ) As An. tesselatus var. orientalis, Brug & Bonne-Wepster, 1947: 181.-Bonne-Wepster & Swellengrebel, 1953: 279.-Waktoedi

  17. differential pulse voltammetric determination of theophylline at poly ...

    African Journals Online (AJOL)

    Preferred Customer

    , W.; Jing-Juan, X.; Hong-Yuan, C. Anal. Lett. 2005, 37, 629. 22. Ohnuki, Y.; Ohsaka, T.; Matsuda, H.; Oyama, N. J. Electroanal. Chem. 1983, 158, 55. 23. Volkov, A.; Tourillon, G.; Lacaze, P.C.; Dubois, J.E. J. Electroanal. Chem. 1980, 115, 279.

  18. Limestone Quarries as Refuges for European Xerophilous Butterflies

    Czech Academy of Sciences Publication Activity Database

    Beneš, Jiří; Kepka, Pavel; Konvička, Martin

    2003-01-01

    Roč. 17, č. 4 (2003), s. 1058-1069 ISSN 0888-8892 Institutional research plan: CEZ:AV0Z5007907 Keywords : Central southern Britain * Brithis butterlies Subject RIV: EH - Ecology, Behaviour Impact factor: 3.279, year: 2003

  19. Lack of main K+ uptake systems in Saccharomyces cerevisiae cells affects yeast performance in both potassium-sufficient and potassium-limiting conditions

    Czech Academy of Sciences Publication Activity Database

    Navarrete, C.; Petrezsélyová, Silvia; Barreto, L.; Martínez, J. L.; Zahrádka, Jaromír; Ariňo, J.; Sychrová, Hana; Ramos, J.

    2010-01-01

    Roč. 10, č. 5 (2010), s. 508-517 ISSN 1567-1356 R&D Projects: GA MŠk(CZ) LC531; GA ČR(CZ) GA204/08/0354 Institutional research plan: CEZ:AV0Z50110509 Keywords : potassium homeostasis * yeast * Trk transporters Subject RIV: EE - Microbiology, Virology Impact factor: 2.279, year: 2010

  20. What Are the Factors That Put a Pregnancy at Risk?

    Science.gov (United States)

    ... 20120730T1640322605 (PDF – 279 KB) [top] MedlinePlus. (n.d.). Teenage pregnancy . Retrieved June 19, 2012, from http://www.nlm. ... teenagepregnancy.html [top] American Academy of Pediatrics. (2011). Teenage Pregnancy . Retrieved August 7, 2012, from http://www.healthychildren. ...

  1. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Maria Suely Pagliarini. Articles written in Journal of Genetics. Volume 83 Issue 3 December 2004 pp 279-283 Research Note. Abnormal pollen mitoses (PM I and PM II) in an interspecific hybrid of Brachiaria ruziziensis and Brachiaria decumbens (Gramineae) · Andréa Beatriz ...

  2. 78 FR 64025 - Submission for OMB Review, Comment Request, Proposed Collection: Public Libraries Survey, 2014-2016

    Science.gov (United States)

    2013-10-25

    ..., Proposed Collection: Public Libraries Survey, 2014-2016 AGENCY: Institute of Museum and Library Services... communications and cooperative networks (20 U.S.C. Chapter 72, 20 U.S.C. 9108). Abstract: The Public Libraries...-0074, which expires 12/31/2013. Pursuant to Public Law 107-279, this Public Libraries Survey collects...

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 88, Issue 3. December 2009, pages 267-391. pp 267-272 Research Article ... pp 273-279 Research Article. Evaluation of RAPD-PCR and protein profile analysis to .... More Details Fulltext PDF. pp 345-348 Research Note. Genetic variation in colchicine-treated regenerated plants of Eucalyptus globulus Labill.

  4. Virginia Board of Education Student Code of Conduct Policy Guidelines

    Science.gov (United States)

    Virginia Department of Education, 2015

    2015-01-01

    The Virginia Board of Education's "Student Conduct Policy Guidelines" were first developed in 1994 in response to action by the 1993 General Assembly requiring the Virginia Board of Education to establish such guidelines. In 2004, the "Guidelines" underwent a major revision in response to requirements of § 22.1-279.6. of the…

  5. Book Review: Patologías de la realidad virtual. Cibercultra y ciencia ficción

    Directory of Open Access Journals (Sweden)

    Miguel Carrera Garrido

    2016-06-01

    Full Text Available Reseña: López-Pellisa, T. (2015 Patologías de la realidad virtual. Cibercultra y ciencia ficción. Madrid/México D. F.: Fondo de Cultura Económica. ISBN: 9788437507316, 279 pgs.

  6. A prospective cohort study on intake of retinol, vitamins C and E and carotenoids and prostate cancer risk (Netherlands)

    NARCIS (Netherlands)

    Schuurman, A.G.; Goldbohm, R.A.; Brants, H.A.M.; Brandt, P.A. van den

    2002-01-01

    Objectives: The roles of retinol, vitamins C and E, and carotenoids as risk factors for prostate carcinoma are still questionable. We evaluated these in the Netherlands Cohort Study. Methods: The cohort study consisted of 58,279 men ages 55-69 years at baseline in 1986. After 6.3 years of follow-up,

  7. International Journal of Health Research

    African Journals Online (AJOL)

    Erah

    collaboration among scientists, the industry and the healthcare professionals. It will also provide an international forum for the ... private hospitals (35.2%) followed by pharmaceutical store. (27.9%) and 17.0% for general/teaching ..... convenience and proximity (71.6%), privacy. (58.7%), respect or good attitude by workers.

  8. A comparative study of atenolol, nifedipine and their combination in ...

    African Journals Online (AJOL)

    1991-01-05

    Jan 5, 1991 ... ICR Spacelabs 5200 system. Blood pressure was recorded automatically and non-invasively at half-hourly intervals between 06hOO and OOhOO ..... Superiority of 24 hour measurement of blood pressure over clinic values in determining prognosis in hypertension. Clin Erp Hypertens [A] 1985; 7: 279-282.

  9. South African Medical Journal - Vol 104, No 4 (2014)

    African Journals Online (AJOL)

    The safety of osteoporosis medication · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. FS Hough, SL Brown, B Cassim, MR Davey, W de Lange, TJ de Villiers, GC Ellis, S Lipschitz, M Lukhele, JM Pettifor, 279-282. http://dx.doi.org/10.7196/SAMJ.7505 ...

  10. Ruth Benedictová v Československu (léto 1948)

    Czech Academy of Sciences Publication Activity Database

    Kubáčková, Patricie

    2015-01-01

    Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics

  11. Age structure and age-related performance of sulfur cinquefoil (Potentilla recta).

    Science.gov (United States)

    Dana L. Perkins; Catherine G. Parks; Kathleen A. Dwire; Bryan A. Endress; Kelsi L. Johnson

    2006-01-01

    Age distributions of sulfur cinquefoil populations were determined on sites that were historically grazed, cultivated, and mechanically disturbed. From 12 sites, a total of 279 reproductively active plants were collected and aged by using herbchronology (counting rings in the secondary root xylem of the root crown) to (1) estimate the age structure of the populations...

  12. 75 FR 16747 - Notice of Intent to Prepare an Environmental Assessment for a Proposed Rule to Revise Marine...

    Science.gov (United States)

    2010-04-02

    ... comments should be mailed to: P. Michael Payne, Chief, Permits, Conservation and Education Division, Office..., on paper no larger than 8\\1/ 2\\ by 11 inches (216 by 279 mm), and suitable for copying and electronic.... Michael Payne, Chief, Permits, Conservation and Education Division, Office of Protected Resources...

  13. Kirjandus ja riigikirjand / Maia Madisso

    Index Scriptorium Estoniae

    Madisso, Maia

    2001-01-01

    2001.a. riigieksami kirjandite analüüs, milles vaadeldakse, kuivõrd on töödes tuginetud kirjandusteostele. 2001.a. riigikirjand oli esimene omataoline, mille puhul kirjandusele toetumine ei olnud ühegi teema puhul obligatoorne. Analüüsiks kasutati 279 kirjandist koosnevat juhuslikku valikut.

  14. Data of evolutionary structure change: 1BRYY-1OBSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BRYY-1OBSA 1BRY 1OBS Y A --DVSFRLSGATTTSYGVFIKNLREAL-PYERKVYNIPL...tryChain> 1OBS A 1OBSA THR CA 279 1OBS A 1OBSA...yChain> 1OBS A 1OBSA SALYYYSTGGTQ...A 308 PRO CA 392 1OBS A 1OBSA

  15. Cytogenetic analysis in couples with recurrent miscarriages: a ...

    Indian Academy of Sciences (India)

    cases, a positive family history of RM was revealed through pedigree analysis. The mean age of females at ... was around 30%. The percentage of males who were both alcoholics and smokers were 13%. In this .... study, the mean maternal age of subjects carrying anoma- lies was 27.9 years. In this study, 10% females ...

  16. An Assessment of College Tuition Increases and Retention

    Science.gov (United States)

    Karasek, Ray, III

    2016-01-01

    This study examines the relationship between tuition increases, retention, and Pell Grant recipients attending college for the first time at 279 four-year public universities in the southeastern and southwestern regions of the United States. The data for this study was gathered from the Integrated Postsecondary Education Data System (IPEDS) using…

  17. Comments on Brodie and Post: Climate-driven declines in wolverine populations: Causal connection or spurious correlation?

    Science.gov (United States)

    Kevin S. McKelvey; Eric C. Lofroth; Jeffrey P. Copeland; Keith B. Aubry; Audrey J. Magoun

    2010-01-01

    The recent paper by Brodie and Post ("Nonlinear responses of wolverine populations to declining winter snowpack", Popul Ecol 52:279-287, 2010) reports conclusions that are unsupportable, in our opinion, due to both mis-interpretations of current knowledge regarding the wolverine's (Gulo gulo) association with snow, and the uncritical use of harvest data...

  18. Differential effects of indirubin and 2,3,7,8-tetrachlorodibenzo-p-dioxin on the aryl hydrocarbon receptor (AhR) signalling in liver progenitor cells

    Czech Academy of Sciences Publication Activity Database

    Procházková, Jiřina; Kozubík, Alois; Machala, M.; Vondráček, Jan

    2011-01-01

    Roč. 279, 1-3 (2011), s. 146-154 ISSN 0300-483X R&D Projects: GA ČR(CZ) GA524/06/0517 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : indirubin * aryl hydrocarbon receptor * plakoglobin Subject RIV: BO - Biophysics Impact factor: 3.681, year: 2011

  19. RETARDANTY HOŘENÍ, JEJICH POUŽITÍ A VLIV NA ŽIVOTNÍ PROSTŘEDÍ

    Czech Academy of Sciences Publication Activity Database

    Petrová, Šárka; Soudek, Petr; Vaněk, Tomáš

    2015-01-01

    Roč. 109, č. 9 (2015), s. 679-686 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LD13028 Institutional support: RVO:61389030 Keywords : pollution * bioaccumulation Subject RIV: DJ - Water Pollution ; Quality Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/full/2015_09_679-686.pdf

  20. Attitude toward Christianity and paranormal belief among 13- to 16-yr.-old students.

    Science.gov (United States)

    Williams, Emyr; Francis, Leslie J; Robbins, Mandy

    2006-08-01

    A small but statistically significant positive correlation (r = .17) was found in a sample of 279 13- to 16-yr.-old students in Wales between scores on the Francis Scale of Attitude toward Christianity and on a new Index of Paranormal Belief. These data suggest that there is little common variance between attitude toward Christianity and belief in the paranormal.

  1. First results studying the transmutation of 129I, 237Np, 238Pu, and 239Pu in the irradiation of an extended natU/Pb-assembly with 2.52 GeV deuterons

    Czech Academy of Sciences Publication Activity Database

    Krivopustov, M. I.; Pavljuk, A. V.; Kovalenko, A.D.; Mariin, I.I.; Elishev, A.F.; Adam, Jindřich; Kovalík, Alojz; Batusov, Yu, A.; Kalinnikov, V. G.; Brudanin, V. B.; Čaloun, Pavel; Tsoupko-Sitnikov, V. M.; Solnyshkin, A. A.; Stegailov, V. I.; Gerbish, Sh.; Svoboda, Ondřej; Dubnická, Z.; Kala, M.; Kloc, M.; Krása, Antonín; Kugler, Andrej; Majerle, Mitja; Wagner, Vladimír; Brandt, R.; Westmeier, W.; Robotham, H.; Siemon, K.; Bielewicz, M.; Kilim, S.; Szuta, M.; Strugalska-Gola, E.; Wojeciechowski, A.; Hashemi-Nezhad, R. S.; Manolopoulou, M.; Fragopolou, M.; Stoulos, S.; Zamani-Valasiadou, M.; Jokic, S.; Katovsky, K.; Schastny, O.; Zhuk, I. V.; Potapenko, A.S.; Safronova, A.A.; Lukashevich, Zh.A.; Voronko, V.A.; Sotnikov, V.V.; Sidorenko, V.V.; Ensinger, W.; Severin, H.D.; Batsev, S.; Kostov, L.; Protokhristov, Kh.; Stoyanov, Ch,.; Yordanov, O.; Zhivkov, P.K.; Kumar, A.V.; Sharma, M.; Khilmanovich, A.M.; Marcinkevich, B.A.; Korneev, S.V.; Damdinsuren, Ts.; Togoo, Ts.; Kumawat, H.

    2009-01-01

    Roč. 279, č. 2 (2009), s. 567-584 ISSN 0236-5731 R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : MCNPX. * GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.631, year: 2009

  2. Effects of gamma irradiation on the survival of Pseudomonas fluorescens inoculated on romaine lettuce

    Science.gov (United States)

    Irradiation of fresh fruits and vegetables has been utilized as a post-harvest intervention measure for inactivation of microbial pathogens. Pseudomonas fluorescens 2-79, Q8R1, Q287 are non-plant pathogenic, non-pectolytic strains of a potential biocontrol agent. We tested the sensitivity of these s...

  3. Sensitivity of Pseudomonas fluorescens to gamma irradiation following surface inoculations on romaine lettuce and baby spinach

    Science.gov (United States)

    Irradiation of fresh fruits and vegetables is a post-harvest intervention measure often used to inactivate pathogenic food-borne microbes. We evaluated the sensitivity of Pseudomonas fluorescens strains (2-79, Q8R1, Q287) to gamma irradiation following surface inoculations on romaine lettuce and spi...

  4. Animal products, calcium and protein and prostate cancer risk in the Netherlands Cohort Study

    NARCIS (Netherlands)

    Schuurman, A.G.; Brandt, P.A. van den; Dorant, E.; Goldbohm, R.A.

    1999-01-01

    Prostate cancer risk in relation to consumption of animal products, and intake of calcium and protein was investigated in the Netherlands Cohort Study. At baseline in 1986, 58,279 men aged 55-69 years completed a self-administered 150-item food frequency questionnaire and a questionnaire on other

  5. One-Pot, Simple and Efficient Synthesis of Triaryl-1H-imidazoles by ...

    African Journals Online (AJOL)

    NICO

    –3000. 30 M.M. Heravi, K. Bakhtiari and H.A. Oskooie, J. Mol. Catal. A Chem.,. 2007, 263, 279–281. 31 M.V. Chary, N.C. Keerthysri, S.V.N. Vupallapati, N. Lingaiah and. S. Kantevari, Catal. Commun., 2008, 9, 2013–2017. 32 A.Y. Usyatinsky ...

  6. Orbital frequencies in radiolarian assemblages of the central Indian Ocean: implications on the Indian summer monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Gupta, S.M.

    forced frequencies in the 975000 year pollen record from Tenagi Philippon (Greece). Clim. Dynamics 11, 4^24. Morley, J.J., Hays, J.D., 1981. Towards a high resolution, global deep sea chronology for the last 750,000 years. Earth Planet. Sci. Lett. 53, 279...

  7. Helminthiasis in Pregnancy in the Niger - Delta Region of Nigeria

    African Journals Online (AJOL)

    TNHJOURNALPH

    The mean age of the patients was 27.9±5.2 years and the ... Other practices such as hand washing, disposal of refuse, ... Study Population. This study was a prospective cross-sectional study of pregnant women presenting at the booking clinic for antenatal care from May through July, 2014 at selected health institutions ...

  8. The Stochastic Galerkin Method for Darcy Flow Problem with Log-Normal Random

    Czech Academy of Sciences Publication Activity Database

    Beres, Michal; Domesová, Simona

    2017-01-01

    Roč. 15, č. 2 (2017), s. 267-279 ISSN 1336-1376 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : Darcy flow * Gaussian random field * Karhunen-Loeve decomposition * polynomial chaos * Stochastic Galerkin method Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics http://advances.utc.sk/index.php/AEEE/article/view/2280

  9. Occupational lung cancer risk among men in the Netherlands

    NARCIS (Netherlands)

    Preller, L.; Balder, H.F.; Tielemans, E.; Brandt, P.A. van den; Goldbohm, R.A.

    2008-01-01

    Objectives: To assess male lung cancer risks for industrial sectors in the Netherlands and to estimate the proportion of lung cancer attributed to working in specific industrial sectors. Methods: Associations were studied among men aged 55-69 years (n = 58 279) from the prospective Netherlands

  10. The experiences and needs of HIV/AIDS counsellors at a South ...

    African Journals Online (AJOL)

    To increase the availability of HIV/AIDS counselling in South Africa, nurses have been trained to serve as counsellors within hospital services. The aim of the study was to document the experiences and needs of nurse HIV/AIDS counsellors at a small South African hospital (with 279 beds and 10 medical doctors on the staff) ...

  11. Risk Factors for Parachute Injuries and Airborne Student Observations on the Parachute Ankle Brace

    Science.gov (United States)

    2007-10-03

    Medicine and Science in Sports and Exercise . 30: 975...factors among armor battalion soldiers at Ft Riley, Kansas. Medicine and Science in Sports and Exercise . 35: S278. 20. Davis WR (1964). Parachute...police (Army). Medicine and Science in Sports and Exercise . 35: S279. 34. Heir T, and Eide G (1997). Injury proneness in infantry conscripts

  12. Agricultural and Food Science Journal of Ghana - Vol 4 (2005)

    African Journals Online (AJOL)

    Accounting for training results: an evaluation of the training activities of the root and tuber improvement programme · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CK Osei, JN Berchie, IOO Ansah, S Gyasi-Boakye, SN Asante, AA Adjekum, Salome Danso, 279-290.

  13. Psychosocial factors associated with smoking behavior among ...

    African Journals Online (AJOL)

    Psychosocial factors associated with smoking behavior among secondary school adolescents in Ibadan Metropolis. AO Taiwo, PO Olapegba, GA Adejuwon. Abstract. No Abstract. African Journal for the Psychological Study of Social Issues Vol. 8(2) 2005: 264-279. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT

  14. Toll of Tobacco in the United States of America

    Science.gov (United States)

    ... and Exposure to Smokers on Adolescent Susceptibility to Smoking,” Journal of the National Cancer Institute 87(20):1538- ... al., “Tobacco Industry Promotion of Cigarettes and Adolescent Smoking,” Journal of the American Medical Association 279(7):511- ...

  15. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. V V S S Sarma. Articles written in Journal of Earth System Science. Volume 109 Issue 2 June 2000 pp 279-283. Controls of dimethyl sulphide in the Bay of Bengal during BOBMEX-Pilot cruise 1998 · D M Shenoy M Dileep Kumar V V S S Sarma · More Details Abstract ...

  16. Neurální komponenty motivačních a rozhodovacích procesů v lidském mozku

    Czech Academy of Sciences Publication Activity Database

    Zelinková, J.; Urbánek, Tomáš; Mareček, R.; Brázdil, M.

    74/107, č. 4 (2011), s. 419-427 ISSN 1210-7859 Institutional research plan: CEZ:AV0Z70250504 Keywords : motivation * decision-making processes * functional magnetic resonance imaging Subject RIV: AN - Psychology Impact factor: 0.279, year: 2011 http://www.csnn.eu/ceska-slovenska-neurologie-clanek/neuralni-komponenty-motivacnich-a-rozhodovacich-procesu-v-lidskem-mozku-35788

  17. Resonance Raman Spectra of the Transient Cl2 and Br2 Radical Anions

    DEFF Research Database (Denmark)

    Wilbrandt, Robert Walter; Jensen, Niels-Henrik; Sillesen, Alfred Hegaard

    1984-01-01

    The resonance Raman spectra of the short-lived radical anions ClImage 2− and BrImage − in aqueous solution are reported. The observed wavenumbers of 279 cm−1 for ClImage − and 177 cm−1 for BrImage − are about 10% higher than those published for the corresponding species isolated in solid argon ma...

  18. 75 FR 14175 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-03-24

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401... Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National...

  19. 76 FR 31967 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-06-02

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; N01DA-11-7777.... Ruiz, PhD, Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse....: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated: May 26...

  20. 76 FR 59415 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-09-26

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Multisites... Administrator, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4234, MSC 9550... funding cycle. (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

  1. 78 FR 43890 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-07-22

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  2. 77 FR 3481 - National Institute on Drug Abuse Notice of Closed Meeting

    Science.gov (United States)

    2012-01-24

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4234, MSC 9550, 6001 Executive Blvd., Bethesda... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  3. 76 FR 81952 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-12-29

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Training and... Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4245, MSC 9550, 6001 Executive Blvd... Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated...

  4. 78 FR 63994 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-10-25

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Substance Use...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

  5. 78 FR 22892 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-04-17

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228, MSC 9550, 6001 Executive Blvd.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  6. 75 FR 25278 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-05-07

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; N44DA-10-5542... Institute on Drug Abuse, NIH, 6101 Executive Blvd., Room 220, MSC 8401, Bethesda, MD 20852, 301-435-1432, [email protected] . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and...

  7. 76 FR 31968 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-06-02

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Technical... Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC 9550... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

  8. 76 FR 22715 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-04-22

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIDA Blending..., Training and Special Projects Review Branch, Office of Extramural Affairs, National Institute on Drug Abuse... Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

  9. 75 FR 6042 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-02-05

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401, 6101 Executive Blvd., Bethesda, MD 20892-8401, 301... Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

  10. 78 FR 37835 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-06-24

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIH Summer...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  11. 78 FR 63995 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-10-25

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel R13 Conference... Officer, Grants Review Branch, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS... . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  12. 76 FR 51381 - National Institute on Drug Abuse; Notice of Meeting

    Science.gov (United States)

    2011-08-18

    ... U.S.C. App.), notice is hereby given of a meeting of the National Advisory Council on Drug Abuse... administrative, legislative and program developments in the drug abuse field. Place: National Institutes of.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  13. 76 FR 35227 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2011-06-16

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, SecuRX..., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, Room 4228....nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

  14. 78 FR 73866 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-12-09

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIDA Center... Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 4227, MSC... Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National...

  15. 75 FR 13136 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-03-18

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Institute on Drug Abuse, NIH. DHHS, Room 220, MSC 8401, 6101 Executive Boulevard, Bethesda, MD 20892- 8401... Assistance Program Nos. 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health...

  16. 77 FR 22581 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2012-04-16

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel Multi-site... Branch, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001 Executive Blvd... Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes...

  17. 75 FR 63498 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-10-15

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; Statistical... Affairs, National Institute on Drug Abuse, NIH, DHHS, Room 220, MSC 8401, 6101 Executive Boulevard... Nos.: 93.279, Drug Abuse and Addiction Research Programs, National Institutes of Health, HHS) Dated...

  18. 77 FR 44640 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2012-07-30

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel Rodent Testing...: Lyle Furr, Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse..., lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction...

  19. 78 FR 40755 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2013-07-08

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel; NIH Summer...., Scientific Review Officer, Office of Extramural Affairs, National Institute on Drug Abuse, NIH, DHHS, Room... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  20. 77 FR 72365 - National Institute on Drug Abuse; Notice of Meeting

    Science.gov (United States)

    2012-12-05

    ... U.S.C. App.), notice is hereby given of a meeting of the National Advisory Council on Drug Abuse... administrative, legislative and program developments in the drug abuse field. Place: National Institutes of... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  1. 77 FR 35418 - National Institute on Drug Abuse; Notice of Closed Meetings

    Science.gov (United States)

    2012-06-13

    ... invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel... Affairs, National Institute on Drug Abuse, NIH, DHHS, 6001 Executive Blvd., Room 4226, MSC 9550, Bethesda... of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  2. 77 FR 47654 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2012-08-09

    ... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse... Drug Abuse, NIH, DHHS, Room 4227, MSC 9550, 6001 Executive Boulevard, Bethesda, MD 20892- 9550, (301) 435-1439, lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse...

  3. 75 FR 9606 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-03-03

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis... Furr, Contract Review Specialist, Office of Extramural Affairs, National Institute on Drug Abuse, NIH....gov . (Catalogue of Federal Domestic Assistance Program Nos. 93.279, Drug Abuse and Addiction Research...

  4. 75 FR 42102 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-07-20

    ... personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis Panel, Research..., lf33c.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Institute on Drug...

  5. 75 FR 21006 - National Institute on Drug Abuse; Notice of Closed Meeting

    Science.gov (United States)

    2010-04-22

    ... unwarranted invasion of personal privacy. Name of Committee: National Institute on Drug Abuse Special Emphasis..., Office of Extramural Affairs, National Institute on Drug Abuse, NIH, 6101 Executive Blvd., Rm. 213, MSC.... (Catalogue of Federal Domestic Assistance Program Nos.: 93.279, Drug Abuse and Addiction Research Programs...

  6. The Power of Partnerships: Exploring the Relationship between Campus Career Centers and Political Science Departments

    Science.gov (United States)

    Despeaux, J. Michael; Knotts, H. Gibbs; Schiff, Jennifer S.

    2014-01-01

    Given the growing emphasis on career preparation in higher education, career centers play important roles on today's college campuses. The literature has focused on the reasons students use career services, but it has not addressed the vital linkage between career centers and academic departments. Using a survey of 279 political science…

  7. Medicolegal autopsies in North Central Nigeria | Mandong | East ...

    African Journals Online (AJOL)

    Objective: To determine the pattern and the causes of deaths reported to the coroner for medicolegal autopsies in North Central Nigeria. Design: A descriptive retrospective study. Setting: Jos University Teaching Hospital, Jos, Nigeria between January1996 to December 2003. Subjects: Autopsies reports of 279 subjects ...

  8. 78 FR 278 - Endangered and Threatened Wildlife and Plants; Reclassification of the Continental United States...

    Science.gov (United States)

    2013-01-03

    ... based on key words (e.g., species name) rather than on the incorrect docket number were able to find the... [Federal Register Volume 78, Number 2 (Thursday, January 3, 2013)] [Proposed Rules] [Pages 278-279..., as amended (Act). In that publication, we supplied an incorrect docket number for commenters to use...

  9. Biocatalysis of azidolysis of epoxides: Computational evidences on ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 123; Issue 3. Biocatalysis of azidolysis of epoxides: Computational evidences on the role of halohydrin dehalogenase (HheC). Dhurairajan senthilnathan Venkatachalam Tamilmani Ponnambalam Venuvanalingam. Volume 123 Issue 3 May 2011 pp 279-290 ...

  10. Acidic and catalytic properties of hierarchical zeolites and hybrid ordered mesoporous materials assembled from MFI protozeolitic units

    Czech Academy of Sciences Publication Activity Database

    Serrano, D. P.; García, R. A.; Vicente, G.; Linares, M.; Vitvarová, Dana; Čejka, Jiří

    2011-01-01

    Roč. 279, č. 2 (2011), s. 366-380 ISSN 0021-9517 Institutional research plan: CEZ:AV0Z40400503 Keywords : hierarchical zeolites * hybrid zeolitic-mesostructured materials * Bronsted and Lewis acid centres Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.002, year: 2011

  11. Stages and Discharges of the Mississippi River and Tributaries and Other Watersheds in the New Orleans District for 1991

    Science.gov (United States)

    1991-01-01

    234 GULF OF MEXICO . . . . ..................... 263 PART II. OBSERVED DISCHARGES MISSISSIPPI RIVERANDPASSES ......... ............... 271 OLD...DISCHARGE IN THOUSAND DAY SECOND FEET DAY JAN FEB NAR APR NAY AtUN Jt. AUG SEP OCT NOV DEC 226215 125 83 33 32 90 64 37 m8 90 279 92 5 63 21 2m 224 127

  12. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

  13. Endogenous cytokinins in Cocos nucifera L. in vitro cultures obtained from plumular explants

    Czech Academy of Sciences Publication Activity Database

    Sáenz, L.; Azpeitia, A.; Oropeza, C.; Jones, L.; Fuchsová, Květoslava; Spíchal, Lukáš; Strnad, Miroslav

    2010-01-01

    Roč. 29, č. 11 (2010), s. 1227-1234 ISSN 0721-7714 R&D Projects: GA ČR GA301/08/1649; GA AV ČR IBS5038351 Institutional research plan: CEZ:AV0Z50380511 Keywords : Coconut palm * Somatic embryogenesis * Endogenous cytokinins Subject RIV: EF - Botanics Impact factor: 2.279, year: 2010

  14. X-ray dark-field refraction-contrast imaging of micro-objects

    Czech Academy of Sciences Publication Activity Database

    Protopopov, V. V.; Sobota, Jaroslav

    2002-01-01

    Roč. 213, 4/6 (2002), s. 267 - 279 ISSN 0030-4018 Institutional research plan: CEZ:AV0Z2065902 Keywords : X-ray imaging * radiography * refraction Subject RIV: JI - Composite Materials Impact factor: 1.488, year: 2002

  15. Tolerance to Central Hypovolemia: The Influence of Oscillations in Arterial Pressure and Cerebral Blood Velocity

    Science.gov (United States)

    2011-10-01

    investigated. This oscillatory response to hypovolemia has been exten- sively reported. In 1951 Guyton and Harris (27) observed a distinctive...the renin-angiotensin system. Am J Physiol Regul Integr Comp Physiol 279: R822–R829, 2000. 27. Guyton AC, Harris JW. Pressoreceptor-autonomic

  16. Ultrastructure of embryonated eggs of the cestode Gyrocotyle urna (Gyrocotylidea) using cryo-methods

    Czech Academy of Sciences Publication Activity Database

    Levron, Céline; Scholz, Tomáš; Vancová, Marie; Kuchta, Roman; Conn, D. B.

    2016-01-01

    Roč. 135, č. 3 (2016), s. 279-289 ISSN 0720-213X R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Gyrocotylidea * Ultrastructure * Embryonic * Cryo-technique * Cestoda Subject RIV: EG - Zoology Impact factor: 1.038, year: 2016

  17. Differential Effects of Four Stressors on Blood Pressure and Hear Rate,

    Science.gov (United States)

    1982-01-01

    Cacioppo and Sandman (1978) presented their subjects with cognitive tasks (arithmetic, string memorization and anagrams) and with an unpleasant visual task...793. Nakano, S., Gillespie, H. K. and Hollister, L. E. Propranolol in experimentally induced stress. Psychopharmacology (Berlin), 1978, 59, 279-284

  18. Crystallization behaviour of poly(N-methyldodecano-12-lactam). III. Kinetics of isothermal crystallization

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Jaroslav; Sikora, Antonín

    2004-01-01

    Roč. 93, č. 1 (2004), s. 279-293 ISSN 0021-8995 R&D Projects: GA AV ČR IAA4050007 Institutional research plan: CEZ:AV0Z4050913 Keywords : poly(N-methyldodecano-12-lactam) (MPA) * crystallization * kinetics Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.021, year: 2004

  19. Motivation for treatment in substance-dependent patients. Psychometric evaluation of the TCU motivation for treatment scales

    NARCIS (Netherlands)

    de Weert-van Oene, Gerdien H.; Schippers, Gerard M.; de Jong, Cor A. J.; Schrijvers, Guus A. J. P.

    2002-01-01

    The objective of this paper is to analyze the psychometric properties of the TCU Motivation for Treatment (MfT) scale in alcohol- and drug-dependent patients in an inpatient treatment facility in the Netherlands, to see whether it is useful in European populations as well. In the study, 279

  20. Isogeometric free vibration of an elastic block

    Czech Academy of Sciences Publication Activity Database

    Kolman, Radek

    2012-01-01

    Roč. 19, č. 4 (2012), s. 279-291 ISSN 1802-1484 R&D Projects: GA ČR GPP101/10/P376; GA ČR(CZ) GAP101/12/2315 Institutional support: RVO:61388998 Keywords : isogeometric analysis * finite element method * B-spline and NURBS basis functions Subject RIV: BI - Acoustics

  1. Contribution to the external surface of a titanium-rich sand (Abou-Khashaba, Egypt) in the uranium uptake processes

    Czech Academy of Sciences Publication Activity Database

    Tykva, Richard; Salahel Din, K.; Pavel, C. C.; Cecal, A.; Popa, K.

    2009-01-01

    Roč. 279, č. 3 (2009), s. 811-816 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z40550506 Keywords : uran uptake * Egyptian black sand * thermodynamic parameters Subject RIV: DL - Nuclear Waste, Radioactive Pollution ; Quality Impact factor: 0.631, year: 2009

  2. Effects of canonical Wnt signaling on dorso-ventral specification of the mouse telencephalon

    Czech Academy of Sciences Publication Activity Database

    Backman, M.; Machoň, Ondřej; Mygland, L.; van den Bout, C. J.; Zhong, W.M.; Taketo, M.M.; Krauss, S.

    2005-01-01

    Roč. 279, č. 1 (2005), s. 155-168 ISSN 0012-1606 R&D Projects: GA ČR(CZ) GA204/04/1358 Institutional research plan: CEZ:AV0Z50520514 Keywords : beta-catenin * telencephalon * progenitor cell identity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.234, year: 2005

  3. Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Yankee Rowe nuclear power plant

    International Nuclear Information System (INIS)

    Latorre, V.R.; Mayn, B.G.

    1979-08-01

    This report documents the technical evaluation of the electrical, instrumentation, and control design aspects for the low temperature overpressure protection system of the Yankee Rowe nuclear power plant. Design basis criteria used to evaluate the acceptability of the system included operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

  4. Technical evaluation of the electrical, instrumentation, and control design aspects of the low temperature overpressure protection system for the Maine Yankee nuclear power plant

    International Nuclear Information System (INIS)

    Latorre, V.R.; Mayn, B.G.

    1979-08-01

    This report documents the technical evaluation of the electrical, instrumentation, and control design aspects for the low temperature overpressure protection system of the Maine Yankee nuclear power plant. Design basis criteria used to evaluate the acceptability of the system included operator action, system testability, single failure criterion, and seismic Category I and IEEE Std-279-1971 criteria

  5. Aporia in the information-processing paradigm of contemporary cognitive psychology

    Czech Academy of Sciences Publication Activity Database

    Sedláková, Miluše

    1999-01-01

    Roč. 41, č. 4 (1999), s. 274-279 ISSN 0039-3320 R&D Projects: GA AV ČR KSK3077601 Keywords : information-processing approach * paradigm * cognitive psychology Subject RIV: AN - Psychology Impact factor: 0.115, year: 1999

  6. An Analysis of Music Fan towards Music Streaming Purchase Intention of Thailand's Music Industry

    Science.gov (United States)

    Sanitnarathorn, Pannawit

    2018-01-01

    Digital music streaming are climbing but overall music revenue is declining with digital music piracy being blamed as the culprit. In a 10 year period from 2003 to 2013, global music sales dropped from $US23.3 to $US15 billion dollars with Thailand's music industry following the trend dropping from $US 304 million in 2010 to $US 279 million in…

  7. Long-term changes of epiphytic lichen species composition over landscape gradients: an 18 year time series

    Czech Academy of Sciences Publication Activity Database

    Liška, Jiří; Herben, Tomáš

    2008-01-01

    Roč. 40, č. 5 (2008), s. 437-448 ISSN 0024-2829 R&D Projects: GA AV ČR(CZ) IA60560; GA AV ČR(CZ) IAA600050712 Institutional research plan: CEZ:AV0Z60050516 Keywords : air pollution * multivariate analysis * permanent recordings Subject RIV: EF - Botanics Impact factor: 1.279, year: 2008

  8. Seward Park High School Project CABES, 1985-1986. OEA Evaluation Report.

    Science.gov (United States)

    New York City Board of Education, Brooklyn. Office of Educational Assessment.

    In 1985-86, the Career Advancement through Bilingual Education Skills (CABES) project was in the final year of a three-year funding cycle at Seward Park High School in Manhattan, New York. The project's major goal was to provide career advancement skills to a population group of 279 students of limited English proficiency (LEP). Included in the…

  9. Isolation of a novel xyloglucan endotransglucosylase (OsXET9 ...

    African Journals Online (AJOL)

    ... booting and heading stages of indica cultivar Pei'ai 64S plants under cold, drought or heat stresses using the GeneChip Rice Genome Array (Affymetrix) representing 51, 279 transcripts from japonica and indica rice. A large number of genes highly up regulated or down regulated were identified under the stresses.

  10. Negative relationships between cellular immune response, Mhc class II heterozygosity and secondary sexual trait in the montane water vole

    Czech Academy of Sciences Publication Activity Database

    Charbonnel, N.; Bryja, Josef; Galan, M.; Deter, J.; Tollenaere, C.; Chaval, Y.; Morand, S.; Cosson, J.-F.

    2010-01-01

    Roč. 3, č. 3 (2010), s. 279-290 ISSN 1752-4571 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : abundance cycles * Dqa and Drb * immunocompetence handicap * Mhc class II genes * parasite-mediated balancing selection * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.145, year: 2010

  11. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 124; Issue 2. Issue front cover thumbnail. Volume 124, Issue 2. May 2014, pages 127-279. pp 127-140. A Statistic on -Color Compositions and Related Sequences · Toufik Mansour Mark Shattuck · More Details Abstract Fulltext PDF. A composition of a ...

  12. When Introverts Ceased to Be More Religious: A Study among 12- to 16-Year-Old Pupils

    Science.gov (United States)

    Williams, Emyr; Robbins, Mandy; Francis, Leslie J.

    2005-01-01

    A sample of 279 12- to 16-year-old pupils completed the Francis Scale of Attitude toward Christianity and the short-form Junior Eysenck Personality Questionnaire Revised. Contrary to the findings of research using earlier junior versions of the Eysenck scales, the data demonstrate that introverts have ceased to be more religious. (Contains 1…

  13. The Relationship between Medical Students' Cognitive Method of Thinking, Their Sex Their Academic Level and the Degree of Their Creative Thinking

    Science.gov (United States)

    Qutami, Nayfeh

    2005-01-01

    The sample of the study consisted of all the students in the Faculty of Medicine. The study was conducted using 290 students. The performance of 279 students of the total were analyzed. 141 were males and 135 were females. The results showed an influence in the interaction of different variables such as sex, academic level, and the cognitive…

  14. Praktická aplikace techniky fotochemické oxidace H2O2/UVC pro čištění kontaminovaných podzemních vod

    Czech Academy of Sciences Publication Activity Database

    Mašín, P.; Krystyník, Pavel; Žebrák, R.

    2015-01-01

    Roč. 109, č. 11 (2015), s. 885-891 ISSN 0009-2770 R&D Projects: GA MPO(CZ) FR-TI1/065 Institutional support: RVO:67985858 Keywords : photochemical oxidation * hydrogen peroxide * ultraviolet irradiation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.279, year: 2015

  15. Prevalence antisociálního chování českých adolescentů z městských oblastí

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Hrdlička, M.; Sobotková, Veronika; Jelínek, Martin; Květon, Petr; Vobořil, Dalibor

    2006-01-01

    Roč. 50, č. 4 (2006), s. 297-310 ISSN 0009-062X R&D Projects: GA AV ČR IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : antisocial behavior * adolescence * theory Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  16. Genetics Home Reference: 1q21.1 microdeletion

    Science.gov (United States)

    ... reciprocal 1q21.1 deletions and duplications associated with microcephaly or macrocephaly and developmental and behavioral abnormalities. Nat Genet. 2008 Dec;40(12):1466-71. doi: 10.1038/ng.279. Citation on PubMed or Free article on PubMed Central Haldeman-Englert CR, Jewett T. ...

  17. Genetics Home Reference: 1q21.1 microduplication

    Science.gov (United States)

    ... reciprocal 1q21.1 deletions and duplications associated with microcephaly or macrocephaly and developmental and behavioral abnormalities. Nat Genet. 2008 Dec;40(12):1466-71. doi: 10.1038/ng.279. Citation on PubMed or Free article on PubMed Central Dolcetti A, Silversides CK, Marshall ...

  18. Influence of magnetic field on the electrodeposition of Ni-Co alloy

    Indian Academy of Sciences (India)

    Full Papers Volume 122 Issue 2 March 2010 pp 279-285 ... Abstract. The electrodeposition of Ni-Co alloy from a nickel Watt's solution in the absence and presence of a permanent parallel magnetic field (PPMF) to the plane of deposition (perpendicular to direction of current) produced a deposited layer with mostly fine grain ...

  19. Multifactor Determinants of Visual Accommodation as a Critical Intervening Variable in the Perception of Size and Distance: Phase I Report

    Science.gov (United States)

    1997-11-01

    279). NY: Macmillan Press. Ciuffreda, K. J., and Goldrich, S. G. (1983). Oculomotor biofeedback therapy . International Rehabilitation Medicine, 5, 111...1906). L’agrandissement apparent de la luna a l’horizon. Archives de Psychologie, 5, 319-325. Haenel, H. (1909). Die gestalt de himmels und

  20. 78 FR 64253 - NASA Advisory Council; Science Committee; Planetary Protection Subcommittee; Meeting

    Science.gov (United States)

    2013-10-28

    ... is https://nasa.webex.com/ , meeting number 990 787 342, password PPS111220131! The WebEx link for the November 13 meeting is https://nasa.webex.com/ , meeting number 999 279 440, password PPS111320132... register and to comply with NASA security requirements. Visitors must show a valid State or Federal issued...

  1. The Association of Athletic Expenditures with Student Academic Achievement in Arkansas Secondary Public Schools

    Science.gov (United States)

    Skelton, Mike

    2009-01-01

    Data on public secondary schools in Arkansas were gathered for two separate school years, 2005-2006 (N = 278) and 2006-2007 (N = 279), to determine if there was an association between athletic expenditures and student academic achievement. Prior to this research, there was little empirical evidence demonstrating any effect that athletic spending…

  2. beta-aminobutyric acid protects Brassica napus plants from infection by Leptosphaeria maculans. Resistance induction or a direct antifungal effect?

    Czech Academy of Sciences Publication Activity Database

    Šašek, Vladimír; Nováková, Miroslava; Dobrev, Petre; Valentová, O.; Burketová, Lenka

    2012-01-01

    Roč. 133, č. 1 (2012), s. 279-289 ISSN 0929-1873 R&D Projects: GA ČR GA522/08/1581; GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Antimicrobial * BTH * Gene expression Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 1.610, year: 2012

  3. Needs Assessment and Telecommunications Cost Benefit Analysis for Army Medical Department Continuing Clinical Education Requirements.

    Science.gov (United States)

    1985-04-01

    Nursing Documentation ---32 Computer Technology Application Diagnosis- Treatment Plan - Restorative Dentistry ---30 *Fixed Prosthodontics 13 Responses B-10 0...Clinical Education Need Assigned by Benefit Delphi Score Multiple Initial Needs N = 42 Legal Issues (Physicians) 45 2.79 Diagnosis/ Treatment Planning 50...Fixed Prosthodontics Oral Surgery Highest Point Totals (when mentioned more than once). 0 Mobilization Planning (Nursing)--- --50 Combat Nrusing

  4. Scientometric analysis of the Ethiopian Journal of Agricultural ...

    African Journals Online (AJOL)

    A Scientometric analysis of the Ethiopian Journal of Agricultural Sciences from volume 1 to 24 covering 279 papers is reported. The journal was covering all areas of agriculture with most papers having single, two or three authors and; in a rare cases up to nine and twelve authors. The number of papers in agronomy, field ...

  5. Scientometric Analysis of the Ethiopian Journal of Agricultural ...

    African Journals Online (AJOL)

    ismail - [2010

    A Scientometric analysis of the Ethiopian Journal of Agricultural Sciences from volume 1 to 24 covering 279 papers is reported. The journal was covering all areas of agriculture with most papers having single, two or three authors and; in a rare cases up to nine and twelve authors. The number of papers in agronomy, field ...

  6. Global stability of the coexistence equilibrium for a general class of models of facultative mutualism

    Czech Academy of Sciences Publication Activity Database

    Maxin, D.; Georgescu, P.; Sega, L.; Berec, Luděk

    2017-01-01

    Roč. 11, č. 1 (2017), s. 339-364 ISSN 1751-3758 Institutional support: RVO:60077344 Keywords : mutualistic interaction * global stability * Lyapunov functional Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.279, year: 2016

  7. Suz12 is essential for mouse development and for EZH2 histone methyltransferase activity

    DEFF Research Database (Denmark)

    Pasini, Diego; Bracken, Adrian P; Jensen, Michael R

    2004-01-01

    SUZ12 is a recently identified Polycomb group (PcG) protein, which together with EZH2 and EED forms different Polycomb repressive complexes (PRC2/3). These complexes contain histone H3 lysine (K) 27/9 and histone H1 K26 methyltransferase activity specified by the EZH2 SET domain. Here we show...

  8. Book Review Remarkable Birds of South Africa By Peter le Sueur ...

    African Journals Online (AJOL)

    Briza Publications, PO Box 56569, Arcadia 0007, South Africa 208 pages, soft cover, 450 colour photographs. ISBN 978-1-875093-58-8. Price R230 OSTRICH 2010, 81(3): 279. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.2989/00306525.2010.

  9. Modelling Nitrogen Transformation in Horizontal Subsurface Flow ...

    African Journals Online (AJOL)

    Accretion of organic nitrogen was a major pathway accounting for 0.279 g/m2.d, which is 19.2% of all the influent nitrogen. The accumulation of ammonia nitrogen was found to be high compared to other water phase state variables (organic nitrogen and nitrate nitrogen). Journal of Civil Engineering Research and Practice ...

  10. Porozumění zkušenosti nemocných rakovinou prsu: narativní přístup

    Czech Academy of Sciences Publication Activity Database

    Chrz, Vladimír; Čermák, Ivo; Plachá, V.

    2006-01-01

    Roč. 50, č. 6 (2006), s. 507-521 ISSN 0009-062X R&D Projects: GA ČR(CZ) GA406/06/1577 Institutional research plan: CEZ:AV0Z70250504 Keywords : breast cancer * control * narrative configuration Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  11. Characterization of monoclonal antibodies against glutamate carboxypeptidase II, the diagnostic and potential therapeutic prostate cancer marker, via the method of surface plasmon resonance

    Czech Academy of Sciences Publication Activity Database

    Tykvart, Jan; Šácha, Pavel; Konvalinka, Jan

    2012-01-01

    Roč. 279, SI suppl. 1 (2012), s. 90-90 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II Subject RIV: CE - Biochemistry

  12. Current Topics in the Asymmetric Transfer Hydrogenation of Imines

    Czech Academy of Sciences Publication Activity Database

    Januščák, J.; Václavík, Jiří; Šot, P.; Pecháček, J.; Vilhanová, B.; Kuzma, Marek; Kačer, P.

    2015-01-01

    Roč. 109, č. 7 (2015), s. 492-498 ISSN 0009-2770 R&D Projects: GA ČR GAP106/12/1276; GA MŠk(CZ) LO1509 Institutional support: RVO:61388971 Keywords : asymmetric transfer hydrogenation * ruthenium * isoquinoline Subject RIV: EE - Microbiology, Virology Impact factor: 0.279, year: 2015

  13. Agrese a sebevědomí

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2006-01-01

    Roč. 50, č. 3 (2006), s. 231-237 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : aggression * self - esteem * egotism Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  14. Assessment of vehicle trip production rates in Ilorin (Nigeria) | Jimoh ...

    African Journals Online (AJOL)

    Occupation, age, gender, income lev-el, vehicle ownership, trip length and fare structure affected the total trip generation, with an average production rate of 3.5, in the range of 2.79 - 4.29. The lower rate was characteristic of school children (5 - 15 years), while the highest rate was attributed to affluent and elderly persons ...

  15. Experiment list: SRX1427026 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available of offspring produced at one birth by a viviparous animal. 22029930,97.6,9.8,279 GSM1937509: Input for SHP ChIP-seq with vehicle...ver || age=8-12 week || genotype=wildtype || treatment=vehicle || chip antibody=n

  16. Growth, haematological and biochemical responses of growing ...

    African Journals Online (AJOL)

    p2492989

    Abstract. Physiological and productive responses to recombinant bovine somatotropin (rbST) injection and calcium soap of fatty acids (CSFA) supplementation were studied in post-weaning male Rahmani lambs. Male lambs (n = 20) of similar initial body weight (27.9 kg) and age (162 d) were divided randomly into four.

  17. Design of a healthy living environment for older adults with low vision

    NARCIS (Netherlands)

    Ir. Joost van Hoof; M.M. Sinoo; F. van Dijken; Dr. H.S.M. Kort

    2006-01-01

    HB2006 : proceedings of the 8th international conference healthy buildings. Oliveira Fernandez, E. de; Gameiro da Silva, M.; Rosada Pinto, J. (red). ISBN 989-95067-1-0 2006 4-8 juni, Lissabon, Portugal, volume III, p. 279-282

  18. Urinary tract pathology in some Schistosoma haematobium infected ...

    African Journals Online (AJOL)

    AJB SERVER

    2007-01-18

    Jan 18, 2007 ... ten pathological conditions as abnormal wall thickness 24 (55.8%), abnormal shape 30 (69.8%), irregular bladder wall 12 (27.9%), masses ... and the town lacks a stream. The inhabitants depend on pipe borne ..... schistosomiasis infection through Ultrasonography and measurement of eosinophil catianic ...

  19. Specific detection of Aspergillus fumigatus in sputum sample of ...

    African Journals Online (AJOL)

    SERVER

    2008-01-04

    -590. Loeffler J, Hebart H, Sepe S, Schumcher U, Klingebiel T, Einsele H. (1998). Detection of PCR-amplified fungal DNA by using a PCR-. ELISA system. Med. Mycol. 36: 275-279. Logan PM, Primack SL, Miller RR, Muller NL ...

  20. Sierra Leone Journal of Biomedical Research Original Article

    African Journals Online (AJOL)

    J. M. Lamin

    A cross-sectional study to determine the knowledge of health care workers on DM, HIV and how some of the drugs used in treating HIV infection secondarily cause metabolic disease like DM. Self-administered, pre-tested questionnaires were distributed to 279 health workers from the primary and secondary health.

  1. Earth fissures in Qinglong Graben in Yuncheng Basin, China

    Indian Academy of Sciences (India)

    Jianwei Qiao

    2018-02-14

    Feb 14, 2018 ... Rudolph D L, Cherry J A and Farvolden R N 1991 Ground- water flow and solute transport in fractured lacustrine clay near Mexico city; Water Resour. Res. 27(9) 2187–. 2201. Sapigni M, Barbera G L and Ghirotti M 2003 Engineering geological characterization and comparison of predicted and measured ...

  2. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  3. Leadership?=?Communication? The Relations of Leaders? Communication Styles with Leadership Styles, Knowledge Sharing and Leadership Outcomes

    OpenAIRE

    de Vries, Reinout E.; Bakker-Pieper, Angelique; Oostenveld, Wyneke

    2009-01-01

    Purpose: The purpose of this study was to investigate the relations between leaders' communication styles and charismatic leadership, human-oriented leadership (leader's consideration), task-oriented leadership (leader's initiating structure), and leadership outcomes. Methodology: A survey was conducted among 279 employees of a governmental organization. The following six main communication styles were operationalized: verbal aggressiveness, expressiveness, preciseness, assuredness, supportiv...

  4. Helminthiasis in pregnancy in the Niger - Delta Region of Nigeria ...

    African Journals Online (AJOL)

    0.05 considered statistically significant. Results: The mean age of the patients was 27.9±5.2 years and the mean gestational age was 27.635±.4 weeks. The overall prevalence of helminthiasis in pregnancy was 91 (22. 7%), with Ascaris ...

  5. Littoral Combat Ship and Frigate: Slowing Planned Frigate Acquisition Would Enable Better Informed Decisions

    Science.gov (United States)

    2016-12-08

    States Government Accountability Office United States Government Accountability Office Highlights of GAO-17-279T, a testimony before the...2GAO, Littoral Combat Ship: Need to Address Fundamental Weaknesses in LCS and Frigate...two shipyards. This all happened without adherence to the principles that lead to sound shipbuilding outcomes—namely, ensuring the maturity of

  6. Prevalence and distribution of ringworm infections in primary school ...

    African Journals Online (AJOL)

    A study on the prevalence and distribution of ringworm infection amongst primary school children in northern Ebony State of eastern Nigeria was carried out between November 2002 and June 2003. Of the 279 pupils sampled randomly from four schools, 59 (21.1%) had ringworm infection. While only two genera of fungi ...

  7. Vom Oppidum zum Einzelgehöft und zurück - zur Geschihcte und dem heutigen Stand der Lateneforschung in Böhmen und Mitteleuropa

    Czech Academy of Sciences Publication Activity Database

    Salač, Vladimír

    2006-01-01

    Roč. 38, - (2006), s. 279-300 ISSN 0065-6585. [75 Jahre Steinsburgmuseum. Römhild, 18.09.2004-19.09.2004] Institutional research plan: CEZ:AV0Z80020508 Keywords : La Tene period * Central Europe * History of research Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    August 2007, pages 279-478. Transportation Research - Safety and Sustainability ... pp 293-307. Success and failures in urban transport planning in Europe — understanding the transport system · Hermann Knoflacher ... Should bus commuting be subsidized for providing quality transport services? – A case for Delhi.

  9. Inviscid incompressible limit under mild stratification: a rigorous derivation of the Euler-Boussinesq system

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Novotný, A.

    2014-01-01

    Roč. 70, č. 2 (2014), s. 279-307 ISSN 0095-4616 EU Projects: European Commission(XE) 320078 - MATHEF Keywords : compressible fluids * Navier-Stokes equations * singular limits Subject RIV: BA - General Mathematics Impact factor: 0.591, year: 2014 http://link.springer.com/article/10.1007%2Fs00245-014-9243-7

  10. school-based survey of adolescents' opinion on premarital sex in ...

    African Journals Online (AJOL)

    PROF. BARTH EKWEME

    premarital sex to be carried out in schools for these adolescents that are at risk of exposure to pre marital sex. ... time premarital is associated with high risk sexual ..... Sexual risk behaviour of street youths in South West. Nigeria. East Afr. J. Public Health, 6, (1): 274 –. 279. Potdar, R and Mmari, K., 2010. Factors influencing.

  11. Capillary electrophoresis in an extended nanospray tip-electrospray as an electrophoretic column

    Czech Academy of Sciences Publication Activity Database

    Týčová, Anna; Foret, František

    2015-01-01

    Roč. 1388, APR (2015), s. 274-279 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : mass spectrometry * interface * separation * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 16, Issue 3. March 2011 ... pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music · V V Raman · More Details Fulltext PDF. pp 293-296 Classics.

  13. 177-IJBCS-Article-Mr S Y GAZUWA

    African Journals Online (AJOL)

    RHUMSIKI

    279:1962-1967. Mossad SB, Macknin, ML, Medendorp SV. 1996. Zinc Gluconate Lozenges for. Treating the Common Cold. Ann. Lat. Med., 125: 81-88. Murray KR, Grammer DK, Mayes PA,. Rodwell. VW. 1992. Harpers. Biochemistry (24th edn). Appleton and. Lange Standfold Connecticut. Obasi OE, Ogbadu GH, Ukoha AI.

  14. Hippophae rhamnoides

    Indian Academy of Sciences (India)

    Unknown

    adaptability and are slow-growing. Many cultivated varieties from Russia and Mongolia have been ..... Agr. Food Sci. Finland 9, 279−289. Bartish I. V., Jeppsson N., Bartish G. I., Lu R. and Nybom H. 2000b Inter- and intraspecific genetic variation in Hippophae. (Elaeagnaceae) investigated by RAPD markers. Plant. Syst.

  15. FREE CONJUNCTIVAL AUTOGRAFT IN THE MANAGEMENT OF ...

    African Journals Online (AJOL)

    hi-tech

    2000-11-11

    Nov 11, 2000 ... pathogenesis of pterygium include ultraviolet light (UVL) exposure(2,7,9), infrared light exposure(7), chronic inflammation, elastodysplasia and elastodystrophy and stem cell aplasia(10). Cameron's global survey of pterygium established a direct relationship between prevalence rates and proximity to the ...

  16. Qualitative Research in Career Development: Content Analysis from 1990 to 2009

    Science.gov (United States)

    Stead, Graham B.; Perry, Justin C.; Munka, Linda M.; Bonnett, Heather R.; Shiban, Abbey P.; Care, Esther

    2012-01-01

    A content analysis of 11 journals that published career, vocational, and work-related articles from 1990 to 2009 was conducted. Of 3,279 articles analyzed, 55.9% used quantitative methods and 35.5% were theoretical/conceptual articles. Only 6.3% used qualitative research methods. Among the qualitative empirical studies, standards of academic rigor…

  17. Breaking ground in cross-cultural research on the fear of being laughted at (gelotophobia): A multi-national study involving 73 countries

    Czech Academy of Sciences Publication Activity Database

    Proyer, R.T.; Ruch, W.; Ali, N.S.; Al-Olimat, H. S.; Amemiya, T.; Adal, T.A.; Ansari, S. A.; Arhar, Š.; Asem, G.; Baudin, N.; Bawab, S.; Bergen, D.; Brdar, I.; Brites, R.; Brunner-Sciarra, M.; Carrell, A.; Dios, H.C.; Celik, M.; Ceschi, G.; Chang, K.; Cheryomukhin, A.; Chik, M.P.Y.; Chlopicki, W.; Cranney, J.; Dahourou, D.; Doosje, S.; Dore, M.; El-Arousy, N.; Ficková, E.; Führ, M.; Gallivan, J.; Geling, H.; Germikova, L.; Goh, A.; Gonzáles, R.D.; Ho, S.K.; Hřebíčková, Martina; Jaime, B.; Hertzberg Kaare, B.; Kamble, S.; Kazarian, S.; Kerkkänen, P.; Klementová, M.; Kobozeva, I.M.; Kovjanic, S.; Kumaraswamy, N.; Lampert, M.; Liao, Ch.; Levesque, M.; Loizou, L.; Loving, R.D.; Lyttle, J.; Machline, V.C.; McGoldrick, S.; McRorie, M.; Min, L.; Mottus, R.; Munyae, M.; Navia, C.E.; Nkhalamba, M.; Pedrini, P.P.; Petkova, M.; Platt, T.; Popa, D-E.; Radomska, A.; Rashid, T.; Rawlings, D.; Rubio, V.J.; Samson, A.C.; Sarid, O.; Shams, S.; Sisokohm, S.; Smári, J.; Sneddon, I.; Snikhovska, I.; Stephanenko, E.A.; Stokenberga, L.; Stuer, B.; Tanoto, Y.S.R.; Tapia, L.; Taylor, J.; Thibault, P.; Thompson, A.; Thőrn, H.; Toyota, H.; Ujlaky, J.; Vanno, V.; van der Westhuizen, B.; Wijayathilake, D.; Wong, P.S.O.; Wycoff, E.B.; Yeun, E.J.

    2009-01-01

    Roč. 22, 1/2 (2009), s. 253-279 ISSN 0933-1719 R&D Projects: GA ČR GA406/07/1561 Institutional research plan: CEZ:AV0Z70250504 Keywords : cross - cultural comparisons * gelotophobia * humor * multi-national study Subject RIV: AN - Psychology Impact factor: 0.771, year: 2009

  18. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  19. Strigolaktony - Struktura a funkce v rostlinách

    Czech Academy of Sciences Publication Activity Database

    Dvořáková, Marcela; Vaněk, Tomáš

    2015-01-01

    Roč. 109, č. 10 (2015), s. 762-769 ISSN 0009-2770 R&D Projects: GA MŠk LD14127 Institutional support: RVO:61389030 Keywords : strigolactones * fytohormones * arbuscular mycorrhizal fungi Subject RIV: CC - Organic Chemistry Impact factor: 0.279, year: 2015 http://www.chemicke-listy.cz/docs/ full /2015_10_762-769.pdf

  20. Genetic and clonal diversity of the endemic ant-plant Humboldtia ...

    Indian Academy of Sciences (India)

    Prakash

    [Dev S A, Shenoy M and Borges R M 2010 Genetic and clonal diversity of the endemic ant-plant Humboldtia brunonis (Fabaceae) in the Western. Ghats of India; J. Biosci. 35 267–279] DOI 10.1007/s12038-010-0031-5. Keywords. Caesalpinioideae; clonality; Detarieae; myrmecophyte; inter simple sequence repeats; spatial ...

  1. Adaptivní testování - základní pojmy a principy

    Czech Academy of Sciences Publication Activity Database

    Jelínek, Martin; Květon, Petr; Denglerová, Denisa

    2006-01-01

    Roč. 50, č. 2 (2006), s. 163-173 ISSN 0009-062X R&D Projects: GA ČR(CZ) GP406/06/P396 Institutional research plan: CEZ:AV0Z70250504 Keywords : diagnostics * computer adaptive testing * item response theory (IRT) Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  2. Hyaluronan minimizes effects of UV irradiation on human keratinocytes

    Czech Academy of Sciences Publication Activity Database

    Hašová, M.; Crhák, Tomáš; Šafaříková, Barbora; Dvořáková, J.; Muthný, T.; Velebný, V.; Kubala, Lukáš

    2011-01-01

    Roč. 303, č. 4 (2011), s. 277-284 ISSN 0340-3696 R&D Projects: GA ČR(CZ) GA305/08/1704 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : hyaluronan * keratinocyte * ultraviolet light Subject RIV: BO - Biophysics Impact factor: 2.279, year: 2011

  3. Sympatric occurrence of various cytotypes of Vaccinium sect. Oxycoccus (Ericaceae)

    Czech Academy of Sciences Publication Activity Database

    Suda, Jan

    2003-01-01

    Roč. 22, - (2003), s. 593-601 ISSN 0107-055X R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : Ericaceae * Vaccinium * flow cytometry Subject RIV: EF - Botanics Impact factor: 0.279, year: 2003

  4. Cacilda Borges Do Valle

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Cacilda Borges Do Valle. Articles written in Journal of Genetics. Volume 83 Issue 3 December 2004 pp 279-283 Research Note. Abnormal pollen mitoses (PM I and PM II) in an interspecific hybrid of Brachiaria ruziziensis and Brachiaria decumbens (Gramineae) · Andréa Beatriz ...

  5. The c.IVS1+1G>A mutation inthe GJB2 gene is prevalent and large ...

    Indian Academy of Sciences (India)

    congenital or prelingual-onset moderate to profound non- syndromic sensorineural hearing loss. Sixteen probands (12 multiplex, 4 simplex) had single exon 2 GJB2 mutations, whereas 279 probands did not have any pathological GJB2 alleles. Fifteen heterozygote probands had the c.35delG and one proband had the p.

  6. Species composition, length-weight relationship and condition factor ...

    African Journals Online (AJOL)

    Chrysichthys nigrodigitatus (b=3.75), Mugil cephalus (b=3.02) and Atherina formis (b=3.46) exhibited positive allometry growth while Pseudotolithus elongatus (b=2.55), Eleotris africana (b=2.79), Sardinella maderemsis (b=2.04), Periophthalmus barbarous (b=2.77), Microchirus poscanion had negative allometry growth.

  7. Is the Universe More Transparent to Gamma Rays than Previously Thought?

    Science.gov (United States)

    Stecker, Floyd W.; Scully, Sean T.

    2009-01-01

    The MAGIC collaboration has recently reported the detection of the strong gamma-ray blazar 3C279 during a 1-2 day flare. They have used their spectral observations to draw conclusions regarding upper limits on the opacity of the Universe to high energy gamma-rays and, by implication, upper limits on the extragalactic mid-infrared background radiation. In this paper we examine the effect of gamma-ray absorption by the extragalactic infrared radiation on intrinsic spectra for this blazar and compare our results with the observational data on 3C279. We find agreement with our previous results, contrary to the recent assertion of the MAGIC group that the Universe is more transparent to gamma-rays than our calculations indicate. Our analysis indicates that in the energy range between approx. 80 and approx. 500 GeV, 3C279 has a best-fit intrinsic spectrum with a spectral index approx. 1.78 using our fast evolution model and approx. 2.19 using our baseline model. However, we also find that spectral indices in the range of 1.0 to 3.0 are almost as equally acceptable as the best fit spectral indices. Assuming the same intrinsic spectral index for this flare as for the 1991 flare from 3C279 observed by EGRET, viz., 2.02, which lies between our best fit indeces, we estimate that the MAGIC flare was approx.3 times brighter than the EGRET flare observed 15 years earlier.

  8. Conization of the cervix uteri. Complications in connection with plain catgut or silk suturing

    DEFF Research Database (Denmark)

    Holmskov, A; Qvist, N; Møller, A

    1984-01-01

    During a retrospective study on postoperative complications in 213 patients who had undergone conization, a (non-significant) reduction in the bleeding rate from 27.9% to 18.6% was found when using silk sutures (102 patients) instead of plain catgut (111 patients) for adaption of the edges of the...

  9. Confining strings revisited - a short comment

    International Nuclear Information System (INIS)

    Botelho, Luiz C.L.

    2000-03-01

    We show that Polyakov's confining string Nucl. Phys. B486, (1997) 23, is the author's previously proposed self-avoiding extrinsic strings (Luiz C.L. Botelho), Rev. Bras. Fis. 16, 279, (1986); CALTECH-preprint 68, 1444, (1987); J. Math. Phys. 30 (9), (1989), 2160). (author)

  10. A new species of Australotaenia (Cestoda: Proteocephalidea) from a snake in Cambodia: host switching or postcyclic parasitism in a distant region?

    Czech Academy of Sciences Publication Activity Database

    de Chambrier, A.; Scholz, Tomáš

    2012-01-01

    Roč. 59, č. 4 (2012), s. 279-286 ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : taxonomy * zoogeography * tapeworms * helminths * Reptilia * South East Asia * Indomalayan Region Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.515, year: 2012 http://folia.paru.cas.cz/detail.php?id=22092

  11. Do plants and animals differ in phenotypic plasticity?

    Indian Academy of Sciences (India)

    Unknown

    between plants; Science 221 277–279. Ballaré C L 1999 Keeping up with the neighbours: phyto- chrome sensing and other signalling mechanisms; Trends Plant. Sci. 4 97–102. Baluška F, Hlavacka A, Volkmann D and Menzel D 2004 Get- ting connected: actin-based cell-to-cell channels in plants and animals; Trends Cell ...

  12. Protection of marine birds and turtles at St Brandon's Rock, Indian ...

    African Journals Online (AJOL)

    A survey of seabirds and turtles at St Brandon's Rock, 400 km north of Mauritius, was undertaken in 2010. We estimated that 1 084 191 seabirds comprising seven breeding species and excluding non-breeders were present at the archipelago and we counted 279 turtle tracks and nesting pits of green turtles Chelonia ...

  13. Analytical results for the Sznajd model of opinion formation

    Czech Academy of Sciences Publication Activity Database

    Slanina, František; Lavička, H.

    2003-01-01

    Roč. 35, - (2003), s. 279-288 ISSN 1434-6028 R&D Projects: GA ČR GA202/01/1091 Institutional research plan: CEZ:AV0Z1010914 Keywords : agent models * sociophysics Subject RIV: BE - Theoretical Physics Impact factor: 1.457, year: 2003

  14. Description of .i.Paratylenchus (Gracilacus) straeleni./i. (De Coninck, 1931) Oostenbrink, 1960 (Nematoda: Criconematoidea, Tylenchulidae) from hazelnut in Turkey and its comparison with other world populations

    Czech Academy of Sciences Publication Activity Database

    Akyazi, F.; Felek, A.F.; Čermák, V.; Čudejková, M.; Foit, J.; Yildiz, S.; Háněl, Ladislav

    2015-01-01

    Roč. 52, č. 3 (2015), s. 270-279 ISSN 0440-6605 Grant - others:GA MŠk(CZ) EE2.3.20.0265 Program:EE Institutional support: RVO:60077344 Keywords : Corylus avellana * multivariate analyses * phylogeny * sequencing * species complex Subject RIV: EG - Zoology Impact factor: 0.602, year: 2015

  15. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... scattering potentials. pp 279-286. The non-equivalence of pseudo-Hermiticity and presence of antilinear symmetry ... pp 287-297. Classical and quantum mechanics of complex Hamiltonian systems: An extended complex phase space approach ... Sturm–Schrödinger equations: Formula for metric · Miloslav Znojil Hendrik ...

  16. Evaluation of workshops on healing through multicultural counseling ...

    African Journals Online (AJOL)

    Evaluation of workshops on healing through multicultural counseling: Sport psychology implications. ... were conducted at universities in South Africa and the United Kingdom respectively with a total sample of 52 participants; 18 women and 27 men, with a mean age of 27.9 years and an age range of 20 to 51 years.

  17. Cyanocohniella calida gen. et sp. nov. (Cyanobacteria: Aphanizomenonaceae) a new cyanobacterium from the thermal springs from Karlovy Vary, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kaštovský, J.; Berrendero Gomez, E.; Hladil, Jindřich; Johansen, J. R.

    2014-01-01

    Roč. 181, č. 5 (2014), s. 279-292 ISSN 1179-3155 Institutional support: RVO:67985831 Keywords : Cyanobacteria * new genus * polyphasic approach * thermal springs * Karlovy Vary Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.318, year: 2014

  18. The effect of temperature on the phenology of germination of Isoëtes lacustris

    Czech Academy of Sciences Publication Activity Database

    Čtvrtlíková, Martina; Znachor, P.; Vrba, J.

    2014-01-01

    Roč. 86, č. 3 (2014), 279-292 ISSN 0032-7786 R&D Projects: GA ČR GAP504/10/0781; GA AV ČR KJB600050704 Institutional support: RVO:67985939 Keywords : aquatic lycopod * reproduction * early ontogeny Subject RIV: EF - Botanics Impact factor: 4.104, year: 2014

  19. Sexual regeneration on a tropical inselberg in French Guiana: an inselberg specialist versus a species with a wider ecological amplitude

    Czech Academy of Sciences Publication Activity Database

    Vlasáková, Blanka

    2013-01-01

    Roč. 214, č. 2 (2013), s. 279-290 ISSN 1385-0237 R&D Projects: GA ČR GPP505/12/P039 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Clusia * inselberg * life strategy Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013

  20. Application of high resolution SNP arrays in patients with congenital ...

    Indian Academy of Sciences (India)

    TING-YING LEI

    ... Shen H., Ishida S. and Dickson C. 2004 SOX7 and. GATA-4 are competitive activators of Fgf-3 transcription. J. Biol. Chem. 279, 28564–28573. Penttinen M., Koillinen H., Niinikoski H., Makitie O. and Hietala. M. 2009 Genitopatellar syndrome in an adolescent female with severe osteoporosis and endocrine abnormalities.

  1. African Journal of AIDS Research - Vol 7, No 3 (2008)

    African Journals Online (AJOL)

    Bridging the gap between VCT and HIV/AIDS treatment uptake: perspectives from a mining-sector workplace in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Anil Bhagwanjee, Inge Petersen, Olagoke Akintola, Gavin George, 271-279.

  2. Search for supersymmetry in events with photons, bottom quarks, and missing transverse momentum in proton-proton collisions at a centre-of-mass energy of 7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abajyan, T.; Abbott, B.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Vrba, Václav; Zeman, Martin

    2013-01-01

    Roč. 719, 4-5 (2013), s. 261-279 ISSN 0370-2693 R&D Projects: GA MŠk LA08032 Institutional support: RVO:68378271 Keywords : ATLAS * CERN * supersymmetry * Gauge mediation * Higgs boson Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.019, year: 2013

  3. Vegetable and fruit consumption and prostate cancer risk: A cohort study in the Netherlands

    NARCIS (Netherlands)

    Schuurman, A.G.; Goldbohm, R.A.; Dorant, E.; Brandt, P.A. van den

    1998-01-01

    The association between 21 vegetables and eight fruits and prostate cancer risk was assessed in the Netherlands Cohort Study among 58,279 men of ages 55-69 years at baseline in 1986. After 6.3 years of follow-up, 610 cases with complete vegetable data and 642 cases with complete fruit data were

  4. Production of Aspergillus niger β-mannosidase in Pichia pastoris

    Czech Academy of Sciences Publication Activity Database

    Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír

    2012-01-01

    Roč. 279, č. 1 (2012), s. 247-247 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline

  5. What Are the Factors That Put a Pregnancy at Risk?

    Science.gov (United States)

    ... ts=20120730T1640322605 (PDF – 279 KB) MedlinePlus. (n.d.). Teenage pregnancy . Retrieved June 19, 2012, from http://www.nlm. ... medlineplus/teenagepregnancy.html American Academy of Pediatrics. (2011). Teenage Pregnancy . Retrieved August 7, 2012, from http://www.healthychildren. ...

  6. Effects of a Rape Awareness Program on College Women: Increasing Bystander Efficacy and Willingness to Intervene

    Science.gov (United States)

    Foubert, John D.; Langhinrichsen-Rohling, Jennifer; Brasfield, Hope; Hill, Brent

    2010-01-01

    An experimental study evaluated the efficacy of a sexual assault risk-reduction program on 279 college women that focused on learning characteristics of male perpetrators and teaching bystander intervention techniques. After seeing The Women's Program, participants reported significantly greater bystander efficacy and significantly greater…

  7. A comparative study of atenolol, nifedipine and their combination in ...

    African Journals Online (AJOL)

    1991-01-05

    Jan 5, 1991 ... related target organ damage by average day-time blood pressure. Clin Exp. Hypertens [A] 1985; 7: 267-278. 22. Mann S, Millar-Craig MW, Raftery EB. Superiority of 24 hour measurement of blood pressure over clinic values in determining prognosis in hypertension. Clin Erp Hypertens [A] 1985; 7: 279-282.

  8. Confining strings revisited - a short comment

    Energy Technology Data Exchange (ETDEWEB)

    Botelho, Luiz C.L. [Universidade Federal Rural do Rio de Janeiro, RJ (Brazil). Dept. de Fisica

    2000-03-01

    We show that Polyakov's confining string Nucl. Phys. B486, (1997) 23, is the author's previously proposed self-avoiding extrinsic strings (Luiz C.L. Botelho), Rev. Bras. Fis. 16, 279, (1986); CALTECH-preprint 68, 1444, (1987); J. Math. Phys. 30 (9), (1989), 2160. (author)

  9. 78 FR 44341 - Semiannual Regulatory Agenda

    Science.gov (United States)

    2013-07-23

    ... Acquisition 9000-AL82 Regulation (FAR); FAR Case 2011-001; Organizational Conflicts of Interest. 279 Federal... Contractor Excise Tax. 291 Federal Acquisition 9000-AM21 Regulation (FAR); FAR Case 2011-028; Nondisplacement... to help source selection officials make better award decisions. This case is included in the FAR...

  10. Case report

    African Journals Online (AJOL)

    ebutamanya

    2015-06-22

    Jun 22, 2015 ... Blood Reviews. 2013; 27: 279-287. PubMed | Google Scholar. 4. Milton J N, Gordeuk V R, Taylor VI J G, Gladwin M T, Steinberg. M H, Sebastiani P. Prediction of fetal hemoglobin in sickle cell anemia using an ensemble of genetic risk. Circ Cardiovasc. Genet. 2014; 7(2):110-115. PubMed | Google Scholar.

  11. Integrating Vision and Audition within a Cognitive Architecture to Track Conversations

    Science.gov (United States)

    2008-03-01

    tracking begins with a detection system that dis- tinguishes people from other objects in a room. To detect people a boosted cascade detection algorithm...action. Journal of Physiology-Paris, 98(1-3):265–279, 2004. [21] R. Lienhart and J. Maydt. An extended set of haar -like features for rapid object

  12. Anti-tumour immune effect of oral administration of Lactobacillus ...

    Indian Academy of Sciences (India)

    2015-04-27

    tumour immune effect of oral administration of Lactobacillus plantarum to CT26 tumour-bearing mice. J. Biosci. 40 269–279] DOI 10.1007/s12038-015-9518-4. 1. Introduction. Colorectal cancer (CRC) is one of the most prevalent ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Articles written in Resonance – Journal of Science Education. Volume 13 Issue 6 June 2008 pp ... 885-894 Reflections. The Scientific Enterprise - Assumptions, Problems, and Goals in the Modern Scientific Framework · V V Raman ... 2011 pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

  14. Anthropometry in relation to prostate cancer risk in the Netherlands : cohort study

    NARCIS (Netherlands)

    Schuurman, A.G.; Goldbohm, R.A.; Dorant, E.; Brandt, P.A. van den

    2000-01-01

    In the Netherlands Cohort Study, the authors investigated whether anthropometry is associated with prostate cancer risk. At baseline in 1986, 58,279 men aged 55-69 years completed a self- administered questionnaire on diet, anthropometry, and other risk factors for cancer. After 6.3 years of

  15. Th·e Vitalograph- A Study of Its Role hI Pulmonary Function Testing ...

    African Journals Online (AJOL)

    Standing pulmonary function studies (FVC, FEV, and. MVV) were carried out using the Vitalograph alone on. 279 normal healthy children (140 boys and 139 girls), aged. 6 - 18 years, mean heights 156 cm and 149 cm for boys and girls respectively. The best of 4 readings were analysed, compared and presented as above.

  16. Od strukturalismu k nové naratologii

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej

    2014-01-01

    Roč. 17, č. 1 (2014), s. 279-285 ISSN 1803-845X R&D Projects: GA ČR GA13-29985S Institutional support: RVO:68378068 Keywords : narratology * narrative * structuralism * structure * history Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Continuing Medical Education - Vol 31, No 8 (2013)

    African Journals Online (AJOL)

    Nuclear medicine in oncology 1: Lymphoma, and cancer of the lung, colon, and oesophagus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Ellmann, J Holness, 279-283. Nuclear medicine in oncology 2: Breast, prostate, and cervical cancer, melanoma, and ...

  18. Association analyses suggest GPR24 as a shared susceptibility gene for bipolar affective disorder and schizophrenia

    DEFF Research Database (Denmark)

    Severinsen, J E; Als, T D; Binderup, H

    2006-01-01

    M segment on 22q13. The present study investigated three candidate genes located in this segment: GPR24, ADSL, and ST13. Nine SNPs located in these genes and one microsatellite marker (D22S279) were applied in an association analysis of two samples: an extension of the previously analyzed Faeroese sample...

  19. Hispanics in Fast Food Jobs.

    Science.gov (United States)

    Charner, Ivan; Fraser, Bryna Shore

    A study examined the employment of Hispanics in the fast-food industry. Data were obtained from a national survey of employees at 279 fast-food restaurants from seven companies in which 194 (4.2 percent) of the 4,660 respondents reported being Hispanic. Compared with the total sample, Hispanic fast-food employees were slightly less likely to be…

  20. Current reflection and transmission at conformal defects: applying BCFT to transport process

    Czech Academy of Sciences Publication Activity Database

    Kimura, T.; Murata, Masaki

    2014-01-01

    Roč. 885, Aug (2014), 266-279 ISSN 0550-3213 R&D Projects: GA ČR GBP201/12/G028 Institutional support: RVO:68378271 Keywords : boundary conformal field theory Subject RIV: BE - Theoretical Physics Impact factor: 3.929, year: 2014