WorldWideScience

Sample records for meitnerium 275

  1. 7 CFR 275.15 - Data management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Data management. 275.15 Section 275.15 Agriculture... § 275.15 Data management. (a) Analysis. Analysis is the process of classifying data, such as by areas of... management information sources available to: (1) Identify all deficiencies in program operations and systems...

  2. 27 CFR 25.275 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false 25.275 Section 25.275 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Pilot Brewing Plants § 25.275 ...

  3. 7 CFR 275.11 - Sampling.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Sampling. 275.11 Section 275.11 Agriculture... § 275.11 Sampling. (a) Sampling plan. Each State agency shall develop a quality control sampling plan which demonstrates the integrity of its sampling procedures. (1) Content. The sampling plan shall...

  4. 25 CFR 275.4 - Implementing regulations.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Implementing regulations. 275.4 Section 275.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM STAFFING § 275.4 Implementing regulations. Regulations to implement section 105 of the Act...

  5. 275 C Downhole Microcomputer System

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Hooi Miin Soo

    2008-08-31

    An HC11 controller IC and along with serial SRAM and ROM support ICs chip set were developed to support a data acquisition and control for extreme temperature/harsh environment conditions greater than 275 C. The 68HC11 microprocessor is widely used in well logging tools for control, data acquisition, and signal processing applications and was the logical choice for a downhole controller. This extreme temperature version of the 68HC11 enables new high temperature designs and additionally allows 68HC11-based well logging tools and MWD tools to be upgraded for high temperature operation in deep gas reservoirs, The microcomputer chip consists of the microprocessor ALU, a small boot ROM, 4 kbyte data RAM, counter/timer unit, serial peripheral interface (SPI), asynchronous serial interface (SCI), and the A, B, C, and D parallel ports. The chip is code compatible with the single chip mode commercial 68HC11 except for the absence of the analog to digital converter system. To avoid mask programmed internal ROM, a boot program is used to load the microcomputer program from an external mask SPI ROM. A SPI RAM IC completes the chip set and allows data RAM to be added in 4 kbyte increments. The HC11 controller IC chip set is implemented in the Peregrine Semiconductor 0.5 micron Silicon-on-Sapphire (SOS) process using a custom high temperature cell library developed at Oklahoma State University. Yield data is presented for all, the HC11, SPI-RAM and ROM. The lessons learned in this project were extended to the successful development of two high temperature versions of the LEON3 and a companion 8 Kbyte SRAM, a 200 C version for the Navy and a 275 C version for the gas industry.

  6. 14 CFR 171.275 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.275 Section 171.275... Reports. The owner of the ISMLS facility or his maintenance representative must make the following reports... the need for periodic maintenance visits to the facility, monthly reports from the remote monitoring...

  7. Effects of W on hydrogen transport property of Nb45Ti27.5Ni27.5 alloy membranes

    Science.gov (United States)

    Yang, Yang; Liu, Dongrong; Zhu, Zhifei; Liu, Guohuai

    2017-12-01

    Alloying influences of tungsten (W) into Nb45Ti27.5Ni27.5 on the microstructure, hydrogen solubility, diffusivity, permeability and resistance to hydrogen embrittlement have been investigated. Four experimental temperatures (673, 623, 573 and 523 K) have been used. It is found that the addition of W (5 at.% and 10 at.%) reduces the hydrogen solubility. The constitution of phases is not changed with W addition, whereas volume fraction of primary bcc-niobium (Nb) phase is distinctly reduced for the content of 10 at.% W. The hydrogen permeability and diffusivity increase for Nb40W5Ti27.5Ni27.5 only at lower temperatures such as 573 K and 523 K. Addition of 10 at.% W causes an obvious reduction in the permeability and diffusivity. The Nb45Ti27.5Ni27.5 alloy membrane fractures at 125∘C, while Nb40W5Ti27.5Ni27.5 and Nb35W10Ti27.5Ni27.5 alloy membranes keep intact when temperature reaches to 100∘C. In comparison with Nb45Ti27.5Ni27.5, the present research confirms that Nb40W5Ti27.5Ni27.5 exhibits an enhancement in hydrogen permeability at relatively lower temperatures and an improvement in embrittlement resistance.

  8. 21 CFR 73.275 - Dried algae meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture broth...

  9. 7 CFR 275.21 - Quality control review reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Quality control review reports. 275.21 Section 275.21... Reporting on Program Performance § 275.21 Quality control review reports. (a) General. Each State agency shall submit reports on the performance of quality control reviews in accordance with the requirements...

  10. 40 CFR 180.275 - Chlorothalonil; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... residues. 180.275 Section 180.275 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.275 Chlorothalonil; tolerances for residues. (a) General. (1) Tolerances are established for the...

  11. 17 CFR 275.206(4)-6 - Proxy voting.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Proxy voting. 275.206(4)-6...) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-6 Proxy voting. If you are an... respect to their securities; and (c) Describe to clients your proxy voting policies and procedures and...

  12. 49 CFR 192.275 - Cast iron pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Cast iron pipe. 192.275 Section 192.275... Cast iron pipe. (a) Each caulked bell and spigot joint in cast iron pipe must be sealed with mechanical leak clamps. (b) Each mechanical joint in cast iron pipe must have a gasket made of a resilient...

  13. 32 CFR Appendix B to Part 275 - Obtaining Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Customer Authorization B Appendix B to... OF 1978 Pt. 275, App. B Appendix B to Part 275—Obtaining Customer Authorization A. A DoD law... feasible, obtain the customer's consent. B. Any authorization obtained under paragraph A. of this appendix...

  14. 21 CFR 137.275 - Yellow corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn meal. 137.275 Section 137.275 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... identity prescribed by § 137.250 for white corn meal except that cleaned yellow corn is used instead of...

  15. 21 CFR 173.275 - Hydrogenated sperm oil.

    Science.gov (United States)

    2010-04-01

    ... FOR HUMAN CONSUMPTION (CONTINUED) SECONDARY DIRECT FOOD ADDITIVES PERMITTED IN FOOD FOR HUMAN CONSUMPTION Solvents, Lubricants, Release Agents and Related Substances § 173.275 Hydrogenated sperm oil. The...

  16. 24 CFR 990.275 - Project-based management (PBM).

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Project-based management (PBM). 990... URBAN DEVELOPMENT THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.275 Project-based... of rental housing at the project level. Under PBM, these property management services are arranged...

  17. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  18. 33 CFR 104.275 - Security measures for handling cargo.

    Science.gov (United States)

    2010-07-01

    ... SECURITY MARITIME SECURITY MARITIME SECURITY: VESSELS Vessel Security Requirements § 104.275 Security...) Maritime Security (MARSEC) Level 1. At MARSEC Level 1, the vessel owner or operator must ensure the..., container, or other cargo transport units are loaded; (3) Intensifying screening of vehicles to be loaded on...

  19. 21 CFR 172.275 - Synthetic paraffin and succinic derivatives.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Synthetic paraffin and succinic derivatives. 172... FOOD FOR HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.275 Synthetic paraffin and succinic derivatives. Synthetic paraffin and succinic derivatives identified in this section may be safely...

  20. 37 CFR 2.75 - Amendment to change application to different register.

    Science.gov (United States)

    2010-07-01

    ... application to different register. 2.75 Section 2.75 Patents, Trademarks, and Copyrights UNITED STATES PATENT... Application § 2.75 Amendment to change application to different register. (a) An application for registration... may be amended to change the application to a different register only after submission of an...

  1. Inelastic scattering of 275 keV neutrons by silver

    International Nuclear Information System (INIS)

    Litvinsky, L.L.; Zhigalov, Ya.A.; Krivenko, V.G.; Purtov, O.A.; Sabbagh, S.

    1997-01-01

    Neutron total, elastic and inelastic scattering cross-scattering of Ag at the E n = 275 KeV neutron energy were measured by using the filtered neutron beam of the WWR-M reactor in Kiev. The d-neutron strength function S n2 of Ag was determined from the analysis of all available data in the E n ≤ keV energy region on neutron inelastic scattering cross-sections with excitation of the first isomeric levels I π m = 7/2 + , E m ∼ 90 keV of 107,109 Ag: S n2 = (1.03 ± 0.19) · 10 -4 . (author). 10 refs, 3 figs

  2. 275 C Downhole Switched-Mode Power Supply

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Vijay Madhuravasal

    2008-08-31

    A vee-square (V2) control based controller IC is developed for a switch mode power supply capable of operating at extreme temperature/harsh environment conditions. A buck type regulator with silicon carbide power junction field effect transistors (JFET) as power devices is used to analyze the performance of controller. Special emphases are made on the analog sub-blocks--voltage reference, operational transconductance amplifier and comparator as individual building blocks. Transformer coupled gate drives and high temperature operable magnetic cores and capacitors are identified and tested for use in the design. Conventional ceramic chip packaging of ICs combined with lead carrier type mounting of passive filter components is introduced for hybrid packaging of the complete product. The developed SMPS is anticipated to support the operation of down-hole microcontrollers and other electronics devices that require low/medium power filtered dc inputs over an operating temperature of 275 C.

  3. East Weddell Sea echinoids from the JR275 expedition

    Directory of Open Access Journals (Sweden)

    Thomas Saucède

    2015-05-01

    Full Text Available Information regarding the echinoids in this dataset is based on the Agassiz Trawl (AGT and epibenthic sledge (EBS samples collected during the British Antarctic Survey cruise JR275 on the RRS James Clark Ross in the austral summer 2012. A total of 56 (1 at the South Orkneys and 55 in the Eastern Weddell Sea Agassiz Trawl and 18 (2 at the South Orkneys and 16 in the Eastern Weddell Sea epibenthic sledge deployments were performed at depths ranging from ~280 to ~2060 m. This presents a unique collection for the Antarctic benthic biodiversity assessment of an important group of benthic invertebrates. In total 487 specimens belonging to six families, 15 genera, and 22 morphospecies were collected. The species richness per station varied between one and six. Total species richness represents 27% of the 82 echinoid species ever recorded in the Southern Ocean (David et al. 2005b, Pierrat et al. 2012, Saucède et al. 2014. The Cidaridae (sub-family Ctenocidarinae and Schizasteridae are the two most speciose families in the dataset. They comprise seven and nine species respectively. This is illustrative of the overall pattern of echinoid diversity in the Southern Ocean where 65% of Antarctic species belong to the families Schizasteridae and Cidaridae (Pierrat et al. 2012.

  4. Composite augmentation phalloplasty: personal experience after 275 patients

    Directory of Open Access Journals (Sweden)

    Juan Monreal

    2015-03-01

    Full Text Available Aim: To report the author's experience in augmentation phalloplasty by studying a retrospective series of patients who underwent fat grafting for girth enhancement or a composite technique based on suspensory ligament release plus fat grafting performed simultaneously. Methods: The author analyzed retrospectively the outcomes of 275 augmentation phalloplasty procedures performed in 259 patients until November 2013. Of these, 127 correspond to girth augmentation with fat grafting and 148 to composite augmentation phalloplasty (girth augmentation with fat grafting and length improvement by suspensory ligament release. In 16 patients girth and length enhancement were performed in two separate procedures. Results: Of this 259 patients, 87 underwent postoperative follow-up for at least 12 months and 160 patients underwent follow-up for at least 6 months. The average increase in circumference at 6 months was 1.7 cm (1.57 cm at 12 months and the average increase in length of 3.2 cm (3.1 cm at 12 months. Twenty-two patients showed minor complications that were treated without sequelae and without influencing the final result. Conclusion: By judicious use of currently available techniques, it is possible to achieve stable increases in penis size. The use of composite techniques provides better final results than the use of individual techniques performed alone due to the increase of the actual volume of the penis. An adequate informed consent is essential in all patients due to the unrealistic expectations expressed by the majority of them.

  5. 12 CFR 563b.275 - How do I file revised proxy materials?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How do I file revised proxy materials? 563b.275... FROM MUTUAL TO STOCK FORM Standard Conversions Proxy Solicitation § 563b.275 How do I file revised proxy materials? (a) You must file revised proxy materials as an amendment to your application for...

  6. 32 CFR Appendix J to Part 275 - Format for Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Format for Customer Authorization J Appendix J... OF 1978 Pt. 275, App. J Appendix J to Part 275—Format for Customer Authorization Pursuant to section 3404(a) of the Right to Financial Privacy Act of 1978, I, [Name of customer], having read the...

  7. 24 CFR 213.275 - Nature of the Cooperative Management Housing Insurance Fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of the Cooperative Management Housing Insurance Fund. 213.275 Section 213.275 Housing and Urban Development Regulations Relating... Nature of the Cooperative Management Housing Insurance Fund. The Cooperative Management Housing Insurance...

  8. 5 CFR 532.275 - Special wage schedules for ship surveyors in Puerto Rico.

    Science.gov (United States)

    2010-01-01

    ... in Puerto Rico. 532.275 Section 532.275 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... schedules for ship surveyors in Puerto Rico. (a) The Department of Defense shall establish special wage schedules for nonsupervisory ship surveyors and supervisory ship surveyors in Puerto Rico. (b) Rates shall...

  9. 32 CFR Appendix G to Part 275 - Releasing Information Obtained From Financial Institutions

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Releasing Information Obtained From Financial... SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT OF 1978 Pt. 275, App. G Appendix G to Part 275—Releasing Information Obtained From...

  10. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of business...

  11. Complete genome sequence of Bacillus sp. 275, producing extracellular cellulolytic, xylanolytic and ligninolytic enzymes.

    Science.gov (United States)

    Gong, Gyeongtaek; Kim, Seil; Lee, Sun-Mi; Woo, Han Min; Park, Tai Hyun; Um, Youngsoon

    2017-07-20

    Technologies for degradation of three major components of lignocellulose (e.g. cellulose, hemicellulose and lignin) are needed to efficiently utilize lignocellulose. Here, we report Bacillus sp. 275 isolated from a mudflat exhibiting various lignocellulolytic activities including cellulase, xylanase, laccase and peroxidase in the cell culture supernatant. The complete genome of Bacillus sp. 275 strain contains 3832 protein cording sequences and an average G+C content of 46.32% on one chromosome (4045,581bp) and one plasmid (6389bp). The genes encoding enzymes related to the degradation of cellulose, xylan and lignin were detected in the Bacillus sp. 275 genome. In addition, the genes encoding glucosidases that hydrolyze starch, mannan, galactoside and arabinan were also found in the genome, implying that Bacillus sp. 275 has potentially a wide range of uses in the degradation of polysaccharide in lignocellulosic biomasses. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. 275 Damping-off Disease of two Pulp and Paper Forest Species ...

    African Journals Online (AJOL)

    Nekky Umera

    Damping-off Disease of two Pulp and Paper Forest Species. (Pinus caribaea Morelet and Pinus oocarpa Schiede) in the. Nursery (Pp. 275-282). Omokhua, G. E. - Department of Forestry and Wildlife Management,. Faculty of Agriculture, University of Port Harcourt, P. M. B. 5323, Port. Harcourt, Rivers State, Nigeria.

  13. 17 CFR 275.203A-2 - Exemptions from prohibition on Commission registration.

    Science.gov (United States)

    2010-04-01

    ... investment adviser that is a “pension consultant,” as defined in this section, with respect to assets of plans having an aggregate value of at least $50,000,000. (2) An investment adviser is a pension... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203A-2...

  14. Effects of electromagnetic field of 33 and 275 kV influences on ...

    African Journals Online (AJOL)

    The effects of electromagnetic fields (EMF) from 33 and 275 kV high voltage transmission line on biochemical and antioxidant system changes in mustard leaf (Brassica chinensis) were investigated under field condition. Mustard leaves were exposed to EMF from power lines at distances of 0, 3, 6, 9, 10, 12, 15, 18, 20, 21, ...

  15. 17 CFR 275.206(4)-1 - Advertisements by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements by investment advisers. (a) It shall constitute a fraudulent, deceptive, or manipulative act...

  16. 20 CFR 404.275 - How is an automatic cost-of-living increase calculated?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How is an automatic cost-of-living increase..., SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.275 How is an automatic cost-of-living increase calculated? (a) Increase based on the CPI. We...

  17. 7 CFR 275.18 - Project area/management unit corrective action plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Project area/management unit corrective action plan... SYSTEM Corrective Action § 275.18 Project area/management unit corrective action plan. (a) The State agency shall ensure that corrective action plans are prepared at the project area/management unit level...

  18. Ário Dídimo, Epítome de Ética Estoica, 2.7.5A- 2.7.5B

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinto de Brito

    2016-06-01

    Full Text Available RESUMO: Tradução dos passos 2.7.5A- 2.7.5B da Epitome de Etica Estoica, do filósofo estoico e doxógrafo alexandrino Ário Dídimo (acme 30 a.C.. Não há traduções em língua moderna das obras completas de Ário Dídimo. Assim, para esta tradução, usamos a fixação da exposição sobre a ética estoica presente em Estobeu (Florilegio, realizada por Pomeroy (1999. A seção que traduzimos versa sobre o conceito estoico de excelência, explicando o que ela é, quais as virtudes que dela participam, e como. Por antítese, Ário Dídimo também elucida o conceito estoico de vício, o que ele é e qual a sua taxonomia.

  19. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... which you provide investment advice based on its investment objectives rather than the individual investment objectives of its shareholders, partners, limited partners, members, or beneficiaries (any of... investment adviser. 275.203(b)(3)-1 Section 275.203(b)(3)-1 Commodity and Securities Exchanges SECURITIES AND...

  20. Evaluation of Characteristics of Lightning Faults on 275kV Transmission Lines

    Science.gov (United States)

    Kawamura, Hironao; Itamoto, Naoki; Shinjo, Kazuo; Ishii, Masaru

    It is effective to design the lightning protection of transmission lines by employing simulation to be able to reproduce conditions of experienced lightning faults. As a result of the lightning faults on 275kV transmission lines in Hokuriku area, the frequency of only one-ground fault of upper or middle lines is higher. Especially, the frequency of one-ground faults of the middle lines in summer is the highest. It is thought that many one-ground faults in summer are caused by direct lightning strokes to phase conductors. Moreover, multi-ground faults caused by lightning strokes to tower tops or overhead ground wires also include many ground faults of the middle lines. In this paper, the experienced lightning faults on the 275kV transmission lines are reproduced by EMTP calculations and the characteristics of the ground-fault lines are examined.

  1. MicroRNA-275 and its target Vitellogenin-2 are crucial in ovary development and blood digestion of Haemaphysalis longicornis.

    Science.gov (United States)

    Hao, Jiawei; Luo, Jin; Chen, Ze; Ren, Qiaoyun; Guo, Jinxia; Liu, Xiaocui; Chen, Qiuyu; Wu, Feng; Wang, Zhen; Luo, Jianxun; Yin, Hong; Wang, Hui; Liu, Guangyuan

    2017-05-22

    The hard tick Haemaphysalis longicornis is widely distributed in eastern Asia, New Zealand and Australia and is considered the major vector of Theileria and Babesia, harmful parasites to humans and animals. Female ticks need successful blood meals to complete the life-cycle. Therefore, elucidation of the underlying molecular mechanisms of H. longicornis development and reproduction is considered important for developing control strategies against the tick and tick-borne pathogens. Luciferase assays were used to identify the targets of micro RNA miR-275 in vitro. RNAi of Vitellogenin (Vg) was used in phenotype rescue experiments of ticks with miR-275 inhibition, and these analyses were used to identify the authentic target of miR-275 in vivo. The expression of miR-275 in different tissues and developmental stages of ticks was assessed by real-time PCR. To elucidate the functions of miR-275 in female ticks, we injected a miR-275 antagomir into female ticks and observed the phenotypic changes. Statistical analyses were performed with GraphPad5 using Student's t-test. In this study, we identified Vg-2 as an authentic target of miR-275 both in vitro and in vivo by luciferase assays and phenotype rescue experiments. miR-275 plays the regulatory role in a tissue-specific manner and differentially in developmental stages. Silencing of miR-275 resulted in blood digestion problems, substantially impaired ovary development and significantly reduced egg mass (P development. These findings improve the molecular understanding of tick development and reproduction.

  2. Detection of drugs in 275 alcohol-positive blood samples of Korean drivers.

    Science.gov (United States)

    Kim, Eunmi; Choe, Sanggil; Lee, Juseon; Jang, Moonhee; Choi, Hyeyoung; Chung, Heesun

    2016-08-01

    Since driving under the influence of drugs (DUID) is as dangerous as drink-driving, many countries regulate DUID by law. However, laws against the use of drugs while driving are not yet established in Korea. In order to investigate the type and frequency of drugs used by drivers in Korea, we analyzed controlled and non-controlled drugs in alcohol-positive blood samples. Total 275 blood samples were taken from Korean drivers, which were positive in roadside alcohol testing. The following analyses were performed: blood alcohol concentrations by GC; screening for controlled drugs by immunoassay and confirmation for positive samples by GC-MS. For the detection of DUID related drugs in blood samples, a total of 49 drugs were selected and were examined by GC-MS. For a rapid detection of these drugs, an automated identification software called "DrugMan" was used. Concentrations of alcohol in 275 blood samples ranged from 0.011 to 0.249% (average 0.119%). Six specimens showed positive results by immunoassay: one methamphetamine and five benzodiazepines I. By GC-MS confirmation, only benzodiazepines in four cases were identified, while methamphetamine and benzodiazepine in two cases were not detected from the presumptive positive blood samples. Using DrugMan, four drugs were detected; chlorpheniramine (5)*, diazepam (4), dextromethorphan (1) and doxylamine (1). In addition, ibuprofen (1), lidocaine (1) and topiramate (1) were also detected as general drugs in blood samples ('*' indicates frequency). The frequency of drug abuse by Korean drivers was relatively low and a total 14 cases were positive in 275 blood samples with a ratio of 5%. However it is necessary to analyze more samples including alcohol negative blood, and to expand the range of drug lists to get the detailed information. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. 33 CFR 334.275 - North and Southwest Branch, Back River, Hampton, U.S. Air Force Base, Langley, Va.; restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false North and Southwest Branch, Back River, Hampton, U.S. Air Force Base, Langley, Va.; restricted area. 334.275 Section 334.275 Navigation... RESTRICTED AREA REGULATIONS § 334.275 North and Southwest Branch, Back River, Hampton, U.S. Air Force Base...

  4. Peramivir analogues bearing hydrophilic side chains exhibit higher activities against H275Y mutant than wild-type influenza virus.

    Science.gov (United States)

    Chiu, Din-Chi; Lin, Tzu-Chen; Huang, Wen-I; Cheng, Ting-Jen; Tsai, Keng-Chang; Fang, Jim-Min

    2017-11-29

    Peramivir is an effective anti-influenza drug in the clinical treatment of influenza, but its efficacy toward the H275Y mutant is reduced. The previously reported cocrystal structures of inhibitors in the mutant neuraminidase (NA) suggest that the hydrophobic side chain should be at the origin of reduced binding affinity. In contrast, zanamivir having a hydrophilic glycerol side chain still possesses high affinity toward the H275Y NA. We thus designed five peramivir analogues (5-9) carrying hydrophilic glycol or glycerol side chains, and evaluated their roles in anti-influenza activity, especially for the H275Y mutant. The synthetic sequence involves a key step of (3 + 2) cycloaddition reactions between alkenes and nitrile oxides to construct the scaffold of peramivir carrying the desired hydrophilic side chains and other appropriate functional groups. The molecular docking experiments reveal that the hydrophilic side chain can provide extra hydrogen bonding with the translocated Glu-276 residue in the H275Y NA active site. Thus, the H275Y mutant may be even more sensitive than wild-type virus toward the peramivir analogues bearing hydrophilic side chains. Notably, the peramivir analogue bearing a glycerol side chain inhibits the H275Y mutant with an IC 50 value of 35 nM, which is better than the WSN virus by 9 fold.

  5. Elastic Modulus of Fe72.5Ga27.5 Magnetostrictive Alloy

    International Nuclear Information System (INIS)

    Xiao-Xi, Zhu; Jing-Hua, Liu; Cheng-Bao, Jiang

    2010-01-01

    The elastic modulus of Fe 72.5 Ga 27.5 magnetostrictive alloy is determined by testing ac impedance resonance frequency and first-principle calculations. The observed elastic modulus is 90.2 GPa for a directionally solidified sample and 103.4 GPa for a water-quenched sample tested in a dc magnetic field of 32.7 mT without compressive pre-stress. The bulk modulus by first-principles calculation is 179.3 GPa which is basically consistent with the experimental result. The elastic modulus first increases and then decreases with increasing dc magnetic field, attributed to magnetostriction occurrence in the Fe 72.5 Ga 27.5 alloy. The elastic modulus increases with increasing compressive pre-stress, resulting from the initial magnetic states change under the applied compressive pre-stress. The elastic modulus increases match well with the improved magnetostriction after quenching. (condensed matter: electronic structure, electrical, magnetic, and optical properties)

  6. 275 Candidates and 149 Validated Planets Orbiting Bright Stars in> K2 Campaigns 0–10

    DEFF Research Database (Denmark)

    Mayo, Andrew W.; Vanderburg, Andrew; Latham, David W.

    2018-01-01

    candidates observed during Campaigns 0–10 of the K2 mission that are orbiting stars brighter than 13 mag (in Kepler band) and for which we have obtained high-resolution spectra ( R = 44,000). These candidates are analyzed using the vespa package in order to calculate their false-positive probabilities (FPP......Since 2014, NASA’s K2 mission has observed large portions of the ecliptic plane in search of transiting planets and has detected hundreds of planet candidates. With observations planned until at least early 2018, K2 will continue to identify more planet candidates. We present here 275 planet...... and newly validated planets are explored. We show tentative evidence of a gap in the planet radius distribution of our candidate sample. Comparing our sample to the Kepler candidate sample investigated by Fulton et al., we conclude that more planets are required to quantitatively confirm the gap with K2...

  7. The relevance of uniform reporting in oral leukoplakia: definition, certainty factor and staging based on experience with 275 patients

    OpenAIRE

    Brouns, Elisabeth-REA; Baart, Jacques A; Bloemena, Elisabeth; Karagozoglu, Hakki; Van der Waal, Isaäc

    2013-01-01

    The aim of the present study was to evaluate the definition of oral leukoplakia, proposed by the WHO in 2005 and taking into account a previously reported classification and staging system, including the use of a Certainty factor of four levels with which the diagnosis of leukoplakia can be established. In the period 1997-2012 a hospital-based population of 275 consecutive patients with a provisional diagnosis of oral leukoplakia has been examined. In only 176 patients of these 275 patients a...

  8. 42 CFR 137.275 - May Self-Governance Tribes include IHS construction programs in a construction project agreement...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false May Self-Governance Tribes include IHS construction... OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Purpose and Scope § 137.275 May Self-Governance Tribes include IHS construction programs in a construction project agreement or in a funding...

  9. 41 CFR 102-75.275 - Who determines whether the proposed disposal would create or maintain a situation inconsistent...

    Science.gov (United States)

    2010-07-01

    ... the proposed disposal would create or maintain a situation inconsistent with antitrust laws? 102-75... Real Property Disposal Applicability of Antitrust Laws § 102-75.275 Who determines whether the proposed disposal would create or maintain a situation inconsistent with antitrust laws? The Attorney General...

  10. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    International Nuclear Information System (INIS)

    Roser, T.

    1999-01-01

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; ampersand 7.6.2- Proton Beam Polarimeters

  11. [Johann Gottlob Leidenfrost (1715-1794). On the 275th anniversary of his birthday, 27 November 1990].

    Science.gov (United States)

    Kaiser, W

    1991-03-01

    The 275th anniversary of the birthday of Johann Gottlob Leidenfrost gave rise to remember life and work of this physician and university teacher. The phenomenon described by him and named after him secured the versatile Halle candidate for a doctorate and Duisburg professor in ordinary a place also in the history of physics.

  12. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  13. 275 Candidates and 149 Validated Planets Orbiting Bright Stars in K2 Campaigns 0–10

    Science.gov (United States)

    Mayo, Andrew W.; Vanderburg, Andrew; Latham, David W.; Bieryla, Allyson; Morton, Timothy D.; Buchhave, Lars A.; Dressing, Courtney D.; Beichman, Charles; Berlind, Perry; Calkins, Michael L.; Ciardi, David R.; Crossfield, Ian J. M.; Esquerdo, Gilbert A.; Everett, Mark E.; Gonzales, Erica J.; Hirsch, Lea A.; Horch, Elliott P.; Howard, Andrew W.; Howell, Steve B.; Livingston, John; Patel, Rahul; Petigura, Erik A.; Schlieder, Joshua E.; Scott, Nicholas J.; Schumer, Clea F.; Sinukoff, Evan; Teske, Johanna; Winters, Jennifer G.

    2018-03-01

    Since 2014, NASA’s K2 mission has observed large portions of the ecliptic plane in search of transiting planets and has detected hundreds of planet candidates. With observations planned until at least early 2018, K2 will continue to identify more planet candidates. We present here 275 planet candidates observed during Campaigns 0–10 of the K2 mission that are orbiting stars brighter than 13 mag (in Kepler band) and for which we have obtained high-resolution spectra (R = 44,000). These candidates are analyzed using the vespa package in order to calculate their false-positive probabilities (FPP). We find that 149 candidates are validated with an FPP lower than 0.1%, 39 of which were previously only candidates and 56 of which were previously undetected. The processes of data reduction, candidate identification, and statistical validation are described, and the demographics of the candidates and newly validated planets are explored. We show tentative evidence of a gap in the planet radius distribution of our candidate sample. Comparing our sample to the Kepler candidate sample investigated by Fulton et al., we conclude that more planets are required to quantitatively confirm the gap with K2 candidates or validated planets. This work, in addition to increasing the population of validated K2 planets by nearly 50% and providing new targets for follow-up observations, will also serve as a framework for validating candidates from upcoming K2 campaigns and the Transiting Exoplanet Survey Satellite, expected to launch in 2018.

  14. "Effect of the drug transporters ABCB1, ABCC2, and ABCG2 on the disposition and brain accumulation of the taxane analog BMS-275,183"

    NARCIS (Netherlands)

    Marchetti, Serena; Pluim, Dick; Beijnen, Jos H; Mazzanti, Roberto; van Tellingen, Olaf; Schellens, Jan H M

    2014-01-01

    BMS-275,183 is a novel oral C-4 methyl carbonate analogue of paclitaxel. Recently, a drug-drug interaction between BMS-275,183 and benzimidazole proton pump inhibitors (PPIs) was suggested in clinical trials resulting in elevated drug exposure and toxicity. We explored whether the interaction takes

  15. 49 CFR 40.275 - What is the effect of procedural problems that are not sufficient to cancel an alcohol test?

    Science.gov (United States)

    2010-10-01

    ... not sufficient to cancel an alcohol test? 40.275 Section 40.275 Transportation Office of the Secretary... cancel an alcohol test? (a) As an STT, BAT, employer, or a service agent administering the testing... employer, these errors, even though not sufficient to cancel an alcohol test result, may subject you to...

  16. Eleven-Year Retrospective Survival Study of 275 Veneered Lithium Disilicate Single Crowns.

    Science.gov (United States)

    Simeone, Piero; Gracis, Stefano

    2015-01-01

    The aim of the present clinical retrospective study was to evaluate the long-term survival and clinical performance of veneered lithium disilicate single restorations in anterior and posterior areas after up to 11 years. Following a rigid protocol, 275 lithium disilicate single crowns (35 IPS Empress II and 240 e.max Press) were cemented over 11 years, in 106 patients, using an adhesive technique; of these 106 were anterior (38.5%) and 169 posterior (61.5%) teeth. Teeth receiving endodontic therapy and composite reconstruction (50%) and teeth with preexisting metalceramic crowns, called prosthetic retreatments (PR; 65%), were included as well. Of the 106 patients enrolled in the study, 25 (23.5%) were diagnosed with bruxism habits, and 7 of these patients (6.6% of all patients) received full-mouth single lithium disilicate restorations (FMR). The exclusion criteria for this retrospective clinical study were: monolithic lithium disilicate crowns, teeth with cast post and cores, implant-supported all-ceramic crowns, active periodontitis, and/or poor oral hygiene. Clinical reevaluation was performed by the clinicians who prepared and luted them during maintenance appointments between January 2012 and October 2013. Number of restoration failures and characteristics of failures were recorded. Marginal adaptation and marginal discoloration were evaluated based on the Cvar-Ryge criteria. The overall cumulative survival rate was 98.2%. The failures recorded were the result of either mechanical failure or debonding. Five crowns failed mechanically-three because of chipping and two because of core fracture-and were replaced. None of the failed crowns was associated with the bruxers with FMR. A total of 15 crowns debonded (5.5% of all crowns); however, 11 belonged to the same patient who had endodontically treated and reconstructed abutments. In this retrospective clinical evaluation of up to 132 months, veneered lithium disilicate single crowns had a low failure rate.

  17. Rotator cuff tears: assessment with MR arthrography in 275 patients with arthroscopic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Waldt, S.; Bruegel, M.; Mueller, D.; Holzapfel, K.; Rummeny, E.J.; Woertler, K. [Technische Universitaet Muenchen, Department of Radiology, Munich (Germany); Imhoff, A.B. [Technische Universitaet Muenchen, Department of Sports Orthopedics, Munich (Germany)

    2007-02-15

    We assessed the diagnostic performance of magnetic resonance (MR) arthrography in the diagnosis of articular-sided partial-thickness and full-thickness rotator cuff tears in a large symptomatic population. MR arthrograms obtained in 275 patients including a study group of 139 patients with rotator cuff tears proved by arthroscopy and a control group of 136 patients with arthroscopically intact rotator cuff tendons were reviewed in random order. MR imaging was performed on a 1.0 T system (Magnetom Expert, Siemens). MR arthrograms were analyzed by two radiologists in consensus for articular-sided partial-thickness and full-thickness tears of the supraspinatus, infraspinatus, and subscapularis tendons. At arthroscopy, 197 rotator cuff tears were diagnosed, including 105 partial-thickness (93 supraspinatus, nine infraspinatus, three subscapularis) and 92 full-thickness (43 supraspinatus, 20 infraspinatus, 29 subscapularis) tendon tears. For full-thickness tears, sensitivity, specificity, and accuracy were 96%, 99%, and 98%, respectively, and for partial tears 80%, 97%, and 95%, respectively. False negative and positive assessments in the diagnosis of articular-sided partial-thickness tears were predominantly [78% (35/45)] observed with small articular-sided (Ellman grade1) tendon tears. MR arthrography is highly accurate in the diagnosis of full-thickness rotator cuff tears and is accurate in the diagnosis of articular-sided partial-thickness tears. Limitations in the diagnosis of partial-thickness tears are mainly restricted to small articular-sided tears (Ellman grade 1) due to difficulties in differentiation between fiber tearing, tendinitis, synovitic changes, and superficial fraying at tendon margins. (orig.)

  18. Synthesis and characterization of Ti-27.5Nb alloy made by CLAD® additive manufacturing process for biomedical applications.

    Science.gov (United States)

    Fischer, M; Laheurte, P; Acquier, P; Joguet, D; Peltier, L; Petithory, T; Anselme, K; Mille, P

    2017-06-01

    Biocompatible beta-titanium alloys such as Ti-27.5(at.%)Nb are good candidates for implantology and arthroplasty applications as their particular mechanical properties, including low Young's modulus, could significantly reduce the stress-shielding phenomenon usually occurring after surgery. The CLAD® process is a powder blown additive manufacturing process that allows the manufacture of patient specific (i.e. custom) implants. Thus, the use of Ti-27.5(at.%)Nb alloy formed by CLAD® process for biomedical applications as a mean to increase cytocompatibility and mechanical biocompatibility was investigated in this study. The microstructural properties of the CLAD-deposited alloy were studied with optical microscopy and electron back-scattered diffraction (EBSD) analysis. The conservation of the mechanical properties of the Ti-27.5Nb material after the transformation steps (ingot-powder atomisation-CLAD) were verified with tensile tests and appear to remain close to those of reference material. Cytocompatibility of the material and subsequent cell viability tests showed that no cytotoxic elements are released in the medium and that viable cells proliferated well. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. MicroRNA-275 targets sarco/endoplasmic reticulum Ca2+ adenosine triphosphatase (SERCA to control key functions in the mosquito gut.

    Directory of Open Access Journals (Sweden)

    Bo Zhao

    2017-08-01

    Full Text Available The yellow fever mosquito Aedes aegypti is the major vector of arboviruses, causing numerous devastating human diseases, such as dengue and yellow fevers, Chikungunya and Zika. Female mosquitoes need vertebrate blood for egg development, and repeated cycles of blood feeding are tightly linked to pathogen transmission. The mosquito's posterior midgut (gut is involved in blood digestion and also serves as an entry point for pathogens. Thus, the mosquito gut is an important tissue to investigate. The miRNA aae-miR-275 (miR-275 has been shown to be required for normal blood digestion in the female mosquito; however, the mechanism of its action has remained unknown. Here, we demonstrate that miR-275 directly targets and positively regulates sarco/endoplasmic reticulum Ca2+ adenosine triphosphatase, which is implicated in active transport of Ca2+ from the cytosol to the sarco/endoplasmic reticulum. We utilized a combination of the gut-specific yeast transcription activator protein Gal4/upstream activating sequence (Gal4/UAS system and miRNA Tough Decoy technology to deplete the endogenous level of miR-275 in guts of transgenic mosquitoes. This gut-specific reduction of miR-275 post blood meal decreased SERCA mRNA and protein levels of the digestive enzyme late trypsin. It also resulted in a significant reduction of gut microbiota. Moreover, the decrease of miR-275 and SERCA correlated with defects in the Notch signaling pathway and assembly of the gut actin cytoskeleton. The adverse phenotypes caused by miR-275 silencing were rescued by injections of miR-275 mimic. Thus, we have discovered that miR-275 directly targets SERCA, and the maintenance of its level is critical for multiple gut functions in mosquitoes.

  20. A Microstructural Investigation of Gas Atomized Raney Type Al-27.5 at.%Ni Catalyst Precursor Alloys

    OpenAIRE

    Mullis, AM; Bigg, TD; Adkins, NJ

    2015-01-01

    Quantitative image analysis has been used to investigate the phase composition of gas atomized powders of a Raney type Ni catalyst precursor alloys of composition Al-27.5 at.% Ni in the powder size range 150-212 μm. We find that there are considerable variations in phase composition both between powders from the same batch and as a function distance from the particle surface within individual particles. Such variations may have significant implications for the future production and uptake of ...

  1. Histone deacetylase inhibitor MS-275 augments expression of a subset of IFN-γ-regulated genes in Toxoplasma gondii-infected macrophages but does not improve parasite control.

    Science.gov (United States)

    Sumpf, Kristina; Nast, Roswitha; Downie, Bryan; Salinas, Gabriela; Lüder, Carsten G K

    2017-09-01

    Toxoplasma gondii is a ubiquitous apicomplexan parasite of mammals and birds and an important pathogen of humans. IFN-γ is the major mediator of host resistance against T. gondii but intriguingly, parasite-infected host cells including macrophages are severely impaired to respond to IFN-γ due to defective transcriptional activation of target genes. Here, we tested the possibility that the impaired responsiveness of T. gondii-infected macrophages to IFN-γ can be restored by inhibiting histone deacetylases (HDACs) using the class I-specific inhibitor MS-275. Treatment of RAW264.7 cells with MS-275 indeed increased MHC class II surface expression in infected and non-infected cells and largely abolished the inhibition of IFN-γ-regulated MHC class II expression exerted by T. gondii. Genome-wide transcriptome profiling revealed that MS-275 increased mean mRNA levels of IFN-γ-regulated genes particularly in non-infected macrophages. Transcript levels of 33% of IFN-γ secondary response genes but only those of a few primary response genes were also increased by MS-275 in T. gondii-infected cells. Importantly, the unresponsiveness of parasite-infected cells to IFN-γ was however not abolished by MS-275. Furthermore, MS-275 also up-regulated several anti-inflammatory cytokines or signaling molecules in T. gondii-infected macrophages. It additionally regulated expression of more than 2500 genes in non-infected macrophages expression of which was surprisingly counteracted by prior infection with T. gondii. FACS analysis and immunofluorescence microscopy revealed that MS-275 did not considerably diminish the number of parasite-positive cells or the intracellular replication in macrophages stimulated or not with IFN-γ. Thus, a supportive therapy using MS-275 appears inappropriate for treatment of toxoplasmosis. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. The relevance of uniform reporting in oral leukoplakia: Definition, certainty factor and staging based on experience with 275 patients

    Science.gov (United States)

    Brouns, Elisabeth R E A.; Baart, Jacques A.; Bloemena, Elisabeth; Karagozoglu, Hakki

    2013-01-01

    The aim of the present study was to evaluate the definition of oral leukoplakia, proposed by the WHO in 2005 and taking into account a previously reported classification and staging system, including the use of a Certainty factor of four levels with which the diagnosis of leukoplakia can be established. In the period 1997-2012 a hospital-based population of 275 consecutive patients with a provisional diagnosis of oral leukoplakia has been examined. In only 176 patients of these 275 patients a firm diagnosis of leukoplakia has been established based on strict clinicopathological criteria. The 176 patients have subsequently been staged using a classification and staging system based on size and histopathologic features. For use in epidemiological studies it seems acceptable to accept a diagnosis of leukoplakia based on a single oral examination (Certainty level 1). For studies on management and malignant transformation rate the recommendation is made to include the requirement of histopathologic examination of an incisional or excisional biopsy, representing Certainty level 3 and 4, respectively. This recommendation results in the following definition of oral leukoplakia: “A predominantly white lesion or plaque of questionable behaviour having excluded, clinically and histopathologically, any other definable white disease or disorder”. Furthermore, we recommend the use of strict diagnostic criteria for predominantly white lesions for which a causative factor has been identified, e.g. smokers’ lesion, frictional lesion and dental restoration associated lesion. Key words:Oral epithelial dysplasia, oral leukoplakia, potentially malignant oral disorders. PMID:23085711

  3. Detection of an apparent, distant cluster of galaxies associated with the radio-tail QSO 3C 275.1

    International Nuclear Information System (INIS)

    Hintzen, P.; Boeshaar, G.O.; Scott, J.S.

    1981-01-01

    Based on the suggestion that QSOs with distorted radio structures are likely to be members of clusters of galaxies (Hintzen and Scott), we have obtained deep direct observations of the fields containing 3C 270.1 and 3C 275.1, the most reliably substantiated cases of wide-angle radio tails associated with QSOs. Our 75'' square field centered on 3C 275.1 (z = 0.557) contains over three-dozen objects, many of which are nonstellar, between m/sub R/ = 19.8 and m/sub R/ = 23.5. The quasar itself lies at the center of an illiptical nebulosity. The size of this nebulosity and the magnitude distribution of the surrounding objects are consistent with the interpretation that the QSO is the nucleus of a giant elliptical galaxy which is a member of a cluster of galaxies at zapprox.0.55. Our observations of 3C 270.1 (z = 1.519) show no definitive evidence of an associated cluster of galaxies, which is consistent with the cosmological interpretation of QSO redshifts

  4. Anti-leukemia activity of MS-275 histone deacetylase inhibitor implicates 4-1BBL/4-1BB immunomodulatory functions.

    Directory of Open Access Journals (Sweden)

    Bérengère Vire

    Full Text Available Histone deacetylase inhibitors (HDACi have demonstrated promising therapeutic potential in clinical trials for hematological malignancies. HDACi, such as SAHA/Vorinostat, Trichostatin A, and MS-275 were found to induce apoptosis of leukemic blasts through activation of the death receptor pathway and transcriptional induction of the Tumor Necrosis Factor (TNF-related pro-apoptotic family members, TRAIL and FasL. The impact of HDACi on TNF-related costimulatory molecules such as 4-1BB ligand (4-1BBL/TNFSF9 is however not known. Following exposure to SAHA/Vorinostat, Trichostatin A, and MS-275, transcript levels were determined by real time PCR in Jurkat, Raji and U937 cells. Treatment with HDACi up-regulated TNFSF9 gene expression in the three leukemia cell lines, yet to different extend and with distinct kinetics, which did not require de novo protein synthesis and was not associated with DNAse I hypersensitive chromatin remodeling. Transcriptional activity of TNFSF9 promoter-luciferase constructs was induced up to 12 fold by HDACi, and implication of Sp1/Sp3 transcription factors binding to functional GC-box elements was evidenced by reporter gene assays, site-directed mutagenesis, and electrophoretic mobility shift assays. Functionality of modulated target genes was assessed in allogeneic mixed leukocyte reaction experiments. MS-275- and to a lesser extent Trichostatin A- and SAHA-treated Raji cells significantly up regulated T lymphocytes proliferation which was reduced by about 50% by a 4-1BB blocking recombinant protein, while MS-275- but neither Trichostatin A- nor SAHA-treated cells up-regulated IFNgamma secretion by T lymphocytes. Our results identify 4-1BBL/4-1BB as a downstream target of HDACi, especially of MS-275 anti-leukemia action in vitro. Thus, HDACi such as MS-275 displaying dual TNF-dependent proapoptotic and costimulatory activities might be favored for inclusion in HDACi-based anti-cancer therapeutic strategies.

  5. THE RATIONALE FOR THE USE OF TWO-PHASE SWITCHES FOR THREE-PHASE CONNECTIONS OF DISTRIBUTIVE DEVICE 27.5 KV

    Directory of Open Access Journals (Sweden)

    Yu. Ya. Sheika

    2008-12-01

    Full Text Available On the basis of materials of scientists of Moscow and Petersburg State Universities of C Ways and NIIEFAENERGO Ltd.» the author of this article with additions has considered a practical possibility of us bipolar switches on three-phase connections of distributive device 27,5 кV.

  6. Nondestructive testing of defective ASTM A 514 steel on the I-275 Combs-Hehl twin bridges over the Ohio River in Campbell County, Kentucky.

    Science.gov (United States)

    2010-03-01

    Three defective ASTM A 514 steel splice plates were discovered on the I-275 Combs-Hehl twin bridges over the Ohio River. A follow-on in-depth field inspection of 1,356 A 514 steel plates on the bridges revealed 14 additional defective gusset and spli...

  7. 17 CFR 275.205-2 - Definition of “specified period” over which the asset value of the company or fund under...

    Science.gov (United States)

    2010-04-01

    ... periodâ over which the asset value of the company or fund under management is averaged. 275.205-2 Section... value of the company or fund under management is averaged. (a) For purposes of this rule: (1) Fulcrum... consisting of a specified number of subperiods of definite length in which the most recent subperiod is...

  8. The Sloan Digital Sky Survey COADD: 275 deg2 of deep Sloan Digital Sky Survey imaging on stripe 82

    International Nuclear Information System (INIS)

    Annis, James; Soares-Santos, Marcelle; Dodelson, Scott; Hao, Jiangang; Jester, Sebastian; Johnston, David E.; Kubo, Jeffrey M.; Lampeitl, Hubert; Lin, Huan; Miknaitis, Gajus; Yanny, Brian; Strauss, Michael A.; Gunn, James E.; Lupton, Robert H.; Becker, Andrew C.; Ivezić, Željko; Fan, Xiaohui; Jiang, Linhua; Seo, Hee-Jong; Simet, Melanie

    2014-01-01

    We present details of the construction and characterization of the coaddition of the Sloan Digital Sky Survey (SDSS) Stripe 82 ugriz imaging data. This survey consists of 275 deg 2 of repeated scanning by the SDSS camera over –50° ≤ α ≤ 60° and –1.°25 ≤ δ ≤ +1.°25 centered on the Celestial Equator. Each piece of sky has ∼20 runs contributing and thus reaches ∼2 mag fainter than the SDSS single pass data, i.e., to r ∼ 23.5 for galaxies. We discuss the image processing of the coaddition, the modeling of the point-spread function (PSF), the calibration, and the production of standard SDSS catalogs. The data have an r-band median seeing of 1.''1 and are calibrated to ≤1%. Star color-color, number counts, and PSF size versus modeled size plots show that the modeling of the PSF is good enough for precision five-band photometry. Structure in the PSF model versus magnitude plot indicates minor PSF modeling errors, leading to misclassification of stars as galaxies, as verified using VVDS spectroscopy. There are a variety of uses for this wide-angle deep imaging data, including galactic structure, photometric redshift computation, cluster finding and cross wavelength measurements, weak lensing cluster mass calibrations, and cosmic shear measurements.

  9. Structure of the Ne-Xe mixture near the 26-MPa demixing curve at T=275 K

    Science.gov (United States)

    Nardone, M.; Ricci, F. P.; Filabozzi, A.; Postorino, P.

    1996-12-01

    We report neutron diffraction measurements for two Ne-Xe mixtures at T=275 K and P=26 MPa, having a Xe molar fraction of 0.81 and 0.45, respectively. These thermodynamic points are chosen to be in the single phase region, close to the gas-gas demixing surface. Total structure factors and neutron weighted pair distribution functions have been extracted. Partial pair distribution functions gij(r) have been calculated by means of molecular dynamics simulation using Lennard-Jones interaction potentials and the Lorentz-Berthelot mixing rules, obtaining a good agreement with the experimental data. These partial pair distribution functions have been analyzed in terms of density expansion and also compared with those derived in a previous experiment on a He-Xe mixture. The main difference found between the structural properties of the two mixtures is that, in the Ne containing mixture, a definitely larger fraction of atoms of the lighter species occupies the Xe-Xe first neighbor shell. The model already used in interpreting the thermodynamic behavior of the He-Xe mixture in terms of microscopic properties suggests that this structural difference is related to the different behavior of the pressure-temperature projection of the critical line in the two mixtures.

  10. A nicotinic acetylcholine receptor transmembrane point mutation (G275E) associated with resistance to spinosad in Frankliniella occidentalis.

    Science.gov (United States)

    Puinean, Alin M; Lansdell, Stuart J; Collins, Toby; Bielza, Pablo; Millar, Neil S

    2013-03-01

    High levels of resistance to spinosad, a macrocyclic lactone insecticide, have been reported previously in western flower thrips, Frankliniella occidentalis, an economically important insect pest of vegetables, fruit and ornamental crops. We have cloned the nicotinic acetylcholine receptor (nAChR) α6 subunit from F. occidentalis (Foα6) and compared the nucleotide sequence of Foα6 from susceptible and spinosad-resistant insect populations (MLFOM and R1S respectively). A single nucleotide change has been identified in Foα6, resulting in the replacement of a glycine (G) residue in susceptible insects with a glutamic acid (E) in resistant insects. The resistance-associated mutation (G275E) is predicted to lie at the top of the third α-helical transmembrane domain of Foα6. Although there is no direct evidence identifying the location of the spinosad binding site, the analogous amino acid in the C. elegans glutamate-gated chloride channel lies in close proximity (4.4 Å) to the known binding site of ivermectin, another macrocyclic lactone pesticide. The functional consequences of the resistance-associated mutation have been examined in the human nAChR α7 subunit. Introduction of an analogous (A272E) mutation in α7 abolishes the modulatory effects of spinosad whilst having no significant effect upon activation by acetylcholine, consistent with spinosad having an allosteric mechanism of action. © 2012 International Society for Neurochemistry.

  11. Revealing the Anti-Tumor Effect of Artificial miRNA p-27-5p on Human Breast Carcinoma Cell Line T-47D

    Directory of Open Access Journals (Sweden)

    Hsueh-Fen Juan

    2012-05-01

    Full Text Available microRNAs (miRNAs cause mRNA degradation or translation suppression of their target genes. Previous studies have found direct involvement of miRNAs in cancer initiation and progression. Artificial miRNAs, designed to target single or multiple genes of interest, provide a new therapeutic strategy for cancer. This study investigates the anti-tumor effect of a novel artificial miRNA, miR P-27-5p, on breast cancer. In this study, we reveal that miR P-27-5p downregulates the differential gene expressions associated with the protein modification process and regulation of cell cycle in T-47D cells. Introduction of this novel artificial miRNA, miR P-27-5p, into breast cell lines inhibits cell proliferation and induces the first “gap” phase (G1 cell cycle arrest in cancer cell lines but does not affect normal breast cells. We further show that miR P-27-5p targets the 3′-untranslated mRNA region (3′-UTR of cyclin-dependent kinase 4 (CDK4 and reduces both the mRNA and protein level of CDK4, which in turn, interferes with phosphorylation of the retinoblastoma protein (RB1. Overall, our data suggest that the effects of miR p-27-5p on cell proliferation and G1 cell cycle arrest are through the downregulation of CDK4 and the suppression of RB1 phosphorylation. This study opens avenues for future therapies targeting breast cancer.

  12. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 27 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for a license to operate Diablo Canyon Nuclear Power Plant, Unit 1 (Docket No. 50-275), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement addresses the revisions to the license conditions and to the Technical Specifications as they relate to Amendment 10 to Diablo Canyon, Unit 1 Facility Operating License, DPR-76

  13. Measurements of the Weak UV Absorptions of Isoprene and Acetone at 261–275 nm Using Cavity Ringdown Spectroscopy for Evaluation of a Potential Portable Ringdown Breath Analyzer

    Science.gov (United States)

    Sahay, Peeyush; Scherrer, Susan T.; Wang, Chuji

    2013-01-01

    The weak absorption spectra of isoprene and acetone have been measured in the wavelength range of 261–275 nm using cavity ringdown spectroscopy. The measured absorption cross-sections of isoprene in the wavelength region of 261–266 nm range from 3.65 × 10−21 cm2·molecule−1 at 261 nm to 1.42 × 10−21 cm2·molecule−1 at 266 nm; these numbers are in good agreement with the values reported in the literature. In the longer wavelength range of 270–275 nm, however, where attractive applications using a single wavelength compact diode laser operating at 274 nm is located, isoprene has been reported in the literature to have no absorption (too weak to be detected). Small absorption cross-sections of isoprene in this longer wavelength region are measured using cavity ringdown spectroscopy for the first time in this work, i.e., 6.20 × 10−23 cm2·molecule−1 at 275 nm. With the same experimental system, wavelength-dependent absorption cross-sections of acetone have also been measured. Theoretical detection limits of isoprene and comparisons of absorbance of isoprene, acetone, and healthy breath gas in this wavelength region are also discussed. PMID:23803787

  14. Headache in patients with cervical radiculopathy: a prospective study with selective nerve root blocks in 275 patients

    Science.gov (United States)

    Carlsson, Jane Y.; Anderberg, Leif

    2006-01-01

    Since many years we routinely use diagnostic selective nerve root blocks (SNRB) at our department when evaluating patients with cervical radiculopathy. Frequently patients who also presented with headache reported that the headache disappeared when the nerve root responsible for the radicular pain was blocked with local anaesthetics. Headache has been described as a companioning symptom related to cervical radiculopathy but has never before been evaluated with SNRB performed in the lower cervical spine. For this reason we added to our routine an evaluation of the response from the SNRB on headache in patients with cervical radiculopathy. The aim was to describe the frequency of headache in patients with cervical radiculopathy and its response to a selective nerve root block of the nerve root/roots responsible for the radiculopathy. Can nerve root compression in the lower cervical spine produce headache? In this consecutive series of 275 patients with cervical radiculopathy, 161 patients reported that they also suffered from daily or recurrent headache located most often unilaterally on the same side as the radiculopathy. All patients underwent a careful clinical examination by a neurosurgeon and a MRI of the cervical spine. The significantly compressed root/roots, according to the MRI, underwent SNRB with a local anaesthetic. The effect of the nerve root block on the radiculopathy and the headache was carefully noted and evaluated by a physiotherapist using visual analogue scales (VAS) before and after the SNRB. All patients with headache had tender points in the neck/shoulder region on the affected side. Patients with headache graded significantly more limitations in daily activities and higher pain intensity in the neck/shoulder/arm than patients without headache. After selective nerve root block, 59% of the patients with headache reported 50% or more reduction of headache and of these 69% reported total relief. A significant correlation was seen between reduced

  15. Influenza A(H1N1)pdm09 virus exhibiting enhanced cross-resistance to oseltamivir and peramivir due to a dual H275Y/G147R substitution, Japan, March 2016.

    Science.gov (United States)

    Takashita, Emi; Fujisaki, Seiichiro; Shirakura, Masayuki; Nakamura, Kazuya; Kishida, Noriko; Kuwahara, Tomoko; Shimazu, Yukie; Shimomura, Takeshi; Watanabe, Shinji; Odagiri, Takato

    2016-06-16

    An influenza A(H1N1)pdm09 virus carrying a G147R substitution in combination with an H275Y substitution in the neuraminidase protein, which confers cross-resistance to oseltamivir and peramivir, was detected from an immunocompromised inpatient in Japan, March 2016. This dual H275Y/G147R mutant virus exhibited enhanced cross-resistance to both drugs compared with the single H275Y mutant virus and reduced susceptibility to zanamivir, although it showed normal inhibition by laninamivir. This article is copyright of The Authors, 2016.

  16. Blockade of the ERK pathway enhances the therapeutic efficacy of the histone deacetylase inhibitor MS-275 in human tumor xenograft models

    International Nuclear Information System (INIS)

    Sakamoto, Toshiaki; Ozaki, Kei-ichi; Fujio, Kohsuke; Kajikawa, Shu-hei; Uesato, Shin-ichi; Watanabe, Kazushi; Tanimura, Susumu; Koji, Takehiko; Kohno, Michiaki

    2013-01-01

    Highlights: •Blockade of the ERK pathway enhances the anticancer efficacy of HDAC inhibitors. •MEK inhibitors sensitize human tumor xenografts to HDAC inhibitor cytotoxicity. •Such the enhanced efficacy is achieved by a transient blockade of the ERK pathway. •This drug combination provides a promising therapeutic strategy for cancer patients. -- Abstract: The ERK pathway is up-regulated in various human cancers and represents a prime target for mechanism-based approaches to cancer treatment. Specific blockade of the ERK pathway alone induces mostly cytostatic rather than pro-apoptotic effects, however, resulting in a limited therapeutic efficacy of the ERK kinase (MEK) inhibitors. We previously showed that MEK inhibitors markedly enhance the ability of histone deacetylase (HDAC) inhibitors to induce apoptosis in tumor cells with constitutive ERK pathway activation in vitro. To evaluate the therapeutic efficacy of such drug combinations, we administered the MEK inhibitor PD184352 or AZD6244 together with the HDAC inhibitor MS-275 in nude mice harboring HT-29 or H1650 xenografts. Co-administration of the MEK inhibitor markedly sensitized the human xenografts to MS-275 cytotoxicity. A dose of MS-275 that alone showed only moderate cytotoxicity thus suppressed the growth of tumor xenografts almost completely as well as induced a marked reduction in tumor cellularity when administered with PD184352 or AZD6244. The combination of the two types of inhibitor also induced marked oxidative stress, which appeared to result in DNA damage and massive cell death, specifically in the tumor xenografts. The enhanced therapeutic efficacy of the drug combination was achieved by a relatively transient blockade of the ERK pathway. Administration of both MEK and HDAC inhibitors represents a promising chemotherapeutic strategy with improved safety for cancer patients

  17. Formation of quasicrystals in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass

    DEFF Research Database (Denmark)

    Wanderka, N.; Macht, M. P.; Siedel, M.

    2000-01-01

    The formation of the quasicrystalline phase is observed as a first step of crystallization during isothermal annealing of the Zr46.7Ti8.3Cu7.5Ni10Be27.5 bulk glass. The structure of the quasicrystals and the sequence of phase formation have been investigated by x-ray powder diffraction...... and transmission electron microscopy. The structure of the quasicrystals is determined to be primitive icosahedral with a quasilattice constant of 4.779 Angstrom. The quasicrystals decompose into several intermetallic compounds after prolonged annealing at lower temperatures or in a short time period (less than 5...

  18. Structure of alkaloid 275A, a novel 1-azabicyclo[5.3.0]decane from a dendrobatid frog, Dendrobates lehmanni: synthesis of the tetrahydrodiastereomers.

    Science.gov (United States)

    Garraffo, H M; Jain, P; Spande, T F; Daly, J W; Jones, T H; Smith, L J; Zottig, V E

    2001-04-01

    The principal alkaloid 275A in skins of the Colombian poison frog Dendrobates lehmanni has been identified as the pyrrolo[1,2-a]azepane (1), the first occurrence in nature of this "izidine" system. Tetrahydro-1 proved identical to one of the four synthetic diastereomers, 2a--2d, thereby establishing that 1 has the 5Z,10E relative stereochemistry. Alkaloid 1 is often accompanied by other congeners, in particular a 5Z,10Z diastereomer 15, a dihydro analogue 16, and a ketone 17. Such izidines in frogs may arise from dietary ants, as do other classes of izidines.

  19. Pressure effect on crystallization kinetics in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Gerward, Leif; Xu, Y.S.

    2002-01-01

    Crystallization kinetics of a Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass in the supercooled liquid region have been investigated by performing in situ high-temperature and high-pressure x-ray diffraction measurements using synchrotron radiation. A pressure-time-temperature-transformation diagram......, describing the onset of crystallization as a function of time during isothermal annealing under pressure, is presented. Different pressure dependences of crystallization kinetics in the temperature range for the glass have been observed and further be explained by a model of competing processes...

  20. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1991-06-01

    Supplement 34 to the Safety Evaluation Report for the application by Pacific Gas and Electric Company (PG ampersand E) for licenses to operate Diablo Canyon Nuclear Power Plant, Unit Nos. 1 and 2 (Docket Nos. 50-275 and 50-323, respectively) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement documents the NRC staff review of the Long-Term Seismic Program conducted by PG ampersand E in response to License Condition 2.C.(7) of Facility Operating License DPR-80, the Diablo Canyon Unit 1 operating license. 111 refs., 20 figs., 31 tabs

  1. Pressure effect of glass transition temperature in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk metallic glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Roseker, W.; Sikorski, M.

    2004-01-01

    Pressure effects on glass transition temperature and supercooled liquid region of a Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass have been investigated by performing in situ high-temperature and high-pressure x-ray powder diffraction measurements using synchrotron radiation. The glass transition...... was detected from the change of the slope of peak position as a function of temperature. It is found that the glass transition temperature increases with pressure by 4.4 K/GPa for the Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass, and the supercooled liquid range decreases with pressure by 2.9 K/GPa in a pressure...... range of 0-2.2 GPa. This method opens a possibility to study the pressure effect of glass transition process in glassy systems under high pressures (>1 GPa). (C) 2004 American Institute of Physics....

  2. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Suppl. 22

    International Nuclear Information System (INIS)

    1984-03-01

    Supplement 22 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. This supplement provides the criteria that were used by the staff to determine which of the allegations that have been evaluated and must be resolved prior to Unit 1 achieving criticality and operating at power level up to 5 percent of rated power (i.e., low power operation). The supplement also reports on the status of the staff's investigation, inspection and evaluation of 219 allegations or concerns that have been identified to the NRC as of March 9, 1984, excluding those recently received under 10 CFR 2.206 petitions

  3. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1983-12-01

    Supplement 20 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter of November 19, 1981 to the licensee. Specifically, Supplement 20 addresses those issues and other matters identified in Supplements 18 and 19 that must be resolved prior to Unit 1 achieving criticality and operating at power levels up to 5% of rated full power. This SER Supplement applies only to Diablo Canyon Unit 1

  4. Speed-of-sound measurements in (argon + carbon dioxide) over the temperature range from (275 to 500) K at pressures up to 8 MPa

    International Nuclear Information System (INIS)

    Wegge, Robin; McLinden, Mark O.; Perkins, Richard A.; Richter, Markus; Span, Roland

    2016-01-01

    Highlights: • The speed of sound was measured in (argon + carbon dioxide) mixtures. • Measurements were carried out from T = (275 to 500) K at pressures up to 8 MPa. • Measurements were made with the spherical acoustic resonator at NIST-Boulder. • The vibrational relaxation of pure carbon dioxide led to high sound absorption. • The relative combined expanded uncertainty (k = 2) ranged from (0.042 to 0.056)%. - Abstract: The speed of sound of two (argon + carbon dioxide) mixtures was measured over the temperature range from (275 to 500) K with pressures up to 8 MPa utilizing a spherical acoustic resonator. The compositions of the gravimetrically prepared mixtures were (0.50104 and 0.74981) mole fraction carbon dioxide. The vibrational relaxation of pure carbon dioxide led to high sound absorption, which significantly impeded the sound-speed measurements on carbon dioxide and its mixtures; pre-condensation may have also affected the results for some measurements near the dew line. Thus, in contrast to the standard operating procedure for speed-of-sound measurements with a spherical resonator, non-radial resonances at lower frequencies were taken into account. Still, the data show a comparatively large scatter, and the usual repeatability of this general type of instrument could not be realized with the present measurements. Nonetheless, the average relative combined expanded uncertainty (k = 2) in speed of sound ranged from (0.042 to 0.056)% for both mixtures, with individual state-point uncertainties increasing to 0.1%. These uncertainties are adequate for our intended purpose of evaluating thermodynamic models. The results are compared to a Helmholtz energy equation of state for carbon capture and storage applications; relative deviations of (−0.64 to 0.08)% for the (0.49896 argon + 0.50104 carbon dioxide) mixture, and of (−1.52 to 0.77)% for the (0.25019 argon + 0.74981 carbon dioxide) mixture were observed.

  5. TU-D-201-02: Medical Physics Practices for Plan and Chart Review: Results of AAPM Task Group 275 Survey

    Energy Technology Data Exchange (ETDEWEB)

    Fong de los Santos, L [Mayo Clinic, Rochester, MN (United States); Dong, L [Scripps Proton Therapy Center, San Diego, CA (United States); Greener, A [VA Medical Center, East Orange, NJ (United States); Johnson, J [UT MD Anderson Cancer Center, Houston, TX (United States); Johnson, P [University of Miami, Miami, FL (United States); Kim, G [University of California, San Diego, La Jolla, CA (United States); Mechalakos, J; Yorke, E [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Napolitano, B [Massachusetts General Hospital, Boston, MA (United States); Parker, S [Novant Health, Winston Salem, NC (United States); Schofield, D [Saint Vincent Hospital, Acton, MA (United States); Wells, M [Piedmont Hospital, Atlanta, GA (United States); Ford, E [Mayo Clinic, Rochester, MN (United States); Scripps Proton Therapy Center, San Diego, CA (United States)

    2016-06-15

    Purpose: AAPM Task Group (TG) 275 is charged with developing riskbased guidelines for plan and chart review clinical processes. As part of this work an AAPM-wide survey was conducted to gauge current practices. Methods: The survey consisted of 103 multiple-choice questions covering the following review processes for external beam including protons: 1) Initial Plan Check, 2) On-Treatment and 3) End-of-Treatment Chart Check. The survey was designed and validated by TG members with the goal of providing an efficient and easy response process. The survey, developed and deployed with the support of AAPM headquarters, was released to all AAPM members who have self-reported as working in the radiation oncology field and it was kept open for 7 weeks. Results: There are an estimated 4700 eligible participants. At the time of writing, 962 completed surveys have been collected with an average completion time of 24 minutes. Participants are mainly from community hospitals (40%), academicaffiliated hospitals (31%) and free-standing clinics (18%). Among many other metrics covered on the survey, results so far indicate that manual review is an important component on the plan and chart review process (>90%) and that written procedures and checklists are widely used (>60%). However, the details of what is reviewed or checked are fairly heterogeneous among the sampled medical physics community. Conclusion: The data gathered from the survey gauging current practices will be used by TG 275 to develop benchmarks and recommendations for the type and extent of checks to perform effective physics plan and chart review processes.

  6. "Kommentar zu „Ableitung von Korngrößenverteilungen aus textbasierten petrografischen Bohrgutbeschreibungen“ von Michael Naumann, Anja Waldeck, Wolfgang Poßin, Carsten Schwarz & Joachim Fritz (Z. Dt. Ges. Geowiss., 165/2: 275–286)"

    DEFF Research Database (Denmark)

    Fuchs, Sven

    2015-01-01

    Fuchs, S. (2015): Kommentar zu „Ableitung von Korngrößenverteilungen aus textbasierten petrografischen Bohrgutbeschreibungen“ von Michael Naumann, Anja Waldeck, Wolfgang Poßin, Carsten Schwarz & Joachim Fritz (Z. Dt. Ges. Geowiss., 165/2: 275?286). [Comment on “Deduction of grain size distributions...... based on petrographic borehole descriptions” by Michael Naumann, Anja Waldeck, Wolfgang Poßin, Carsten Schwarz & Joachim Fritz (Z. Dt. Ges. Geowiss., 165/2: 275?286).] – Z. Dt. Ges. Geowiss....

  7. The Histone Deacetylase Inhibitors MS-275 and SAHA Suppress the p38 Mitogen-Activated Protein Kinase Signaling Pathway and Chemotaxis in Rheumatoid Arthritic Synovial Fibroblastic E11 Cells

    Directory of Open Access Journals (Sweden)

    Hai-Shu Lin

    2013-11-01

    Full Text Available MS-275 (entinostat and SAHA (vorinostat, two histone deacetylase (HDAC inhibitors currently in oncological trials, have displayed potent anti-rheumatic activities in rodent models of rheumatoid arthritis (RA. To further elucidate their anti-inflammatory mechanisms, the impact of MS-275 and SAHA on the p38 mitogen-activated protein kinase (MAPK signaling pathway and chemotaxis was assessed in human rheumatoid arthritic synovial fibroblastic E11 cells. MS-275 and SAHA significantly suppressed the expression of p38α  MAPK, but induced the expression of MAPK phosphatase-1 (MKP-1, an endogenous suppressor of p38α  in E11 cells. At the same time, the association between p38α and MKP-1 was up-regulated and consequently, the activation (phosphorylation of p38α  was inhibited. Moreover, MS-275 and SAHA suppressed granulocyte chemotactic protein-2 (GCP-2, monocyte chemotactic protein-2 (MCP-2 and macrophage migration inhibitory factor (MIF in E11 cells in a concentration-dependent manner. Subsequently, E11-driven migration of THP-1 and U937 monocytes was inhibited. In summary, suppression of the p38 MAPK signaling pathway and chemotaxis appear to be important anti-rheumatic mechanisms of action of these HDAC inhibitors.

  8. Structure and expression of major histocompatibility complex-binding protein 2, a 275-kDa zinc finger protein that binds to an enhancer of major histocompatibility complex class I genes

    NARCIS (Netherlands)

    Veer, L.J. van 't; Lutz, P.M.; Isselbacher, K.J.; Bernards, R.A.

    1992-01-01

    We have isolated a cDNA encoding a transcription factor that binds to the enhancer of major histocompatibility complex (MHC) class I genes. MHC-binding protein 2 (MBP-2) is a 275-kDa protein, containing two sets of widely separated zinc fingers and a stretch of highly acidic amino acids, a

  9. Improved detection of genetic markers of antimicrobial resistance by hybridization probe-based melting curve analysis using primers to mask proximal mutations: examples include the influenza H275Y substitution.

    Science.gov (United States)

    Whiley, David M; Jacob, Kevin; Nakos, Jennifer; Bletchly, Cheryl; Nimmo, Graeme R; Nissen, Michael D; Sloots, Theo P

    2012-06-01

    Numerous real-time PCR assays have been described for detection of the influenza A H275Y alteration. However, the performance of these methods can be undermined by sequence variation in the regions flanking the codon of interest. This is a problem encountered more broadly in microbial diagnostics. In this study, we developed a modification of hybridization probe-based melting curve analysis, whereby primers are used to mask proximal mutations in the sequence targets of hybridization probes, so as to limit the potential for sequence variation to interfere with typing. The approach was applied to the H275Y alteration of the influenza A (H1N1) 2009 strain, as well as a Neisseria gonorrhoeae mutation associated with antimicrobial resistance. Assay performances were assessed using influenza A and N. gonorrhoeae strains characterized by DNA sequencing. The modified hybridization probe-based approach proved successful in limiting the effects of proximal mutations, with the results of melting curve analyses being 100% consistent with the results of DNA sequencing for all influenza A and N. gonorrhoeae strains tested. Notably, these included influenza A and N. gonorrhoeae strains exhibiting additional mutations in hybridization probe targets. Of particular interest was that the H275Y assay correctly typed influenza A strains harbouring a T822C nucleotide substitution, previously shown to interfere with H275Y typing methods. Overall our modified hybridization probe-based approach provides a simple means of circumventing problems caused by sequence variation, and offers improved detection of the influenza A H275Y alteration and potentially other resistance mechanisms.

  10. Volumetric and viscometric study of aqueous binary mixtures of some glycol ethers at T = (275.15 and 283.15) K

    Energy Technology Data Exchange (ETDEWEB)

    Dhondge, Sudhakar S., E-mail: s_dhondge@hotmail.com [Department of Chemistry, S.K. Porwal College, Kamptee, Dist. Nagpur 441 002 (India); Pandhurnekar, Chandrashekhar P. [Shri Ramdeobaba Kamla Nehru Engineering College, Nagpur 440 013 (India); Sheikh, Shaziya; Deshmukh, Dinesh W. [Department of Chemistry, R.T.M. Nagpur University, Nagpur 440 033 (India)

    2011-12-15

    Graphical abstract: Highlights: > Study of aqueous solutions of glycol ethers at low temperatures is presented. > Glycol ethers are industrially important liquids. > Reduction in the volume was observed upon addition of all glycol ethers to water. > Glycol ethers act as structure makers in aqueous medium. - Abstract: The experimental data for the density ({rho}) and viscosity ({eta}) are reported for aqueous binary mixtures of different glycol ethers, namely ethylene glycol monomethyl ether (EGMME), ethylene glycol monoethyl ether (EGMEE), diethylene glycol monomethyl ether (DEGMME), and diethylene glycol monoethyl ether (DEGMEE), at different temperatures (T = 275.15 K and 283.15 K) within the concentration range 0 mol . kg{sup -1} to 0.1 mol . kg{sup -1}. The values of density ({rho}) and viscosity ({eta}) of the solutions were used to compute different derived parameters, such as apparent molar volume ({phi}{sub V}) of the solute, excess molar volume (V{sup E}) of the solution, viscosity B and D coefficients of solution and temperature coefficient of viscosity B-coefficient (dB/dT) of solution. The limiting apparent molar volume of the solutes ({phi}{sub V}{sup 0}) have been obtained for aqueous binary mixtures of these glycol ethers by smooth extrapolation of {phi}{sub V}-m curves to zero concentration. By using the values of {phi}{sub V}{sup 0}, the limiting excess partial molar volumes (V-bar{sub 2}{sup 0E}) have also been calculated. The results are interpreted in term of various interactions such as solute-solvent interactions and hydrogen bonding.

  11. Synthesis, crystal structure and magnetic properties of a new pillared perovskite La5Mo2.75V1.25O16

    International Nuclear Information System (INIS)

    Ramezanipour, Farshid; Derakhshan, Shahab; Greedan, John E.; Cranswick, Lachlan M.D.

    2008-01-01

    A new pillared perovskite compound La 5 Mo 2.76(4) V 1.25(4) O 16 , has been synthesized by solid-state reaction and its crystal structure has been characterized using powder X-ray and neutron diffraction. The magnetic properties of this compound have been investigated using SQUID magnetometry, and the magnetic structure has been studied using neutron diffraction data. A theoretical calculation of relative strengths of spin interactions among different magnetic ions and through different pathways has been performed using extended Hueckel, spin dimer analysis. The crystal structure of this material contains perovskite-type layers that are connected through edge-sharing dimeric units of octahedra. The structure is described in space group C2/m with unit cell parameters a=7.931(2) A, b=7.913(2) A, c=10.346(5) A and β=95.096(5) o . The material shows both short-range ferrimagnetic correlations from ∼200 to 110 K and long-range antiferromagnetic order below T c ∼100 K. The magnetic structure was investigated by neutron diffraction and is described by k=(0 0 1/2 ) as for other pillared perovskites. It consists of a ferrimagnetic arrangement of Mo and V within the layers that are coupled antiferromagnetically between layers. This is the first magnetic structure determination for any Mo-based pillared perovskite. - Graphical abstract: Long-range magnetic order below 100 K in the pillared perovskite La 5 Mo 2.75 V 1.25 O 16 . The magnetic structure is shown in the inset

  12. Narrow implants (2.75 and 3.25 mm diameter) supporting a fixed splinted prostheses in posterior regions of mandible: one-year results from a prospective cohort study.

    Science.gov (United States)

    Grandi, Tommaso; Svezia, Luigi; Grandi, Giovanni

    2017-09-08

    Can multiple splinted narrow-diameter implants be used as definitive implants in patients with insufficient bone ridge thickness in posterior regions of the mandible? With this aim, we evaluated their outcomes in this set up to 1 year after loading. Forty-two patients with a mean age of 61.3 years old (range 49-73) in need of fixed prosthetic implant-supported rehabilitations in the posterior region of the mandible, presenting a thin alveolar crest, were selected. One hundred twenty-four narrow-diameter implants (2.75 and 3.25 mm diameter) were placed and splinted with a bridge. One implant for each missing tooth was requested to be inserted. Outcomes measured were implant survival, complications, and marginal bone level changes up to 1 year after loading. At the 12-month follow-up, three implants failed. Two 2.75 mm diameter implants and one 3.2 mm diameter implant failed. The implant survival rate was 97.6%. Peri-implant bone resorption was 0.20 mm (CI 95% 0.14: 0.26) after 6 months and 0.47 mm (CI 95% 0.29; 0.65) after 12 months of loading, not different between 2.75 and 3.25 mm diameter groups (p = 0.786). Of the 42 cases, three had an episode of peri-implant mucositis (7.1%). Within the limits of this study, preliminary short-term data (1 year post-loading) suggested that narrow-diameter implants (2.75 to 3.25 mm) can be successfully used as a minimally invasive alternative to horizontal bone augmentation in the posterior mandible. However, larger and longer follow-ups of 5 years or more are needed.

  13. Physical activity, body mass index and heart rate variability-based stress and recovery in 16 275 Finnish employees: a cross-sectional study.

    Science.gov (United States)

    Föhr, Tiina; Pietilä, Julia; Helander, Elina; Myllymäki, Tero; Lindholm, Harri; Rusko, Heikki; Kujala, Urho M

    2016-08-02

    Physical inactivity, overweight, and work-related stress are major concerns today. Psychological stress causes physiological responses such as reduced heart rate variability (HRV), owing to attenuated parasympathetic and/or increased sympathetic activity in cardiac autonomic control. This study's purpose was to investigate the relationships between physical activity (PA), body mass index (BMI), and HRV-based stress and recovery on workdays, among Finnish employees. The participants in this cross-sectional study were 16 275 individuals (6863 men and 9412 women; age 18-65 years; BMI 18.5-40.0 kg/m(2)). Assessments of stress, recovery and PA were based on HRV data from beat-to-beat R-R interval recording (mainly over 3 days). The validated HRV-derived variables took into account the dynamics and individuality of HRV. Stress percentage (the proportion of stress reactions, workday and working hours), and stress balance (ratio between recovery and stress reactions, sleep) describe the amount of physiological stress and recovery, respectively. Variables describing the intensity (i.e. magnitude of recognized reactions) of physiological stress and recovery were stress index (workday) and recovery index (sleep), respectively. Moderate to vigorous PA was measured and participants divided into the following groups, based on calculated weekly PA: inactive (0 min), low (0 300 min). BMI was calculated from self-reported weight and height. Linear models were employed in the main analyses. High PA was associated with lower stress percentages (during workdays and working hours) and stress balance. Higher BMI was associated with higher stress index, and lower stress balance and recovery index. These results were similar for men and women (P stress on workdays. Additionally, lower BMI was associated with better recovery during sleep, expressed by a greater amount and magnitude of recovery reactions, which suggests that PA in the long term resulting in improved fitness has a

  14. Physical activity, body mass index and heart rate variability-based stress and recovery in 16 275 Finnish employees: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Tiina Föhr

    2016-08-01

    Full Text Available Abstract Background Physical inactivity, overweight, and work-related stress are major concerns today. Psychological stress causes physiological responses such as reduced heart rate variability (HRV, owing to attenuated parasympathetic and/or increased sympathetic activity in cardiac autonomic control. This study’s purpose was to investigate the relationships between physical activity (PA, body mass index (BMI, and HRV-based stress and recovery on workdays, among Finnish employees. Methods The participants in this cross-sectional study were 16 275 individuals (6863 men and 9412 women; age 18–65 years; BMI 18.5–40.0 kg/m2. Assessments of stress, recovery and PA were based on HRV data from beat-to-beat R-R interval recording (mainly over 3 days. The validated HRV-derived variables took into account the dynamics and individuality of HRV. Stress percentage (the proportion of stress reactions, workday and working hours, and stress balance (ratio between recovery and stress reactions, sleep describe the amount of physiological stress and recovery, respectively. Variables describing the intensity (i.e. magnitude of recognized reactions of physiological stress and recovery were stress index (workday and recovery index (sleep, respectively. Moderate to vigorous PA was measured and participants divided into the following groups, based on calculated weekly PA: inactive (0 min, low (0 300 min. BMI was calculated from self-reported weight and height. Linear models were employed in the main analyses. Results High PA was associated with lower stress percentages (during workdays and working hours and stress balance. Higher BMI was associated with higher stress index, and lower stress balance and recovery index. These results were similar for men and women (P < 0.001 for all. Conclusion Independent of age and sex, high PA was associated with a lower amount of stress on workdays. Additionally, lower BMI was associated with better recovery during

  15. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 25

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 25 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323) has been prepared by the Office of Nuclear Reactor Regulation (NRR) of the US Nuclear Regulatory Commission. This supplement reports on the staff's inspection and evaluation efforts on the matter of piping and piping supports as related to the seven technical license conditions in an Order Modifying License issued by NRR on April 18, 1984

  16. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 28

    International Nuclear Information System (INIS)

    1985-04-01

    Supplement 28 to the Safety Evaluation Report for the Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of those allegations or concerns that have been identified to the NRC as of March 1, 1985

  17. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 26

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 26 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection and evaluation of those allegations or concerns that have been identified to the NRC as of July 8, 1984. The report specifically addresses those allegations which the staff determined must be satisfactorily resolved prior to full power operation of Diablo Canyon Unit 1

  18. Safety-evaluation report related to the operation of Diablo Canyon Nuclear Power Plants, Units 1 and 2. Docket Nos. 50-275 and 50-323. Supplement No. 18

    International Nuclear Information System (INIS)

    1983-08-01

    Supplement 18 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter to the licensee

  19. Correlation between ferromagnetism and the concentration of interfacial defects in multiferroic Bi{sub 7}Fe{sub 2.75}Co{sub 0.25}Ti{sub 3}O{sub 21} studied by positron annihilation

    Energy Technology Data Exchange (ETDEWEB)

    Ge, W.N. [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei 230026 (China); Li, X.N. [CAS Key Laboratory of Materials for Energy Conversion, Department of Materials Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); Xu, J.P. [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei 230026 (China); Huang, S.J. [Zhejiang University of Water Resources and Electric Power, Hangzhou 310018 (China); Liu, J.D. [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei 230026 (China); Zhu, Z.; Fu, Z.P. [CAS Key Laboratory of Materials for Energy Conversion, Department of Materials Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); Lu, Y.L., E-mail: yllu@ustc.edu.cn [CAS Key Laboratory of Materials for Energy Conversion, Department of Materials Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); Ye, B.J., E-mail: bjye@ustc.edu.cn [State Key Laboratory of Particle Detection and Electronics, University of Science and Technology of China, Hefei 230026 (China); Department of Modern Physics, University of Science and Technology of China, Hefei 230026 (China)

    2017-03-01

    Highlights: • Interfacial defects and magnetization of Bi{sub 7}Fe{sub 2.75}Co{sub 0.25}Ti{sub 3}O{sub 21} were studied. • Interfacial defects disappear slowly with the increase of annealing temperature. • Saturation magnetization decreased with increasing the annealing temperature. • Higher concentration of interfacial defects bring higher saturation magnetization. - Abstract: This paper investigated the effect of the annealing temperature on the interfacial defects and the magnetization of a single-phase multiferroic Bi{sub 7}Fe{sub 2.75}Co{sub 0.25}Ti{sub 3}O{sub 21.} With the increase of annealing temperature, the average thickness of the nonaplates increased from 80 to 180 nm. But the magnetic property measurement shows that the saturation magnetization gradually decreases with the increase of the annealing temperature correspondingly. Positron annihilation measurements reveal that the interfacial defects disappear obviously when the annealing temperature increased, which is found to agree well with the variation of saturation magnetization. The results suggest that with the higher concentration of interfacial defects may bring about higher saturation magnetization for the Aurivillius phase material, opening a window to improve the magnetic performance through controlling the concentration of interfacial defects.

  20. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 33

    International Nuclear Information System (INIS)

    1986-05-01

    Supplement 33 to the Safety Evaluation Report for the Pacific Gas and Electric Company's Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of allegations and concerns that have been identified to the NRC through March 1986. The report includes a complete listing of all allegations and concerns, indicating the status of their resolution. The NRC staff concludes that the technical issues raised in the allegations with regard to the design, construction, and safe operation of Diablo Canyon Units 1 and 2 have been satisfactorily resolved and no further action is required

  1. The kinetic glass transition of the Zr46.75Ti8.25Cu7.5Ni10Be27.5 bulk metallic glass former-supercooled liquids on a long time scale

    International Nuclear Information System (INIS)

    Busch, R.; Johnson, W.L.

    1998-01-01

    Viscosity and enthalpy relaxation from the amorphous state into the supercooled liquid state was investigated in the bulk metallic glass forming Zr 46.75 Ti 8.25 Cu 7.5 Ni 10 Be 27.5 alloy below the calorimetric glass transition. At different temperatures, the viscosities relax into states that obey the same Vogel endash Fulcher endash Tammann relation as the data obtained at higher temperatures in the supercooled liquid. Enthalpy recovery experiments after relaxation in the same temperature range show that the enthalpy of the material reaches values that also corresponds to the supercooled liquid state. The glass relaxes into a metastable supercooled liquid state, if it is observed on a long time scale. Equilibration is possible far below the calorimetric glass transition and very likely even below the isentropic temperature. copyright 1998 American Institute of Physics

  2. Publications | Page 275 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  3. Publications | Page 275 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  4. 49 CFR 27.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Administration, Federal Railroad Administration, National Highway Traffic Safety Administration, Federal Transit... college, university, or other postsecondary institution, or a public system of higher education; or (ii) A local educational agency (as defined in 20 U.S.C. 7801), system of vocational education, or other school...

  5. 7 CFR 275.14 - Review processing.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... techniques described in the Quality Control Sampling Handbook, FNS Handbook 311. (c) Worksheets. The...

  6. 7 CFR 275.9 - Review process.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Management Evaluation (ME..., reporting points, and data management units selected for review and the techniques used to select them; (iv.... Bias can be introduced through leading questions, incomplete reviews, incorrect sampling techniques...

  7. BDML Metadata: 275 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available wt_N2_030124_02.zip http://ssbd.qbic.riken.jp/data/bdml/Ce_KK_P002/wt_N2_030124_02.bdml0.18.xml... http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/searc

  8. 32 CFR 275.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... business engaged in vehicle sales, including automobile, airplane, and boat sales. (21) Persons involved in real estate closings and settlements. (22) The United States Postal Service. (23) An agency of the..., or any officer, employee, or agent thereof, to include DoD law enforcement offices, personnel...

  9. 48 CFR 211.275-2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... (RFID), in the form of a passive RFID tag, is required for individual cases and palletized unit loads... demand items (non-military sales items). (vi) Subclass of Class VIII—Medical materials (excluding...

  10. 21 CFR 556.275 - Fenbendazole.

    Science.gov (United States)

    2010-04-01

    ...) Milk. The tolerance for fenbendazole sulfoxide metabolite (the marker residue in cattle milk) is 0.6... residues of fenbendazole is 40 micrograms per kilogram of body weight per day. (b) Tolerances—(1) Cattle—(i...

  11. Long time scale GPU dynamics reveal the mechanism of drug resistance of the dual mutant I223R/H275Y neuraminidase from H1N1-2009 influenza virus.

    Science.gov (United States)

    Woods, Christopher J; Malaisree, Maturos; Pattarapongdilok, Naruwan; Sompornpisut, Pornthep; Hannongbua, Supot; Mulholland, Adrian J

    2012-05-29

    Multidrug resistance of the pandemic H1N1-2009 strain of influenza has been reported due to widespread treatment using the neuraminidase (NA) inhibitors, oseltamivir (Tamiflu), and zanamivir (Relenza). From clinical data, the single I223R (IR(1)) mutant of H1N1-2009 NA reduced efficacy of oseltamivir and zanamivir by 45 and 10 times, (1) respectively. More seriously, the efficacy of these two inhibitors against the double mutant I223R/H275Y (IRHY(2)) was significantly reduced by a factor of 12 374 and 21 times, respectively, compared to the wild-type.(2) This has led to the question of why the efficacy of the NA inhibitors is reduced by the occurrence of these mutations and, specifically, why the efficacy of oseltamivir against the double mutant IRHY was significantly reduced, to the point where oseltamivir has become an ineffective treatment. In this study, 1 μs of molecular dynamics (MD) simulations was performed to answer these questions. The simulations, run using graphical processors (GPUs), were used to investigate the effect of conformational change upon binding of the NA inhibitors oseltamivir and zanamivir in the wild-type and the IR and IRHY mutant strains. These long time scale dynamics simulations demonstrated that the mechanism of resistance of IRHY to oseltamivir was due to the loss of key hydrogen bonds between the inhibitor and residues in the 150-loop. This allowed NA to transition from a closed to an open conformation. Oseltamivir binds weakly with the open conformation of NA due to poor electrostatic interactions between the inhibitor and the active site. The results suggest that the efficacy of oseltamivir is reduced significantly because of conformational changes that lead to the open form of the 150-loop. This suggests that drug resistance could be overcome by increasing hydrogen bond interactions between NA inhibitors and residues in the 150-loop, with the aim of maintaining the closed conformation, or by designing inhibitors that can form

  12. Optimized subsequent-annealing-free Ni/Ag based metallization contact to p-type GaN for vertical light emitting diodes with high yield and extremely low operating voltage (2.75 V@350 mA, >95%)

    International Nuclear Information System (INIS)

    Tian, Ting; Wang, Liancheng; Guo, Enqing; Liu, Zhiqiang; Zhan, Teng; Guo, Jinxia; Yi, Xiaoyan; Li, Jing; Wang, Guohong

    2014-01-01

    A Ni/Ag based metallization contact to p-type GaN (p-GaN), free of a subsequent annealing process, was optimized to couple excellent optical reflectance (as high as 90% at 460 nm) and electrical characteristics (specific contact resistivity as low as 2.1 × 10 −5  Ω cm 2 ) simultaneously. Vertical light emitting diode devices with optimized Ni/Ag/Pt/Au contacts were fabricated, and they exhibited extremely low forward voltage (2.75 V@350 mA, approaching its corresponding theoretical limit) and light output power was improved by 35%. Chip-on-wafer mapping tests revealed significantly high yield and excellent uniformity across the wafer. X-ray diffraction results indicated improved crystalline quality and more favourable crystal orientation of Ni [1 1 1]∥Ag [1 1 1]∥GaN [0 0 0 2] at high deposition temperature. Auger electron spectroscopy profiles were used to examine the inter-diffusion of Ni/Ag atoms and Ga atoms in p-GaN, which led to the formation of a Ni/Ag–Ga alloy interface and the improvement of hole concentration in p-GaN. As a result, the chips' reliability and Ni/Ag-p-GaN contact characteristics were improved. (paper)

  13. 38 CFR 3.275 - Criteria for evaluating net worth.

    Science.gov (United States)

    2010-07-01

    ... applicable to the improved pension program); potential rate of depletion, including unusual medical expenses.... 1833(c)) (j) Victims of Crime Act. There shall be excluded from the corpus of estate or net worth of a claimant any amounts received as compensation under the Victims of Crime Act of 1984 unless the total...

  14. 40 CFR 1065.275 - N2O measurement devices.

    Science.gov (United States)

    2010-07-01

    ... functions of other gaseous measurements and the engine's known or assumed fuel properties. The target value... assumed fuel properties. The target value for any compensation algorithm is 0.0% (that is, no bias high... sampling. (i) You may use a packed or porous layer open tubular (PLOT) column phase of suitable polarity...

  15. 7 CFR 275.16 - Corrective action planning.

    Science.gov (United States)

    2010-01-01

    ... provide responsive service to eligible households. (b) The State agency and project area(s)/management... control reviews and those deficiencies requiring corrective action only at the project area level... project area/management unit corrective action, the State agency and/or project area/management unit shall...

  16. 275 THE AETIOLOGY AND POSSmLE PREVENTION OF ...

    African Journals Online (AJOL)

    1971-03-13

    Mar 13, 1971 ... cardial infarction treated personally, initially in private practice and then .... Hypertension. Diastolic hypertension, or a definite his- tory thereof, was noted in 63 of 171 males and 45 of 79 females with a peak incidence in the 50- 59 decade (Fig. 5). .... the menopause and thereafter with oestrogen deficiency.

  17. 7 CFR 275.13 - Review of negative cases.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... month or effective for the sample month shall be selected for quality control review. These negative... reasons for denial, suspension or termination on the Negative Quality Control Review Schedule, Form FNS...

  18. 7 CFR 275.10 - Scope and purpose.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... responsible for conducting quality control reviews. For food stamp quality control reviews, a sample of... date, was correct. Quality control reviews measure the validity of food stamp cases at a given time...

  19. 9 CFR 2.75 - Records: Dealers and exhibitors.

    Science.gov (United States)

    2010-01-01

    ... intermediate handler or, if a privately owned vehicle is used to transport a dog or cat, the name of the owner... information concerning each dog or cat purchased or otherwise acquired, owned, held, or otherwise in his or... whom a dog or cat was purchased or otherwise acquired whether or not the person is required to be...

  20. 275 Uses and Gratifications of Home Videos among the Nigerian ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... George Melies, called the first artist of the cinema introduced narration to film with this A Trip to the Moon in 1902. Melies was also held to have introduced special effects on film with this single innovation. By 1903, the. American Edwin S. Potter released his The Great Train Robbery. Potter who is held to be ...

  1. Dicty_cDB: VHC275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 8 EL371567 |EL371567.1 CCEL13585.b1_B13.ab1 CCE(LMS) endive Cichorium endivia cDNA clone CCEL13585, mRNA s...equence. 48 0.26 1 EL360537 |EL360537.1 CCEM5240.b1_O14.ab1 CCE(LMS) endive Cicho

  2. 17 CFR 275.203-3 - Hardship exemptions.

    Science.gov (United States)

    2010-04-01

    ... ADV-H (17 CFR 279.3) in paper format with no later than one business day after the filing that is the...-H at least ten business days before a filing is due. The Commission will grant or deny your application within ten business days after you file Form ADV-H. (3) Effective date—upon approval. You are not...

  3. Worldwide Report, Telecommunications Policy, Research and Development No. 275.

    Science.gov (United States)

    1983-06-10

    8217 Channel Seven, y..- The issue; of metro - p<mtan< stations being Ablelto beam into local TV . argas, will arise a&aih W&ea Australia’s ■aoraestiis...follow the bus networks that are used now (and their precursor is " Ethernet .") Turnover, Sales Paris ZERO UN INFORMATIQUE HEBDO in French 18 Apr 83 p 3

  4. 7 CFR 275.12 - Review of active cases.

    Science.gov (United States)

    2010-01-01

    ... information; and any other materials and activity pertinent to the review of the case. The scope of the review... well as other information documented on other portions of the Integrated Worksheet, Form FNS-380, as appropriate. (f) Reporting of review findings. All information verified to be incorrect during the review of...

  5. Dicty_cDB: VSF275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *prfkccylkr*i kdhhqhhhpilkeipqifnkeilkiqtnqrfltccchhqkyirtqilqhw*f*itrin*f *fliyff*kk--- ---mpnvqknrrkeis*ir...h*lyrssw*nr*cccfrkvltrqnqs*qqs**prfkccylk r*ikdhhqhhhpilkeipqifnkeilkiqtnqrfltccchhqkyirtqilqhwdsesqe* infnf

  6. 33 CFR 106.275 - Security measures for monitoring.

    Science.gov (United States)

    2010-07-01

    ... watches, waterborne patrols, automatic intrusion-detection devices, or surveillance equipment as specified... facility; (3) Ensure that equipment or system failures or malfunctions are identified and corrected; (4) Ensure that any automatic intrusion detection device, sets off an audible or visual alarm, or both, at a...

  7. 275---11 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    11 Des 2009 ... Narrative therapy is suggested as a means of grief counselling, as it makes use of the story analogy, which supports the notion of an open end to the ... narrative approach to grief will generate the consolation needed by the grief-stricken on their ...... International Journal of Practical Theology 8(2), 1–14.

  8. 49 CFR 234.275 - Processor-based systems.

    Science.gov (United States)

    2010-10-01

    ...) Applicable definitions. The definitions in § 236.903 of this chapter shall apply to this section, where applicable. (b) Use of performance standard authorized or required. (1) In lieu of compliance with the... are satisfied using alternative means. Deviation from those particular requirements is authorized if...

  9. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... Phase II (IAC2), Composite Training Unit Exercises (COMPTUEX), and Joint Task Force Exercises (JTFEX... swimming, etc.) (iii) An evaluation (based on data gathered during all of the MTEs) of the effectiveness of... animal closing to bow ride, paralleling course/speed, floating on surface and not swimming etc...

  10. 275 Proverbial Space and the Dialectics of Place and Displacement ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Literary scholarship on proverb usage in Nigerian literary discourse had focused mostly on canonized .... proverbs in Nigeria but have not examined proverb usage in fictional, isolated and dialogic ... as crucial features of postcolonial discourse and site for ―crisis of identity‖ (Empire,9) on the one hand ...

  11. 25 CFR 275.3 - Methods for staffing.

    Science.gov (United States)

    2010-04-01

    ... provided by the Area Personnel Office in complying with Civil Service instructions (Federal Personnel... coverage for any of the following Federal benefits: (i) Compensation for work injuries. (ii) Retirement... designated by the tribal governing body, is responsible for the planning, coordination, and completion of the...

  12. 25 CFR 275.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM... utilizing the services of Bureau employees. These regulations are not intended to prevent an Indian tribe or... Service Commission regulations must be adhered to. ...

  13. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... This trend is maintained when abasic sites in DNA oligomers are exposed to fibroblast cell extracts in the presence of the extract. While DNA conformational alteration is negligible, APE1 enzyme shows characteristic changes in the alpha helix and beta strand ratio after incubation with G. lucidum extract.

  14. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    s12038-016-9614-0. 1. Introduction. Ganoderma lucidum (GL) is a fungus that belongs to the class basidiomycetes and polyporaceae family (Russell and Paterson. 2006). This mushroom is quite well known from ancient times.

  15. All projects related to | Page 275 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-01

    A two-year grant will support research, analysis, and dialogue by Canadian civil society organizations to enhance their effectiveness. Start Date: January 1, 2012. End Date: January 1, 2014. Topic: SUSTAINABLE DEVELOPMENT, Poverty alleviation, Capacity building, HUMAN RIGHTS, POLICY MAKING, SOCIAL JUSTICE.

  16. Translations on Narcotics and Dangerous Drugs No. 275.

    Science.gov (United States)

    1976-12-09

    room 218 of the Hotel Florida, situated in the center of Cucuta, and its protagonists were Porfirio Hernandez and Maria Luisa Hernandez de Hernandez...arrested. Apprehended in the same city were marihuana distributors Jesus Flores Aguilar, Virginia Valdivia de Flores, Francisco Guevara Ruiz and...Maria de Jesus Flores Valdez, from whom 127 joints and 500 grams of grass were seized. In Tijuana, the arrest was also made of Ruben Moreno Alcala

  17. 7 CFR 275.5 - Scope and purpose.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Management Evaluation (ME... migrant councils, advocate groups, or other organizations in the project area to ensure that migrants are...

  18. 275 Uses and Gratifications of Home Videos among the Nigerian ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... preponderant of the population use home video for diversion and relaxation, while a sizable number use it to ease tension. The content and duration of watching put in this past time are different ball games. As much as 42 percent of those polled spend 3 -5 hours a day watching films. Their dominant genres ...

  19. Dicty_cDB: VHI275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTAATCCTATTTGGTGTTCGTACCAATAACCAXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *gvcnns...GP*kpdygi*sylvfvpit--- Translated Amino Acid sequence (All Frames) Frame A: *gvcnnspakwtspeng*r*qwmvdaqslkev

  20. 78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes

    Science.gov (United States)

    2013-01-03

    ... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa... requested using the procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace...

  1. People and things. CERN Courier, Jun 1987, v. 27(5)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events:; An International Conference on the Physics and Astrophysics of Quark-Gluon Plasma will be held from 8-12 February 1988 at the Tata Institute for Fundamental Research, Bombay, India. This year the Joliot-Curie School of Nuclear Physics, arranged jointly by the French National Institute of Nuclear and Particle Physics (IN2P3) and the Institute for Fundamental Research of the French Atomic Energy Commission, will be held at Maubuisson, Gironde (France) from 14-18 September. The Europhysics Conference on Control Systems for Experimental Physics, sponsored by the European Physics Society (EPS) and CERN, and organized by the EPS Inter divisional Group on Experimental Physics Control Systems, will be held in Villars-sur-Ollon, Switzerland, from 28 September to 2 October

  2. Mill, John Stuart, El sometimiento de las mujeres. Madrid: Editorial Edaf, 2005, 275 p.

    Directory of Open Access Journals (Sweden)

    Cristhian Camilo Rodríguez Arias

    2014-07-01

    Full Text Available El sometimiento de las mujeres es uno de los libros más importantes del filósofo y economista inglés John Stuart Mill, defensor del utilitarismo como doctrina moral y padre del feminismo liberal, que llegó a defender delante del Parlamento inglés la amplitud de derechos en el terreno político mediante el reconocimiento del sufragio universal para las mujeres.

  3. Sud du Sahara | Page 275 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Animal products – particularly offal –, green vegetables and orange fruits and vegetables are the best sources of vitamin A. As a result, Tanzanians are severely deficient in this essential micronutrient. Read more about Eye health in Tanzania: An essential oil. Langue English. Le Fonds Cultiver l'avenir de l'Afrique (CultivAf) ...

  4. Environmental Assessment: Employment of the 2.75-Inch Rocket at Saylor Creek Air Force Range

    Science.gov (United States)

    2007-06-01

    the range has been covered with recent wind-laid deposits with deep alluvial deposits in depressed areas. These soils have a low to moderate potential...AFB, Idaho. Mountain Home AFB, Idaho. U.S. Army 2004. http://www.army.mil/ cmh -pg/books/www/252b.htm. Accessed May 26, 2004. VanderSchaaf, D. 1996

  5. Effects of electromagnetic field of 33 and 275 kv influences - AJOL

    African Journals Online (AJOL)

    user

    2012-08-16

    Poland). 347:107-113. Martinez E, Carbonell MV, Florez M (2002) Magnetic biostimulation of initial growth stages of wheat (Triticum aestivum, L.). Electromagnetic. Biol. Med. 21(1):43-53. Mihailovic DT, de Bruin HAR, Jeftic M, ...

  6. 40 CFR 80.275 - How are allotments generated and used?

    Science.gov (United States)

    2010-07-01

    ...) During 2003 only, any domestic or foreign refiner who produces gasoline from crude oil may have the... credits under paragraph (a)(2) of this section. (2) If the average sulfur content of the gasoline produced... importers. (i) If the average sulfur content of the gasoline produced at a refinery is less than or equal to...

  7. 7 CFR 275.23 - Determination of State agency program performance.

    Science.gov (United States)

    2010-01-01

    ... the strike (i.e., the issues surrounding the strike); (iii) The date(s) after the occurrence when..., in accordance with section 602 of the Hunger Prevention Act of 1988, which amended section 13(a)(1...

  8. [Investigation on knowledge, attitudes and practice of oral heath in 275 Kazak people in Changji district].

    Science.gov (United States)

    Gao, Rui; Wang, Xue-jing; You, Qing-ling

    2014-12-01

    To explore the situation of Kazak people's knowledge, attitude and practice (KAP) about oral health and to offer scientific evidence for carrying out oral health education for Kazak people in Xinjiang Changji district. Three hundred Kazak people were randomly included from those who went to the People's Hospital, Department of Stomatology in Xinjiang Changji district for oral examination to conduct a survey on oral KAP. Two hundred seventy-five valid questionnaires were obtained. The data was inputted individually into Excel 2003 on 2 computers, and SPSS 17.0 software package was used for X(2) test. The percentage of the examined Kazak people in Xinjiang Changji district who obtained oral health knowledge through media was 69.4%. Only 8.7% of the subjects had their oral cavity examined regularly. 44% of the subjects achieved oral heath knowledge positively and 64.4% of the subjects believed in health education. 56% of the subjects brushed teeth twice or more per day and only 4% of the subjects used dental floss. Regarding the attitude towards treating dental diseases, 69.5% of the subjects would like to choose the departments of stomatology in the central hospitals, and 6.9% of the subjects didn't care about the doctors. The unbalanced development of oral health knowledge, attitude and practice and the difference in education and income were statistically significant in oral health behavior such as the times of brushing teeth, the choice of doctors and hospitals. The Kazak responders in Xinjiang Changji district have little knowledge about oral health, although their attitude towards oral health is very positive. Because their oral health behavior is not satisfactory, it is very important to provide with them further education of oral health.

  9. Determination of the curves, torque harnesses of performance of an agricultural tractor Massey Ferguson MF 275

    Energy Technology Data Exchange (ETDEWEB)

    Paula, Vanderson Rabelo de [Universidade de Sao Paulo (ESALQ/USP), Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz; Silva, Breno Alves; Santos, Thiago Castro Vidal dos; Porto, Rodrigo Padovani; Volpato, Carlos Eduardo Silva; Barbosa, Jackson Antonio [Universidade Federal de Lavras (UFLA), MG (Brazil)

    2008-07-01

    The globalization of the economy has approached the markets and one of the consequences of this approach is the entrance of new equipment and highly competitive machines in cost terms. This is the same reality of the Brazilian agricultural sector that today counts on new options of machines and very interesting implements of the point of view of the acquisition cost. In this context, this work aimed at the dynamometric assay of an agricultural tractor for attainment of its curves of torque, power using the B100 soybean fuels, B100 olive, B100 diesel. (author)

  10. 32 CFR Appendix N to Part 275 - Obtaining Access to Financial Records Overseas

    Science.gov (United States)

    2010-07-01

    ... Justice. 2. An intelligence organization may seek access pursuant to Procedure 7 of DoD 5240.1-R. 3... only where an official need-to-know exists. Failure to identify or limit access in accordance with this paragraph does not render the information inadmissible in courts-martial or other proceedings. 4. Access to...

  11. 17 CFR 275.203-1 - Application for investment adviser registration.

    Science.gov (United States)

    2010-04-01

    ..., substantial changes to Part II of Form ADV. Thus, the rules for preparing, delivering, and offering Part II... materially inaccurate. State law may continue to require you to file Part II with the appropriate State...) When filed. Each Form ADV is considered filed with the Commission upon acceptance by the IARD. (d...

  12. : tous les projets | Page 275 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HIV, AIDS, PROPHYLAXIS, VACCINES, VACCINATION, Immunization, MEDICAL RESEARCH. Région: North of Sahara, South of Sahara, Namibia. Programme: Santé des mères et des enfants. Financement total : CA$ 1,677,537.00. Renforcement des capacités en vue d'essais en matière de prévention du VIH/sida ...

  13. Forest insects and diseases in Kouchibouguac National Park in 1992. Technical note No. 275. Annual publication

    Energy Technology Data Exchange (ETDEWEB)

    Lemieux, G.R.

    1993-01-01

    Personnel of the Forest Insect and Disease Survey regularly survey national parks for forest insect and disease conditions. This document presents some of the conditions encountered in Kouchibouguac National Park in 1992, including balsam twig aphids, gypsy moth, whitespotted sawyer bettle, white pine weevil, frost damage, Eastern tent caterpiller, uglynest caterpillar, hypoxylon canker, spruce budmoth, Eastern spruce gall adelgid, and other pests encountered.

  14. 17 CFR 275.206(3)-2 - Agency cross transactions for advisory clients.

    Science.gov (United States)

    2010-04-01

    ..., receive commissions from, and have a potentially conflicting division of loyalties and responsibilities... of such other remuneration will be furnished upon written request of such customer; (3) The...

  15. 32 CFR Appendix D to Part 275 - Obtaining Access By Search Warrant

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT... of Criminal Procedure. B. Unless a delay of notice has been obtained under provisions of Appendix H... rights under the Right to Financial Privacy Act of 1978.” C. In any state or territory of the United...

  16. Voice Biometrics over the Internet in the Framework of COST Action 275

    Directory of Open Access Journals (Sweden)

    Evans Nicholas WD

    2004-01-01

    Full Text Available The emerging field of biometric authentication over the Internet requires both robust person authentication and secure computer network protocols. This paper presents investigations of vocal biometric person authentication over the Internet, both at the protocol and authentication robustness levels. As part of this study, an appropriate client-server architecture for biometrics on the Internet is proposed and implemented. It is shown that the transmission of raw biometric data in this application is likely to result in unacceptably long delays in the process. On the other hand, by using data models (or features, the transmission time can be reduced to an acceptable level. The use of encryption/decryption for enhancing the data security in the proposed client-server link and its effects on the transmission time are also examined. Furthermore, the scope of the investigations includes an analysis of the effects of packet loss and speech coding on speaker verification performance. It is experimentally demonstrated that whilst the adverse effects of packet loss can be negligible, the encoding of speech, particularly at a low bit rate, can reduce the verification accuracy considerably. The paper details the experimental investigations conducted and presents an analysis of the results.

  17. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... (a) of this section who renders any investment supervisory or management service to any client shall... definite amount of the particular security. (j)(1) Except as provided in paragraph (j)(3) of this section...

  18. 17 CFR 275.202(a)(11)-1 - Certain broker-dealers.

    Science.gov (United States)

    2010-04-01

    ... incidental to the brokerage services provided to those accounts (including, in particular, that the broker or...); and (ii) Advertisements for, and contracts, agreements, applications and other forms governing...: “Your account is a brokerage account and not an advisory account. Our interests may not always be the...

  19. IAEA Newsbriefs. V. 12, no. 2(75). Apr-May 1997

    International Nuclear Information System (INIS)

    1997-01-01

    This issue gives brief information on the following topics: IAEA safeguards inspectorate granted broader rights, Conferences on nuclear liability, waste safety in early September, States set nuclear safety review meeting, Statements of IAEA Director General, Namibia joins anti-trafficking programme, Symposium on desalination in Republic of Korea, Energy issues on agenda of nuclear fuel cycle symposium in June, IAEA seminars and symposia this autumn, Recent IAEA publications, Atoms for animal health and productivity, Studying the past to learn about the future, Nuclear power status around the world, and other short information

  20. 46 CFR 28.275 - Acceptance criteria for instructors and course curricula.

    Science.gov (United States)

    2010-10-01

    ... contingencies listed in § 28.270(a), or a letter certifying the use of the “Personal Survival and Emergency... service as master of unispected fishing industry vessels and proof of experience that relates directly to... Coast Guard authorizing service as a master of inspected vessels of 100 gross tons or more and proof of...

  1. 33 CFR 207.275 - McClellan-Kerr Arkansas River navigation system: use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... of their tows. (2) Sound signals. In addition to radio communication, the following sound signals are... red light visible through an arc of 360 degrees on the dolphin located furthest upstream in line with the land wall and on the dolphin located furthest downstream in line with the land wall. (3) The...

  2. Thermodynamic Properties of Low-Density {}^{132}Xe Gas in the Temperature Range 165-275 K

    Science.gov (United States)

    Akour, Abdulrahman

    2018-01-01

    The method of static fluctuation approximation was used to calculate selected thermodynamic properties (internal energy, entropy, energy capacity, and pressure) for xenon in a particularly low-temperature range (165-270 K) under different conditions. This integrated microscopic study started from an initial basic assumption as the main input. The basic assumption in this method was to replace the local field operator with its mean value, then numerically solve a closed set of nonlinear equations using an iterative method, considering the Hartree-Fock B2-type dispersion potential as the most appropriate potential for xenon. The results are in very good agreement with those of an ideal gas.

  3. 17 CFR 275.206(4)-4 - Financial and disciplinary information that investment advisers must disclose to clients.

    Science.gov (United States)

    2010-04-01

    ... course of business within the meaning of section 206(4) of the Act (15 U.S.C. 80b-6(4)) for any... such action involved: an investment-related business; fraud, false statements, or omissions; wrongful taking of property; or bribery, forgery, counterfeiting, or extortion; (ii) Was found to have been...

  4. SU-E-J-275: Review - Computerized PET/CT Image Analysis in the Evaluation of Tumor Response to Therapy

    International Nuclear Information System (INIS)

    Lu, W; Wang, J; Zhang, H

    2015-01-01

    Purpose: To review the literature in using computerized PET/CT image analysis for the evaluation of tumor response to therapy. Methods: We reviewed and summarized more than 100 papers that used computerized image analysis techniques for the evaluation of tumor response with PET/CT. This review mainly covered four aspects: image registration, tumor segmentation, image feature extraction, and response evaluation. Results: Although rigid image registration is straightforward, it has been shown to achieve good alignment between baseline and evaluation scans. Deformable image registration has been shown to improve the alignment when complex deformable distortions occur due to tumor shrinkage, weight loss or gain, and motion. Many semi-automatic tumor segmentation methods have been developed on PET. A comparative study revealed benefits of high levels of user interaction with simultaneous visualization of CT images and PET gradients. On CT, semi-automatic methods have been developed for only tumors that show marked difference in CT attenuation between the tumor and the surrounding normal tissues. Quite a few multi-modality segmentation methods have been shown to improve accuracy compared to single-modality algorithms. Advanced PET image features considering spatial information, such as tumor volume, tumor shape, total glycolytic volume, histogram distance, and texture features have been found more informative than the traditional SUVmax for the prediction of tumor response. Advanced CT features, including volumetric, attenuation, morphologic, structure, and texture descriptors, have also been found advantage over the traditional RECIST and WHO criteria in certain tumor types. Predictive models based on machine learning technique have been constructed for correlating selected image features to response. These models showed improved performance compared to current methods using cutoff value of a single measurement for tumor response. Conclusion: This review showed that computerized PET/CT image analysis holds great potential to improve the accuracy in evaluation of tumor response. This work was supported in part by the National Cancer Institute Grant R01CA172638

  5. Technical specifications: Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1985-08-01

    Safety limits and limiting safety system settings are presented for the reactivity control systems; power distribution limits; instrumentation; reactor coolant system; emergency core cooling system; containment systems; plant systems; electrical power systems; refueling operations; special test exceptions; radioactive effluents; and radiological environmental monitoring

  6. Strong conservation of the bird Z chromosome in reptilian genomes is revealed by comparative painting despite 275 million years divergence

    Czech Academy of Sciences Publication Activity Database

    Pokorná, Martina; Giovannotti, M.; Kratochvíl, L.; Kasai, F.; Trifonov, V. A.; O'Brien, P. C. M.; Caputo, V.; Olmo, E.; Ferguson-Smith, M. A.; Rens, W.

    2011-01-01

    Roč. 120, č. 5 (2011), s. 455-468 ISSN 0009-5915 R&D Projects: GA ČR GAP506/10/0718 Institutional research plan: CEZ:AV0Z50450515 Keywords : Distantly related marsupials * Avian sex-hromosomes * karyotype relationships Subject RIV: EG - Zoology Impact factor: 3.847, year: 2011

  7. 17 CFR 275.206(4)-2 - Custody of funds or securities of clients by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... to meet control objectives relating to custodial services, including the safeguarding of funds and... in customer accounts; (iii) A futures commission merchant registered under section 4f(a) of the Commodity Exchange Act (7 U.S.C. 6f(a)), holding the client assets in customer accounts, but only with...

  8. 41 CFR 102-118.275 - What must my agency consider when designing and implementing a prepayment audit program?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Prepayment Audits of Transportation... services, your agency should ensure that each TSP bill or employee travel voucher contains enough information for the prepayment audit to determine which contract or rate tender is used and that the type and...

  9. 49 CFR 178.275 - Specification for UN Portable Tanks intended for the transportation of liquid and solid hazardous...

    Science.gov (United States)

    2010-10-01

    ... solid hazardous materials. (b) Definitions and requirements—(1) Design pressure means the pressure to be used in calculations required by the recognized pressure vessel code. The design pressure must not be less than the highest of the following pressures: (i) The maximum effective gauge pressure allowed in...

  10. The relevance of uniform reporting in oral leukoplakia: Definition, certainty factor and staging based on experience with 275 patients

    NARCIS (Netherlands)

    Brouns, E.R.E.A.; Baart, J.A.; Bloemena, E.; Karagozoglu, H.; van der Waal, I.

    2013-01-01

    The aim of the present study was to evaluate the definition of oral leukoplakia, proposed by the WHO in 2005 and taking into account a previously reported classification and staging system, including the use of a Certainty factor of four levels with which the diagnosis of leukoplakia can be

  11. Environmental Assessment for Travis AFB C-17 Use of Instrument Routes 264, 275, 280, 281 , and 282 in Central Nevada

    Science.gov (United States)

    2013-09-01

    Travis AFB will seek to eliminate or minimize the potential for adverse effects to Native American resources (i.e., burial sites and ceremonial and...archaeological sites, burial sites, ceremonial areas, caves, mountains, water sources, trails, plant habitat or gathering areas, or any other natural...the USEPA. Ecoregions of Nevada. Available at http://www.epa.gov/ wed /pages/ecoregions/nv_eco.htm Downloaded on July 22, 2011. Clarkson, B.L. and

  12. Youth, violence and health: the construction of information in processes of knowledge mediation and appropriation - DOI: 10.3395/reciis.v3i3.275en

    Directory of Open Access Journals (Sweden)

    Regina Maria Marteleto

    2009-09-01

    Full Text Available This is a report of a study on how youngsters from lower economical classes in large cities, as information subjects,transform the established meanings of discursive and narrative forms – the “third knowledge” -, revealing the influence of physical and symbolic violence suffered from state, media, school, and society, that results on negative representation for their identities. The subjects include youngsters from projects conducted by non-governmental organizations, by the state or social movements. We use the concepts of mediation and social knowledge appropriation to study how they translate their violence experiences into their symbolic reserve. We present an informational experiment, a fanzine,regarding urban violence and its effects on young people, that was carried out in the research process. The interpretative analysis based on qualitative methodology indicates a symbolic and identity conflict in a possible informational action taken on the violent contexts where these youngsters live.

  13. Crystal structure, thermal behaviour and parageneses of koninckite, FePO.sub.4./sub.•2.75H.sub.2./sub.O

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Majzlan, J.; Wierzbicka-Wieczorek, M.; Kiefer, B.

    2015-01-01

    Roč. 79, č. 5 (2015), s. 1159-1173 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : koninckite * ferric phosphate * synchrotron diffraction * crystal structure * density-functional theory Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2015

  14. Physical activity, body mass index and heart rate variability-based stress and recovery in 16 275 Finnish employees: a cross-sectional study

    OpenAIRE

    F?hr, Tiina; Pietil?, Julia; Helander, Elina; Myllym?ki, Tero; Lindholm, Harri; Rusko, Heikki; Kujala, Urho M.

    2016-01-01

    Background Physical inactivity, overweight, and work-related stress are major concerns today. Psychological stress causes physiological responses such as reduced heart rate variability (HRV), owing to attenuated parasympathetic and/or increased sympathetic activity in cardiac autonomic control. This study?s purpose was to investigate the relationships between physical activity (PA), body mass index (BMI), and HRV-based stress and recovery on workdays, among Finnish employees. Methods The part...

  15. Role of the Ectodomain Serine 275 in Shaping the Binding Pocket of the ATP-Gated P2X3 Receptor

    Czech Academy of Sciences Publication Activity Database

    Petrenko, N.; Khafizov, K.; Tvrdoňová, Vendula; Skorinkin, A.; Giniatullin, R.

    2011-01-01

    Roč. 50, č. 39 (2011), s. 8427-8436 ISSN 0006-2960 Grant - others:Univerzita Karlova(CZ) 3446/2011 Institutional research plan: CEZ:AV0Z50110509 Keywords : P2X3 * purinergic * ATP * ATP-binding pocket * receptor Subject RIV: ED - Physiology Impact factor: 3.422, year: 2011

  16. The synchronization of palaeoclimatic events in the North Atlantic region during Greenland Stadial 3 (ca 27.5 to 23.3 kyr b2k)

    DEFF Research Database (Denmark)

    Hibbert, F.D.; Peters, C.; Rasmussen, Sune Olander

    2012-01-01

    Two high resolution marine sediment cores located 83 km apart in the NE Atlantic have been studied: MD95-2006 (Barra Fan; 57°01.82 N, 10°03.48 W; 2120 m water depth) and MD04-2822 (Rockall Trough; 56°50.54 N, 11°22.96 W; 2344 m water depth). The records are anchored to the NGRIP ice core stratigr...

  17. Multibeam collection for TN275: Multibeam data collected aboard Thomas G. Thompson from 2012-02-11 to 2012-02-21, Apra, Guam to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Spin density matrix elements in exclusive ρ 0 electroproduction on 1H and 2H targets at 27.5 GeV beam energy

    Science.gov (United States)

    Airapetian, A.; Akopov, N.; Akopov, Z.; Andrus, A.; Aschenauer, E. C.; Augustyniak, W.; Avakian, R.; Avetissian, A.; Avetissian, E.; Belostotski, S.; Bianchi, N.; Blok, H. P.; Böttcher, H.; Bonomo, C.; Borissov, A.; Brüll, A.; Bryzgalov, V.; Capiluppi, M.; Capitani, G. P.; Cisbani, E.; Ciullo, G.; Contalbrigo, M.; Dalpiaz, P. F.; Deconinck, W.; de Leo, R.; Demey, M.; de Nardo, L.; de Sanctis, E.; Diefenthaler, M.; di Nezza, P.; Dreschler, J.; Düren, M.; Ehrenfried, M.; Elalaoui-Moulay, A.; Elbakian, G.; Ellinghaus, F.; Elschenbroich, U.; Fabbri, R.; Fantoni, A.; Felawka, L.; Frullani, S.; Funel, A.; Gabbert, D.; Gapienko, G.; Gapienko, V.; Garibaldi, F.; Gavrilov, G.; Gharibyan, V.; Giordano, F.; Gliske, S.; Grebeniouk, O.; Gregor, I. M.; Guler, H.; Hadjidakis, C.; Hartig, M.; Hasch, D.; Hasegawa, T.; Hesselink, W. H. A.; Hill, G.; Hillenbrand, A.; Hoek, M.; Holler, Y.; Hommez, B.; Hristova, I.; Iarygin, G.; Imazu, Y.; Ivanilov, A.; Izotov, A.; Jackson, H. E.; Jgoun, A.; Kaiser, R.; Keri, T.; Kinney, E.; Kisselev, A.; Kobayashi, T.; Kopytin, M.; Korotkov, V.; Kozlov, V.; Kravchenko, P.; Krivokhijine, V. G.; Lagamba, L.; Lamb, R.; Lapikás, L.; Lehmann, I.; Lenisa, P.; Liebing, P.; Linden-Levy, L. A.; Lorenzon, W.; Lu, S.; Lu, X.-R.; Ma, B.-Q.; Maiheu, B.; Makins, N. C. R.; Manaenkov, S. I.; Mao, Y.; Marianski, B.; Marukyan, H.; Mexner, V.; Miller, C. A.; Miyachi, Y.; Muccifora, V.; Murray, M.; Mussgiller, A.; Nagaitsev, A.; Nappi, E.; Naryshkin, Y.; Nass, A.; Negodaev, M.; Nowak, W.-D.; Osborne, A.; Pappalardo, L. L.; Perez-Benito, R.; Pickert, N.; Raithel, M.; Reggiani, D.; Reimer, P. E.; Reischl, A.; Reolon, A. R.; Riedl, C.; Rith, K.; Rock, S. E.; Rosner, G.; Rostomyan, A.; Rubacek, L.; Rubin, J.; Ryckbosch, D.; Salomatin, Y.; Sanjiev, I.; Schäfer, A.; Schnell, G.; Schüler, K. P.; Seitz, B.; Shearer, C.; Shibata, T.-A.; Shutov, V.; Stancari, M.; Statera, M.; Steffens, J. E.; Steijger, J. J. M.; Stenzel, H.; Stewart, J.; Stinzing, F.; Streit, J.; Tait, P.; Taroian, S.; Tchuiko, B.; Terkulov, A.; Trzcinski, A.; Tytgat, M.; Vandenbroucke, A.; van der Nat, P. B.; van der Steenhoven, G.; van Haarlem, Y.; van Hulse, C.; Varanda, M.; Veretennikov, D.; Vikhrov, V.; Vilardi, I.; Vogel, C.; Wang, S.; Yaschenko, S.; Ye, H.; Ye, Y.; Ye, Z.; Yen, S.; Yu, W.; Zeiler, D.; Zihlmann, B.; Zupranski, P.

    2009-08-01

    Spin Density Matrix Elements (SDMEs) describing the angular distribution of exclusive ρ 0 electroproduction and decay are determined in the HERMES experiment with 27.6 GeV beam energy and unpolarized hydrogen and deuterium targets. Eight (fifteen) SDMEs that are related (unrelated) to the longitudinal polarization of the beam are extracted in the kinematic region 1exchange amplitudes; these amplitudes are naturally generated with a quark-exchange mechanism.

  19. Comparison of various methods to determine bulk specific gravity of cores : an investigation of high values using AASHTO T275 - paraffin-coated method.

    Science.gov (United States)

    2012-07-01

    A report from a MoDOT asphalt paving project was that unexpected results were obtained when adhering to the standard for determination of bulk specific gravity of compacted asphalt mixture (Gmb) specimens, AASHTO T 166. The test method requires speci...

  20. Technical specifications Diablo Canyon Nuclear Power Plant, Unit No. 1 (Docket No. 50-275). Appendix A to License No. DPR-80

    International Nuclear Information System (INIS)

    1984-11-01

    This Appendix includes definitions, safety limits and limiting safety system settings, limiting conditions for opertion and surveillance requirements, bases, design features, and administrative controls

  1. Suicide in peacekeepers--a cohort study of mortality from suicide in 22,275 Norwegian veterans from international peacekeeping operations.

    Science.gov (United States)

    Thoresen, Siri; Mehlum, Lars; Moller, Bjorn

    2003-11-01

    Several studies have investigated post-traumatic stress reactions and other psychosocial problems in former peacekeepers. The question has also been raised as to whether such veterans might be at increased risk of suicide. This study investigated the suicide mortality in Norwegian former peacekeepers. Cause-specific mortality was identified in the population of Norwegian peacekeepers having participated in army missions in the years 1978-95. General population data were used for comparison. Standardized Mortality Ratios (SMRs) were calculated for different suicide methods and certain peacekeeping-related variables. Marital status was available for each year and controlled for by using separate suicide rates for unmarried, married and divorced. A moderately, but significantly, increased SMR of 1.4 for suicide was found among the former peacekeepers (95% confidence interval = 1.1-1.8). After adjusting for marital status, the SMR was reduced to insignificance (SMR = 1.1, 95% confidence interval = 0.9-1.4). There was a significant increase in suicide by means of firearms and carbon monoxide poisoning. The increased risk of suicide in former peacekeepers was related to the peace-keepers' lower marriage rate compared to the general population. This finding may indicate that the personnel were characterized by certain vulnerability factors before entering peacekeeping service, resulting in a reduced ability to enter into and remain in stable love relations. However, it cannot be excluded that stress reactions following peacekeeping may have contributed to possible strains on interpersonal relationships. Preventative work should, thus, include improved personnel selection routines and preferably also psychosocial support for veterans and their families. The increased number of suicides by use of firearms indicates that gun control might be an important prevention measure in this group.

  2. Hubungan Self Regulation Dengan Self Determination (Studi Pada Mahasiswa Aktif Semester Genap 2013/2014, Ipk ≤ 2.75, Fakultas Psikologi, Universitas X, Jakarta)

    OpenAIRE

    Rozali, Yuli Azmi

    2014-01-01

    Students who are motivated towards their task, will be able to perform its task properly and independently, as well as having a high level of creativity in their work, so that students are expected to produce satisfactory academic achievement. However, students with lower educational achievement measured in GPA, a student who is suspected of having a low self-sufficiency. They are not motivated to follow the teaching and learning process in higher education. This study is a quantitative non-e...

  3. Druggists and pharmacists as gatekeepers: Sales routines and compliance with sales protocols for over-the-counter naproxen 275 mg medicines in the Netherlands

    NARCIS (Netherlands)

    van Hoof, Joris Jasper; Cents, Michel H.G.; Megens, Nicole M.J.; van der Tang, Sijbrand J.

    2014-01-01

    Objectives Since for the sales of over-the-counter (OTC) medicines, prescribing physicians are not involved, and written instructions on/in the medicine boxes are inefficient, druggists and pharmacists are important gatekeepers in preventing customers’ accidents. In this study we investigated the

  4. Service life study as a result of a failure in the 10 kV/275 MVA power switch system in Emmeloord, July 8th, 1991. Duurzaamheidsonderzoek naar aanleiding van de storing in de 10 kV/275 MVA schakelinstallatie te Emmeloord, d. d. 8-7-1991

    Energy Technology Data Exchange (ETDEWEB)

    Koerts, H.C.; Smit, J.J.

    1992-01-01

    The title study serves as a case study in the current research on the rest service life of power switching circuits. The results of the research will be important for preventive maintenance, component management and the estimation of the service life of power switching systems. In cooperation with the users diagnostic procedures were developed for older switching circuits. A breakdown scenario was drafted to localize the primary failure. In this case study the cause appeared to be the failure of the insulation system. The quality of the oil insulation and the solid insulation materials was poor.

  5. 2013 Review of Neutron and Non-Neutron Nuclear Data

    Science.gov (United States)

    Holden, N. E.

    2016-02-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  6. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  7. Technical evaluation report TMI action: NUREG-0737 (II.D.1) relief and safety valve testing,. Diablo Canyon Units 1 and 2 (Docket Nos. 50-275, 50-323)

    International Nuclear Information System (INIS)

    Miller, G.K.; Magleby, H.L.; Nalezny, C.L.

    1984-07-01

    Light water reactor operators have experienced a number of occurrences of improper performance of safety and relief valves installed in their primary coolant systems. Because of this, the authors of NUREG-0578 (TMI-2 Lessons Learned Task Status Report and Short-Term Recommendations) and subsequently NUREG-0737 (Clarification of TMI Action Plan Requirements) recommended that programs be developed and completed which would reevaluate the functional performance capabilities of Pressurized Water Reactor (PWR) safety, relief, and block valves and which would verify the integrity of the piping systems for normal, transient and accident conditions. This report provides the results of the review of these programs and their results by the Nuclear Regulatory Commission (NRC) and their consultant, EG and G Idaho, Inc. Specifically, this report has examined the response of the Licensee for Diablo Canyon Units 1 and 2, to the requirements of NUREG-0578 and NUREG-0737 and finds that the Licensee has provided an acceptable response, reconfirming that the General Design Criteria 14, 15 and 30 of Appendix A to 10 CRF 50 have been met. 18 refs

  8. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 30

    International Nuclear Information System (INIS)

    1985-04-01

    Supplement 30 to the Safety Evaluation Report for the application by the Pacific Gas and Electric Company (PG and E) to operate the Diablo Canyon Nuclear Power Plant - Unit 2 (Docket No. 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. SSER 30 reports on the staff's technical review and evaluation of the design and analysis of Unit 2 piping systems and pipe supports. The staff effort includes an evaluation of PG and E's treatment of issues raised during the Unit 1 design verification, actions resulting from low power License Condition 2.C.(11) in the Unit 1 low power license DPR-76 and the Unit 2 applicability and resolution of certain allegations related to piping and supports

  9. Safety-evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 16

    International Nuclear Information System (INIS)

    1983-08-01

    This supplement addresses certain allegations received by the staff concerning safety deficiencies at the Diablo Canyon project, specifically those relative to design aspects of the component cooling water system (CCWS), including its seismic classification, single failure considerations, and its heat removal capabilities. It is based on the staff's re-review of the Diablo Canyon Final Safety Analysis Report (FSAR); on a site walkdown conducted on January 12, 1983; on information obtained during meetings with the applicant dated March 15, 18, and 25, April 4, 7, and 15, and May 3 and 18, 1983

  10. SU-E-J-275: Impact of the Intra and Inter Observer Variability in the Delineation of Parotid Glands On the Dose Calculation During Head and Neck Helical Tomotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Jodda, A; Piotrowski, T [Greater Poland Cancer Centre Poznan (Poland)

    2014-06-01

    Purpose: The intra- and inter-observer variability in delineation of the parotids on the kilo-voltage computed tomography (kVCT) and mega-voltage computed tomography (MVCT) were examined to establish their impact on the dose calculation during adaptive head and neck helical tomotherapy (HT). Methods: Three observers delineated left and right parotids for ten randomly selected patients with oropharynx cancer treated on HT. The pre-treatment kVCT and the MVCT from the first fraction of irradiation were selected to delineation. The delineation procedure was repeated three times by each observer. The parotids were delineated according to the institutional protocol. The analyses included intra-observer reproducibility and inter-structure, -observer and -modality variability of the volume and dose. Results: The differences between the left and right parotid outlines were not statistically significant (p>0.3). The reproducibility of the delineation was confirmed for each observer on the kVCT (p>0.2) and on the MVCT (p>0.1). The inter-observer variability of the outlines was significant (p<0.001) as well as the inter-modality variability (p<0.006). The parotids delineated on the MVCT were 10% smaller than on the kVCT. The inter-observer variability of the parotids delineation did not affect the average dose (p=0.096 on the kVCT and p=0.176 on the MVCT). The dose calculated on the MVCT was higher by 3.3% than dose from the kVCT (p=0.009). Conclusion: Usage of the institutional protocols for the parotids delineation reduces intra-observer variability and increases reproducibility of the outlines. These protocols do not eliminate delineation differences between the observers, but these differences are not clinically significant and do not affect average doses in the parotids. The volumes of the parotids delineated on the MVCT are smaller than on the kVCT, which affects the differences in the calculated doses.

  11. Danish Post‐Secondary Students Use Public Libraries for Study Purposes. A review of: Pors, Niels Ole. “The Public Library and Students’ Information Needs.” New Library World 107.1226/12272 (2006: 275‐85.

    Directory of Open Access Journals (Sweden)

    Julie McKenna

    2007-09-01

    Full Text Available Objective – To determine whether and how Danish university and higher education students use public libraries for studypurposes.Design – Online survey.Setting – Post‐secondary programs in Denmark.Subjects – 1,575 students in university‐level programs or other higher education programs (vocational three‐to‐four‐year programs in Denmark.Methods – A sample of students was drawn from the national database of students by selecting every student born on the 15th of every month (approximately 4,900 students. A letter describing the study and with an invitation to fill out an online questionnaire was sent to all students in the sample. There were 1,694 valid responses (approximately 35% response rate. Students following short vocational programs were deemed to be under‐represented and these subjects were omitted from the analysis of this report,which reflects the response of 1,575 students. The online questionnaire gathered demographic details (gender, age, educational institution, study topic, study year, geographical location, access to the Internet, etc. and used 110 questions or statements to gather information about student information‐seeking behaviour related to study purposes. These included use of the physical library and satisfaction with services, use of search engines, awareness and use of library Web‐based services, study behaviour, and participation in information literacy activities. Main results – For the purposes of this study, “academic library is used as a generic term covering university libraries, research libraries, educational libraries and all other kind of libraries outside the field of public libraries” (p. 278. The survey results confirmed many of the previous international reports of student information‐seeking behaviour: 85% of students use the academic library for study purposes; fewer than 10% of all students are able to cope without any library use; students in technology and engineering, the sciences and arts, architecture and music have a higher rate of non‐use of their academic libraries; a large percentage of students access the electronic resources from home; the physical library is still considered important to students; Google is used extensively and is nearly the exclusive choice for search engine. The public library is used for study purposes by about 58 percent of all students with the highest use (76% by students in higher education institutions (HEI; students of education, social topics and psychology are very frequent public library users. Female students in HEI were the most frequent users of the public library independent of study subject or year, or any other demographic variable. Seven per cent of students rely exclusively on the public library for study purposes and first‐year HEI students in the subject areas of education, social topics and psychology are over‐represented in this group (which additionally has less Internet access from home than the other students. Students perceive nearly all aspects of service in the academic library as superior; HEI students rate ambience, electronic resources and speed of inter‐library loan provision in the public library as higher than the academic. University students give a low rating to the collections of public library, although the students use the public library principally to supplement the collections available in their academic libraries. Another high use of public libraries by HEI students is for interlibrary loans placed through the national resource sharing system. Public library reference services are used often by only one per cent of students and only two per cent use the public library on a regular basis for “study related group activities.” Conclusion – Students use physical libraries to a great extent to support their studies and students have embraced digital access to collections, especially access from home. Google is the most heavily used search engine and is used by nearly all students;use of Google complements and supplements library use. Nearly 60% of all students use public libraries for study purposes and to supplement the collections of their academic library, but they find that the public library collections are insufficient to meet their needs. The inter‐library loan policies of public libraries are more lenient and accommodating to student needs and may drive the high use of public libraries. Students form a large constituency of the public library user population and they generally rate most aspects of service as substandard to those of academic libraries. There is a call for review of the public library’s role in meeting the information needs of students, and in particular, those of HEI programs who are most dependent on the public library.

  12. A Bluetooth Low-Energy Transceiver with 3.7-mW All-Digital Transmitter, 2.75-mW High-IF Discrete-Time Receiver, and TX/RX Switchable On-Chip Matching Network

    NARCIS (Netherlands)

    Kuo, F.W.; Binsfeld Ferreira, S.; Chen, R.; Cho, L.C.; Jou, C.P.; Hsueh, F.L.; Madadi, I.; Tohidian, M.; Shahmohammadi, M.; Babaie, M.; Staszewski, R.B.

    2017-01-01

    We present an ultra-low-power Bluetooth low-energy (BLE) transceiver (TRX) for the Internet of Things (IoT) optimized for digital 28-nm CMOS. A transmitter (TX) employs an all-digital phase-locked loop (ADPLL) with a switched current-source digitally controlled oscillator (DCO) featuring low

  13. Additive Effectiveness Investigations in Alternative Fuels

    Science.gov (United States)

    2014-05-01

    Proprietary chemistry marketed by Innospec as Stadis 450. The CI/LI and FSII were added to the SPKs in bulk before additizing to the test plan. Since...275 275 275 ASTM Code ɚ ɚ ɚ. ɚ 4AP > 4P ɚ ɚ ɚ >4AP > 4P Ellipsometry Depth, 2.5mm2 nm 8.9 9.7 10.9 12.2 219.4 181.9 4.3 7.3 9.0 >250 >250 Maximum...23.0 23.0 D3241 Jet Fuel Thermal Stability Test Temperature °C 275 275 275 275 275 275 275 275 275 275 275 ASTM Code ɚ ɚ ɚ. ɚ 4AP > 4P ɚ ɚ ɚ >4AP

  14. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  15. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2011-05-27

    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  16. ÂNGELO, Vitor Amorim de; VILLA, Marco Antonio (Orgs. O Partido dos Trabalhadores e a política brasileira (1980-2006: uma história revisitada. São Carlos(SP: Editora: EdUFSCar, 2009 (275p.

    Directory of Open Access Journals (Sweden)

    REA Editor

    2009-09-01

    Full Text Available

  17. Classics in physical geography revisited. Hewlett, J.D. and Hibbert, A.R. 1967: Factors affecting the response of small watersheds to precipitation in humid areas. In Sopper, W.E. and Lull, H.W., editors, Forest hydrology, New York: Pergamon Press, 275-90.

    Science.gov (United States)

    Jeffrey J. McDonnell

    2009-01-01

    Hewlett and Hibbert’s (1967) ‘Factors affecting the response of small watersheds to precipitation in humid areas’ (hereafter referred to as ‘Factors’) is one of the most important papers published in the field of catchment hydrology.

  18. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Cancer Society 4,275 views 3:29 Little Stars – Paediatric Palliative Care – Charlie's Story - Duration: 10:35. Little Stars 12,275 views 10:35 Pediatric Palliative Care ...

  19. The role of radiation loses in high-pressure blasted electrical arcs

    Czech Academy of Sciences Publication Activity Database

    Gregor, J.; Jakubová, I.; Šenk, J.; Mašláni, Alan

    2011-01-01

    Roč. 275, č. 1 (2011), 012007-012007 E-ISSN 1742-6596. [European Conference on High-Technology Plasma Processes (HTPP 11)/11th./. Brussels, 27.06.2010-02.07.2010] Institutional research plan: CEZ:AV0Z20430508 Keywords : High-pressure electrical arc * radiation loss * mathematical model Subject RIV: BL - Plasma and Gas Discharge Physics http://iopscience.iop.org/1742-6596/275/1/012007/pdf/1742-6596_275_1_012007.pdf

  20. Alfvén wave filamentation and dispersive phase mixing in a high-density channel: Landau fluid and hybrid simulations

    Czech Academy of Sciences Publication Activity Database

    Borgogno, D.; Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2009-01-01

    Roč. 16, č. 2 (2009), s. 275-285 ISSN 1023-5809 R&D Projects: GA AV ČR IAA300420702 Institutional research plan: CEZ:AV0Z30420517; CEZ:AV0Z10030501 Keywords : Alfven wave * phase mixing * filamentation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.152, year: 2009 http://www.nonlin-processes-geophys.net/16/275/2009/npg-16-275-2009.pdf

  1. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Length = 140 ... Query: 275 IDLKAMITGILRETKLPGNVTVQQHFTEELPRIWADEKQLPIVFKNLLRNARDAMPDGGS 334 ... IDLKA...MITGILRETKLPGNVTVQQHFTEELPRIWADEKQLPIVFKNLLRNARDAMPDGGS Sbjct: 1 ... IDLKAMITGILRET...KLPGNVTVQQHFTEELPRIWADEKQLPIVFKNLLRNARDAMPDGGS 60 ... Query: 395 MRLESEPGRGTSFDISIPIA 414 ... MRLESEPGRGTSFDISIPIA Sbjct: 121 MRLESEPGRGTSFDISIPIA 140

  2. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... paratuberculosis str. k10] ... Length = 296 ... Query: 216 VAQLIDRHGMARPESPGGSLDDAHLTLLDVRTELHRVS...GRGLDQLLAQYGDELSAALHIG 275 ... VAQLIDRHGMARPESPGGSLDDAHLTLLDVRTELHRVSGRGLD...QLLAQYGDELSAALHIG Sbjct: 1 ... VAQLIDRHGMARPESPGGSLDDAHLTLLDVRTELHRVSGRGLDQLLAQYGDELSAALHIG 60 ... Query: 336 LAR

  3. South African Radio League Introduction to Amateur Radio: A study guide for the Radio Amateur Examination

    CSIR Research Space (South Africa)

    Burger, Chris

    2016-01-01

    Full Text Available (CW) ......................................................................................... 181 21.6 Frequency Modulation (FM) .................................................................................. 182 21.7 Digital Modulation... ........................................................................................................................ 275 Revision Questions ........................................................................................................ 276 Chapter 30: Digital Systems...

  4. The Coast Artillery Journal. Volume 86, Number 2, March-April 1943

    Science.gov (United States)

    1943-04-01

    Parkinson Keyes .. 3.00 Reprisal. By Ethel Vance , 2.50 The Cup and the Sword. B)’ Alice Tisdale Hobart 2.75 Time of Peace. B)’ Ben Ames Williams 2.75...shower of dirt covers you momentarily, but you keep on crawling as though stopping was impossible. After the first few hectic minutes you forgot the

  5. Why can’t a woman bid more like a man?

    Czech Academy of Sciences Publication Activity Database

    Chen, Y.; Katuščák, Peter; Ozdenoren, E.

    -, č. 275 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : auction * gender * menstrual cycle * estrogen Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp275.pdf

  6. 2017-2018 Expense report for Uri Rosenthal | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-06-19

    $7,275.54. Board Meetings. June 19, 2017 to June 21, 2017. CA$7,275.54. What we do · Funding · Resources · About IDRC. Knowledge. Innovation. Solutions. Careers · Contact Us · Site map. Sign up now for IDRC news and views sent directly to your ...

  7. Seasonal variation in the flux of planktic foraminifera: Sediment trap results from the Bay of Bengal, Northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Guptha, M.V.S.; Curry, W.B.; Ittekkot, V.; Muralinath, A.S.

    stream_size 15 stream_content_type text/plain stream_name J_Foramin_Res_27_5.pdf.txt stream_source_info J_Foramin_Res_27_5.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  8. Mutually consistent thermodynamic potentials for fluid water, ice and seawater: a new standard for oceanography

    Czech Academy of Sciences Publication Activity Database

    Feistel, R.; Wright, D.G.; Miyagawa, K.; Harvey, A.H.; Hrubý, Jan; Jackett, D.R.; McDougall, T.J.; Wagner, W.

    2008-01-01

    Roč. 4, č. 4 (2008), s. 275-291 ISSN 1812-0784 Institutional research plan: CEZ:AV0Z20760514 Keywords : seawater * equation of state * metastable states Subject RIV: BJ - Thermodynamics www.ocean-sci.net/4/275/2008

  9. Foreign Language Analysis and Recognition (FLARE) Progress

    Science.gov (United States)

    2015-02-01

    results in the same format as the input. Research into HTML5 was initiated to improve functionality across different operating systems. The...geolocation information. Scripts were developed for translating web pages and displaying the results in the same format as the input. Research into HTML5 ...26.6 HMM-ML – 27.5 27.5 27.5 N-best ROVER – 25.3 25.0 25.0 as Adobe Flash, so research into HTML5 was initiated. Multiple File Upload: There was a

  10. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  11. Effect of gamma radiation and ethylene oxide on neomycin sulphate

    International Nuclear Information System (INIS)

    Gopal, N.G.S.; Rajagopalan, S.

    1981-01-01

    Neomycin is affected by ethylene oxide but not by gamma radiation (2.75 Mrad). Differential refractometry is more advantageous in quantitating neomycin A, B and C than is the ninhydrin method. (Auth.)

  12. Semeia und Tekmeria im 5. Jahrhundert v. Chr.: Ein Beitrag zur Geschichte der ältesten griechischen Semiotik und Argumentationstechnik

    Czech Academy of Sciences Publication Activity Database

    Klouda, Jiří

    2016-01-01

    Roč. 139, 3/4 (2016), s. 275-299 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : theory of signs * theory of argumentation * the older Attic orators * Hippocratic Prognosticon * Dissoi logoi Subject RIV: AA - Philosophy ; Religion

  13. Nová konstrukce rotoru heliové expanzní turbiny

    Czech Academy of Sciences Publication Activity Database

    Dupák, Jan; Hanzelka, Pavel; Michalička, Petr; Tuček, L.; Ustohal, V.

    č. 9 (2002), s. 275 - 276 ISSN 0447-6441 Institutional research plan: CEZ:AV0Z2065902 Keywords : helium expansion turbine * nickel-chrome-tungsten steel 16720 Subject RIV: BM - Solid Matter Physics ; Magnetism

  14. On the behavioural relevance of optional and mandatory impure public goods

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Munro, A.; Valente, M.

    2017-01-01

    Roč. 61, August (2017), s. 134-144 ISSN 0167-4870 Institutional support: RVO:67985998 Keywords : behavioural economics * experiment * charity Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 1.275, year: 2016

  15. 76 FR 58830 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year (FY) 2008

    Science.gov (United States)

    2011-09-22

    ... Component Howard University: 576 W Streets, NW., Washington, DC 20059...... (202) 806-5567 3 312,621.00...,000.00 CA 92701 Fair Housing Council of Oregon: 1020 SW., Taylor Street, Ste. (503) 402-1157 10 275...

  16. Two-step processing of human frataxin by mitochondrial processing peptidase

    Czech Academy of Sciences Publication Activity Database

    Cavadini, P.; Adamec, Jiří; Taroni, F.; Gakh, O.; Isaya, G.

    2000-01-01

    Roč. 275, č. 52 (2000), s. 41469-41475 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z5020903 Keywords : eukaryotes * human frataxin Subject RIV: EE - Microbiology, Virology Impact factor: 7.368, year: 2000

  17. 29 CFR 37.6 - What specific discriminatory actions, based on prohibited grounds other than disability, are...

    Science.gov (United States)

    2010-07-01

    ... indirect, and other mechanisms may also be considered indirect. See also §§ 667.266 and 667.275 of 20 CFR... social service providers and beneficiaries. (f)(2) Except under the circumstances described in paragraph...

  18. First operation of SOLEIL, a third generation synchrotron radiation source in France and prospects for ARC-EN-CIEL, a LINAC based fourth generation source

    Energy Technology Data Exchange (ETDEWEB)

    Couprie, M.E. [Synchrotron SOLEIL, Saint Abin, BP 34, 91 192 Gif-sur-Yvette (France)]. E-mail: marie-emmanuelle.couprie@synchrotron-soleil.fr; Filhol, J.M. [Synchrotron SOLEIL, Saint Abin, BP 34, 91 192 Gif-sur-Yvette (France); Benabderhammane, C. [Synchrotron SOLEIL, Saint Abin, BP 34, 91 192 Gif-sur-Yvette (France)] (and others)

    2007-05-21

    The first results of commissioning for the French Synchrotron Radiation Facility SOLEIL at 2.75 GeV are presented. Perspectives for the fourth generation light source based on the ARC-EN-CIEL project are described.

  19. First operation of SOLEIL, a third generation synchrotron radiation source in France and prospects for ARC-EN-CIEL, a LINAC based fourth generation source

    Science.gov (United States)

    Couprie, M. E.; Filhol, J. M.; Benabderhammane, C.; Berteaud, P.; Besson, J. C.; Briquez, F.; Brunelle, P.; Bruni, C.; Chubar, O.; Denard, J. C.; Girault, M.; Godefroy, J. M.; Herbaux, C.; Lebasque, P.; Le Roux, V.; Level, M. P.; Lestrade, A.; Loulergue, A.; Marchand, P.; Marcouille, O.; Marteau, F.; Massal, M.; Nadji, A.; Nadolski, L.; Nagaoka, R.; Paulin, F.; Pottin, B.; Tordeux, M. A.; Valleau, M.; Vétéran, J.; Carré, B.; Garzella, D.; Labat, M.; Lambert, G.; Monot, P.; Jablonka, M.; Méot, F.; Mosnier, A.; Marquès, J. R.; Ortéga, J. M.

    2007-05-01

    The first results of commissioning for the French Synchrotron Radiation Facility SOLEIL at 2.75 GeV are presented. Perspectives for the fourth generation light source based on the ARC-EN-CIEL project are described.

  20. Intracranial EEG Connectivity Analysis and Result Imaging

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Petr; Janeček, Jiří; Jurák, Pavel; Halámek, Josef; Chládek, Jan; Brázdil, M.

    2012-01-01

    Roč. 2, č. 4 (2012), s. 275-279 ISSN 2010-3638 Institutional support: RVO:68081731 Keywords : Connectivity * Correlation * Intracranial EEG * Signal Processing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  1. Impact of transporters in oral absorption

    DEFF Research Database (Denmark)

    Gram, Luise Kvisgaard; Rist, Gerda Marie; Steffansen, Bente

    2009-01-01

    was to investigate whether transporters were involved in the intestinal absorption of an organic anion A275 and to compare the impact of interactions related to transporters in the Caco-2 cell model versus the in vivo rat model of intestinal absorption. In both models, it was investigated whether intestinal...... permeation of A275 was concentration dependent and affected by inhibitors or competitive organic anions. Interactions related to transporters in intestinal permeation was clearly demonstrated in the Caco-2 cell model but was not directly evident for in vivo rat absorption. However, an observed biphasic...... in vivo absorption and a large intervariability between rats might mask a dose-dependent absorption of A275. To avoid these suggested interactions, a dose of at least 10 mg/kg, which saturates the intestinal transporters involved in A275 absorption, should be administered, but at doses below that the risk...

  2. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965553 >1rkd0 3 268 9 275 2e-23 ... emb|CAC46379.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_385906.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  3. Gambler’s fallacy and imperfect best response in legislative bargaining

    Czech Academy of Sciences Publication Activity Database

    Nunnari, S.; Zápal, Jan

    2016-01-01

    Roč. 99, September (2016), s. 275-294 ISSN 0899-8256 Institutional support: RVO:67985998 Keywords : legislative bargaining * experiments * quantal response Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

  4. Měření hmotnosti pomocí elektronového mikroskopu

    Czech Academy of Sciences Publication Activity Database

    Krzyžánek, Vladislav

    2012-01-01

    Roč. 57, č. 10 (2012), s. 275-277 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : REM * SEM * RTEM * STEM * quantitative measurements * dark-field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  5. Mizan Law Review - Vol 11, No 2 (2017)

    African Journals Online (AJOL)

    Legal and Practical Aspects of Child Custody, Visitation and Maintenance: A Case Study in SNNP Regional State · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Nigussie Afesha, 275-303 ...

  6. 10 CFR 434.513 - Occupancy.

    Science.gov (United States)

    2010-01-01

    ... used in calculating the Energy Cost Budget. 513.2Table 513.2.a, Occupancy Density, establishes the... area Ft 2 person Assembly 50 Office 275 Retail 300 Warehouse 15000 School 75 Hotel/Motel 250 Restaurant...

  7. Original article Survival Following Kidney Sparing Management of ...

    African Journals Online (AJOL)

    , Transitional Cell Carcinoma, Endoscopic, Kidney Sparing. Surgery .... Upper Ureter. 6 (15%). Lower Ureter. 20 (50%). Upper and Lower Ureter. 2 (5%). Kidney and Ureter. 1 (2.5%). Tumor focality. Unifocal. 29 (72.5%). Multifocal. 11 (27.5%).

  8. Chiral Separations by Capillary Electrochromatography on Multiple-Interaction Based Stationary Phases

    Czech Academy of Sciences Publication Activity Database

    Honzátko, Aleš; Aturki, Z.; Flieger, Miroslav; Messina, A.; Sinibaldi, M.

    2003-01-01

    Roč. 58, - (2003), s. 271-275 ISSN 0009-5893 Institutional research plan: CEZ:AV0Z5020903 Keywords : enantioseparations * capillary * electromatography Subject RIV: EE - Microbiology, Virology Impact factor: 1.145, year: 2003

  9. 77 FR 35060 - Pfizer Therapeutic Research, Formerly Known as Warner Lambert Company, Pfizer Worldwide Research...

    Science.gov (United States)

    2012-06-12

    ..., Antibacterials Research Unit, Pharmacokinetics, Dynamics and Metabolism Department, Antibacterial Chemistry Department, Analytical Chemistry and Material Management Department Groton, CT; Amended Certification... group identified in the certification for TA-W- 80,275 to include the Pharmacokinetics, Dynamics and...

  10. 77 FR 54548 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition To List the Eagle...

    Science.gov (United States)

    2012-09-05

    ... for sport fishery purposes (Moyle et al. 1995, p. 87; Behnke 2002, p. 103; Moyle 2002, p. 275). In the... bright red lesions on the skin. The petition attributes these outbreaks to stress, and describes symptoms...

  11. Hygiene Fast Facts: Information on Water-Related Hygiene

    Science.gov (United States)

    ... in the ear after swimming or bathing 12 . World Health Organization. Water for health: taking charge. 2001. [PDF - 6 ... Lancet Infect Dis. 2003;3(5):275-81. World Health Organization. Hand washing and food safety fact sheet 2. ...

  12. Convergent and Divergent Social Cues: Effects of Televised Aggression on Children

    Science.gov (United States)

    Collins, W. Andrew; Zimmermann, Stephen A.

    1975-01-01

    Contends that television's portrayal of character aggression, specifically the aggressor's motives and the consequences to him, effectively modifies children's behavior. Communication Research-International Quarterly, Sage Publications, Inc., 275 S. Beverly Dr., Beverly Hills, California 90212. (MH)

  13. 77 FR 47822 - Procurement List; Additions

    Science.gov (United States)

    2012-08-10

    ... Hawkins Boulevard, Suite 275, El Paso, TX. NPA: Training, Rehabilitation, & Development Institute, Inc..., Rehabilitation, & Development Institute, Inc., San Antonio, TX Contracting Activity: Dept of the Army, W076... Leavenworth, KS. NPA: The Helping Hand of Goodwill [[Page 47823

  14. 75 FR 44806 - Ellicott Slough National Wildlife Refuge, Santa Cruz County, CA

    Science.gov (United States)

    2010-07-29

    ... available to the public, including opportunities for hunting, fishing, wildlife observation and photography... Main Public Library, 275 Main Street, Suite 100, Watsonville, CA 95076. The Draft CCP/EA will also be...

  15. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275 ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.761, year: 2015

  16. 2014 National Asset Management Conference and training on implementation strategies.

    Science.gov (United States)

    2014-07-01

    This report documents the major research activities conducted as part of the Federal Highway Administration (FHWA) : Transportation Pooled Fund (TPF) Program project, TPF-5(275) 2014 National Asset Management Conference and Training on : Implementati...

  17. 41 CFR 101-27.507 - Transportation and other costs.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT 27.5-Return of GSA Stock Items § 101-27.507 Transportation and other costs. Transportation costs for the movement of material to GSA and handling costs for preparation and shipment shall be paid by...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Plant Growth Promoting Rhizobacteria - Potential Microbes for Sustainable Agriculture. Jay Shankar Singh. General Article Volume 18 Issue 3 March 2013 pp 275-281 ...

  19. The mitochondrial genome and ribosomal operon of Brachycladium goliath (Digenea: Brachycladiidae) recovered from a stranded minke whale

    Czech Academy of Sciences Publication Activity Database

    Briscoe, A.G.; Bray, R. A.; Brabec, Jan; Littlewood, D. T. J.

    2016-01-01

    Roč. 65, č. 3 (2016), s. 271-275 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : Digenea * Balaenoptera acutorostrata * Cetacea * Hologenophore * NGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.744, year: 2016

  20. Restoration of Transforming Growth Factor Beta Signaling by Histone Deacetylase Inhibitors in Human Prostate Carcinoma

    National Research Council Canada - National Science Library

    Qian, Zheng D

    2006-01-01

    The goal of the current grant is to investigate the potential antitumor activity of histone deacetylase inhibitor MS-275 along with the activation of TGFb signaling pathway with the restoration of TGFb receptor II...

  1. Restoration of Transforming Growth Factor Beta Signaling by Histone Deacetylase Inhibitors in Human Prostate Carcinoma

    National Research Council Canada - National Science Library

    Qian, Zheng D

    2005-01-01

    The goal of the current grant is to investigate the potential antitumor activity of histone deacetylase inhibitor MS-275 a with the activation of TGFb signaling pathway with the restoration of TGFbeta receptor II...

  2. 50 CFR 679.41 - Transfer of quota shares and IFQ.

    Science.gov (United States)

    2010-10-01

    .... (vi) Bering Sea subarea: 91,275 QS. (3) Halibut. QS blocks for the same IFQ regulatory area and vessel... paragraph (k) of this section. (i) Transfer across catcher vessel categories—(1) CDQ compensation. Persons...

  3. Sankcionovat

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    2016-01-01

    Roč. 99, č. 5 (2016), s. 271-275 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : sanction * origin * different meanings * dictionary Subject RIV: AI - Linguistics

  4. Lepingute suhtes kohaldatava seaduse küsimusi Euroopa Liidus : [bakalaureusetöö] / Tarvo Lindma ; Tartu Ülikool, õigusteaduskond ; juhendaja: Heiki Pisuke

    Index Scriptorium Estoniae

    Lindma, Tarvo, 1974-

    1996-01-01

    Lepinguõiguse unifitseerimine; Rooma 1980. a. lepingulistele suhetele kohaldatava seaduse konventsioon; ostu-müügileping (Haagi konventsioonid); esindus; usaldusleping; Beneluxi leping; konventsioonide kohaldatavus liikmesriikides. Vt. ka: Juridica (1996) nr. 6, lk. 275-279

  5. Metaphoric Perceptions of the Students of the Sports Sciences Faculty Regarding the Concept of Fair-Play

    Science.gov (United States)

    Çaglayan, Hakan Salim; Gül, Özgür

    2017-01-01

    The objective of this study is to reveal the perceptions of the students of the sports sciences faculty regarding the concept of "Fair-Play" by means of metaphors. 275 students [male[subscript (n = 173)], female [subscript (n = 102)

  6. Emilie Bláhová (13. 6. 1931 - 9. 10. 2016)

    Czech Academy of Sciences Publication Activity Database

    Chromá, Martina

    2017-01-01

    Roč. 140, 1-2 (2017), s. 275-277 ISSN 0024-4457 Institutional support: RVO:68378017 Keywords : Bláhová, Emilie * obituary * paleoslavistics Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  7. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 21. KidsCancerChannel 62,777 views 5:21 Little Stars – Paediatric Palliative Care – Charlie's Story - Duration: 10:35. Little Stars 12,275 views 10:35 Teen Cancer Stories | ...

  8. Organisational Commitment, Job Satisfaction and Turnover ...

    African Journals Online (AJOL)

    This study investigated organisational commitment, job satisfaction and turnover intentions among records management personnel in Ondo State Civil Service, Akure, Nigeria. Simple random sampling technique was used to draw 240 subjects from a population size of 275 records management personnel.

  9. Ideas and Inspirations: Good News about Diabetes Prevention and Management in Indian Country

    Medline Plus

    Full Text Available ... DSMES Into Your Practice [PDF – 275 KB] In the Spotlight "Wit and Wisdom" is Back – Updated Book ... today! Find Tools for Diabetes Educators! See what the IHS Division of Diabetes has to offer for ...

  10. Building policy leadership among HIV/AIDS health workers | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Learn more: Read a journal article on the reliability of data collected by community health workers for policy and planning in Kenya. Read project summaries​ of the Teasdale-Corti Global Research Partnership Program (PDF, 275KB) ...

  11. TMFunction data: 238 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  12. TMFunction data: 234 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  13. TMFunction data: 239 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  14. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  15. TMFunction data: 233 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  16. Plant Growth Promoting Rhizobacteria

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Plant Growth Promoting Rhizobacteria - Potential Microbes for Sustainable Agriculture. Jay Shankar Singh. General Article Volume 18 Issue 3 March 2013 pp 275-281 ...

  17. Wind Generated Ocean Waves

    DEFF Research Database (Denmark)

    Frigaard, Peter

    2001-01-01

    Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)......Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)...

  18. Rapport de frais de 2017-2018 pour Uri Rosenthal | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Accueil · À propos du CRDI · Obligation de rendre compte · Transparence · Déplacements et accueil. Rapport de frais de 2017-2018 pour Uri Rosenthal. Total des frais de déplacement : CAD$7,275.54. Réunion du Conseil des gouverneurs. 19 juin 2017 au 21 juin 2017. CAD$7,275.54. Ce que nous faisons · Financement ...

  19. Capacity analysis for high-speed terahertz wireless communications

    DEFF Research Database (Denmark)

    Dogadaev, Anton Konstantinovich; Lavrinenko, Andrei; Tafur Monroy, Idelfonso

    2012-01-01

    We report on the analytical capacity analysis of terahertz wireless communications supporting 275–325 GHz frequency band. Our goal in this paper is to provide design guidelines for close proximity links with transmission capacity beyond 100 Gbit/s.......We report on the analytical capacity analysis of terahertz wireless communications supporting 275–325 GHz frequency band. Our goal in this paper is to provide design guidelines for close proximity links with transmission capacity beyond 100 Gbit/s....

  20. The effect of transport density and gender on stress indicators and carcass and meat quality in pigs

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.

    2015-07-01

    A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)

  1. PM Raman fiber laser at 1679 nm

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    2012-01-01

    We demonstrate a PM Raman fiber laser emitting light at 1679 nm. The laser has an slope efficiency of 67 % and an output power of more than 275mWwith a 27 pm linewidth.......We demonstrate a PM Raman fiber laser emitting light at 1679 nm. The laser has an slope efficiency of 67 % and an output power of more than 275mWwith a 27 pm linewidth....

  2. Involvement of Heme Oxygenase-1 Induction in the Cytoprotective and Immunomodulatory Activities of Viola patrinii in Murine Hippocampal and Microglia Cells

    Directory of Open Access Journals (Sweden)

    Bin Li

    2012-01-01

    Full Text Available A number of diseases that lead to injury of the central nervous system are caused by oxidative stress and inflammation in the brain. In this study, NNMBS275, consisting of the ethanol extract of Viola patrinii, showed potent antioxidative and anti-inflammatory activity in murine hippocampal HT22 cells and BV2 microglia. NNMBS275 increased cellular resistance to oxidative injury caused by glutamate-induced neurotoxicity and reactive oxygen species generation in HT22 cells. In addition, the anti-inflammatory effects of NNMBS275 were demonstrated by the suppression of proinflammatory mediators, including proinflammatory enzymes (inducible nitric oxide synthase and cyclooxygenase-2 and cytokines (tumor necrosis factor-α and interleukin-1β. Furthermore, we found that the neuroprotective and anti-inflammatory effects of NNMBS275 were linked to the upregulation of nuclear transcription factor-E2-related factor 2-dependent expression of heme oxygenase-1 in HT22 and BV2 cells. These results suggest that NNMBS275 possesses therapeutic potential against neurodegenerative diseases that are induced by oxidative stress and neuroinflammation.

  3. Antimicrobial resistance in Campylobacter spp. isolated from Ontario sheep flocks and associations between antimicrobial use and antimicrobial resistance.

    Science.gov (United States)

    Scott, L; Menzies, P; Reid-Smith, R J; Avery, B P; McEwen, S A; Moon, C S; Berke, O

    2012-06-01

    The objectives of this study were to determine the prevalence of antimicrobial resistance (AMR) in faecal Campylobacter spp. from lambs and adult sheep and associations between antimicrobial use (AMU) and AMR. A total of 275 faecal samples collected during initial and final visits from 51 sheep flocks, including one feedlot, across southern Ontario were tested for the presence of Campylobacter spp. Campylobacter jejuni was detected in 52% (143/275) of the faecal samples, Campylobacter coli in 7% (19/275), Campylobacter lari in 1% (2/275) and 2% (4/275) were non-speciated Campylobacter. Broth microdilution was used to test antimicrobial susceptibility of 162 isolates to nine antimicrobials. Campylobacter jejuni isolates (n = 142) were resistant to tetracycline (39%), ciprofloxacin (4%), nalidixic acid (4%) and telithromycin (1%). C. coli isolates (n = 19) were resistant to tetracycline (74%), and azithromycin, clindamycin, erythromycin, and telithromycin (5%). The C. lari isolate displayed resistance to nalidixic acid. No statistically significant associations were found between AMU and AMR during multivariate modelling in this study. © 2012 Blackwell Verlag GmbH.

  4. [Analysis of the mineral elements of Lactuca sativa under the condition of different spectral components].

    Science.gov (United States)

    Chen, Xiao-Li; Guo, Wen-Zhong; Xue, Xu-Zhang; Wang, Li-Chun; Li, Liang; Chen, Fei

    2013-08-01

    Mineral elements absorption and content of Lactuca sativa under different spectral component conditions were studied by ICP-AES technology. The results showed that: (1) For Lactuca sativa, the average proportion for Ca : Mg : K : Na : P was 5.5 : 2.5 : 2.3 : 1.5 : 1.0, the average proportion for Fe : Mn : Zn : Cu : B was 25.9 : 5.9 : 2.8 : 1.1 : 1.0; (2) The absorptions for K, P, Ca, Mg and B are the largest under the LED treatment R/B = 1 : 2.75, red light from fluorescent lamps and LED can both promote the absorptions of Fe and Cu; (3)The LED treatments exhibiting relatively higher content of mineral elements are R/B = 1 : 2.75 and R/W = 1 : 1 while higher dry matter accumulations are R/B = 1 : 2.75 and B/W = 1 : 1.

  5. Aspects of fracture mechanics in cryogenic model design. Part 2: NTF materials

    Science.gov (United States)

    Newman, J. C., Jr.; Lisagor, W. B.

    1983-01-01

    Results of fatigue crack growth and fracture toughness tests conducted on three candidate materials are presented. Fatigue crack growth and fracture toughness tests were conducted on NITRONIC 40 at room temperature and -275 F. Fracture toughness tests were also conducted on Vascomax 200 and 250 maraging steel from room temperature to -320 F. NITRONIC 40 was used to make the Pathfinder 1 model. The fatigue crack growth rate tests were conducted at room temperature and -275 F on three-point notch bend specimens. The fracture toughness tests on the as received and stress relieved materials at -275 F were conducted on the center crack tension specimens. Toughness tests were also conducted on Vascomax CVM-200 and CVM-250 maraging steel from room temperature to -320 F using round and rectangular compact specimens.

  6. Long-term mequindox treatment induced endocrine and reproductive toxicity via oxidative stress in male Wistar rats

    International Nuclear Information System (INIS)

    Ihsan, Awais; Wang Xu; Liu Zhaoying; Wang Yulian; Huang Xianju; Liu Yu; Yu Huan; Zhang Hongfei; Li Tingting; Yang Chunhui; Yuan Zonghui

    2011-01-01

    Mequindox (MEQ) is a synthetic antimicrobial chemical of quinoxaline 1, 4-dioxide group. This study was designed to investigate the hypothesis that MEQ exerts testicular toxicity by causing oxidative stress and steroidal gene expression profiles and determine mechanism of MEQ testicular toxicity. In this study, adult male Wistar rats were fed with MEQ for 180 days at five different doses as 0, 25, 55, 110 and 275 mg/kg, respectively. In comparison to control, superoxide dismutase (SOD), reduced glutathione (GSH) and 8-hydroxydeoxyguanosine (8-OHdG) levels were elevated at 110 and 275 mg/kg MEQ, whereas the malondialdehyde (MDA) level was slightly increase at only 275 mg/kg. Furthermore, in LC/MS-IT-TOF analysis, one metabolite 2-isoethanol 4-desoxymequindox (M11) was found in the testis. There was significant decrease in body weight, testicular weight and testosterone at 275 mg/kg, serum follicular stimulating hormone (FSH) at 110 and 275 mg/kg, while lutinizing hormone (LH) levels were elevated at 110 mg/kg. Moreover, histopathology of testis exhibited germ cell depletion, contraction of seminiferous tubules and disorganization of the tubular contents of testis. Compared with control, mRNA expression of StAR, P450scc and 17β-HSD in testis was significantly decreased after exposure of 275 mg/kg MEQ while AR and 3β-HSD mRNA expression were significantly elevated at the 110 mg/kg MEQ group. Taken together, our findings provide the first and direct evidence in vivo for the formation of free radicals during the MEQ metabolism through N → O group reduction, which may have implications to understand the possible mechanism of male infertility related to quinoxaline derivatives.

  7. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    International Nuclear Information System (INIS)

    Kodera, Ryo; Shikata, Kenichi; Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro; Usui, Hitomi Kataoka; Makino, Hirofumi

    2014-01-01

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose

  8. Influence of ocular features and incision width on surgically induced astigmatism after cataract surgery.

    Science.gov (United States)

    Chang, Shu-Wen; Su, Tai-Yuan; Chen, Yao-Lin

    2015-02-01

    To identify factors associated with surgically induced astigmatism (SIA) following phacoemulsification. Six hundred five eyes underwent phacoemulsification with a 2.2-mm (the 2.2-mm group, n = 248) or 2.75-mm (the 2.75-mm group, n = 357) superior limbal incision. Preoperative axial length, anterior chamber depth, corneal curvature, and intra-ocular pressure were measured. Corneal curvature and intraocular pressure were measured at 1 day, 1 week, and 1, 2, and 3 months postoperatively. SIA, corneal flattening, and torque were calculated using the Alpins method. The effect of preoperative corneal astigmatism meridian on SIA was also examined. Differences in SIA between the 2.2- and 2.75-mm groups were explored, and correlations between SIA and preoperative corneal astigmatism, anterior chamber depth, axial length, age, and intraocular pressure were analyzed. SIA, corneal flattening, and torque were smaller in the 2.2-mm group than in the 2.75-mm group at 1 week (P = .003, .006, and .014, respectively), but not statistically different thereafter. Higher preoperative corneal astigmatism, older age, and shallower anterior chamber depth were associated with greater SIA in both groups. The effect of astigmatism meridian on SIA was more noticeable in the 2.75-mm group. Shorter axial length and lower intraocular pressures were associated with greater SIA in the 2.75-mm group but not in the 2.2-mm group. Reducing limbal incision width and considering patient age, the meridian and magnitude of corneal astigmatism, anterior chamber depth, axial length, and intraocular pressure, and adjusting the flattening component of SIA input for toric intraocular lens power calculation could potentially improve the astigmatism control in refractive lens surgery. Copyright 2015, SLACK Incorporated.

  9. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    Energy Technology Data Exchange (ETDEWEB)

    Kodera, Ryo, E-mail: kodera@cc.okayama-u.ac.jp [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Shikata, Kenichi [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Usui, Hitomi Kataoka [Department of Primary Care and Medical Education, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Makino, Hirofumi [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan)

    2014-01-17

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose.

  10. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes.

    Science.gov (United States)

    Kodera, Ryo; Shikata, Kenichi; Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro; Usui, Hitomi Kataoka; Makino, Hirofumi

    2014-01-17

    Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Five-week-old male Sprague-Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose. Crown Copyright © 2013. Published by Elsevier Inc. All rights reserved.

  11. Monolithic all-PM femtosecond Yb-doped fiber laser using photonic bandgap fibers

    DEFF Research Database (Denmark)

    Liu, Xiaomin; Lægsgaard, Jesper; Turchinovich, Dmitry

    2009-01-01

    We present a monolithic Yb fiber laser, dispersion managed by an all-solid photonic bandgap fiber, and pulse compressed in a hollow-core photonic crystal fiber. The laser delivers 9 nJ, 275-fs long pulses at 1035 nm.......We present a monolithic Yb fiber laser, dispersion managed by an all-solid photonic bandgap fiber, and pulse compressed in a hollow-core photonic crystal fiber. The laser delivers 9 nJ, 275-fs long pulses at 1035 nm....

  12. Overall evaluation of the clinical value of prenatal screening for fetal-free DNA in maternal blood

    OpenAIRE

    Yu, Bin; Lu, Bei-Yi; Zhang, Bin; Zhang, Xiao-Qing; Chen, Ying-Ping; Zhou, Qin; Jiang, Jian; Wang, Hui-Yan

    2017-01-01

    Abstract Objective: To explore the clinical value of prenatal screening for fetal-free DNA in maternal blood. Methods: A total of 10,275 maternal blood samples were collected from October 2012 to May 2016 at the prenatal diagnosis center of Changzhou Woman and Children Health Hospital. Results: Among 10,275 pregnant women accepted noninvasive prenatal testing (NIPT), 9 cases could not get the results after collected the blood second times. The rate of NIPT failure was 0.09%. Seventy-two cases...

  13. Effects of irradiation at low temperature on V-4Cr-4Ti

    International Nuclear Information System (INIS)

    Alexander, D.J.; Snead, L.L.; Zinkle, S.J.

    1996-01-01

    Irradiation at low temperatures (100 to 275 degrees C) to 0.5 dpa causes significant embrittlement and changes in the subsequent room temperature tensile properties of V-4Cr-4Ti. The yield strength and microhardness at room temperature increase with increasing irradiation temperature. The tensile flow properties at room temperature show large increases in strength and a complete loss of work hardening capacity with no uniform ductility. Embrittlement, as measured by an increase in the ductile-to-brittle transition temperature, increases with increasing irradiation temperature, at least up to 275 degrees C. This embrittlement is not due to pickup of O or other interstitial solutes during the irradiation

  14. Very Bright CV discovered by MASTER-ICATE (Argentina)

    Science.gov (United States)

    Saffe, C.; Levato, H.; Mallamaci, C.; Lopez, C.; Lipunov, F. Podest V.; Denisenko, D.; Gorbovskoy, E.; Tiurina, N.; Balanutsa, P.; Kornilov, V.; Belinski, A.; Shatskiy, N.; Chazov, V.; Kuznetsov, A.; Yecheistov, V.; Yurkov, V.; Sergienko, Y.; Varda, D.; Sinyakov, E.; Gabovich, A.; Ivanov, K.; Yazev, S.; Budnev, N.; Konstantinov, E.; Chuvalaev, O.; Poleshchuk, V.; Gress, O.; Frolova, A.; Krushinsky, V.; Zalozhnih, I.; Popov, A.; Bourdanov, A.; Parkhomenko, A.; Tlatov, A.; Dormidontov, D.; Senik, V.; Podvorotny, P.; Shumkov, V.; Shurpakov, S.

    2013-06-01

    MASTER-ICATE very wide-field camera (d=72mm f/1.2 lens + 11 Mpix CCD) located near San Juan, Argentina has discovered OT source at (RA, Dec) = 14h 20m 23.5s -48d 55m 40s on the combined image (exposure 275 sec) taken on 2013-06-08.048 UT. The OT unfiltered magnitude is 12.1m (limit 13.1m). There is no minor planet at this place. The OT is seen in more than 10 images starting from 2013-06-02.967 UT (275 sec exposure) when it was first detected at 12.4m.

  15. La statistique industrielle de 1861 à 1896

    OpenAIRE

    2011-01-01

       Titre Niveau Documentation Fichier 1 Fichier 2 Statistique industrielle, 1861-1865 Département DS274.pdf DS274.xls Statistique industrielle, 1861-1865 Département DS275.pdf DS275.xls Statistique industrielle, 1861-1865 Chef-Lieu DS276.pdf DS276.xls Statistique industrielle, 1873 Département DS277.pdf DS277.xls Statistique industrielle, 1873 Département DS278.pdf DS278.xls Statistique industrielle, 1896 Département DS301.pdf DS301_1.xls DS301_2.xls Statistique industrielle, 1896 Département...

  16. An Analysis of Physically Demanding Tasks Performed by U.S. Navy Fleet Divers

    Science.gov (United States)

    1993-04-01

    occupational physical requirements, the objectives of this research investigation were to: (1) Develop a general taxonomy of physically demanding...to identify the physically demanding jobs performed by fleet divers. The purpose of the present investigation was to: (1) Develop a general taxonomy ...3 3 Grate 2. Camel Bumper 30 30 5-10 7.5 3. Carpenter Stop* 350 275 50 27 200 3-5 275 4. Chainfall 40-50 45 100 100 5. Cofferdam* 100 117 3 4.5 50

  17. Effects of irradiation at low temperature on V-4Cr-4Ti

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, D.J.; Snead, L.L.; Zinkle, S.J. [Oak Ridge National Lab., TN (United States)] [and others

    1996-10-01

    Irradiation at low temperatures (100 to 275{degrees}C) to 0.5 dpa causes significant embrittlement and changes in the subsequent room temperature tensile properties of V-4Cr-4Ti. The yield strength and microhardness at room temperature increase with increasing irradiation temperature. The tensile flow properties at room temperature show large increases in strength and a complete loss of work hardening capacity with no uniform ductility. Embrittlement, as measured by an increase in the ductile-to-brittle transition temperature, increases with increasing irradiation temperature, at least up to 275{degrees}C. This embrittlement is not due to pickup of O or other interstitial solutes during the irradiation.

  18. AcEST: BP919774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A06 275 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A06. BP9197...74 CL74Contig1 Show BP919774 Clone id YMU001_000129_A06 Library YMU01 Length 275 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_A06. Accession BP919774 Tissue type prothallium Developmental stage ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris mR...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris

  19. Heat load and deuterium plasma effects on SPS and WSP tungsten

    Czech Academy of Sciences Publication Activity Database

    Vilémová, Monika; Matějíček, Jiří; Nevrlá, Barbara; Chernyshova, M.; Gasior, P.; Kowalska-Strzeciwilk, E.; Jäger, Aleš

    2015-01-01

    Roč. 60, č. 2 (2015), s. 275-283 ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA ČR(CZ) GA14-12837S Institutional support: RVO:61389021 ; RVO:68378271 Keywords : Tungsten * fusion * heat loading * irradiation * bubbles * surface damage Subject RIV: JJ - Other Materials; JJ - Other Materials (FZU-D) Impact factor: 0.546, year: 2015 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p275f.pdf

  20. Genetic and bibliographic information: KRT5 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available KRT5 keratin 5 human epidermolysis bullosa simplex (MeSH) Congenital, Hereditary, and Neonatal Diseases...genital, Hereditary, and Neonatal Diseases and Abnormalities (C16) > Genetic Diseases..., Inborn (C16.320) > Skin Diseases, Genetic (C16.320.850) > Epidermolysis Bullosa (C16.320.850.275) > Ep...idermolysis Bullosa Simplex (C16.320.850.275.180) Skin and Connective Tissue Diseases (C17) > Skin Diseases ....493) > Epidermolysis Bullosa Simplex (C17.800.804.493.180) Skin and Connective Tissue Diseases (C17) > Skin Diseases

  1. Mass strandings of various ommastrephid squid species have been ...

    African Journals Online (AJOL)

    spamer

    escape reaction, to jet backwards at speed, is commonly observed. Appearing to work their jets at top pressure with ... north-east of the continental shelf break, in an area influenced by the confluence of Antarctic circumpolar ..... the Indian Ocean sector of the Southern Ocean. Polar Biol. 11(4): 273–275. PRESCOTT, R. 1977 ...

  2. Appropriate body mass index cut-offs to determine thinness, overweight and obesity in South Asian children in The Netherlands

    NARCIS (Netherlands)

    Wilde, J.A. de; Dommelen, P. van; Middelkoop, B.J.C.

    2013-01-01

    Background: Asian populations have an increased risk of developing cardiometabolic disorders at a lower body mass index (BMI) than other ethnic groups. Therefore, lower adult BMI cut-offs to determine overweight and obesity are recommended to assess the associated health risks for Asian (23 and 27.5

  3. The histology of dermal glands of mating Breviceps with comments ...

    African Journals Online (AJOL)

    CONAWAY, C.H. & METTER, D.E. 1967. Skin glands associated with breeding in Microhyla carolinensis. Copeia 3: 672 - 673. FITCH, H.S. 1956. A field study of the Kansas ant-eating frog,. Gaslrophryne olivacea. Univ. Kans. Publ. Mus. Nal. Hisl. 8;. 275 - 306. INGER, R.F. 1954. Systematics and zoogeography of Philippine.

  4. Development of depressive symptoms and depression during organizational change--a two-year follow-up study of civil servants

    DEFF Research Database (Denmark)

    Netterstrøm, Bo; Blønd, Morten; Nielsen, Martin

    2010-01-01

    On 1 January 2007, Denmark went through a major reorganization, where most of its 275 municipalities and 14 counties merged into larger units. Our study aimed to examine the development of depressive symptoms and incident depression among employees affected by this organizational change....

  5. Genetic diversity and molecular discrimination of wild tea plants from ...

    African Journals Online (AJOL)

    To efficiently assess and discriminate wild tea germplasms, inter-simple sequence repeats (ISSR) were used to determine genetic relationships among 40 wild tea plants. A total of 275 bands were generated with 15 ISSR primers, of which 274 (99.6%) were polymorphic. The mean genetic similarity coefficient, the mean ...

  6. First Results of ISO-SWS Grating Observations of Jupiter

    NARCIS (Netherlands)

    Encrenaz, Th.; de Graauw, Th.; Schaeidt, S.; Lellouch, E.; Feuchtgruber, H.; Beintema, D. A.; Bezard, B.; Drossart, P.; Griffin, M.; Heras, A.; Kessler, M.; Leech, K.; Morris, A.; Roelfsema, P. R.; Roos-Serote, M.; Salama, A.; Vandenbussche, B.; Valentijn, E. A.; Davies, G. R.; Naylor, D. A.

    1996-01-01

    The spectrum of Jupiter has been recorded on April 12, 1996, between 2.75 and 14.5 mu m, with the grating mode of the Short-Wavelength Spectrometer of ISO (Infrared Space Observatory). The resolving power is 1500 and the sensitivity limit is better than 1 Jy. The corresponding S/N ratio is better

  7. Comparison of pollutant concentrations in fog (low cloud) water in Northern and Southern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Fišák, Jaroslav; Řezáčová, Daniela; Eliáš, Václav; Tesař, Miroslav

    2001-01-01

    Roč. 49, č. 5 (2001), s. 275-290 ISSN 0042-790X R&D Projects: GA ČR GA205/99/1426 Institutional research plan: CEZ:AV0Z3042911 Keywords : fog * low clouds * fog water Subject RIV: DG - Athmosphere Sciences, Meteorology

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian Institute of Pulses Research, Kanpur 208 024, India; Department of Plant Pathology and CAES Genomics Facility, University of California, Davis, CA 95616, USA; National Bureau of Agriculturally Important Microorganisms, Mau Nath Bhanjan 275 101, India; University of Port Harcourt, East/West Road PMB 5323 ...

  9. Experimental Verification of a New Tool for Wood Mechanical Resistance Measurement

    Czech Academy of Sciences Publication Activity Database

    Kloiber, Michal; Tippner, J.; Hrivnák, J.; Praus, L.

    2012-01-01

    Roč. 57, č. 3 (2012), s. 383-398 ISSN 1336-4561 R&D Projects: GA ČR(CZ) GPP105/10/P573 Institutional support: RVO:68378297 Keywords : pin * resistance * mean force * density * wood strength Subject RIV: JN - Civil Engineering Impact factor: 0.275, year: 2012

  10. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275 ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  11. Childhood Sexual Abuse Severity Reconsidered: A Factor Structure of CSA Characteristics

    Science.gov (United States)

    Young, T. Lorraine; Riggs, Matt; Robinson, Jill L.

    2011-01-01

    To address the lack of empirically grounded measures of childhood sexual abuse severity, a survey of self-report items was developed following a thorough review of the childhood sexual abuse literature. An exploratory factor analysis was conducted using data collected from a convenience sample of college students that included 275 females and…

  12. Untitled

    African Journals Online (AJOL)

    Annalr of Epidemiology 2005;15(3):236-242. Dcndukuri N, McCusker J, Bellavance F, Cardin S, Verdon ], Karp I,. Belzile E. Comparing the Validity of Different Sources of Informa- tion on Emergency Department Visits: A Latent Class Analysis. Medical. Care 2005;43(3):266-275. Rennie KL, J'ebb SA, Wright A, Coward WA.

  13. GLOBAL JOURNAL OF SOCIAL SCIENCES VOL 8, NO

    African Journals Online (AJOL)

    Ada

    % is estimated at N3, 143,100.00. The Debt Service Coverage Ratio (DSCR) increases gradually from 1.33 to 2.75 between the first and the fifth year. KEYWORDS: Entrepreneur, Palm Wine Preservation, Palmwine Bottling Technology, Techno- ...

  14. The Shock and Vibration Digest. Volume 16, Number 9

    Science.gov (United States)

    1984-09-01

    structures, Ontario Superstructures," TRRL 20. Murakami , E. and Okubo, T., "Wind Resistant (England) No. 275, Symp. Dynam. Behavior Design of a Cable...S. Gopalakrishnan and Y. Usui A concept of the basic aggregate is introduced. Then aqua- Byron Jackson Pump Div., Borg -Warner Corp., 5800 tions of

  15. Phylogeny of Trochetia species based on morphological and ...

    African Journals Online (AJOL)

    Nafiisah

    Molecular. Phylogenetics and Evolution 1 : 3 – 16. BALDWIN, B.G., SANDERSON, M.J., WOJCIECHOWSKI, M.F., CAMPBELL,. C.S. & DONOGHUE, M.J. (1995). The ITS region of nuclear ribosomal DNA: A valuable source of evidence on angiosperm phylogeny. Ann. of the Missouri. Botanical Garden. 82: 247- 275. BAUM ...

  16. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian practice on estimation of scour around bridge piers—A comment · Umesh C Kothyari ... Investigation of stress–strain models for confined high strength concrete · Metin Husem Selim Pul ... model. pp 253-275. TCP with header checksum option for wireless links: An analytical approach towards performance evaluation.

  17. Is diversification history of maize influencing selection of soil bacteria by roots?

    Czech Academy of Sciences Publication Activity Database

    Bouffaud, M.-L.; Kyselková, Martina; Gouesnard, B.; Grundmann, G.; Muller, D.; Moënne-Loccoz, Y.

    2012-01-01

    Roč. 21, č. 1 (2012), s. 195-206 ISSN 0962-1083 Institutional research plan: CEZ:AV0Z60660521 Keywords : bacterial community * plant diversity * rhizosphere * taxonomic microarray Subject RIV: EH - Ecology , Behaviour Impact factor: 6.275, year: 2012

  18. Breeding biology of the eastern population of the Short-clawed Lark ...

    African Journals Online (AJOL)

    Nest sites and structure were similar to those of the western population. The mean clutch size of 2.27 eggs for the eastern population was significantly smaller than the mean of 2.75 reported for the western population. There was also seasonal variation in clutch size with three-egg clutches restricted to the peak rainy season ...

  19. Early Life Processes, Endocrine Mediators and Number of Susceptible Cells in Relation to Breast Cancer Risk

    Science.gov (United States)

    2008-04-01

    Sweden, for overseeing the DNA isolation from the blood sam- ples; Heng Khai Koon and Ong Eng Hu Jason for genotyping; Lim Siew Lan and Irene Chen for...polymorphisms with sporadic breast cancer. Int J Cancer 2001, 95:271-275. 35. Dunning AM, Healey CS, Pharoah PD, Teare MD, Ponder BA, Eas- ton DF: A systematic

  20. Environmental Assessment for MILCON Fitness Center and Fitness Training Area, Eglin Air Force Base, Florida

    Science.gov (United States)

    2010-06-01

    Sands, the Citronelle Fmmation, the Intracoastal Fmmation!Alum Bluff Formation, the Bmce Creek Limestone, the Chattahoochee-Chickasawhay Limestone... Citronelle Formation Alum BluffUndiffereotiated 50 -25 275 ------------------ Intracoastal F ormatioo 325 -300 40 Bruce Creek Limestone -----------·- 365...levels fluctuated_ Pa1t of the sand represents reworked Miocene and Pliocene deposits, such as the Miocene coarse clastics and the Citronelle

  1. Analgetic treatment in acute myocardial infarction. A controlled clinical comparison of morphine, nicomorphine and pethidine

    DEFF Research Database (Denmark)

    Nielsen, J R; Pedersen, K E; Dahlstrøm, C G

    1984-01-01

    In a randomized double-blind study with flexible dosage, morphine, nicomorphine and pethidine were compared with regard to analgetic effect, dose requirements, dose intervals and adverse reactions. A total of 275 patients were included, and 28 patients were excluded due to adverse reactions (n = ...

  2. Tiredness as determinant of subsequent use of health and social services among nondisabled elderly people

    DEFF Research Database (Denmark)

    Avlund, K; Damsgaard, M T; Schroll, M

    2001-01-01

    OBJECTIVE. To examine whether self-reported tiredness in daily activities at age 75 is an independent determinant of incident hospitalization and use of home services 5 years later. METHODS. In all, 275 people participated in a prospective study in Glostrup, Denmark, when they were 75 and 80 years...

  3. Reading habit and level of utilization of agricultural information ...

    African Journals Online (AJOL)

    Reading habit and level of utilization of agricultural information among farmers in Saki West Local Government Area of Oyo State. MF Siyanbola, PO Eniola, OA Olaniyi. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 275-279. http://dx.doi.org/10.4314/ijotafs.v1i3.

  4. Correction to Hilton et al. (2004)

    Science.gov (United States)

    Hilton, N. Zoe; Harris, Grant T.; Rice, Marnie E.; Lang, Carol; Cormier, Catherine A.; Lines, Kathryn J.

    2005-01-01

    This paper reports errors in the article "A Brief Actuarial Assessment for the Prediction of Wife Assault Recidivism: The Ontario Domestic Assault Risk Assessment," by N. Zoe Hilton, Grant T. Harris, Marnie E. Rice, Carol Lang, Catherine A. Cormier, and Kathryn J. Lines (Psychological Assessment, 2004, Vol. 16, No. 3, pp. 267-275). On page 272,…

  5. Arboviruses pathogenic for domestic and wild animals

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Nowotny, N.

    2014-01-01

    Roč. 89, č. 5 (2014), s. 201-275 ISSN 0065-3527 Institutional support: RVO:68081766 Keywords : West-Nile virus * Tick-borne encephalitis * Louping-ill virus * Cache-Valley virus * African-swine-fever * California serogroup virus * Kyasanur-forest-disease * sparrows Passer domesticus Subject RIV: EE - Microbiology, Virology Impact factor: 4.571, year: 2014

  6. Transabdominal ultrasonographic assessment of prostate size and ...

    African Journals Online (AJOL)

    this reason, ultrasound scanning has gained wide popularity in the past few years.[2] There is paucity of data on ... of ultrasound at the Department of Radiology, Usumanu. Danfodiyo University Teaching Hospital, ... Ultrasound 1982;12:275‑8. 3. Kaplan SA. Medical therapy for benign prostatic hyperplasia: New terminology,.

  7. Experiences with surgical management of undescended testis at a ...

    African Journals Online (AJOL)

    The relative risk of testicular cancer in an undescended testis is between 2.75 to 8 that of a normal male. The risk appears higher in patients with bilateral UDT and late (after age of 12) or uncorrected UDT (David & Iyekoretin,. 2008). Previous studies have estimated that an UDT increases the risk of testicular torsion by 10.

  8. A Study of the Reactivity of Polyhydroxylated Sterol Derivatives

    Czech Academy of Sciences Publication Activity Database

    Marek, Aleš; Klepetářová, Blanka; Elbert, Tomáš

    2015-01-01

    Roč. 4, č. 8 (2015), s. 808-817 ISSN 2193-5807 R&D Projects: GA AV ČR IAA400550801 Institutional support: RVO:61388963 Keywords : alpha-hydroxyketones * polyhydroxylated compounds * regiospecific reactions * silylation * sterols Subject RIV: CC - Organic Chemistry Impact factor: 3.275, year: 2015

  9. Luminescence and scintillation properties of liquid phase epitaxy grown Y.sub.2./sub.SiO.sub.5./sub.:Ce single crystalline films

    Czech Academy of Sciences Publication Activity Database

    Wantong, K.; Yawai, N.; Chewpraditkul, W.; Kučera, M.; Hanus, M.; Nikl, Martin

    2017-01-01

    Roč. 468, Jun (2017), s. 275-277 ISSN 0022-0248 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : luminescence * liquid phase epitaxy * Ce doping * Y 2 SiO 5 :Ce * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.751, year: 2016

  10. Cast Coil Transformer Fire Susceptibility and Reliability Study

    Science.gov (United States)

    1991-04-01

    Transformers," 29th Annual Petroleum and Chemical Industry Conference, St. Louis, Missouri, IEEE Paper, #PCI-82-F, 275-60, August 30-September 1, 1982, pp. 257...375 150 560 For comparison only I Acetic acid (vinegar) 10 25 15 37 Acetylsalicylic acid ( aspirin ) - 5 - - Ammiio [" 25 18 35 27 Perctloroothylono 5

  11. High-Performance Bio-Based Cyanate Esters with Low Moisture Uptake

    Science.gov (United States)

    2012-04-01

    which is found at a natural occurrence of >90% in the essential oil of star anise ( Illicium verum ), an evergreen native to portions of China and...275. 2. Illicium , pimpinella, and foeniculum. Jodral, M. M., Ed.; CRC Press: Washington, DC, 2004. 3. Guenthner, A. J.; Lamison, K. R.; Vij, V

  12. Laboratory research of coal geocomposits - some results

    Czech Academy of Sciences Publication Activity Database

    Souček, Kamil; Staš, Lubomír; Šňupárek, Richard

    2005-01-01

    Roč. 15, č. 1 (2005), s. 271-275 ISSN 1003-6326 R&D Projects: GA AV ČR(CZ) IBS3086351 Institutional research plan: CEZ:AV0Z30860518 Keywords : chemical grouting * reinforcing * geocomposite material Subject RIV: JI - Composite Material s Impact factor: 0.302, year: 2005

  13. Motility and fertilizing capacity of boar semen stored in raffia palm ...

    African Journals Online (AJOL)

    STORAGESEVER

    Aspects of the preparation of formulated palm wine. M.Sc. Dissertation. University of Nigeria, Nsukka. Norman C (1964). The coconut milk extender. Vo Congresso Interna zionale per 1a Reproduzione Animals ela Fecanazione artificiale, settembre, pp. 269-275. Okafor N (1978). Microbiology and biochemistry of oil palm ...

  14. Moment Tensor inversion based on the principal component analysis of waveforms: Method and application to microearthquakes in West Bohemia, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Vavryčuk, Václav; Adamová, Petra; Doubravová, Jana; Jakoubková, Hana

    2017-01-01

    Roč. 88, č. 5 (2017), s. 1303-1315 ISSN 0895-0695 R&D Projects: GA ČR GC16-19751J Institutional support: RVO:67985530 Keywords : double-couple earthquakes * focal mechanism determination * seismic moment Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 3.275, year: 2016

  15. Rehabilitation of Youth Offenders in South Africa: The Relevance of ...

    African Journals Online (AJOL)

    In 2009, a quarter of the sentenced offenders in public and private correctional facilities was the youth, an increase from 26 275 in 2006 to 33 796 in 2009. The high recidivism rate of youth offenders illustrates the need to develop comprehensive and effective interventions for them and their families. Although rehabilitation is ...

  16. Congenital anomalies in rural black South African neonates - a ...

    African Journals Online (AJOL)

    13. 1,71. Spina bifida (with and without. 12. 1,58 hydrocephalus). Encephalocele. 2. 0,26. (Combined neural tube defects). (27). (3,55). Hydrocephalus. 4. 0,53. Microcephalus. 2. 0,26. Chromosomal. 21. 2,75. Down syndrome. 16. 2,10. Trisomy 18 translocation. 1. 0,13. Trisomy 13. 1. 0,13. Other chromosomal abnormalities.

  17. Analysis of Phyllostachys pubescens bamboo residues for liquefaction: chemical components, infrared spectroscopy, and thermogravimetry

    Science.gov (United States)

    Jinqiu Qi; Chung-Yun Hse; Todd F. Shupe

    2013-01-01

    Residues of Phyllostachys pubescens bamboo obtained from central Louisiana, USA, were comprehensively investigated for use in liquefaction. The results showed that bamboo branches had the highest Klason lignin and ash content, about 26% and 2.75%, respectively. The epidermis layer sample had relatively higher carbohydrate content, while the wax layer sample had the...

  18. 46 CFR 2.75-70 - Welding procedure and performance qualifications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Welding procedure and performance qualifications. 2.75... for Construction Personnel § 2.75-70 Welding procedure and performance qualifications. (a) Welding... requirements for the welding of pressure piping, boilers, pressure vessels, and nonpressure vessel type tanks...

  19. Spectrum of benign breast diseases

    International Nuclear Information System (INIS)

    Khanzada, T.W.; Samad, A.; Sushel, C.

    2009-01-01

    Objective: To determine the frequencies of various benign breast diseases (BBD) in female patients in three private hospitals of Hyderabad. Methodology: This is a prospective cohort study of all female patients visiting the surgical clinic with breast problems. This study was conducted at Isra University Hospital Hyderabad and two other private hospitals of Hyderabad over a period of about three years starting from March 2004 to February 2007. All female patients visiting the surgical clinic with breast problems were included in the study. Patients with obvious clinical features of malignancy or those who on work up were diagnosed as carcinoma were excluded from the study. Results: A total of 275 patients were included in the study. About 44% (120/275) patients belonged to third decade of life (age between: 21-30 years) followed by 33% from forth decade (age between: 31- 40 years). Fibroadenoma was the most common benign breast disease, seen in 27% (75/275) of patients, followed by fibrocystic disease seen in about 21% (57/275) patients. Conclusion: Benign Breast Diseases (BBD) are common problems in females of reproductive age. Fibroadenoma is the commonest of all benign breast disease in our set up mostly seen in second and third decade of life. Fibrocystic disease of the breast is the next common BBD whose incidence increases with increasing age. (author)

  20. Variation in coumarin accumulation by stem age in Dendrobium ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-06

    Mar 6, 2009 ... King RG, Delancy PM (1994). Confocal microscopy in pharmacological research. Trends Pharmacol. Sci, 15(8): 275-279. Perez-de-Luque A, Lozano MD, Cubero JI, Gonzalez-Melendi P,. Risueno MC, Rubiales D (2006). Mucilage production during the incompatible interaction between Orobanche crenata ...

  1. Canarium sect. Africanarium nov. sect. (Burseraceae)

    NARCIS (Netherlands)

    Leenhouts, P.W.

    1966-01-01

    In my revision of the genus Canarium (Blumea 9, 1959, p. 275—475), C. schweinfurthii was included in sect. Canarium and within this section in the denticulatum-group (see p. 382). The main arguments for giving it that position were: 1. its general resemblance in several characters with sect.

  2. Latest AMS Results: The Positron Fraction and the p-bar/p Ratio

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    A precision measurement by AMS of the positron fraction in primary cosmic rays is presented. The results show that at 275±32 GeV the positron fraction no longer increases with energy. The current status of the anti-proton analysis is also presented.

  3. Near-Critical Extraction of Pigments and Oleoresin from Stinging Nettle Leaves

    Czech Academy of Sciences Publication Activity Database

    Sovová, Helena; Sajfrtová, Marie; Bártlová, Milena; Opletal, L.

    2004-01-01

    Roč. 30, č. 2 (2004), s. 213-224 ISSN 0896-8446 R&D Projects: GA ČR GA203/01/0550 Institutional research plan: CEZ:AV0Z4072921 Keywords : Urtica dioica leaves * carbon dioxide * carotenoids Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.275, year: 2004

  4. Ahmed Zafar Random matrix model for disordered conduc-tors 413 ...

    Indian Academy of Sciences (India)

    Nonlinear wave propagation through a ferro- magnet with damping in (2+1) dimensions. 275. Borah Rita Moni. A comparison of the intensity contours of fringes due to multiple reflection and spatial hole burning in semiclassical theory of laser. 269. Chaddah P. Supercooling across first-order phase transi- tions in vortex ...

  5. Open-Ocean Movements of a Satellite-Tagged Blainville’s Beaked Whale (Mesoplodon densirostris): Evidence for an Offshore Population in Hawaii?

    Science.gov (United States)

    2011-01-01

    of messages received by the satellite during the overpass) was similar (LC3 – 2.75%; LC2 – 9.17%; LC1 – 22.02%; LC0 – 44.04%; LCA – 11.01%; LCB...Northwest Fisheries Science Center for GIS analyses, and two anonymous review- ers for their comments. Tagging was undertaken under NMFS Scientific Research

  6. Computer Education: A Catalog of Projects Sponsored by the U.S. Department of Education, 1983.

    Science.gov (United States)

    Klein, Susan S., Ed.

    This first catalog of computer education projects sponsored by the U.S. Department of Education presents summaries of 275 computer education projects, each of which includes an abstract and information on target audience, award amount, major products, project director, and Department of Education contact person. An introductory overview summarizes…

  7. Renal injury is accelerated by global hypoxia-inducible factor 1 alpha deficiency in a mouse model of STZ-induced diabetes

    Czech Academy of Sciences Publication Activity Database

    Bohuslavová, Romana; Čerychová, Radka; Nepomucká, Kateřina; Pavlínková, Gabriela

    2017-01-01

    Roč. 17, č. 1 (2017), č. článku 48. ISSN 1472-6823 Institutional support: RVO:86652036 Keywords : Diabetic complications * Diabetic nephropathy * Hypoxia Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition OBOR OECD: Urology and nephrology Impact factor: 2.275, year: 2016

  8. Shallow crustal structure of the Central Bohemian Pluton, Czech Republic, inferred from refraction measurements

    Czech Academy of Sciences Publication Activity Database

    Málek, Jiří; Novotný, O.; Žanda, Libor

    2009-01-01

    Roč. 6, č. 2 (2009), s. 143-154 ISSN 1214-9705 R&D Projects: GA AV ČR IAA300460705; GA AV ČR IAA300460602 Institutional research plan: CEZ:AV0Z30460519 Keywords : pluton * refraction measurements * crustal structure Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.275, year: 2009

  9. A deficit scaling algorithm for the minimum flow problem

    Indian Academy of Sciences (India)

    Ciupal˘a L, Ciurea E 2003 An algorithm for the minimum flow problem. Sixth Int. Conf. of Economic. Informatics, pp 565–569. Ciurea E, Ciupal˘a L 2001 Algorithms for minimum flows. Comput. Sci. J. Moldova 9: 275–290. Ciurea E, Ciupal˘a L 2004 Sequential and parallel algorithms for minimum flows. J. Appl. Math. Comput.

  10. Obesity and health problems among South African healthcare workers

    African Journals Online (AJOL)

    2011-01-08

    Jan 8, 2011 ... Obesity and overweight in IMSS female workers in Mexico City. Salud Publica Mex. 2005;47(4):268-275. 13. Chiu-Fang C, Johnson PJ. Health disparities among America's healthcare providers: evidence from the integrated health interview series, 1982 to 2004. J. Occup Environ Med. 2008;50(6):696-704.

  11. Beliefs about Parental Authority Legitimacy among Refugee Youth in Jordan: Between- and Within-Person Variations

    Science.gov (United States)

    Smetana, Judith G.; Ahmad, Ikhlas; Wray-Lake, Laura

    2016-01-01

    We examined within- and between-person variations in parental legitimacy beliefs in a sample of 883 Arab refugee youth (M[subscript age] = 15.01 years, SD = 1.60), 277 Iraqis, 275 Syrians, and 331 Palestinians, in Amman, Jordan. Latent profile analyses of 22 belief items yielded 4 profiles of youth. The "normative" profile (67% of the…

  12. Production and verification of heterozygous clones in Japanese ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Microsatellite-centromere mapping in the zebrafish (Danio rerio). Genomics, 30: 337-341. Kobayashi T, Ide A, Hiasa T, Fushiki S, Ueno K (1994). Production of cloned amago salmon Oncorhynchus rhodurus. Fish. Sci. 60: 275-281. Komen H, Thorgaard GH (2007). Androgenesis, gynogenesis and the.

  13. Design, synthesis, and pharmacology of a highly subtype-selective GluR1/2 agonist, (RS)-2-amino-3-(4-chloro-3-hydroxy-5-isoxazolyl)propionic acid (Cl-HIBO)

    DEFF Research Database (Denmark)

    Bjerrum, Esben J; Kristensen, Anders S; Pickering, Darryl S

    2003-01-01

    On the basis of structural studies, chloro-homoibotenic acid (Cl-HIBO) was designed and synthesized. Cl-HIBO was characterized in binding and electrophysiology experiments on native and cloned subtypes of GluRs. Electrophysiological selectivities ranged from 275 to 1600 for GluR1/2 over GluR3/4. ...

  14. The Book of My Dreams

    Science.gov (United States)

    Degirmenci Gundogmus, Hatice

    2018-01-01

    This study offers an opportunity for learning the characteristics of elementary school students' dream books that can increase their willingness to read. In the study, for which the qualitative research method was adopted in line with this main purpose, 275 elementary school students that attended different schools at 2nd, 3rd and 4th grades were…

  15. Changes in Nafion® 117 internal structure and related properties during exposure to elevated temperature and pressure in an aqueous environment

    Czech Academy of Sciences Publication Activity Database

    Mališ, J.; Paidar, M.; Bystroň, T.; Brožová, Libuše; Zhigunov, Alexander; Bouzek, K.

    2018-01-01

    Roč. 262, 1 February (2018), s. 264-275 ISSN 0013-4686 Institutional support: RVO:61389013 Keywords : Nafion * elevated temperature * excessive swelling Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

  16. Effect of copper sulphate supplementation on performance of broiler chickens, cholesterol content and fatty acid profile of meat

    Czech Academy of Sciences Publication Activity Database

    Skřivan, M.; Ševčíková, S.; Tůmová, E.; Skřivanová, V.; Marounek, Milan

    2002-01-01

    Roč. 47, č. 7 (2002), s. 275-280 ISSN 1212-1819 R&D Projects: GA AV ČR KSK5020115 Grant - others:GA NATO(XX) MO2-99-04 Keywords : broiler * copper sulphate * quality of meat Subject RIV: GH - Livestock Nutrition Impact factor: 0.187, year: 2002

  17. Fear of crime: The role of sex, neuroticism and prior victimization of ...

    African Journals Online (AJOL)

    Fear of crime: The role of sex, neuroticism and prior victimization of Ibadan, Nigeria. Helen O Osinowo. Abstract. No Abstract Available African Journal for the Psychological Study of Social Issues Vol.4(2) 1999: 275-285. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  18. IS2-mediated re-arrangement of the promoter sequence supresses metabolic burden of the recombinant plasmid

    Czech Academy of Sciences Publication Activity Database

    Valešová, Renata; Štěpánek, Václav; Večerek, Branislav; Kyslík, Pavel

    2005-01-01

    Roč. 50, č. 4 (2005), s. 275-282 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : is2 * recombinant plasmid * escherichia coli Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005

  19. An Analysis of Attitudes toward Statistics: Gender Differences among Advertising Majors.

    Science.gov (United States)

    Fullerton, Jami A.; Umphrey, Don

    This study measures advertising students' attitudes toward statistics. Subjects, 275 undergraduate advertising students from two southwestern United States universities, completed a questionnaire used to gauge students' attitudes toward statistics by measuring 6 underlying factors: (1) students' interest and future applicability; (2) relationship…

  20. Proceedings of the Tri-Service Conference on Corrosion (1987) Held at the Air Force Academy, Colorado on 5-7 May 1987.

    Science.gov (United States)

    1987-05-01

    pp. 297-3 11. al Ilovs in ;ul t Hse con;taminated brine . Corrosion , Vol . 31, X, pp. 269-275. (2) Bianchi, (;. and Ionghi, P. 1973. Copper inl sea...WHEN JOINED TOGETHER NOT COMPATIBLE TO THE NAVY OPERATING ENVIRONMENT. ELECTROLYSIS NICKEL PLATED CONNECTOR STAINLESS STEEL BRAID NOMAX PROTECTIVE COVER

  1. Fulltext PDF

    Indian Academy of Sciences (India)

    see Kang Moon Seong. 561. Iyengar R N see Kanth Raghu S T G. 199. Jang Tae Il see Kang Moon Seong. 561. Jeeva K see Panneerselvam C. 179. Jikun Ou see Debao Wen. 235. Jose Mathew K see Venkatesh B. 321. Joseph P V see Shankar D. 385. Joshi D W see Shekhawat L S. 511. Kalsi S R see Abhilash S. 275.

  2. Efficient optical trapping and visualization of silver nanoparticles

    DEFF Research Database (Denmark)

    Bosanac, Lana; Aabo, Thomas; Bendix, Pól Martin

    2008-01-01

    We performed efficient optical trapping combined with sensitive optical detection of individual silver nanoparticles. The particles ranging in size from 20 to 275 nm in diameter were trapped in three dimensions using low laser power by minimizing spherical aberrations at the focus. The optical...

  3. Accumulation of phosphorus in nests of red wood ants .i.Formica s. str../i

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří; Cudlín, Pavel

    2005-01-01

    Roč. 42, - (2005), s. 269-275 ISSN 0003-455X Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6087904 Keywords : accumulation of phosphorus * nests of ants * red wood ants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.992, year: 2005

  4. Carboxylate-bridged Cu(II) coordination polymeric complex ...

    Indian Academy of Sciences (India)

    SABITHAKALA THATITURI

    An in vitro antibacterial activity study of BIGH and Cu-BIG showed moderate activity against Bacillus subtilis. ..... ure 10. Thermogram of the complex shows only one stage of weight loss between 250 and 275 .... ligands: Syntheses, structures, and physical properties. CrystEngComm 17 3181. 15. Fan L M, Zhang X T, Sun Z, ...

  5. Two new species of Schistura from Myanmar (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula

    2013-01-01

    Roč. 24, č. 1 (2013), s. 21-30 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional research plan: CEZ:AV0Z50450515 Keywords : loach * basin * drainage Subject RIV: EG - Zoology Impact factor: 2.275, year: 2013

  6. Characterization and Targeting of the Aldehyde Dehydrogenase Subpopulation in Ovarian Cancer

    Science.gov (United States)

    2013-07-01

    pancreatic cancer. Pancreas. 2008 Oct;37(3):275-81. 28. Hu D, Wang X, Mao Y, Zhou L. Identification of CD105 (endoglin)-positive stem-like cells in...Women who have breaks in ovulation due to pregnancy and breast- feeding have lower risk of disease.19,20 Moreover, women who take oral con

  7. DNA from soil mirrors plant taxonomic and growth form diversity

    Czech Academy of Sciences Publication Activity Database

    Yoccoz, N. G.; Brathen, K. A.; Gielly, L.; Haile, J.; Edwards, M. E.; Goslar, T.; von Stedingk, H.; Brysting, A.; Coissac, E.; Pompanon, F.; Sonstebo, J. H.; Miquel, C.; Valentini, A.; de Bello, Francesco; Chave, J.; Thuiller, W.; Wincker, P.; Cruaud, C.; Gavory, F.; Rasmussen, M.; Gilbert, M. T. P.; Orlando, L.; Brochmann, C.; Willerslev, E.; Taberlet, P.

    2012-01-01

    Roč. 21, č. 15 (2012), s. 3647-3655 ISSN 0962-1083 R&D Projects: GA ČR GAP505/12/1296 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : biodiversity assessment * environmental sequencing * plant diversity * DNA Subject RIV: EH - Ecology, Behaviour Impact factor: 6.275, year: 2012

  8. Katolíci doufali, že se Hitler nažral

    Czech Academy of Sciences Publication Activity Database

    Med, Jaroslav; Peňás, J.

    2010-01-01

    Roč. 23, 275 /27. 11.; příloha Orientace/ (2010), s. 27-27 ISSN 0862-5921 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Catholic literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Efektivita přeměn energie - Možnosti dokonalejší přeměny

    Czech Academy of Sciences Publication Activity Database

    Luxa, Martin; Synáč, J.

    2013-01-01

    Roč. 92, č. 5 (2013), s. 272-275 ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics http://www.vesmir.cz/clanek/efektivita-premen-energie

  10. Management and the Executive.

    Science.gov (United States)

    1988-01-01

    A.; and Lockhart, Paula. PROFESSIONAL DISSENT: AN ANNOATED BIBLIOGRAPHY AND RESOURCE o -DE. New York, NY: Garland Pub., 1984. 322 p. HD 60 .B763 -984...Robert E. TOPICS IN MAHE2GU SCIENCE. 2nd ed. New York, - NY: Wiiey, 1983. 853 p. T 56 .M275 1983 (172) Marshall, Judi . DVOMEN MANGERS: TRAVELLERS IN

  11. Ultrafast exciton transport in organic nanotubes

    NARCIS (Netherlands)

    Pugzlys, A; Hania, R; Didraga, C; Malyshev, V.A.; Knoester, J; Duppen, K; Kobayashi, T; Okada, T; Kobayashi, T; Nelson, KA; DeSilvestri, S

    2005-01-01

    The dynamics of exciton transport between the inner and outer walls of double-layer cylindrical aggregates is measured. Downhill transport is fast (275 A) and excitation intensity independent. Uphill transport is much slower (3.5 ps), but this rate increases when the excitation density is raised.

  12. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Sanoli Gun. Articles written in Proceedings – Mathematical Sciences. Volume 119 Issue 3 June 2009 pp 275-281. Remarks on some Zero-Sum Theorems · S D Adhikari Sanoli Gun Purusottam Rath · More Details Abstract Fulltext PDF. In the present paper, we give a ...

  13. Optimisation of Lab-Scale Continuous Alcohol-Free Beer Production

    Czech Academy of Sciences Publication Activity Database

    Lehnert, R.; Novák, Pavel; Macieira, F.; Kuřec, M.; Teixeira, J.A.; Brányik, T.

    2009-01-01

    Roč. 27, č. 4 (2009), s. 267-275 ISSN 1212-1800 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol-free beer * continuous reactor * immobilised yeast Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.602, year: 2009

  14. 75 FR 65292 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-22

    ... Supplemental Nutrition Assistance Program (SNAP) Quality Control system. The Food and Nutrition Service (FNS... a currently valid OMB control number. Food and Nutrition Service Title: Supplemental Nutrition Assistance Program Regulations, Part 275--Quality Control OMB Control Number: 0584-0303 Summary of Collection...

  15. S¯adhan¯a Vol. 29, 2004 Author Index

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Abhinandan L see Benerji N S. 297. Agrawal A K. Effect of EGR on the exhaust gas temperature and exhaust opacity in compression ignition engines. 275. Ailawalia P. Effects of fluid at micropolar orthotropic boundary surface. 605. Akansu S O. Investigations of neutronic performance of a peaceful nuclear explosive reactor ...

  16. 75 FR 77051 - Rules Implementing Amendments to the Investment Advisers Act of 1940

    Science.gov (United States)

    2010-12-10

    ...) pension consultants; (iii) investment advisers affiliated with an adviser registered with the Commission... Exchange Commission 31 Parts 275 and 279 Rules Implementing Amendments to the Investment Advisers Act of... Implementing Amendments to the Investment Advisers Act of 1940 AGENCY: Securities and Exchange Commission...

  17. Statistical evaluation of the 3-D monitoring of displacements of Dinaric Fault Zone in Postojna Cave, Slovenia

    Czech Academy of Sciences Publication Activity Database

    Šebela, S.; Turk, J.; Mulec, J.; Stemberk, Josef; Košťák, Blahoslav

    2009-01-01

    Roč. 6, č. 2 (2009), s. 163-176 ISSN 1214-9705 R&D Projects: GA ČR GA205/09/2024 Institutional research plan: CEZ:AV0Z30460519 Keywords : fault displacements * Dinaride * statistic Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.275, year: 2009

  18. Soil biota and upper soil layer development in two contrasting post-mining chronosequences

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Keplin, B.; Pižl, Václav; Tajovský, Karel; Starý, Josef; Lukešová, Alena; Nováková, Alena; Balík, Vladimír; Háněl, Ladislav; Materna, Jan; Düker, Ch.; Chalupský, Josef; Rusek, Josef; Heinkele, T.

    2001-01-01

    Roč. 17, - (2001), s. 275-284 ISSN 0925-8574 R&D Projects: GA MŠk ME 076; GA ČR GA526/98/P156 Institutional research plan: CEZ:AV0Z6066911 Keywords : succession * coal mining * soil formation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.601, year: 2001

  19. New definition for the partial remission period in children and adolescents with type 1 diabetes

    DEFF Research Database (Denmark)

    Mortensen, Henrik B; Hougaard, Philip; Swift, Peter

    2009-01-01

    OBJECTIVE To find a simple definition of partial remission in type 1 diabetes that reflects both residual beta-cell function and efficacy of insulin treatment. RESEARCH DESIGN AND METHODS A total of 275 patients aged type 1 diabetes. After 1, 6, and 12 months...

  20. Condensation of the highest occupied molecular orbital within the ...

    Indian Academy of Sciences (India)

    Unknown

    E CHAMORRO,1,* M DUQUE,1 C CÁRDENAS,1 J SANTOS,2,3 W TIZNADO2 and. P FUENTEALBA2. 1Departamento de Ciencias Químicas, Facultad de Ecología y Recursos Naturales, Universidad Andres. Bello (UNAB), Av. República 275, Santiago. Chile. 2Departamento de Física, Facultad de Ciencias, Universidad de ...

  1. Inactivation of colicin Y by intramembrane helix–helix interaction with its immunity protein

    Czech Academy of Sciences Publication Activity Database

    Šmajs, D.; Doležalová, M.; Macek, Pavel; Žídek, L.

    2008-01-01

    Roč. 275, č. 21 (2008), s. 5325-5331 ISSN 1742-464X Institutional research plan: CEZ:AV0Z50200510 Keywords : colicin immunity * colicin y * helix-helix interaction Subject RIV: CE - Biochemistry Impact factor: 3.139, year: 2008

  2. DFT calculations of vibrational spectra of oxidized (111) diamond surface

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Kozak, Halyna; Remeš, Zdeněk

    2015-01-01

    Roč. 7, č. 4 (2015), s. 275-278 ISSN 2164-6627 R&D Projects: GA ČR GPP205/12/P331; GA MŠk LH12186 Institutional support: RVO:68378271 Keywords : density functional theory * vibrational spectra * FTIR * diamond nanoparticles * functionalized diamond surface Subject RIV: JJ - Other Materials

  3. cAMP-dependent phosphorylation of the nuclear encoded 18-kDa (IP) subunit of respiratory complex I and activation of the complex in serum-starved mouse fibroblast cultures

    Czech Academy of Sciences Publication Activity Database

    Scacco, S.; Vergari, R.; Scarpulla, R. C.; Dobrová, Zuzana; Sardanelli, A.; Lambo, R.; Lorusso, V.; Papa, S.

    2000-01-01

    Roč. 275, č. 23 (2000), s. 17578-17582 ISSN 0021-9258 Grant - others:Italian Research Council(IT) 97.01167.PF49; National Institute of Health(US) GM32525-17 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: CE - Biochemistry Impact factor: 7.368, year: 2000

  4. Listado anotado de Solanum L. (Solanaceae) en el Perú

    DEFF Research Database (Denmark)

    Särkinen, Tiina; Baden, Maria; Gonzáles, Paúl

    2015-01-01

    The genus Solanum is among the most species-rich genera both of the Peruvian flora and of the tropical Andes in general. The present revised checklist treats 275 species of Solanum L., of which 252 are native, while 23 are introduced and/or cultivated. A total of 73 Solanum species (29% of native...

  5. Influence of pretreatment of agriculture residues on phytase ...

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... and low oil in which the increase in phytase activity was 6.85, 6.1, 5.3 and 3.0 times, respectively. Maximum phytase activity of 68 IU/ml .... that supplementation of microbial phytase to low non phytate phosphorus diets for broiler ..... measurement with the folin phenol reagent. J. Biol. Chem. 193: 265-. 275.

  6. Trophic niche partitioning in communities of African annual fish: evidence from stable isotopes

    Czech Academy of Sciences Publication Activity Database

    Polačik, Matej; Harrod, C.; Blažek, Radim; Reichard, Martin

    2014-01-01

    Roč. 721, č. 1 (2014), s. 99-106 ISSN 0018-8158 R&D Projects: GA ČR GPP505/11/P646 Institutional support: RVO:68081766 Keywords : Nothobranchius * Coexistence * Niche separation * Sympatric * Extreme environment * Africa Subject RIV: EG - Zoology Impact factor: 2.275, year: 2014

  7. The relationship of diversity and biomass in phytoplankton communities weakens when accounting for species proportions

    Czech Academy of Sciences Publication Activity Database

    Skácelová, O.; Lepš, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 67-77 ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : algae * cyanobacteria * database Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014 http://link.springer.com/article/10.1007%2Fs10750-013-1723-2#

  8. Towards a better understanding of small scale distribution of littoral age-0 fish in a deep-valley reservoir: day or night surveys?

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Michal; Vašek, Mojmír; Peterka, Jiří; Draštík, Vladislav; Čech, Martin; Jůza, Tomáš; Muška, Milan; Matěna, Josef; Kubečka, Jan

    2014-01-01

    Roč. 728, č. 1 (2014), s. 125-139 ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : spatial distribution * habitat use * juvenile fish * littoral zone * deep reservoirs * electrofishing Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  9. Small ones and big ones: cross-taxon congruence reflects organism body size in ombrotrophic bogs

    Czech Academy of Sciences Publication Activity Database

    Hájek, Michal; Poulíčková, A.; Vašutová, Martina; Syrovátka, V.; Jiroušek, M.; Štěpánková, J.; Opravilová, V.; Hájková, Petra

    2014-01-01

    Roč. 726, č. 1 (2014), s. 95-107 ISSN 0018-8158 R&D Projects: GA ČR GA206/08/0389 Institutional support: RVO:67985939 ; RVO:67179843 Keywords : biomonitoring * multi-proxy * species richness Subject RIV: EF - Botanics; EH - Ecology, Behaviour (UEK-B) Impact factor: 2.275, year: 2014

  10. Chaos and stability of age-0 fish assemblages in a temperate deep reservoir: unpredictable success and stable habitat use

    Czech Academy of Sciences Publication Activity Database

    Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Blabolil, Petr; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Muška, Milan; Peterka, Jiří; Prchalová, Marie; Říha, Milan; Tušer, Michal; Kubečka, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 217-234 ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : horizontal migration * Římov reservoir * trawling * seining * fry distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  11. Spatio-temporal study of phytoplankton cell viability in a eutrophic reservoir using SYTOX Green nucleic acid stain

    Czech Academy of Sciences Publication Activity Database

    Rychtecký, Pavel; Znachor, Petr; Nedoma, Jiří

    2014-01-01

    Roč. 740, č. 1 (2014), s. 177-189 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : phytoplankton * reservoir * cell death * SYTOX Green Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  12. The oldest Czech fishpond discovered? An interdisciplinary approach to reconstruction of local vegetation in mediaeval Prague suburbs

    Czech Academy of Sciences Publication Activity Database

    Pokorná, Adéla; Houfková, P.; Novák, J.; Bešta, T.; Kovačiková, L.; Nováková, K.; Zavřel, J.; Starec, P.

    2014-01-01

    Roč. 730, č. 1 (2014), s. 191-213 ISSN 0018-8158 Grant - others:GA ČR(CZ) GA13-11193S Institutional support: RVO:67985912 Keywords : archaeobotany * archaeozoology * environmental changes * human impact * fishpond * hydrobiology * Prague * the Middle Ages * vegetation diversity Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.275, year: 2014

  13. Effect of habitat conditions on parasite infection in 0+juvenile perch (Perca fluviatilis L.) in two Czech reservoirs

    Czech Academy of Sciences Publication Activity Database

    Francová, K.; Ondračková, Markéta

    2014-01-01

    Roč. 721, č. 1 (2014), s. 57-66 ISSN 0018-8158 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Parasite * Intermediate host * Food availability * Habitat conditions * Lentic * Littoral Subject RIV: EG - Zoology Impact factor: 2.275, year: 2014

  14. Monetary policy efficiency in the economies of Central Asia

    Czech Academy of Sciences Publication Activity Database

    Isakova, Asel

    2008-01-01

    Roč. 58, 11-12 (2008), s. 525-553 ISSN 0015-1920 Institutional research plan: CEZ:AV0Z70850503 Keywords : monetary policy * Central Asia * dollarization Subject RIV: AH - Economics Impact factor: 0.275, year: 2008 http://journal.fsv.cuni.cz/storage/1147_str_525_553_-_isakova.pdf

  15. 76 FR 15010 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-03-18

    ... adopted rule 206(4)-6 (17 CFR 275.206(4)-6), the proxy voting rule, to address an investment adviser's...) describe to clients the adviser's proxy voting policies and procedures and, on request, furnish a copy of... that vote proxies for their clients vote those proxies in their clients' best interest and provide...

  16. 76 FR 64341 - Big Sandy Pipeline, LLC; Notice of Cost and Revenue Study

    Science.gov (United States)

    2011-10-18

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP06-275-003] Big Sandy Pipeline, LLC; Notice of Cost and Revenue Study Take notice that on April 8, 2011, Big Sandy Pipeline, LLC... protestants parties to the proceeding. Such protests must be filed on or before the date as indicated below...

  17. Libraries in New York: MedlinePlus

    Science.gov (United States)

    ... 212-410-8142 http://library.nycpm.edu NYU School of Medicine Health Sciences Library 550 First Avenue New York, NY 10016-6402 ... 4743 http://wernerlibrary.org/wellness University of Rochester School of Medicine and Dentistry Edward G. Miner Library 601 Elmwood Avenue Rochester, NY 14642 585-275- ...

  18. Gambler’s fallacy and imperfect best response in legislative bargaining

    Czech Academy of Sciences Publication Activity Database

    Nunnari, S.; Zápal, Jan

    2016-01-01

    Roč. 99, September (2016), s. 275-294 ISSN 0899-8256 R&D Projects: GA ČR(CZ) GP14-27902P Institutional support: PRVOUK-P23 Keywords : legislative bargaining * experiments * quantal response Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

  19. Computers, pattern, chaos and beauty

    CERN Document Server

    Pickover, Clifford A

    1980-01-01

    Combining fractal theory with computer art, this book introduces a creative use of computers. It describes graphic methods for detecting patterns in complicated data and illustrates simple techniques for visualizing chaotic behavior. ""Beautiful."" - Martin Gardner, Scientific American. Over 275 illustrations, 29 in color.

  20. Microstructure of X210Cr12 steel after the forming in semi-solid state visualized by very low energy SEM in ultra high vacuum

    Czech Academy of Sciences Publication Activity Database

    Mikmeková, Šárka; Mašek, B.; Jirková, H.; Aišman, D.; Müllerová, Ilona; Frank, Luděk

    2013-01-01

    Roč. 275, 15 June (2013), s. 403-408 ISSN 0169-4332 R&D Projects: GA ČR GAP108/11/2270 Institutional support: RVO:68081731 Keywords : Very low energy SEM * Crystallographic contrast * Strain mapping * Semi-solid state processing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.538, year: 2013

  1. Influence of pH, temperature and glucose on biodegradation of 4 ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-18

    Aug 18, 2009 ... biodegradation of 4-aminophenol by a novel bacterial .... observed at 30°C, as compared to 15.6, 36.1 and 25.5% .... toxicity of aniline and aniline derivatives of cyanobacteria. Arch. Microbiol. 130: 272-275. Dean-Ross D, Rahimi M (1995). Toxicity of phenolic compounds to sediment bacteria. Bull. Environ.

  2. Macroporous silica–alumina composites with mesoporous walls

    Indian Academy of Sciences (India)

    Unknown

    surfactant N-cetyl-N,N,N-trimethylammonium bromide. (CTAB). We describe the macroporous–mesoporous silica– alumina composites with satisfactory/high surface areas. 2. Experimental. Polymethylmethacrylate (PMMA) spheres of diameter. 275 nm were obtained from Soken Chemicals, Japan. These were taken as 1% ...

  3. MCD_Volume4_Issue I_MtFrancais

    African Journals Online (AJOL)

    Sabel, J.

    2009-06-01

    Jun 1, 2009 ... A new species of Colubrid snake (Liopholidophis) from northern Madagascar. Salamandra 41: 83-90. Glaw, F., Vences, M. and Nussbaum, R. A. 2005b. A new species of. Heteroliodon (Reptilia: Squamata: Colubridae) from Montagne des. Français, far northern Madagascar. Herpetologica 61, 3: 275-280.

  4. Parent-Child Predictors of Social Competence with Peers in Children with and without Autism

    Science.gov (United States)

    Meek, Shantel E.; Robinson, Lauren T.; Jahromi, Laudan B.

    2012-01-01

    The current study investigated the relations among parent-child joint engagement, dyadic interactive behaviors, and children's subsequent social competence with peers. Participants were 40 children (20 children with autism, and 20 developmentally-matched typical children) between the ages of 2.75 and 6.5 years. Observational coding was conducted…

  5. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,888 views 5: ... Little Stars 12,275 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  6. Maternal and fetal outcome of gestational diabetes mellitus in ...

    African Journals Online (AJOL)

    Blood sugar was measured using a one touch glucometer. Outcome variables: Socio demographic characteristics, maternal complications, mode of delivery and the foetal outcomes. Results: The mean age of mothers in both groups was similar: 28.6 years vs 27.5 years. Both groups had similar body mass index more than ...

  7. Profiling of diffuse large B-cell lymphoma by immunohistochemistry

    DEFF Research Database (Denmark)

    Sjö, Lene Dissing; Poulsen, Christian Bjørn; Hansen, Mads

    2007-01-01

    , which is an adverse parameter. Furthermore, using two algorithms for distinction between low- and high-risk patients proposed by Hans et al. (Blood, 2004; 103:275) and Muris et al. (Journal of Pathology, 2006; 208:714), it is shown that both are useful for predicting outcome in DLBCL. However...

  8. Chondrocytic potential of allogenic mesenchymal stem cells transplanted without immunosuppression to regenerate physeal defect in rabbits

    Czech Academy of Sciences Publication Activity Database

    Gál, P.; Nečas, A.; Plánka, L.; Kecová, H.; Křen, L.; Krupa, P.; Hlučilová, Jana; Usvald, Dušan

    2007-01-01

    Roč. 76, - (2007), s. 265-275 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Grant - others:MZd(CZ) NR8483 Institutional research plan: CEZ:AV0Z50450515 Keywords : growth plate injury * bone bridge * limb deformity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.687, year: 2007

  9. The role of ultrasound in determining fetal sex

    African Journals Online (AJOL)

    admin

    Conclusion: Ultrasound is a safe and a relatively accurate method of determining fetal gender that can be used at the .... Low lying. 4. 1.5. Total. 269. 100. From the total 275 fetuses included in the analysis, US finding showed that 132 (48.0%) were definitely male and all were confirmed to be so at birth, 90 (32.7%) were.

  10. Isotopic studies of beach rock carbonates from Konkan, central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, B.; Rajamanickam, G.V.; Gujar, A.R.

    .7% (PDB) and delta sup(18)O signatures lie in a narrow range of +27.5 to +28.6% (SMOW), respectively. Isotopic data obtained in this study show that cementation of beach rock carbonates might have taken place in a shallow vadose zone. The large variations...

  11. Seed banks of managed and degraded grasslands in the Krkonoše Mts., Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Handlová, Viola; Münzbergová, Zuzana

    2006-01-01

    Roč. 41, - (2006), s. 275-288 ISSN 1211-9520 R&D Projects: GA ČR GA526/05/0430 Institutional research plan: CEZ:AV0Z60050516 Keywords : degradation * mountain grasslands * seed bank Subject RIV: EF - Botanics Impact factor: 1.196, year: 2006

  12. Happiness and Death Distress: Two Separate Factors

    Science.gov (United States)

    Abdel-Khalek, Ahmed M.

    2005-01-01

    The aim of the present study was to explore the relationship between happiness and death distress (death anxiety, death depression, and death obsession) in 275 volunteer Kuwaiti undergraduates. They responded to the Oxford Happiness Inventory, the Death Anxiety Scale, the Arabic Scale of Death Anxiety, the Death Depression Scale-Revised, and the…

  13. Guilty by association: olympic law and the IP effect / Mark James, Guy Osborn

    Index Scriptorium Estoniae

    James, Mark

    2013-01-01

    Intellektuaalse omandi kaitsest seoses olümpiamängudega seotud sümbolite ja kaubamärkidega Londoni 2012. aasta olümpiamängude näitel. Vaata ka vastukaja artiklile: Intellectual Property Quarterly (2013) nr 3, lk. 275-277

  14. New knowledge for yield, composition and insecticidal activity ofessential oils obtained from the aerial parts or seeds of fennel(Foeniculum vulgare Mill.)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda

    2016-01-01

    Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016

  15. Using stable isotopes to trace resource acquisition and trophic position in four Afrotropical birds with different diets

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Reif, J.; Hořák, D.; Klvaňa, P.; Lee, R. W.; Yohannes, E.

    2010-01-01

    Roč. 81, č. 3 (2010), s. 273-275 ISSN 0030-6525 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : stable isotope analysis * diet ary niche * Cameroon Mountains Subject RIV: EG - Zoology Impact factor: 0.338, year: 2010

  16. Antibiotic Sensitivity Pattern of Urinary Tract Pathogens in Port ...

    African Journals Online (AJOL)

    DR. MIKE HORSFALL

    New mechanisms of bacterial resistance to antimicrobial agents. New. England Journal of Medicine, 324: 601-612. Kabins, A E and Cohen, S (1966). Resistance factor in. Enterobacteriaceae. New England Journal of. Medicine, 275: 248-252. Kunin, C M (1987). Detection, Prevention and. Management of Urinary Tract ...

  17. Higher Doses of (+)MK-801 (Dizocilpine) Induced Mortality and Procedural but Not Cognitive Deficits in Delayed Testing in the Active Place Avoidance With Reversal on the Carousel

    Czech Academy of Sciences Publication Activity Database

    Lobellová, Veronika; Brichtová, Eva; Petrásek, Tomáš; Valeš, Karel; Stuchlík, Aleš

    2015-01-01

    Roč. 64, č. 2 (2015), s. 269-275 ISSN 0862-8408 R&D Projects: GA MZd(CZ) NT13386 Institutional support: RVO:67985823 Keywords : Dizocilpine * (+)MK-801 * active place avoidance * Carousel * Long-Evans rats Subject RIV: FH - Neurology Impact factor: 1.643, year: 2015

  18. Drug-drug interation prediction between ketoconazole and anti-liver ...

    African Journals Online (AJOL)

    Aims: To predict the metabolic behavior and metabolism-based drug-drug interaction of gomisin G. Methods: ... Results: Gomisin G can be well docked into the activity site of CYP3A4, and distance between gomisin G the heme active site was 2.75 Å. To .... Fang ZZ, Krausz KW, Li F, Cheng J, Tanaka N, Gon- zalez FJ.

  19. South African Journal of Animal Science - Vol 4, No 2 (1974)

    African Journals Online (AJOL)

    Recent advances in the deep-freeze preservation of ram semen · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Visser, 275-288. Egg transfer as an adjunct to twinning in cattle · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ...

  20. Quantum optics, molecular spectroscopy and low-temperaturespectroscopy: general discussion

    Czech Academy of Sciences Publication Activity Database

    Orrit, M.; Evans, G.; Cordes, T.; Kratochvílová, Irena

    2015-01-01

    Roč. 184, Sep (2015), 275-303 ISSN 1359-6640 R&D Projects: GA TA ČR TA04020156 Institutional support: RVO:68378271 Keywords : quantum optics * molecular spectroscopy Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.544, year: 2015

  1. Postoperative Recovery of Mechanical Muscle Function in Hip Replacement Patients

    DEFF Research Database (Denmark)

    Jensen, Carsten; Aagaard, Per; Overgaard, Søren

    2011-01-01

    old hip patients.   MATERIAL AND METHODS Patients: Forty elderly patients (age 55 ± 6, BMI 27.5 ± 4.1) with unilateral osteoarthritis participated in this prospectively study and were randomized to either total or resurfacing hip replacement. All implants inserted by two senior surgeons using only...

  2. EPR and NMR spectroscopy on spin-labeled proteins

    NARCIS (Netherlands)

    Finiguerra, Michelina Giuseppina

    2011-01-01

    Spin labeling and electron paramagnetic resonance (EPR) have been employed to study structure and dynamics of proteins. The surface polarity of four single cysteine mutants of the Zn-azurin in frozen solution were studied using 275 GHz EPR (J-band), with the advantage compared to 9 GHz (X-band) and

  3. Extending quantum efficiency roll-over threshold with compositionally graded InGaN/GaN LED

    KAUST Repository

    Mishra, Pawan

    2014-12-01

    We report a significant improvement in the electrical characteristic of compositionally graded InGaN/GaN multiple-quantum-well (MQWs) micro-LED. The efficiency droop in this device occurred at ∼20 times higher injection levels (∼275 A/cm2) compared to a conventional step-MQWs microLED (∼14 A/cm2).

  4. Meta-analysis of California Spotted Owl (Strix occidentalis occidentalis) territory occupancy in the Sierra Nevada: habitat associations and their implications for forest management

    Science.gov (United States)

    Douglas J. Tempel; John J. Keane; R. J. Gutierrez; Jared D. Wolfe; Gavin M. Jones; Alexander Koltunov; Carlos M. Ramirez; William J. Berigan; Claire V. Gallagher; Thomas E. Munton; Paula A. Shaklee; Sheila A. Whitmore; M. Zachariah Peery

    2016-01-01

    We assessed the occupancy dynamics of 275 California Spotted Owl (Strix occidentalis occidentalis) territories in 4 study areas in the Sierra Nevada, California, USA, from 1993 to 2011. We used Landsat data to develop maps of canopy cover for each study area, which we then used to quantify annual territory-specific habitat...

  5. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,819 views 5: ... Little Stars 12,275 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  6. Socioeconomic Status, Higher-Level Mathematics Courses, Absenteeism, and Student Mobility as Indicators of Work Readiness

    Science.gov (United States)

    Folds, Lea D.; Tanner, C. Kenneth

    2014-01-01

    The purpose of this study was to analyze the relations among socioeconomic status, highest-level mathematics course, absenteeism, student mobility and measures of work readiness of high school seniors in Georgia. Study participants were 476 high school seniors in one Georgia county. The full regression model explained 27.5% of the variance in…

  7. Elemental characterization of the new Czech meteorite "Morávka" by neutron and photon activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003

  8. Bulletin of Animal Health and Production in Africa - Vol 62, No 3 (2014)

    African Journals Online (AJOL)

    Co-administration of Albendazole and Levamisole to control multiple anthelmintic resistant nematodes in a sheep farm in Kabete Kenya · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CJ Nganga, DW Gakuya, RO Otieno, RW Githinji, 275-278 ...

  9. Localization of MHC class II/human cartilage glycoprotein-39 complexes in synovia of rheumatoid arthritis patients using complex-specific monoclonal antibodies

    NARCIS (Netherlands)

    Steenbakkers, Peter G. A.; Baeten, Dominique; Rovers, Eric; Veys, Eric M.; Rijnders, Antonius W. M.; Meijerink, Jan; de Keyser, Filip; Boots, Annemieke M. H.

    2003-01-01

    Recently human cartilage gp-39 (HC gp-39) was identified as a candidate autoantigen in rheumatoid arthritis (RA). To further investigate the relevance of this Ag in RA, we have generated a set of five mAbs to a combination epitope of complexes of HC gp-39(263-275) and the RA-associated DR alpha beta

  10. Gastrointestinal Parasites of Two Populations of Arctic Foxes (Vulpes lagopus) from Northeast Greenland

    DEFF Research Database (Denmark)

    Andreassen, P.N.S.; Schmidt, Niels Martin; Kapel, Christian M. O.

    2017-01-01

    Parasitological examination of 275 faecal samples from Arctic foxes (Vulpes lagopus) collected at Zackenberg Valley and Karupelv Valley in north-east Greenland from 2006 to 2008 was conducted using sieving and microscopy. Overall, 125 (45.5%) samples contained parasite eggs of Taenia crassiceps...

  11. Employment impacts of ARRA funding on TxDOT projects.

    Science.gov (United States)

    2010-10-01

    The stimulus package signed by President Obama on March 6, 2009 is known as the American Recovery and : Reinvestment Act (ARRA). This act allocated $48.1 billion to transportation of which $27.5 billion was for : highway projects. Texas was allotted ...

  12. 78 FR 51101 - Regulatory Capital Rules: Regulatory Capital, Enhanced Supplementary Leverage Ratio Standards for...

    Science.gov (United States)

    2013-08-20

    ..., 3501 North Fairfax Drive, Room E-1002, Arlington, VA 22226 by telephone at (877) 275-3342 or (703) 562... economy associated with the disorderly failure of these companies, the U.S. government (and many foreign... Kong SAR, India, Indonesia, Italy, Japan, Korea, Luxembourg, Mexico, the Netherlands, Russia, Saudi...

  13. Cross-Linked Poly-Vinyl Polymers versus Polyureas as Designed Supports for Catalytically Active M0 Nanoclusters. Part I. Nanometer Scale Structure of the Polyurea Support EnCatTM 40

    Czech Academy of Sciences Publication Activity Database

    Bolfa, C.; Zoleo, A.; Sassi, A.S.; Maniero, A.L.; Pears, D.; Jeřábek, Karel; Corain, B.

    2007-01-01

    Roč. 275, 1-2 (2007), s. 233-239 ISSN 1381-1169 Institutional research plan: CEZ:AV0Z40720504 Keywords : esr spectroscopy * functional resins * nanopores Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.707, year: 2007

  14. Cold Response of Dedifferentiated Barley Cells at the Gene Expression, Hormone Composition, and Freezing Tolerance Levels: Studies on Callus Cultures

    Czech Academy of Sciences Publication Activity Database

    Vashegyi, I.; Marozsan-Toth, Z.; Galiba, G.; Dobrev, Petre; Vaňková, Radomíra; Toth, B.

    2013-01-01

    Roč. 54, č. 2 (2013), s. 337-349 ISSN 1073-6085 R&D Projects: GA ČR GA522/09/2058 Institutional research plan: CEZ:AV0Z50380511 Keywords : ABA * Barley * Callus Subject RIV: ED - Physiology Impact factor: 2.275, year: 2013

  15. Does the expansion of a motorway network lead to economic agglomeration? : Evidence from China

    NARCIS (Netherlands)

    Yu, Nannan; de Roo, Gert; de Jong, Martin; Storm, Servaas

    In contrast to most existing studies examining the generative effects of transport infrastructure, this paper addresses the distributive effects of transport infrastructure in China. Using panel data from 275 Chinese municipalities in the 2000–2010 period, our study explores the role of road

  16. Measuring the readability of sustainability reports: : A corpus-based analysis through standard formulae and NLP

    NARCIS (Netherlands)

    Smeuninx, N.; De Clerck, B.; Aerts, Walter

    2016-01-01

    This study characterises and problematises the language of corporate reporting along region, industry, genre, and content lines by applying readability formulae and more advanced natural language processing (NLP)–based analysis to a manually assembled 2.75-million-word corpus. Readability formulae

  17. Relationship of birth order and the marketing-related variable of materialism.

    Science.gov (United States)

    Zemanek, J E; Claxton, R P; Zemanek, W H

    2000-04-01

    The relationship between the birth order and materialism scores was investigated using materialism conceptualized as a consumer value. Data were collected from 275 alumni of a major southwestern university. The analysis indicated that first-borns in this sample scored significantly lower on materialism than younger siblings.

  18. Long-term monitoring of native bullhead and invasive gobiids in the Danubian rip-rap zone

    Czech Academy of Sciences Publication Activity Database

    Janáč, Michal; Roche, Kevin Francis; Šlapanský, Luděk; Polačik, Matej; Jurajda, Pavel

    2018-01-01

    Roč. 807, č. 1 (2018), s. 263-275 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Competition * Fish population structure * Invasive species impact * Ponto–Caspian gobies * River bank stabilisation Subject RIV: EG - Zoology Impact factor: 2.056, year: 2016

  19. 76 FR 32242 - Federal Employees' Retirement System; Normal Cost Percentages

    Science.gov (United States)

    2011-06-03

    ... statistical data prepared by the OPM actuaries and considered trends that may affect future experience under... that it would be appropriate to assume a rate of investment return of 5.75 percent, reduced from the... investment return will exceed inflation by 2.75 percent and General Schedule salary increases will exceed...

  20. Informed trading and the bid-ask spread: evidence from an emerging market

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Podpiera, R.

    2003-01-01

    Roč. 31, č. 2 (2003), s. 275-296 ISSN 0147-5967 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : market microstructure * bid-ask spread * informed trading Subject RIV: AH - Economics Impact factor: 0.746, year: 2003

  1. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:27 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,983 views 5: ... Little Stars 12,275 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  2. 77 FR 71678 - The Goodyear Tire & Rubber Company, Receipt of Petition for Decision of Inconsequential...

    Science.gov (United States)

    2012-12-03

    ...: The Goodyear Tire & Rubber Company (GOODYEAR),\\1\\ has determined that certain Goodyear brand tires... LT 275/65R18 brand tires manufactured between April 8, 2012, and May 12, 2012 at its plant in Gadsden..., although there is no limit to the length of necessary attachments to the comments. If comments are...

  3. Assessment of the hydrolytic performance of locally sourced crude ...

    African Journals Online (AJOL)

    amylases increased with increase in substrate concentration up to a maximum substrate concentration of 10%. The crude alpha amylase exhibited a dextrinization time of 2.5h, 2.75h and 3.0h for maize, cassava and potato starches and produced 13%, 12% and 11.8% glucose respectively. The crude gluco-amylase had ...

  4. A Proof of Concept Imaging System for Automated Cervical Cancer Screening in Peru

    Science.gov (United States)

    Raza Garcia, Mabel Karel

    2013-01-01

    Cervical cancer is the second most frequent cancer in women around the world and affects half a million women per year. The World Health Organization (WHO) estimates that 275,000 women die every year, and 80% to 85% of these deaths occur in low-resource countries in Africa and South America. In Peru, cervical cancer has the highest incidence and…

  5. Food contamination with salmonella and human health in Kinshasa ...

    African Journals Online (AJOL)

    SARAH

    2015-10-31

    Oct 31, 2015 ... Objectives: The objective of this study was to assess the level of salmonella contamination of fish and meat .... The prevalence of. Salmonella contamination for beef carcasses at the public abattoir was 27.5% (Table 4) with a mean value of 5.76 ± 2.71 log10 .... Listeria and Enteric bacteria of public health.

  6. Untitled

    Indian Academy of Sciences (India)

    oligomers 275. 1-Phenylethanol. Ruthenium(III) catalysed oxidation of l-phenyl- ethanol and substituted 1-phenylethanols by phenyliodosoacetate (PIA) 573. Phenyliodosoacetate. Ruthenium(III) catalysed oxidation of 1-pheny- lethanol and substituted 1-phenylethanols by phenyliodosoacetate (PIA) 573. Photoconductivity.

  7. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,059 views 5: ... Little Stars 12,275 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  8. Profile of Australian Preschool Children with Speech Sound Disorders at Risk for Literacy Difficulties

    Science.gov (United States)

    McLeod, Sharynne; Crowe, Kathryn; Masso, Sarah; Baker, Elise; McCormack, Jane; Wren, Yvonne; Roulstone, Susan; Howland, Charlotte

    2017-01-01

    Speech sound disorders are a common communication difficulty in preschool children. Teachers indicate difficulty identifying and supporting these children. The aim of this research was to describe speech and language characteristics of children identified by their parents and/or teachers as having possible communication concerns. 275 Australian 4-…

  9. The development of a new class of inhibitors for betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Pícha, Jan; Vaněk, Václav; Buděšínský, Miloš; Mládková, Jana; Garrow, T. A.; Jiráček, Jiří

    2013-01-01

    Roč. 65, July (2013), s. 256-275 ISSN 0223-5234 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : BHMT * inhibitor * homocysteine * phosphonate * phosphinate * amino acid derivative * bioisostere * S-alkylated homocysteine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  10. The Goteborg Discotheque Fire: Posttraumatic Stress, and School Adjustment as Reported by the Primary Victims 18 Months Later

    Science.gov (United States)

    Broberg, Anders G.; Dyregrov, Atle; Lilled, Lars

    2005-01-01

    Background: On October 29, 1998, around 400 young people were gathered in an old warehouse in Goteborg, Sweden, for a discotheque party. A fire erupted and spread explosively. Adolescents were exposed to dreadful scenes inside and outside the building. In all, 63 young people were killed and 213 physically injured. An 18-month follow-up with 275

  11. Automatically tunable continuous-wave optical parametric oscillator for high-resolution spectroscopy and sensitive trace-gas detection

    NARCIS (Netherlands)

    Ngai, A.K.Y.; Persijn, S.T.; Basum, G. von; Harren, F.J.M.

    2006-01-01

    We present a high-power (2.75 W), broadly tunable (2.75-3.83 mu m) continuous-wave optical parametric oscillator based on MgO-doped periodically poled lithium niobate. Automated tuning of the pump laser, etalon and crystal temperature results in a continuous wavelength coverage up to 450 cm(-1) per

  12. 75 FR 53980 - Notice of Availability of the Record of Decision; Elk Management Plan/Environmental Impact...

    Science.gov (United States)

    2010-09-02

    ... March 8, 2010. The Preferred Alternative will make use of skilled public volunteers to assist the Park... 275 elk per year. Following the initial reduction phase, the Park would take an additional 20 to 24... are willing recipients that can meet all Federal and State requirements to transport and receive live...

  13. Contribution of the Institute of Geonics of the ASCR Ostrava to Seismolological Monitoring in Silesia and Northern Moravia

    Czech Academy of Sciences Publication Activity Database

    Holub, Karel; Kaláb, Zdeněk; Knejzlík, Jaromír; Rušajová, Jana

    2009-01-01

    Roč. 6, č. 3 (2009), s. 391-398 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z30860518 Keywords : Moravian-Silesian region * natural seismicity * microearthquake Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.275, year: 2009 http://apps.isiknowledge.com/full_record.do? product =UA&search_mode

  14. Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.

    2015-01-01

    Roč. 591, Sep (2015), s. 271-275 ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.761, year: 2015

  15. Ferromagnetism in 5f-band metamagnet UCoAl induced by Os doping

    Czech Academy of Sciences Publication Activity Database

    Andreev, Alexander V.; Shirasaki, K.; Šebek, Josef; Vejpravová, Jana; Gorbunov, Denis; Havela, L.; Daniš, S.; Yamamura, T.

    2016-01-01

    Roč. 681, Oct (2016), 275-282 ISSN 0925-8388 R&D Projects: GA ČR GA16-03593S Institutional support: RVO:68378271 Keywords : uranium intermetallics * UCoAl * itinerant metamagnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.133, year: 2016

  16. INVESTIGATIONS ON THE CORROSION OF CONSTRUCTIONAL ...

    African Journals Online (AJOL)

    BCSE

    Results indicate that S355 and S235 steels have comparable corrosion resistance, which are much lower than that of S275. KEY WORDS: Corrosion, Steel, Salt spray, Tafel polarization, Electrochemical impedance spectroscopy. INTRODUCTION. Steel is an alloy used in construction and mechanical engineering.

  17. Fulltext PDF

    Indian Academy of Sciences (India)

    An allele-specific polymerase chain reaction assay for the dif- ferentiation of members of the Anopheles culicifacies complex. 275. Anoxia. Habitat diversity and adaptation to environmental stress in encysted embryos of the crustacean Artemia. 489. Antennal lobe. Maxillary palp glomeruli and ipsilateral projections in the.

  18. Sex Differences in the Timing of Identification among Children and Adults with Autism Spectrum Disorders

    Science.gov (United States)

    Begeer, Sander; Mandell, David; Wijnker-Holmes, Bernadette; Venderbosch, Stance; Rem, Dorien; Stekelenburg, Fred; Koot, Hans M.

    2013-01-01

    To examine differences by sex in the timing of identification of individuals with autism spectrum disorders (ASD), survey data were collected in the Netherlands from 2,275 males and females with autistic disorder, Asperger's syndrome and PDD-NOS. Among participants less than 18 years of age, females with Asperger's syndrome were identified later…

  19. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Zhu Chen. Articles written in Journal of Biosciences. Volume 25 Issue 3 September 2000 pp 275-284 Review articles. Mechanisms of all-trans retinoic acid-induced differentiation of acute promyelocytic leukemia cells · Ji-Wang Zhang Jian Gu Zhen-Yi Wang Sai-Juan Chen Zhu Chen.

  20. Re-training needs of village extension agents in Nigeria: A study of ...

    African Journals Online (AJOL)

    Areas agents felt they had highest competence were principles of crop production (X=2.75) and Animal Nutrition (X=2.57). Subject matter areas of relevance and competence have been identified. There are several areas in agriculture in which the agents need functional training. Keywords: Re-Training Extension Agents, ...

  1. 75 FR 17145 - Food Additives; Bisphenol A; Availability

    Science.gov (United States)

    2010-04-05

    ... comments on the four documents prepared by FDA's Center for Food Safety and Applied Nutrition (CFSAN... Applied Nutrition (HFS-275), Food and Drug Administration, 5100 Paint Branch Pkwy., College Park, MD 20740... Subcommittee of FDA's Science Board for external review. On September 16, 2008, the Subcommittee held a public...

  2. Studies on the Biology of Larvae of Clarias albopunctatus (N. & L ...

    African Journals Online (AJOL)

    Clarias albopunctatus larvae, collected from the laboratory hatchlings were on the 4th day of lie, subjected to six different diet consisting of A - Plankton, B - Egg Yolk, C - Beef liver, D - Milk Powder, E - Crayfish trash and F - Soya bean meal. The experiment was maintained at 27.5 ± 5 0oC. Larval weight measurements ...

  3. Case report

    African Journals Online (AJOL)

    abp

    144. PubMed | Google Scholar. 6. Pant R, Poh ACC, Hwang SG. An unusual case of an intramuscular lipoma of the pectoralis major muscle simulating a malignant breast mass. Annals Academy of Medecine. Singapore. 2005; 34 (3): 275-276.

  4. Study of adhesion of cement mixture and fibres and changes of its tension properties

    Czech Academy of Sciences Publication Activity Database

    Trčková, Jiřina; Řezba, Karel

    2009-01-01

    Roč. 6, č. 4 (2009), s. 475-482 ISSN 1214-9705 R&D Projects: GA ČR GA103/08/1197 Institutional research plan: CEZ:AV0Z30460519 Keywords : fibre cement mixture * pullout test * tension properties Subject RIV: JM - Building Engineering Impact factor: 0.275, year: 2009

  5. 7110.65H Air Traffic Control

    Science.gov (United States)

    1993-09-16

    these functions, it is rec. 2-75a2 Example.- ommended combining them on local control. The ATIS may be "Attention all aircraft. False air traffic...all aircraft. False air traffic control instructions used to specify the desired frequency. have been received in the area of Long Beach Airport

  6. Further evidence for the influence of intraduodenal pH on the PABA test

    NARCIS (Netherlands)

    Hoek, F. J.; Tytgat, G. N.

    1984-01-01

    The effect of prior administration of 400 mg of cimetidine on the outcome of the PABA test was investigated. In 8 patients the PABA test result rose with on average 27.5% after the administration of cimetidine. Four of them were selected for these investigations, because a much lower PABA test

  7. First results of ISO-SWS observations of Jupiter

    NARCIS (Netherlands)

    Encrenaz, T.; de Graauw, T.; Schaeidt, S.; Lellouch, E.; Feuchtgruber, H.; Beintema, D. A.; Bezard, B.; Drossart, P.; Griffin, M.; Heras, A.; Kessler, M.; Leech, K.; Morris, P.; Roelfsema, P. R.; Roos-Serote, M.; Salama, A.; Vandenbussche, B.; Valentijn, E. A.; Davis, G. R.; Naylor, D. A.

    1996-01-01

    The spectrum of Jupiter has been recorded between 2.75 and 14.5 mu m with the grating mode of the Short-Wavelength Spectrometer (SWS) of ISO. The resolving power is 1500. The main preliminary results of this observation are (1) at 3 mu m, the first spectroscopic signature, probably associated with

  8. Fine structure and dynamics in a light bridge inside a solare pore

    Czech Academy of Sciences Publication Activity Database

    Hirzberger, J.; Bonet, J. A.; Sobotka, Michal; Vazquez, M.; Hanslmeier, A.

    2002-01-01

    Roč. 383, č. 1 (2002), s. 275-282 ISSN 0004-6361 R&D Projects: GA AV ČR IAA3003903; GA AV ČR KSK2043105 Institutional research plan: CEZ:AV0Z1003909 Keywords : sun granulation * sunspots * photosphere Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.781, year: 2002

  9. A new [(1R,2R)-1,2-diaminocyclohexane]platinum(II) complex: formation by nitrate-acetonitrile ligand exchange

    Czech Academy of Sciences Publication Activity Database

    Pažout, R.; Housková, J.; Dušek, Michal; Maixner, J.; Cibulková, J.; Kačer, P.

    2010-01-01

    Roč. 66, Part 10 (2010), m273-m275 ISSN 0108-2701 Institutional research plan: CEZ:AV0Z10100521 Keywords : platinum complexes * structure analysis * disorder * cyclohexane * diamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.745, year: 2010

  10. Sadhana – Academy Proceedings in Engineering Sciences: A ...

    Indian Academy of Sciences (India)

    collaboration in research work. Table 4 explains the authorship pattern of contributions volume-wise. Regarding contributions by single author, the volume number 31 records the highest percentage (27.5%). Regarding two authors contributions, the volume 32 shows maximum percentage (25.58%). Regarding three.

  11. Natural gas industry in Iran

    Energy Technology Data Exchange (ETDEWEB)

    Omidvar, Hedayat

    2010-09-15

    Iran holds the second largest gas reserves in the word with over 27.5 trillion cubic meters (TCM) of natural gas. Due to lack of geological surveys in certain geographical regions in Iran, it is likely to explore further reserves in the future.

  12. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  13. Modo in Quadragesimale Admontense

    Czech Academy of Sciences Publication Activity Database

    Nývlt, Pavel

    2014-01-01

    Roč. 137, 3/4 (2014), s. 275-292 ISSN 0024-4457 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval Latin * lexicography * particles in medieval Latin * conjunctions in medieval Latin Subject RIV: AI - Linguistics

  14. Microenvironmental Regulation of Mammary Carcinogenesis

    Science.gov (United States)

    2009-06-01

    involvement of chymase-angiotensin-dependent pathway in the hamster sponge angiogenesis model. J Biol Chem 275, 5545-5552 (2000). 17. Lundequist, A...infiltrates has been obscure for many years. Historically, activated macrophages were merely thought of as effector cells that phagocyte microorganisms ... microorganisms and release chemokines and proteases that in turn recruit additional immune effector cells. Moreover, neutrophils are involved in

  15. Assumptions of Multiple Regression: Correcting Two Misconceptions

    Science.gov (United States)

    Williams, Matt N.; Gomez Grajales, Carlos Alberto; Kurkiewicz, Dason

    2013-01-01

    In 2002, an article entitled "Four assumptions of multiple regression that researchers should always test" by Osborne and Waters was published in "PARE." This article has gone on to be viewed more than 275,000 times (as of August 2013), and it is one of the first results displayed in a Google search for "regression…

  16. GLYCOGEN IN BACILLUS-SUBTILIS - MOLECULAR CHARACTERIZATION OF AN OPERON ENCODING ENZYMES INVOLVED IN GLYCOGEN BIOSYNTHESIS AND DEGRADATION

    NARCIS (Netherlands)

    KIEL, JAKW; BOELS, JM; BELDMAN, G; VENEMA, G

    Although it has never been reported that Bacillus subtilis is capable of accumulating glycogen, we have isolated a region from the chromosome of B. subtilis containing a glycogen operon. The operon is located directly downstream from trnB, which maps at 275 degrees on the B. subtilis chromosome. It

  17. Humidity resistant hydrogenated carbon nitride films

    Czech Academy of Sciences Publication Activity Database

    Mikmeková, Eliška; Polčák, J.; Sobota, Jaroslav; Müllerová, Ilona; Peřina, Vratislav; Caha, O.

    2013-01-01

    Roč. 275, 15 June (2013), s. 7-13 ISSN 0169-4332 R&D Projects: GA MŠk ED0017/01/01 Institutional support: RVO:68081731 ; RVO:61389005 Keywords : thin films * corrosion behanior * delamination * stress Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; BH - Optics, Masers, Lasers (UJF-V) Impact factor: 2.538, year: 2013

  18. Absorption properties of chromophoric dissolved organic matter (CDOM) in the East China Sea and the waters off eastern Taiwan

    Science.gov (United States)

    Zhou, Fengxia; Gao, Xuelu; Song, Jinming; Chen, Chen-Tung Arthur; Yuan, Huamao; Xing, Qianguo

    2018-05-01

    The absorption properties of chromophoric dissolved organic matter (CDOM) in the East China Sea (ECS) and the waters off eastern Taiwan (WET) were studied during May 2014. CDOM absorption coefficient (a280) and spectral slope (S275-295) revealed considerable spatial variations. In the ECS, the values of a280 and S275-295 presented a reverse distribution pattern. In the WET, a280 values were generally low while S275-295 values were generally high. Vertical distributions of a280 and S275-295 also varied in different regions. Terrestrial input, phytoplankton production, sediment release or photobleaching may be responsible for the dynamics of CDOM. Relationships among CDOM related parameters could partly support this conclusion. a280 were also used to trace different water masses and the result showed that the influence of Changjiang Diluted Water could reach the outer shelf of the northern ECS, and that the Kuroshio Current had a strong influence on the middle shelf of the southern ECS.

  19. 76 FR 13427 - Ellicott Slough National Wildlife Refuge, Santa Cruz County, CA; Final Comprehensive Conservation...

    Science.gov (United States)

    2011-03-11

    ... Watsonville Main Public Library, 275 Main Street, Suite 100, Watsonville, CA 95076. FOR FURTHER INFORMATION... photography, and environmental education and interpretation. We will review and update the CCP at least every... observation, and photography programs will be improved and/or expanded. The selected alternative best meets...

  20. Radiation Damage In Advanced Bipolar Transistors

    Science.gov (United States)

    Zoutendyk, John A.; Goben, Charles A.; Berndt, Dale F.

    1989-01-01

    Report describes measurements of common-emitter current gains (hFE) of advanced bipolar silicon transistors before, during, and after irradiation with 275-MeV bromine ions, 2.5-MeV electrons, and conductivity rays from cobalt-60 atoms.

  1. Take One for the Team? Influence of Team and Individual Sport Participation on High School Athlete Substance Use Patterns

    Science.gov (United States)

    Kulesza, Magdalena; Grossbard, Joel R.; Kilmer, Jason; Copeland, Amy L.; Larimer, Mary E.

    2014-01-01

    The current Web-based survey investigated the association between team or individual sport participation (or both) and self-reported alcohol and tobacco use among high school athletes (N = 1,275) transitioning to college. Peak blood alcohol concentration, weekly drinking, and alcohol-related problems were significantly lower among athletes in…

  2. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 35. Little Stars 12,275 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer ... Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators Advertise Developers +YouTube Terms Privacy ...

  3. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:39 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,707 views 5: ... Little Stars 12,275 views 10:35 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  4. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. S T Nandibewoor. Articles written in Journal of Chemical Sciences. Volume 121 Issue 3 May 2009 pp 275-281 Full Papers. Mechanistic study of ruthenium (III) catalysed oxidation of L-lysine by diperiodatoargentate (III) in aqueous alkaline medium · R R Hosamani S T ...

  5. A tool to ascertain taxonomic relatedness based on features derived ...

    Indian Academy of Sciences (India)

    MADHU

    placements of a new isolate based on phenotypic characteristics are now being supported by information preserved in the 16S rRNA gene. ... were extracted from the training data set of the 16S rDNA sequence, and was subjected to an artificial neural network ..... variables to 275 principal components, accounting for 99%.

  6. Gastrointestinal Parasites of Two Populations of Arctic Foxes (Vulpes lagopus) from Northeast Greenland

    DEFF Research Database (Denmark)

    Andreassen, P.N.S.; Schmidt, Niels Martin; Kapel, Christian M. O.

    2017-01-01

    Parasitological examination of 275 faecal samples from Arctic foxes (Vulpes lagopus) collected at Zackenberg Valley and Karupelv Valley in north-east Greenland from 2006 to 2008 was conducted using sieving and microscopy. Overall, 125 (45.5%) samples contained parasite eggs of Taenia crassiceps...

  7. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Abhijit Chakraborty. Articles written in Journal of Earth System Science. Volume 114 Issue 3 June 2005 pp 275-286. Significance of transition between Talchir Formation and Karharbari Formation in Lower Gondwana basin evolution — A study in West Bokaro Coal basin, ...

  8. Effect of addition of a second metal in Mo/ZSM-5 catalyst for methane aromatization reaction under elevated pressures

    Czech Academy of Sciences Publication Activity Database

    Fíla, V.; Bernauer, Milan; Bernauer, B.; Sobalík, Zdeněk

    2015-01-01

    Roč. 256, č. 2 (2015), s. 269-275 ISSN 0920-5861 Grant - others:EU 7th Framework Program(XE) NMP3-LA-2009-229183 Institutional support: RVO:61388955 Keywords : methane * aromatization * metal dopants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  9. [A gradual method for a more physiological hormonal contraception].

    Science.gov (United States)

    Hamann, B; Büchner, C

    1976-01-01

    The multiple physiologie stages of method by oral hormonal anticonception was reported, which have been in use in combination. Since 1969 about 362 women at the average age of 27,5 years received 10281 cycles, that means in an average cycles from 28,4 days, the stage method from 11/10 days or 7-7-7 days rhythmus.

  10. Kultuurikalender : Nopitud tähtpäevi märtsis / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    1996-01-01

    12. märtsil 75 a. eesti viiuldaja, kitarristi ja orkestrijuhi Emil Laansoo sünnist; 19. märtsil 275 a. šoti-inglise kirjaniku Tobias George Smolletti sünnist; 27. märtsil 125 a. saksa kirjaniku Heinrich Manni sünnist

  11. Discrete maximum principle for FE solutions of the diffusion-reaction problem on prismatic meshes

    Czech Academy of Sciences Publication Activity Database

    Hannukainen, A.; Korotov, S.; Vejchodský, Tomáš

    2009-01-01

    Roč. 226, č. 2 (2009), s. 275-287 ISSN 0377-0427 R&D Projects: GA AV ČR IAA100760702 Institutional research plan: CEZ:AV0Z10190503 Keywords : diffusion-reaction problem * maximum principle * prismatic finite elements Subject RIV: BA - General Mathematics Impact factor: 1.292, year: 2009

  12. Assessment of shale-oil resources of the Central Sumatra Basin, Indonesia, 2015

    Science.gov (United States)

    Schenk, Christopher J.; Charpentier, Ronald R.; Klett, Timothy R.; Tennyson, Marilyn E.; Mercier, Tracey J.; Brownfield, Michael E.; Pitman, Janet K.; Gaswirth, Stephanie B.; Leathers-Miller, Heidi M.

    2015-11-12

    Using a geology-based assessment methodology, the U.S. Geological Survey estimated means of 459 million barrels of shale oil, 275 billion cubic feet of associated gas, and 23 million barrels of natural gas liquids in the Central Sumatra Basin, Indonesia.

  13. 75 FR 75941 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-12-07

    ... City of Romulus, City Born Road. of Wayne, Township of Van Buren. Just downstream of I- None +669 275... South Wayne Road, Wayne, MI 48184. Township of Van Buren Maps are available for inspection at 46425 Tyler Road, Van Buren Township, MI 48111. Harris County, Texas, and Incorporated Areas K100-00-00...

  14. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:39 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,777 views 5: ... Little Stars 12,275 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  15. A Comparative Study of Nitrilases Identified by Genome Mining

    Czech Academy of Sciences Publication Activity Database

    Kaplan, Ondřej; Veselá, Alicja Barbara; Petříčková, Alena; Pasquarelli, F.; Pičmanová, Martina; Rinágelová, Anna; Bhalla, T. C.; Pátek, Miroslav; Martínková, Ludmila

    2013-01-01

    Roč. 54, č. 3 (2013), s. 996-1003 ISSN 1073-6085 R&D Projects: GA ČR(CZ) GAP504/11/0394; GA TA ČR TA01021368 Institutional support: RVO:61388971 Keywords : Nitrilase * Arylacetonitrilase * Cyanide hydratase Subject RIV: CE - Biochemistry Impact factor: 2.275, year: 2013

  16. A two-stage decentralised system combining high rate activated ...

    African Journals Online (AJOL)

    Total ammonium nitrogen (TAN) and total phosphates (TP) were largely retained in the effluent with average removal percentages of 19.5 and 27.5%, respectively, encouraging reuse for plant growth. Key words: A-stage, sustainable wastewater treatment, resource recovery, developing countries, water reuse, nutrient ...

  17. The effect of starvation on the metabolic rate and microanatomy of Galumna elimata (Acari: Oribatida)

    Czech Academy of Sciences Publication Activity Database

    Hubert, J.; Šustr, Vladimír

    2001-01-01

    Roč. 98, - (2001), s. 265-275 ISSN 1210-5759 R&D Projects: GA ČR GA206/97/0629 Institutional research plan: CEZ:AV0Z6066911 Keywords : Acari * starvation * mortality Subject RIV: EH - Ecology, Behaviour Impact factor: 0.802, year: 2001

  18. Marine depth use of sea trout Salmo trutta in fjord areas of central Norway

    DEFF Research Database (Denmark)

    Eldøy, S. H.; Davidsen, J. G.; Thorstad, E. B.

    2017-01-01

    The vertical behaviour of 44 veteran sea trout Salmo trutta (275-580 mm) in different marine fjord habitats (estuary, pelagic, near shore with and without steep cliffs) was documented during May-February by acoustic telemetry. The swimming depth of S. trutta was influenced by habitat, time of day...

  19. Sanoli Gun

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Sanoli Gun. Articles written in Proceedings – Mathematical Sciences. Volume 119 Issue 3 June 2009 pp 275-281. Remarks on some Zero-Sum Theorems · S D Adhikari Sanoli Gun Purusottam Rath · More Details Abstract Fulltext PDF. In the present paper, we give a ...

  20. Continuing Medical Education - Vol 28, No 6 (2010)

    African Journals Online (AJOL)

    Bacterial infections in travellers: The rise in global tourism has resulted in an increase in travel-related infections. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Dlamini, H Van der Plas, M Mendelson, 270-275 ...

  1. Cancer of unknown primary

    DEFF Research Database (Denmark)

    Dyrvig, Anne-Kirstine; Yderstræde, Knud Bonnet; Gerke, Oke

    2017-01-01

    to procedures and patient survival. The cohort was investigated in terms of validity of diagnosis through cross-referencing with the Cancer Registry (CR), which served as gold standard for cancer diagnoses and patients' cancer histories.The NPR cohort consisted of 542 patients (275 males, 264 females) of whom...

  2. Untitled

    Indian Academy of Sciences (India)

    1987). DHBT June {Ꮹ > 275 Nottenburg et al (1987). SAGM-APD July t = 14 Tsang et al ... *Source: IEEE Trans. Electron Devices Lett. 8 (1987). Table 2. Physical constants of in (0.53) Ga (0.47) As. Physical constant. T Valley L valley X valley.

  3. Thinking Styles and Academic Stress Coping among Chinese Secondary School Students

    Science.gov (United States)

    Yuan, Wei; Zhang, Li-Fang; Fu, Mingchen

    2017-01-01

    This study investigated the predictive power of thinking styles for academic stress coping. Participants were 563 (280 males, 275 females, 8 gender unspecified) secondary school students in grades 7 through 12 from mainland China. Thinking styles were measured using the Thinking Styles Inventory-Revised II which was based on the theory of mental…

  4. 75 FR 67122 - Notice of Entering Into a Compact With the Hashemite Kingdom of Jordan

    Science.gov (United States)

    2010-11-01

    ... (``Compact'') will provide up to $275.1 million to reduce poverty and accelerate economic growth. The Compact... cost of construction. 1. Program Overview The Compact program consists of three tightly integrated... proposal for such assistance to achieve lasting economic growth and poverty reduction; and Recognizing that...

  5. Slides and the Foreign Language Teacher: A Bibliography.

    Science.gov (United States)

    Galt, Alan

    This bibliography lists 275 items relating to the use of visual and audiovisual aids in the foreign language classroom. The items are entered under the following major headings: (1) Audiovisual Aids; (2) Photography; (3) Picture Composition; (4) Slides and Photographs for Teaching; and (5) Slides and Slide Shows: Production and Presentation.…

  6. Elom et al., Afr., J. Infect. Dis.

    African Journals Online (AJOL)

    NNACHI

    Farming. 320. 88 (27.5%). Articians. 69. 18 (26%). Civil servant. 11. 2 (18.2%). TOTAL. 400. 108 (27%). Key: Pu = proteinuria; Hu = haematuria; Lu = leucocyturia. Intensity of Infection. Table 2 shows the relationship between proteinuria, haematuria and leucocyturia and ova excretion in urine of. S. haematobium infected ...

  7. Frequency and type of toenail tumors in the dromedary camel ...

    African Journals Online (AJOL)

    total of 275 dromedary camels (16 males and 259 females) of local “Arabiyat” breed suffering from different types and degrees of severity of toenail tumors were surgically treated. Histopathological examination of the tissue samples removed from 50 tumor-like growths (2 males and 48 females) revealed three types of ...

  8. Gender Differences in the Content of Preschool Children's Recollections: A Longitudinal Study

    Science.gov (United States)

    Tõugu, Pirko; Tulviste, Tiia; Suits, Kristi

    2014-01-01

    Personal recollections constitute autobiographical memory that develops intensively during the preschool years. The two-wave longitudinal study focuses on gender differences in preschool children's independent recollections. The same children (N = 275; 140 boys, 135 girls) were asked to talk about their previous birthday and the past weekend at…

  9. Someshwar Das

    Indian Academy of Sciences (India)

    Improvement is noticed in rainfall forecasts that used NCEP data, probably because of its high spatial and temporal resolution. Volume 116 Issue 4 August 2007 pp 275-304. Assimilation of Doppler weather radar observations in a mesoscale model for the prediction of rainfall associated with mesoscale convective systems.

  10. Trans-umbilical Laparoscopic Appendectomy for Acute Appendicitis ...

    African Journals Online (AJOL)

    We discuss a useful modification of trans-umbilical appendectomy for acute appendicitis using routine instruments. Materials and Methods: From August 2009 to March 2011, 164 patients were operated by this method at our rural center. Out of them, 102 were males and 62, females. Mean age for males was 27.5 years ...

  11. S¯adhan¯a Vol. 29, 2004 Author Index

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Author Index. 677. Shivakumara P. Document image mosaicing: A novel approach document images based on linear regression analysis. 329. Shukla M K see Agrawal A K. 275. Simundic B see Krešic G. 1. Singh B. Plane waves in a thermally conducting vis- cous liquid. 27. Reflection of plane waves at the free surface.

  12. A tutorial survey of topics in wireless networking: Part II

    Indian Academy of Sciences (India)

    Kumar A, Kumar V 2005 Optimal association of stations and APs in an IEEE 802.11 WLAN. Proc. of the Nat. Conf. on Comm. Kumar A, Patil D 1997 Stability and Throughput analysis of CDMA-ALOHA with Finite number of users and code sharing. Telecomm. Systems (a Baltzer Science Journal) 8: 257–275. Kumar A, Altman ...

  13. 76 FR 57727 - Notice of Competing Preliminary Permit Applications Accepted for Filing and Soliciting Comments...

    Science.gov (United States)

    2011-09-16

    ... redirect flow as it exits the tailrace; (5) a project storage yard; (6) a concrete intake structure; (7) a... 275-foot powerhouse located on the west bank of the river; (2) a 40-foot by 55-foot control building located on the west end of the dam; (3) a 320-foot-long transmission line extending south from a newly...

  14. Loblolly pine regeneration and competing vegetation 5 years after implementing uneven-aged silviculture

    Science.gov (United States)

    Michael G. Shelton; Paul A. Murphy

    1994-01-01

    Thc effects of three basal areas (9.2, 133, and 18.4 m2/ha), maximum diameters (30.5. 40.6, and 50.8 cm), and site indices (24.6, 24.7-27.4, and >27.5 m at 50 years) on establishment and development of loblolly pine (Pinus taeda L.) regeneration and competing vegetation were...

  15. Annals of Medical and Health Sciences Research - Vol 4, No 2 (2014)

    African Journals Online (AJOL)

    Reservoir Complete Denture in a Patient with Xerostomia Secondary to Radiotherapy for Oral Carcinoma: A Case Report and Review of Literature · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Ladda, VO Kasat, SA Gangadhar, S Baheti, AJ Bhandari, 271-275.

  16. Sex differences in the timing of identification among children and adults with autism spectrum disorders

    NARCIS (Netherlands)

    Begeer, S.; Mandell, S.; Wijnker-Holmes, B.; Venderbosch, S.; Rem, D.; Stekelenburg, F.; Koot, H.M.

    2013-01-01

    To examine differences by sex in the timing of identification of individuals with autism spectrum disorders (ASD), survey data were collected in the Netherlands from 2,275 males and females with autistic disorder, Asperger's syndrome and PDD-NOS. Among participants <18 years of age, females with

  17. Utilization Status of Electronic Information Sources (EIS) for HIV ...

    African Journals Online (AJOL)

    Tesfa

    HIV/AIDS Care and Treatment in Specialized Teaching Hospitals of. Ethiopia ... enhances cognitive skills for critical inquiry, and .... characteristics of respondents in selected Specialized Teaching Hospitals of. Ethiopia, 2016. Characteristics. Number. Percent (%) sex. Male. 230. 72.5. Female. 87. 27.5. Religion. Orthodox.

  18. 75 FR 29914 - Telecommunications Relay Services, Speech-to-Speech Services, E911 Requirements for IP-Enabled...

    Science.gov (United States)

    2010-05-28

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 64 [CG Docket No. 03-123; WC Docket No. 05-196; FCC 08-275] Telecommunications Relay Services, Speech-to-Speech Services, E911 Requirements for IP... with the Commission's Telecommunications Relay Services, [[Page 29915

  19. Evaluation Of Antmicrobial Properties, Acute Toxicity and ...

    African Journals Online (AJOL)

    Mr. Ihima

    Lorke, D. (1983). A new approach to practical acute toxicity testing. Archive of Toxicology. Vol.54: 275-287. 11. Chidume, F.C., Kwanashie, H.O.,. Adekeye, J.O., Wambebe,C., Odama,. L.E. and Gamanial, R.S. (2002). Evaluation of the methanolic extract of. Cassia tora leaves for immunodulatory and antimicrobial activities.

  20. Reptilia, Squamata, Amphisbaenia, Amphisbaena cuiabana (Strussmann and Carvalho, 2001: Range extension in the state of Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Silva, P. C.

    2010-01-01

    Full Text Available Amphisbaena cuiabana (Strüssmann and Carvalho, 2001 is reported from three localities in Mato Grosso,Brazil. These new records extend its known distribution on 275 km northwest, 230 km west, 67 km east of its type-locality.We redefine the diagnosis of the species based on these additional specimens.