WorldWideScience

Sample records for meitnerium 273

  1. 33 CFR 273.12 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 273.12 Section 273.12 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE AQUATIC PLANT CONTROL § 273.12 References. (a) Section 302, Pub. L. 89-298, (79 Stat. 1092), Rivers and Harbors...

  2. 40 CFR 273.13 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.13 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.13 Waste management. (a) Universal waste batteries. A small quantity handler of universal waste must manage...

  3. 40 CFR 273.33 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.33 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.33 Waste management. (a) Universal waste batteries. A large quantity handler of universal waste must manage...

  4. 40 CFR 273.52 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.52 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.52 Waste management. (a) A universal waste transporter must comply with all applicable U.S. Department of...

  5. 7 CFR 273.5 - Students.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Students. 273.5 Section 273.5 Agriculture Regulations... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.5 Students. (a... programs regardless of whether a high school diploma is required. (b) Student Exemptions. To be eligible...

  6. 25 CFR 273.12 - Eligible students.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Eligible students. 273.12 Section 273.12 Indians BUREAU... PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.12 Eligible students. Indian students, from age 3 years through grade(s) 12, except those who are enrolled in Bureau or...

  7. 7 CFR 273.1 - Household concept.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Household concept. 273.1 Section 273.1 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.1 Household concept... the application for or receipt of unemployment compensation), or is employed or self-employed and...

  8. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265.273 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by § 265.13...

  9. 39 CFR 273.10 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual report...

  10. 40 CFR 273.20 - Exports.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Exports. 273.20 Section 273.20... UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.20 Exports. A... exporter in 40 CFR 262.53, 262.56(a) (1) through (4), (6), and (b) and 262.57; (b) Export such universal...

  11. 40 CFR 273.56 - Exports.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Exports. 273.56 Section 273.56 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.56 Exports. A universal waste...

  12. 40 CFR 273.40 - Exports.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Exports. 273.40 Section 273.40... UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.40 Exports. A... exporter in 40 CFR 262.53, 262.56(a)(1) through (4), (6), and (b) and 262.57; (b) Export such universal...

  13. 43 CFR 27.3 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Discrimination prohibited. 27.3 Section 27... ISSUED UNDER TITLE II OF PUBLIC LAW 93-153 § 27.3 Discrimination prohibited. (a) General. No person shall... through contractual or other arrangements, subject an individual to discrimination on the grounds of race...

  14. 48 CFR 719.273-1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 719.273-1 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Protégé Program 719.273-1 Purpose. The USAID Mentor-Protégé Program is designed to assist small business...

  15. 48 CFR 719.273-2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Section 719.273-2 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Protégé Program 719.273-2 Definitions. Throughout, the term “small business” includes all categories...

  16. 38 CFR 3.273 - Rate computation.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Rate computation. 3.273... Which Became Effective January 1, 1979 § 3.273 Rate computation. The commencement date of change in benefit payments based on rate computations under the provisions of this section will be determined under...

  17. 40 CFR 273.9 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Definitions. 273.9 Section 273.9 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR... mitigating any pest, or intended for use as a plant regulator, defoliant, or desiccant, other than any...

  18. 40 CFR 273.36 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.36 Section 273.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A large quantity handler of universal waste must ensure that all employees are...

  19. 40 CFR 273.16 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.16 Section 273.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A small quantity handler of universal waste must inform all employees who handle or have...

  20. 36 CFR 27.3 - Seashore District.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Seashore District. 27.3 Section 27.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR CAPE...' studio, for appropriate small scale home occupations as the making and selling of traditional Cape Cod...

  1. 3q27.3 microdeletional syndrome

    DEFF Research Database (Denmark)

    Thevenon, Julien; Callier, Patrick; Poquet, Hélène

    2014-01-01

    patients with interstitial deletions at the 3q27.3q28 locus gathered through the Decipher database, and suggest this locus as a new microdeletional syndrome. RESULTS: The patients shared a recognisable facial dysmorphism and marfanoid habitus, associated with psychosis and mild to severe intellectual...... disability (ID). Most of the patients had no delay in gross psychomotor acquisition, but had severe impaired communicative and adaptive skills. Two small regions of overlap were defined. The first one, located on the 3q27.3 locus and common to all patients, was associated with psychotic troubles and mood...

  2. 40 CFR 273.70 - Imports.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Import Requirements § 273.70 Imports. Persons managing universal waste that is...) Persons managing universal waste that is imported from an OECD country as specified in 40 CFR 262.58(a)(1...

  3. 40 CFR 273.3 - Applicability-pesticides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-pesticides. 273.3... (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.3 Applicability—pesticides. (a) Pesticides covered under this part 273. The requirements of this part apply to persons managing pesticides, as...

  4. 48 CFR 719.273-6 - Application process.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application process. 719.273-6 Section 719.273-6 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...égé Program 719.273-6 Application process. Entities interested in becoming a Mentor firm must...

  5. 27 CFR 27.3 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ... Administrator. 27.3 Section 27.3 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... § 27.3 Delegations of the Administrator. The regulatory authorities of the Administrator contained in....27, Delegation of the Administrator's Authorities in 27 CFR Part 27, Importation of Distilled Spirits...

  6. 25 CFR 273.32 - Pro rata requirement.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Pro rata requirement. 273.32 Section 273.32 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.32 Pro rata...

  7. 25 CFR 273.53 - Applicable procurement regulations.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Applicable procurement regulations. 273.53 Section 273.53 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT General Contract Requirements § 273.53...

  8. 48 CFR 719.273-8 - Developmental assistance.

    Science.gov (United States)

    2010-10-01

    .... 719.273-8 Section 719.273-8 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development... relating to— (1) Financial management; (2) Organizational management; (3) Overall business management...

  9. 28 CFR 2.73 - Parole suitability criteria.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Parole suitability criteria. 2.73 Section 2.73 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF... prisoner's release is not incompatible with the welfare of society. (b) It is the policy of the Commission...

  10. 26 CFR 1.273-1 - Life or terminable interests.

    Science.gov (United States)

    2010-04-01

    ....273-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.273-1 Life or terminable interests. Amounts paid as income to the holder of a life or a terminable interest acquired by gift, bequest, or inheritance shall not...

  11. 33 CFR 273.17 - Annual budget request.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Annual budget request. 273.17... DEFENSE AQUATIC PLANT CONTROL § 273.17 Annual budget request. The Aquatic Plant Control Program is a... to utilize within the budget year taking into account the foreseeable availability of local funds to...

  12. 48 CFR 719.273-10 - Internal controls.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Internal controls. 719.273...égé Program 719.273-10 Internal controls. (a) OSDBU will oversee the Program and will work in... objectives. OSDBU will establish internal controls as checks and balances applicable to the Program. These...

  13. 48 CFR 852.273-70 - Late offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Late offers. 852.273-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-70 Late offers. As prescribed in 873.110(a), insert the following provision: Late Offers (JAN 2003) This provision replaces...

  14. 40 CFR 60.273a - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Emission monitoring. 60.273a Section 60.273a Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Steel Plants: Electric Arc...

  15. 25 CFR 273.4 - Policy of maximum Indian participation.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Policy of maximum Indian participation. 273.4 Section 273... Policy of maximum Indian participation. The meaningful participation in all aspects of educational... success. Such participation not only enhances program responsiveness to the needs of those served, but...

  16. 7 CFR 273.6 - Social security numbers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Social security numbers. 273.6 Section 273.6... normally uses the Receipt of Application for a Social Security Number, Form SSA-5028, as evidence that an... security numbers. (a) Requirements for participation. The State agency shall require that a household...

  17. 7 CFR 1150.273 - Application for certification.

    Science.gov (United States)

    2010-01-01

    ....273 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM... organization whose membership consists primarily of milk producers may apply for certification. Applicant...

  18. 27 CFR 25.273 - Action on application.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS BEER Pilot Brewing Plants § 25.273 Action on application. If the appropriate TTB officer approves the application for a pilot brewing plant, he or she will note approval on...

  19. 7 CFR 273.8 - Resource eligibility standards.

    Science.gov (United States)

    2010-01-01

    ...) Energy assistance payments or allowances excluded as income under § 273.9(c)(11). (15) Non-liquid asset(s... resource exclusion for an unlimited period of time. The resources of students and self-employment...

  20. A modified stratified model for the 3C 273 jet

    International Nuclear Information System (INIS)

    Liu Wenpo; Shen Zhiqiang

    2009-01-01

    We present a modified stratified jet model to interpret the observed spectral energy distributions of knots in the 3C 273 jet. Based on the hypothesis of the single index of the particle energy spectrum at injection and identical emission processes among all the knots, the observed difference of spectral shape among different 3C 273 knots can be understood as a manifestation of the deviation of the equivalent Doppler factor of stratified emission regions in an individual knot from a characteristic one. The summed spectral energy distributions of all ten knots in the 3C 273 jet can be well fitted by two components: a low-energy component (radio to optical) dominated by synchrotron radiation and a high-energy component (UV, X-ray and γ-ray) dominated by inverse Compton scattering of the cosmic microwave background. This gives a consistent spectral index of α = 0.88 (S v ∝ v -α ) and a characteristic Doppler factor of 7.4. Assuming the average of the summed spectrum as the characteristic spectrum of each knot in the 3C 273 jet, we further get a distribution of Doppler factors. We discuss the possible implications of these results for the physical properties in the 3C 273 jet. Future GeV observations with GLAST could separate the γ-ray emission of 3C 273 from the large scale jet and the small scale jet (i.e. the core) through measuring the GeV spectrum.

  1. 40 CFR 61.273 - Alternative means of emission limitation.

    Science.gov (United States)

    2010-07-01

    ... full-size or scale-model storage vessels that accurately collect and measure all benzene emissions from... for Benzene Emissions From Benzene Storage Vessels § 61.273 Alternative means of emission limitation... achieved by the requirements of § 61.271 (a), (b), or (c) will be evaluated using the following information...

  2. 40 CFR 98.273 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Pulp and Paper Manufacturing § 98.273 Calculating GHG emissions. (a) For each chemical recovery furnace located at a kraft or soda facility, you must determine... solids fired and the carbon content of the spent liquor solids, according to Equation AA-2 of this...

  3. 27 CFR 26.273b - Package gauge record.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Package gauge record. 26... § 26.273b Package gauge record. When required in this part with respect to Virgin Islands spirits, a package gauge record shall be prepared to show: (a) The date prepared; (b) The related transaction record...

  4. 48 CFR 852.273-71 - Alternative negotiation techniques.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative negotiation....273-71 Alternative negotiation techniques. As prescribed in 873.110(b), insert the following provision: Alternative Negotiation Techniques (JAN 2003) The contracting officer may elect to use the alternative...

  5. 7 CFR 273.2 - Office operations and application processing.

    Science.gov (United States)

    2010-01-01

    ... provide include, but are not limited to, a driver's license, a work or school ID, an ID for health benefits or for another assistance or social services program, a voter registration card, wage stubs, or a... State agency's request) in accordance with the provisions of § 273.2(f)(1)(viii). (xi) Students. If a...

  6. 49 CFR 40.273 - What is the effect of a cancelled alcohol test?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled alcohol test? 40.273 Section 40.273 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.273 What is the...

  7. 40 CFR 273.8 - Applicability-household and conditionally exempt small quantity generator waste.

    Science.gov (United States)

    2010-07-01

    ... conditionally exempt small quantity generator waste. 273.8 Section 273.8 Protection of Environment ENVIRONMENTAL....8 Applicability—household and conditionally exempt small quantity generator waste. (a) Persons... universal wastes defined at § 273.9; and/or (2) Conditionally exempt small quantity generator wastes that...

  8. 25 CFR 273.16 - Powers and duties of Indian Education Committee.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Powers and duties of Indian Education Committee. 273.16 Section 273.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.16...

  9. Prediction of Chronic Kidney Disease Stage 3 by CKD273, a Urinary Proteomic Biomarker

    DEFF Research Database (Denmark)

    Pontillo, Claudia; Zhang, Zhen-Yu; Schanstra, Joost P

    2017-01-01

    Introduction: CKD273 is a urinary biomarker, which in advanced chronic kidney disease predicts further deterioration. We investigated whether CKD273 can also predict a decline of estimated glomerular filtration rate (eGFR) to ... threshold (P = 0.086). Discussion: In conclusion, while accounting for baseline eGFR, albuminuria, and covariables, CKD273 adds to the prediction of stage 3 chronic kidney disease, at which point intervention remains an achievable therapeutic target....

  10. Structure of caesium disulfate at 120 and 273 K

    DEFF Research Database (Denmark)

    Ståhl, Kenny; Berg, Rolf W.; Eriksen, Kim Michael

    2009-01-01

    The crystal structures of Cs2S2O7 at 120 and 273 K have been determined from X-ray single-crystal data. Caesium disulfate represents a new structure type with a uniquely high number of independent formula units at 120 K: In one part caesium ions form a tube surrounding the disulfate ions, [Cs8(S2O7......)6+]n; in the other part a disulfate double-sheet sandwiches a zigzagging caesium ion chain, [Cs2(S2O7)6−]n. Caesium disulfate shows an isostructural order–disorder transition between 230 and 250 K, where two disulfate groups become partially disordered above 250 K. The Cs+-ion arrangement shows...

  11. 48 CFR 719.273-5 - Selection of Protégé firms.

    Science.gov (United States)

    2010-10-01

    ...© firms. 719.273-5 Section 719.273-5 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development... responsible for selecting Protégé firms. Mentors are encouraged to select from a broad base of small business...

  12. 40 CFR 27.3 - Basis for civil penalties and assessments.

    Science.gov (United States)

    2010-07-01

    ... assessments. 27.3 Section 27.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROGRAM FRAUD... actually made to an agent, fiscal intermediary, or other entity, including any State or political... such statement is actually made to an agent, fiscal intermediary, or other entity, including any State...

  13. 25 CFR 273.17 - Programs approved by Indian Education Committee.

    Science.gov (United States)

    2010-04-01

    ... pursuant to this part shall be changed from the time of its original approval by the Indian Education... 25 Indians 1 2010-04-01 2010-04-01 false Programs approved by Indian Education Committee. 273.17... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.17...

  14. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    the photon index in the case of simple power law model fitting. For power law + free absorption model fitting, the average photon index ( ) is 2.08. Key words. Galaxies: individual (3C273), quasar—X-rays: galaxies. 1. Introduction. Bright quasar 3C273 (z = 0.158) is one of the most extensively observed extragalac- tic objects ...

  15. 7 CFR 2.73 - Director, Office of Energy Policy and New Uses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Energy Policy and New Uses. 2.73... § 2.73 Director, Office of Energy Policy and New Uses. (a) Delegations. Pursuant to § 2.29(a)(11), the following delegations of authority are made by the Chief Economist to the Director, Office of Energy Policy...

  16. 25 CFR 273.38 - Equal quality and standard of education.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Equal quality and standard of education. 273.38 Section... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.38 Equal quality and standard of education. Contracts with State education agencies or school districts...

  17. Prediction of Chronic Kidney Disease Stage 3 by CKD273, a Urinary Proteomic Biomarker

    NARCIS (Netherlands)

    Pontillo, Claudia; Zhang, Zhen-Yu; Schanstra, Joost P; Jacobs, Lotte; Zürbig, Petra; Thijs, Lutgarde; Ramírez-Torres, Adela; Heerspink, Hiddo J L; Lindhardt, Morten; Klein, Ronald; Orchard, Trevor; Porta, Massimo; Bilous, Rudolf W; Charturvedi, Nishi; Rossing, Peter; Vlahou, Antonia; Schepers, Eva; Glorieux, Griet; Mullen, William; Delles, Christian; Verhamme, Peter; Vanholder, Raymond; Staessen, Jan A; Mischak, Harald; Jankowski, Joachim

    2017-01-01

    Introduction: CKD273 is a urinary biomarker, which in advanced chronic kidney disease predicts further deterioration. We investigated whether CKD273 can also predict a decline of estimated glomerular filtration rate (eGFR) to <60 ml/min per 1.73 m2. Methods: In analyses of 2087 individuals from 6

  18. Testing a double AGN hypothesis for Mrk 273

    Science.gov (United States)

    Iwasawa, K.; U, V.; Mazzarella, J. M.; Medling, A. M.; Sanders, D. B.; Evans, A. S.

    2018-04-01

    The ultra-luminous infrared galaxy (ULIRG) Mrk 273 contains two infrared nuclei, N and SW, separated by 1 arcsecond. A Chandra observation has identified the SW nucleus as an absorbed X-ray source with NH 4 × 1023 cm-2 but also hinted at the possible presence of a Compton-thick AGN in the N nucleus, where a black hole of 109 M⊙ is inferred from the ionized gas kinematics. The intrinsic X-ray spectral slope recently measured by NuSTAR is unusually hard (Γ 1.3) for a Seyfert nucleus, for which we seek an alternative explanation. We hypothesize a strongly absorbed X-ray source in N, of which X-ray emission rises steeply above 10 keV, in addition to the known X-ray source in SW, and test it against the NuSTAR data, assuming the standard spectral slope (Γ = 1.9). This double X-ray source model gives a good explanation of the hard continuum spectrum, deep Fe K absorption edge, and strong Fe K line observed in this ULIRG, without invoking the unusual spectral slope required for a single source interpretation. The putative X-ray source in N is found to be absorbed by NH = 1.4+0.7-0.4 × 1024 cm-2. The estimated 2-10 keV luminosity of the N source is 1.3 × 1043 erg s-1, about a factor of 2 larger than that of SW during the NuSTAR observation. Uncorrelated variability above and below 10 keV between the Suzaku and NuSTAR observations appears to support the double source interpretation. Variability in spectral hardness and Fe K line flux between the previous X-ray observations is also consistent with this picture.

  19. Prediction of Chronic Kidney Disease Stage 3 by CKD273, a Urinary Proteomic Biomarker

    Directory of Open Access Journals (Sweden)

    Claudia Pontillo

    2017-11-01

    Discussion: In conclusion, while accounting for baseline eGFR, albuminuria, and covariables, CKD273 adds to the prediction of stage 3 chronic kidney disease, at which point intervention remains an achievable therapeutic target.

  20. {alpha} decay of {sup 273}110: Shell closure at {ital N}=162

    Energy Technology Data Exchange (ETDEWEB)

    Lazarev, Y.A.; Lobanov, Y.V.; Oganessian, Y.T.; Utyonkov, V.K.; Abdullin, F.S.; Polyakov, A.N.; Rigol, J.; Shirokovsky, I.V.; Tsyganov, Y.S.; Iliev, S.; Subbotin, V.G.; Sukhov, A.M.; Buklanov, G.V.; Gikal, B.N.; Kutner, V.B.; Mezentsev, A.N.; Subotic, K. [Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation); Wild, J.F.; Lougheed, R.W.; Moody, K.J. [University of California, Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)

    1996-08-01

    In bombardments of {sup 244}Pu with {sup 34}S we discovered the {alpha}-decaying nuclide {sup 273}110. We conducted an extensive off-line search of the raw data for event sequences which fit the expected pattern of implantation in a position-sensitive detector and subsequent decay of {sup 273}110 and its descendants. We observed one three-member sequence of genetically linked {alpha} decays, resulting in {ital E}{sub {alpha}}=11.35 MeV, a half-life of 0.3{sub {minus}0.2}{sup +1.3} ms, and a production cross section of about 0.4 pb for {sup 273}110. Other possible {sup 273}110 event chains were also observed. The measured {alpha}-particle energy for the {ital N}=163 nuclide {sup 273}110 provides direct evidence for a neutron shell closure at {ital N}=162. {copyright} {ital 1996 The American Physical Society.}

  1. Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

    DEFF Research Database (Denmark)

    Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.

    2003-01-01

    INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...

  2. 39 CFR 273.3 - Liability for false claims and statements.

    Science.gov (United States)

    2010-07-01

    ... OF PROGRAM FRAUD CIVIL REMEDIES ACT § 273.3 Liability for false claims and statements. Section 3802... agent, fiscal intermediary, or other entity, including any State or political subdivision thereof... actually made to an agent, fiscal intermediary, or other entity, including any State or political...

  3. 20 CFR 404.273 - When are automatic cost-of-living increases effective?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When are automatic cost-of-living increases..., SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.273 When are automatic cost-of-living increases effective? We make automatic cost-of-living...

  4. 7 CFR 273.10 - Determining household eligibility and benefit levels.

    Science.gov (United States)

    2010-01-01

    ..., shelter, child support and medical costs as described in § 273.9. (1) Disallowed expenses. (i) Any expense...) or the Transitional Child Care (TCC) program shall not be deductible. A utility expense which is... household may elect to income average. Households shall be advised to report all changes in gross monthly...

  5. 25 CFR 273.37 - Use of funds outside of schools.

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.37 Use of funds outside of schools. Nothing in these regulations shall prevent the Commissioner from contracting...

  6. Re-Analysis of QPO in 3C 273 Light Curve P. Mohan1,∗ , A ...

    Indian Academy of Sciences (India)

    c Indian Academy of Sciences. Re-Analysis of QPO in 3C 273 Light Curve. P. Mohan1,∗. , A. Mangalam1, Hum Chand2 & Alok C. Gupta2. 1Indian Institute of Astrophysics, Sarjapur Road, Koramangala, Bangalore 560 034, India. 2Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital 263 129, India. ∗.

  7. Milli-arcsecond structure of 3C 84, 3C 273, and 3C 279 at 2 centimeter wavelength

    International Nuclear Information System (INIS)

    Niell, A.E.; Kellermann, K.I.; Clark, B.G.; Shaffer, D.B.

    1975-01-01

    Long baseline interferometer observations of 3C 84, 3C 273, and 3C 279 show structure on a scale of 1 milli-arcsec which is more complex than can be described by any simple one- or two-component models. Furthermore, for 3C 84 and 3C 273 the structure is not collinear

  8. An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273 (ApJ, 496, L9 [1998])

    Science.gov (United States)

    Xia, X.-Y.; Boller, Th.; Wu, H.; Deng, Z.-G.; Gao, Y.; Zou, Z.-L.; Mao, S.; Börner, G.

    1998-11-01

    In the Letter ``An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273'' by X.-Y. Xia, Th. Boller, H. Wu, Z.-G. Deng, Y. Gao, Z.-L. Zou, S. Mao, and G. Börner (ApJ, 496, L9 [1998]), an observational error occurred that invalidates some of our conclusions. Since Mrk 273x was essentially invisible (B~21) in our acqusition image, in order to position the slit on the faint Mrk 273x, a slit rotation had to be applied. Unfortunately, the amount of rotation was applied incorrectly. As a result, the spectrum obtained (shown in Fig. 2) was not for the intended target, Mrk 273x, but for an object very close to, but northeast of, Mrk 273. A new spectrum of Mrk 273x indicates that Mrk 273x is at redshift 0.458, not at 0.0378 as quoted in the Letter. The larger redshift implies that both the optical and X-ray luminosity have to be revised upward by a factor of ~170. Mrk 273x is therefore not a dwarf galaxy optically. The X-ray properties of Mrk 273x remain the same except that its soft X-ray luminosity now reaches ~1044 ergs s-1 for H0=50 km s-1 Mpc-1. The new observations will be presented in a subsequent paper (X.-Y. Xia et al., in preparation [1998]) in order to make corrections and shed further insights on the objects in the Mrk 273 field.

  9. Ten Years of Monitoring 3C 273 with XMM–Newton Liu Liu ...

    Indian Academy of Sciences (India)

    273 performed using XMM–Newton between 2000 and 2009. The short- time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum with a hard power-law component plus a soft Comptonization component.

  10. Ten Years of Monitoring 3C 273 with XMM–Newton Liu Liu ...

    Indian Academy of Sciences (India)

    Abstract. We present ten years optical/UV/X-ray observations of 3C. 273 performed using XMM–Newton between 2000 and 2009. The short- time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum with a ...

  11. Ten Years of Monitoring 3C 273 with XMM–Newton

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... We present ten years optical/UV/X-ray observations of 3C 273 performed using XMM–Newton between 2000 and 2009. The short-time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum ...

  12. 48 CFR 719.273 - The U.S. Agency for International Development (USAID) Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... International Development (USAID) Mentor-Protégé Program. 719.273 Section 719.273 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Protégé Program 719.273 The U.S. Agency for...

  13. Gammay rays from Penrose powered black holes in centaurus A, 3C 273, and NGC 4151

    International Nuclear Information System (INIS)

    Kafatos, M.; and Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center)

    1980-01-01

    Gamma-ray observations of active galaxies have important consequences for theories of the activity in their nuclei. The observations of Cen A, 3C 273, and NGC 4151 are examined under the assumption that Penrose collision processes in the ergospheres of massive black holes power their nuclei. The observed sharp break in the MeV region of the NGC 4151 spectrum cannot be due to the γ-γ pair production process. We attribute this break to the Penrose Compton scattering (PCS), in which γ-rays escape from the ergosphere as a result of Penrose processes involving electrons and lower energy X-ray photons in the ergosphere of the black hole. The absence of an MeV break in the spectra of Cen A and 3C 273 argues in favor of the Penrose pair production (PPP), in which high-energy pairs (a few GeV in energy) escape as result of Penrose processes involving protons and γ-rays that are present in any hot, optically thin, vertically extended accretion disk. An intrinsic break in the GeV region is predicted for both Cen A and 3C 273 as well as any other PPP powered nucleus.If PPP is important for QSOs and radio galaxies and some Seyferts, powerful radio objects should also be powerful γ-ray objects. Nuclei in which the black hole is spinning slowly would still emit visible light, UV, and X-rays as result of accretion without Penrose processes but would be weak in radio or high-energy γ-rays. Future γ-ray observations should provide clues as to whether this scenario is correct. Besides spectral information at γ-ray frequencies, possible variability at γ-ray frequencies should be searched for

  14. Trap pumping schemes for the Euclid CCD273 detector: characterisation of electrodes and defects

    Science.gov (United States)

    Skottfelt, J.; Hall, D. J.; Dryer, B.; Bush, N.; Campa, J.; Gow, J. P. D.; Holland, A. D.; Jordan, D.; Burt, D.

    2017-12-01

    The VISible imager instrument (VIS) on board the Euclid mission will deliver high resolution shape measurements of galaxies down to very faint limits (R ~ 25 at 10σ) in a large part of the sky, in order to infer the distribution of dark matter in the Universe. To help mitigate radiation damage effects that will accumulate in the detectors over the mission lifetime, the properties of the radiation induced traps needs to be known with as high precision as possible. For this purpose the trap pumping method will be employed as part of the in-orbit calibration routines. Using trap pumping it is possible to identify and characterise single traps in a Charge-Coupled Device (CCD), thus providing information such as the density, emission time constants and sub-pixel positions of the traps in the detectors. This paper presents the trap pumping algorithms used for the radiation testing campaign of the CCD273 detectors, performed by the Centre for Electronic Imaging (CEI) at the Open University, that will be used for the VIS instrument. The CCD273 is a four-phase device with uneven phase widths, which complicates the trap pumping analysis. However, we find that by optimising the trap pumping algorithms and analysis routines, it is possible to obtain sub-pixel and even sub-phase positional information about the traps. Further, by comparing trap pumping data with simulations, it is possible to gain more information about the effective electrode widths of the device.

  15. Thrap3 docks on phosphoserine 273 of PPARγ and controls diabetic gene programming.

    Science.gov (United States)

    Choi, Jang Hyun; Choi, Sun-Sil; Kim, Eun Sun; Jedrychowski, Mark P; Yang, Yong Ryoul; Jang, Hyun-Jun; Suh, Pann-Ghill; Banks, Alexander S; Gygi, Steven P; Spiegelman, Bruce M

    2014-11-01

    Phosphorylation of peroxisome proliferator-activated receptor γ (PPARγ) at Ser273 by cyclin-dependent kinase 5 (CDK5) in adipose tissue stimulates insulin resistance, but the underlying molecular mechanisms are unclear. We show here that Thrap3 (thyroid hormone receptor-associated protein 3) can directly interact with PPARγ when it is phosphorylated at Ser273, and this interaction controls the diabetic gene programming mediated by the phosphorylation of PPARγ. Knockdown of Thrap3 restores most of the genes dysregulated by CDK5 action on PPARγ in cultured adipocytes. Importantly, reduced expression of Thrap3 in fat tissue by antisense oligonucleotides (ASOs) regulates a specific set of genes, including the key adipokines adiponectin and adipsin, and effectively improves hyperglycemia and insulin resistance in high-fat-fed mice without affecting body weight. These data indicate that Thrap3 plays a crucial role in controlling diabetic gene programming and may provide opportunities for the development of new therapeutics for obesity and type 2 diabetes. © 2014 Choi et al.; Published by Cold Spring Harbor Laboratory Press.

  16. RADIOASTRON OBSERVATIONS OF THE QUASAR 3C273: A CHALLENGE TO THE BRIGHTNESS TEMPERATURE LIMIT

    Energy Technology Data Exchange (ETDEWEB)

    Kovalev, Y. Y.; Kardashev, N. S.; Voitsik, P. A.; Kovalev, Yu. A.; Lisakov, M. M.; Sokolovsky, K. V. [Astro Space Center of Lebedev Physical Institute, Profsoyuznaya 84/32, 117997 Moscow (Russian Federation); Kellermann, K. I. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903-2475 (United States); Lobanov, A. P.; Zensus, J. A.; Anderson, J. M.; Bach, U.; Kraus, A. [Max-Planck-Institute for Radio Astronomy, Auf dem Hügel 69, D-53121 (Germany); Johnson, M. D. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gurvits, L. I. [Joint Institute for VLBI ERIC, P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Jauncey, D. L. [CSIRO Astronomy and Space Sciences, Epping, NSW 1710 (Australia); Ghigo, F. [National Radio Astronomy Observatory, Rt. 28/92, Green Bank, WV 24944-0002 (United States); Ghosh, T.; Salter, C. J. [Arecibo Observatory, NAIC, HC3 Box 53995, Arecibo, Puerto Rico, PR 00612 (United States); Petrov, L. Yu. [Astrogeo Center, 7312 Sportsman Drive, Falls Church, VA 22043 (United States); Romney, J. D. [National Radio Astronomy Observatory, P.O. Box O, 1003 Lopezville Road, Socorro, NM 87801-0387 (United States)

    2016-03-20

    Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of 10{sup 11.5} K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of 10{sup 13} K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C 273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 μas (2.7 light months) and brightness temperature in excess of 10{sup 13} K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require a much higher Doppler factor than what is determined from jet apparent kinematics.

  17. The radio-ultraviolet spectral energy distribution of the jet in 3C 273

    Science.gov (United States)

    Jester, S.; Röser, H.-J.; Meisenheimer, K.; Perley, R.

    2005-02-01

    We present deep VLA and HST observations of the large-scale jet in 3C 273 matched to 0.3 arcsec resolution. The observed spectra show a significant flattening in the infrared-ultraviolet wavelength range. The jet's emission cannot therefore be assumed to arise from a single electron population and requires the presence of an additional emission component. The observed smooth variations of the spectral indices along the jet imply that the physical conditions vary correspondingly smoothly. We determine the maximum particle energy for the optical jet using synchrotron spectral fits. The slow decline of the maximum energy along the jet implies particle reacceleration acting along the entire jet. In addition to the already established global anti-correlation between maximum particle energy and surface brightness, we find a weak positive correlation between small-scale variations in maximum particle energy and surface brightness. The origin of these conflicting global and local correlations is unclear, but they provide tight constraints for reacceleration models. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc. under NASA contract No. NAS5-26555. These observations are associated with proposals #5980 and #7848. Also based on observations obtained at the NRAO's VLA. The National Radio Astronomy Observatory is a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

  18. No evidence for large-scale outflows in the extended ionized halo of ULIRG Mrk273

    Science.gov (United States)

    Spence, R. A. W.; Zaurín, J. Rodríguez; Tadhunter, C. N.; Rose, M.; Cabrera-Lavers, A.; Spoon, H.; Muñoz-Tuñón, C.

    2016-06-01

    We present deep new Gran Telescopio Canarias (GTC) narrow-band images and William Herschel Telescope (WHT) long-slit spectroscopy of the merging system Mrk273 that show a spectacular extended halo of warm ionized gas out to a radius of ˜45 kpc from the system nucleus. Outside of the immediate nuclear regions (r > 6 kpc), there is no evidence for kinematic disturbance in the ionized gas: in the extended regions covered by our spectroscopic slits the emission lines are relatively narrow (full width at half-maximum, FWHM ≲ 350 km s-1) and velocity shifts small (|ΔV| ≲ 250 km s-1). This is despite the presence of powerful near-nuclear outflows (FWHM > 1000 km s-1; |ΔV| > 400 km s-1; r < 6 kpc). Diagnostic ratio plots are fully consistent with Seyfert 2 photoionization to the NE of the nuclear region, however to the SW the plots are more consistent with low-velocity radiative shock models. The kinematics of the ionized gas, combined with the fact that the main structures are aligned with low-surface-brightness tidal continuum features, are consistent with the idea that the ionized halo represents tidal debris left over from a possible triple-merger event, rather than a reservoir of outflowing gas.

  19. The Global Jet Structure of the Archetypical Quasar 3C 273

    Directory of Open Access Journals (Sweden)

    Kazunori Akiyama

    2018-01-01

    Full Text Available A key question in the formation of the relativistic jets in active galactic nuclei (AGNs is the collimation process of their energetic plasma flow launched from the central supermassive black hole (SMBH. Recent observations of nearby low-luminosity radio galaxies exhibit a clear picture of parabolic collimation inside the Bondi accretion radius. On the other hand, little is known of the observational properties of jet collimation in more luminous quasars, where the accretion flow may be significantly different due to much higher accretion rates. In this paper, we present preliminary results of multi-frequency observations of the archetypal quasar 3C 273 with the Very Long Baseline Array (VLBA at 1.4, 15, and 43 GHz, and Multi-Element Radio Linked Interferometer Network (MERLIN at 1.6 GHz. The observations provide a detailed view of the transverse structure resolved on a broad range of spatial scales from sub-parsec to kilo parsecs, allowing us to profile the jet width as a function of the distance from the core for the first time in jets of bright quasars. We discovered a transition from a parabolic stream to a conical stream, which has been seen in much lower-luminosity radio galaxies. The similarity in the profile to the much lower-powered radio galaxy M87 suggests the universality of jet collimation among AGNs with different accretion rates.

  20. Prospective clinical evaluation of 273 modified acid-etched dental implants: 1- to 5- year results

    Directory of Open Access Journals (Sweden)

    Michele De Franco

    2012-03-01

    Full Text Available Aim: The aim of this study was to evaluate the implant survival and the implant-crown success of implants with surface treated with organic acids. Materials and methods: A total of 273 implants (Implus®, Leader-Novaxa, Milan, Italy were inserted in 63 patients, from June 2006 to June 2010, in a single clinical centre. In each annual follow up session, clinical, radiographic and prosthetic parameters were evaluated. The implant-crown success criteria included the absence of pain, suppuration and clinical mobility, a distance between the implant shoulder and the first visible bone contact (DIB <2.0 mm from the surgery and the absence of prosthetic complications at the implantabutment interface. Prosthetic restorations were 32 fixed partial prostheses, 48 single crowns and 16 fixed full arches. Results: The cumulative survival rate was 95.70% (93.81 maxilla, 98.24% mandible. Among the surviving implants, the implant-crown success was 96.07%. At the 5-year control, the mean DIB was 1.2 mm (± 0.5. Conclusion: Implants with surface treated with organic acids seem to represent a good solution for the prosthetic rehabilitation of partially and completely edentulous patients.

  1. Effect of Sleep-Disordered Breathing on Albuminuria in 273 Patients With Type 2 Diabetes.

    Science.gov (United States)

    Nishimura, Akihiro; Kasai, Takatoshi; Kikuno, Shota; Nagasawa, Kaoru; Okubo, Minoru; Narui, Koji; Mori, Yasumichi

    2018-03-15

    Sleep-disordered breathing (SDB) can induce hyperglycemia, hypertension, and oxidative stress, conditions that are known to cause kidney damage. Therefore, SDB may exacerbate albuminuria, which is an established marker of early-stage kidney damage in patients with type 2 diabetes mellitus (T2DM). The association between SDB and albuminuria in patients with T2DM was investigated in this study. This cross-sectional study included 273 patients with T2DM who underwent portable sleep testing and measurement of urine albumin to creatinine ratio (UACR). The association between the severity of SDB and albuminuria was investigated. Patients were divided into three groups according to the respiratory event index (REI): the no or mild group (REI < 15 events/h), moderate (REI 15 to < 30 events/h), and severe (REI ≥ 30 events/h). Albuminuria was defined as UACR ≥ 3.4 mg/mmol creatinine. Logistic regression analysis for albuminuria included the categorical REI as the independent variable. The median (interquartile range) REI of all patients (age 57.9 ± 11.9 years, mean ± standard deviation, male sex 81.7%, body mass index 26.7 [24.2-29.5] kg/m 2 , estimated glomerular filtration rate 82 [65-97] mL/min/1.73 m 2 ) was 13.0 (7.0-24.2) events/h. The REI, as a categorical variable, was significantly associated with albuminuria after adjustment for other risk factors for albuminuria; REI 15 to < 30 events/h: odds ratio (OR) 3.35, 95% confidence interval (95% CI), 1.68-6.67, P < .001; REI ≥ 30: OR 8.52, 95% CI, 3.52-20.63, P < .001). In addition, the natural logarithm-transformed REI of all patients also correlated significantly with albuminuria. The severity of SDB is associated with albuminuria in patients with T2DM. © 2018 American Academy of Sleep Medicine.

  2. Psychrobacter arcticus 273-4 uses resource efficiency and molecular motion adaptations for subzero temperature growth.

    Science.gov (United States)

    Bergholz, Peter W; Bakermans, Corien; Tiedje, James M

    2009-04-01

    Permafrost soils are extreme environments that exert low-temperature, desiccation, and starvation stress on bacteria over thousands to millions of years. To understand how Psychrobacter arcticus 273-4 survived for >20,000 years in permafrost, transcriptome analysis was performed during growth at 22 degrees C, 17 degrees C, 0 degrees C, and -6 degrees C using a mixed-effects analysis of variance model. Genes for transcription, translation, energy production, and most biosynthetic pathways were downregulated at low temperatures. Evidence of isozyme exchange was detected over temperature for D-alanyl-D-alanine carboxypeptidases (dac1 and dac2), DEAD-box RNA helicases (csdA and Psyc_0943), and energy-efficient substrate incorporation pathways for ammonium and acetate. Specific functions were compensated by upregulation of genes at low temperature, including genes for the biosynthesis of proline, tryptophan, and methionine. RNases and peptidases were generally upregulated at low temperatures. Changes in energy metabolism, amino acid metabolism, and RNase gene expression were consistent with induction of a resource efficiency response. In contrast to results observed for other psychrophiles and mesophiles, only clpB and hsp33 were upregulated at low temperature, and there was no upregulation of other chaperones and peptidyl-prolyl isomerases. relA, csdA, and dac2 knockout mutants grew more slowly at low temperature, but a dac1 mutant grew more slowly at 17 degrees C. The combined data suggest that the basal biological machinery, including translation, transcription, and energy metabolism, is well adapted to function across the growth range of P. arcticus from -6 degrees C to 22 degrees C, and temperature compensation by gene expression was employed to address specific challenges to low-temperature growth.

  3. PI-273, a Substrate-Competitive, Specific Small-Molecule Inhibitor of PI4KIIα, Inhibits the Growth of Breast Cancer Cells.

    Science.gov (United States)

    Li, Jiangmei; Gao, Zhen; Zhao, Dan; Zhang, Lunfeng; Qiao, Xinhua; Zhao, Yingying; Ding, Hong; Zhang, Panpan; Lu, Junyan; Liu, Jia; Jiang, Hualiang; Luo, Cheng; Chen, Chang

    2017-11-15

    While phosphatidylinositol 4-kinase (PI4KIIα) has been identified as a potential target for antitumor therapy, the clinical applications of PI4KIIα are limited by a lack of specific inhibitors. Here we report the first small-molecule inhibitor (SMI) of human PI4KIIα. Docking-based and ligand-based virtual screening strategies were first employed to identify promising hits, followed by two rounds of kinase activity inhibition validation. 2-(3-(4-Chlorobenzoyl)thioureido)-4-ethyl-5-methylthiophene-3-carboxamide (PI-273) exhibited the greatest inhibitory effect on PI4KIIα kinase activity (IC 50 = 0.47 μmol/L) and suppressed cell proliferation. Surface plasmon resonance and thermal shift assays indicated that PI-273 interacted directly with PI4KIIα. Kinetic analysis identified PI-273 as a reversible competitive inhibitor with respect to the substrate phosphatidylinositol (PI), which contrasted with most other PI kinase inhibitors that bind the ATP binding site. PI-273 reduced PI4P content, cell viability, and AKT signaling in wild-type MCF-7 cells, but not in PI4KIIα knockout MCF-7 cells, indicating that PI-273 is highly selective for PI4KIIα. Mutant analysis revealed a role of palmitoylation insertion in the selectivity of PI-273 for PI4KIIα. In addition, PI-273 treatment retarded cell proliferation by blocking cells in G 2 -M, inducing cell apoptosis and suppressing colony-forming ability. Importantly, PI-273 significantly inhibited MCF-7 cell-induced breast tumor growth without toxicity. PI-273 is the first substrate-competitive, subtype-specific inhibitor of PI4KIIα, the use of which will facilitate evaluations of PI4KIIα as a cancer therapeutic target. Cancer Res; 77(22); 6253-66. ©2017 AACR . ©2017 American Association for Cancer Research.

  4. First results from TN273 studies of the SE Mariana Forearc rift

    Science.gov (United States)

    Ribeiro, J. M.; Stern, R. J.; Kelley, K. A.; Shaw, A. M.; Shimizu, N.; Martinez, F.; Ishii, T.; Ishizuka, O.; Manton, W. I.

    2012-12-01

    TN 273 aboard R/V Thomas Thompson (Dec. 22 2011- Jan. 22 2012) studied an unusual region of rifting affecting the southern Mariana forearc S.W. of Guam. The S.E. Mariana Forearc Rift (SEMFR) formed by diffuse tectonic and volcanic deformation (Martinez and Sleeper, this meeting) ~2.7-3.7 Ma ago to accommodate opening of the southernmost Mariana Trough backarc basin. A total of 730 km linear-track of SEMFR seafloor was surveyed with deep-towed side-scan sonar IMI-30. 14 dredges provided samples of SEMFR igneous rocks, analyzed for whole rock (WR) and glass compositions. These new results coupled with results of earlier investigations confirm that SEMFR is dominated by Miocene lavas along with minor gabbro and diabase. SEMFR lavas range in major element composition from primitive basalt to fractionated andesite (Mg# = 0.36-0.73; SiO2 = 50-57 wt%), mainly controlled by crystal fractionation. Rare Earth Element (REE) patterns range from LREE-depleted, N-MORB-like to flat patterns, reflecting different mantle processes (i.e. different sources, degree of melting …). Glassy rinds and olivine-hosted melt inclusions in these lavas contain variable volatile compositions (F = 75-358 ppm, S = 35-1126 ppm, Cl= 74-1400 ppm, CO2 = 15-520 ppm, 0.36-2.36 wt% H2O). SEMFR lavas show spider diagrams with positive anomalies in LILE and negative anomalies in HSFE. SEMFR lavas have backarc basin-like (BAB-like) chemical composition (H2O < 2.5wt%, Ba/Yb~20, Nb/Yb~1 and ɛNd~9) along with stronger enrichment in Rb and Cs than arc and BAB lavas, as demonstrated by their higher Rb/Th and Cs/Ba ratios in WR and glasses, which may reflect the role of the ultra-shallow fluids. Ultra-shallow fluids are derived from the top of the subducting slab, beneath the forearc, where most of the water and the fluid-mobile elements (Rb, Cs, Ba,) are thought to be released (Schmidt and Poli, 1998, EPSL, Savov et al., 2005, G-3). Our results suggest that i) SEMFR lavas formed by metasomatism of a BAB mantle

  5. Lateral canal BPPV with Pseudo-Spontaneous Nystagmus masquerading as vestibular neuritis in acute vertigo: a series of 273 cases.

    Science.gov (United States)

    Asprella-Libonati, Giacinto

    2014-01-01

    To investigate the incidence of Lateral Semicircular Canal BPPV (LSC BPPV) with Pseudo-Spontaneous Nystagmus in patients preliminarily diagnosed for vestibular neuritis in the Emergency Department (ED). Retrospective study of 273 patients with acute vertigo and persistent horizontal nystagmus in upright position (male 110, female 163, 14-93 years old) observed over four years. All the patients were checked for any nystagmus modification by performing the Head Pitch Test (HPT) in the upright position. The HPT modified the beating direction of the persistent horizontal nystagmus in 56 of the 273 examined patients. The positioning tests subsequently confirmed the diagnosis of LSC BPPV in all those 56 patients. There were 37 geotropic variants and 19 apogeotropic variants and all of them were successfully treated by performing liberatory manoeuvres in the course of the same session. Performing the HPT in the upright position helps to differentiate a direction fixed nystagmus from a direction changing one, and in so doing, to make the differential diagnosis between vestibular neuritis and LSC BPPV, achieving the goal of successfully treating LSC BPPV in the first session.

  6. FERMI-LARGE AREA TELESCOPE OBSERVATIONS OF THE EXCEPTIONAL GAMMA-RAY OUTBURSTS OF 3C 273 IN 2009 SEPTEMBER

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We present the light curves and spectral data of two exceptionally luminous gamma-ray outbursts observed by the Large Area Telescope experiment on board the Fermi Gamma-ray Space Telescope from 3C 273 in 2009 September. During these flares, having a duration of a few days, the source reached its highest γ-ray flux ever measured. This allowed us to study, in some details, their spectral and temporal structures. The rise and the decay are asymmetric on timescales of 6 hr, and the spectral index was significantly harder during the flares than during the preceding 11 months. We also found that short, very intense flares put out the same time-integrated energy as long, less intense flares like that observed in 2009 August.

  7. Results of the independent verification of radiological remedial action at 273 East 1st South Street, Monticello, Utah (MS00092)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Smuin, M.W.

    1989-12-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1984 and 1985, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 273 East 1st South Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  8. Transesterification of waste cooking oil by an organic solvent-tolerant alkaline lipase from Streptomyces sp. CS273.

    Science.gov (United States)

    Mander, Poonam; Yoo, Hah-Young; Kim, Seung Wook; Choi, Yun Hee; Cho, Seung Sik; Yoo, Jin Cheol

    2014-02-01

    The aim of this present study was to produce a microbial enzyme that can potentially be utilized for the enzymatic transesterification of waste cooking oil. To that end, an extracellular lipase was isolated and purified from the culture broth of Streptomyces sp. CS273. The molecular mass of purified lipase was estimated to be 36.55 kDa by SDS PAGE. The optimum lipolytic activity was obtained at alkaline pH 8.0 to 8.5 and temperature 40 °C, while the enzyme was stable in the pH range 7.0 ∼ 9.0 and at temperature ≤40 °C. The lipase showed highest hydrolytic activity towards p-nitrophenyl myristate (C14). The lipase activity was enhanced by several salts and detergents including NaCl, MnSo₄, and deoxy cholic acid, while phenylmethylsulfonyl fluoride at concentration 10 mM inhibited the activity. The lipase showed tolerance towards different organic solvents including ethanol and methanol which are commonly used in transesterification reactions to displace alcohol from triglycerides (ester) contained in renewable resources to yield fatty acid alkyl esters known as biodiesel. Applicability of the lipase in transesterification of waste cooking oil was confirmed by gas chromatography mass spectrometry analysis.

  9. Psychrobacter arcticus 273-4 Uses Resource Efficiency and Molecular Motion Adaptations for Subzero Temperature Growth▿ †

    Science.gov (United States)

    Bergholz, Peter W.; Bakermans , Corien; Tiedje, James M.

    2009-01-01

    Permafrost soils are extreme environments that exert low-temperature, desiccation, and starvation stress on bacteria over thousands to millions of years. To understand how Psychrobacter arcticus 273-4 survived for >20,000 years in permafrost, transcriptome analysis was performed during growth at 22°C, 17°C, 0°C, and −6°C using a mixed-effects analysis of variance model. Genes for transcription, translation, energy production, and most biosynthetic pathways were downregulated at low temperatures. Evidence of isozyme exchange was detected over temperature for d-alanyl-d-alanine carboxypeptidases (dac1 and dac2), DEAD-box RNA helicases (csdA and Psyc_0943), and energy-efficient substrate incorporation pathways for ammonium and acetate. Specific functions were compensated by upregulation of genes at low temperature, including genes for the biosynthesis of proline, tryptophan, and methionine. RNases and peptidases were generally upregulated at low temperatures. Changes in energy metabolism, amino acid metabolism, and RNase gene expression were consistent with induction of a resource efficiency response. In contrast to results observed for other psychrophiles and mesophiles, only clpB and hsp33 were upregulated at low temperature, and there was no upregulation of other chaperones and peptidyl-prolyl isomerases. relA, csdA, and dac2 knockout mutants grew more slowly at low temperature, but a dac1 mutant grew more slowly at 17°C. The combined data suggest that the basal biological machinery, including translation, transcription, and energy metabolism, is well adapted to function across the growth range of P. arcticus from −6°C to 22°C, and temperature compensation by gene expression was employed to address specific challenges to low-temperature growth. PMID:19168616

  10. Recurrent Microdeletions at Xq27.3-Xq28 and Male Infertility: A Study in the Czech Population.

    Directory of Open Access Journals (Sweden)

    Blanka Chylíková

    Full Text Available Genetic causes of male infertility are hypothesized to involve multiple types of mutations, from single gene defects to complex chromosome rearrangements. Recently, several recurrent X-chromosome microdeletions (located in subtelomeric region of the long arm were reported to be associated with male infertility in Spanish and Italian males. The aim of our study was to test their prevalence and infertility association in population of men from the Czech Republic.107 males with pathological sperm evaluation resulting in nonobstructive infertility were compared to 131 males with normal fecundity. X-chromosome microdeletions were assessed by +/- PCR with three primer pairs for each region Xcnv64 (Xq27.3, Xcnv67 (Xq28 and Xcnv69 (Xq28. The latter microdeletion was further characterized by amplification across the deleted region, dividing the deletion into three types; A, B and C.We detected presence of isolated Xcnv64 deletion in 3 patients and 14 controls, and Xcnv69 in 3 patients and 6 controls (1 and 1 patient vs.4 and 1 control for types A and B respectively. There was one control with combined Xcnv64 and Xcnv69 type B deletions, and one patient with combination of Xcnv64 and Xcnv69 type C deletions. The frequency of the deletions was thus not higher in patient compared to control group, Xcnv64 was marginally associated with controls (adjusted Fisher´s exact test P = 0.043, Xcnv69 was not associated (P = 0.452. We excluded presence of more extensive rearrangements in two subjects with combined Xcnv64 and Xcnv69 deletions. There was no Xcnv67 deletion in our cohort.In conclusion, the two previously reported X-linked microdeletions (Xcnv64 and Xcnv69 do not seem to confer a significant risk to impaired spermatogenesis in the Czech population. The potential clinical role of the previously reported patient-specific Xcnv67 remains to be determined in a larger study population.

  11. Periodontitis and cancer mortality: Register-based cohort study of 68,273 adults in 10-year follow-up.

    Science.gov (United States)

    Heikkilä, Pia; But, Anna; Sorsa, Timo; Haukka, Jari

    2018-06-01

    Periodontitis, a multifactorial infection-induced low-grade chronic inflammation, can influence the process of carcinogenesis. We studied with 10 years follow-up of 68,273 adults-based cohort the involvement of periodontitis as a risk factor for cancer mortality. Periodontal status was defined based on procedure codes of periodontal treatment. Rate ratios and absolute differences of overall and cancer mortality rates were assessed with respect to periodontal status using multiplicative and additive Poisson regression models, respectively. We adjusted for effect of age, sex, calendar time, socio-economic status, oral health, dental treatments and diabetes. Data about smoking or alcohol consumption were not available. Altogether 797 cancer deaths occurred during 664,020 person-years accumulated over a mean 10.1-year follow-up. Crude cancer mortality rate per 10,000 person-years for participants without and with periodontitis was 11.36 (95% CI 10.47-12.31) and 14.45 (95% CI 12.51-16.61), respectively. Crude rate ratios for periodontitis indicated an increased risk of overall (RR 1.27, 95% CI 1.08-1.39) and pancreatic cancer (RR 1.69, 95% CI 1.04-2.76) mortality. After adjustment, the results showed even stronger associations of periodontitis with increased overall (RR 1.33, 95% CI 1.10-1.58) and pancreatic cancer (RR 2.32, 95% CI 1.31-3.98) mortality. A higher pancreatic cancer mortality among individuals with periodontitis contributed considerably to the difference in overall cancer mortality, but this difference was not due to pancreatic cancer deaths alone. © 2018 UICC.

  12. Amino acids at positions 273 and 394 in rabies virus nucleoprotein are important for both evasion of host RIG-I-mediated antiviral response and pathogenicity.

    Science.gov (United States)

    Masatani, Tatsunori; Ito, Naoto; Shimizu, Kenta; Ito, Yuki; Nakagawa, Keisuke; Abe, Masako; Yamaoka, Satoko; Sugiyama, Makoto

    2011-01-01

    We previously reported that nucleoprotein (N) is related to the different pathogenicities of the virulent rabies virus strain Nishigahara (Ni) and avirulent strain Ni-CE and also that Ni N, but not Ni-CE N, functions to evade retinoic acid-inducible gene I (RIG-I)-mediated innate immunity. There are three amino acid differences between Ni and Ni-CE N (at positions 273, 394 and 395), indicating that one of these mutations or a combination of mutations is important for the pathogenicity and evasion of innate immunity. We generated Ni-CE mutants in which the amino acids in Ni-CE N were replaced with those of Ni in all combinations. Among the mutants, CE(NiN273/394) with mutations at positions 273 and 394 evaded activation of RIG-I-mediated signaling most efficiently and also showed the highest pathogenicity. This correlation reinforces the relation between evasion of host RIG-I-mediated innate immunity and pathogenicity of rabies virus. Copyright © 2010 Elsevier B.V. All rights reserved.

  13. The rate coefficient for the reaction NO2 + NO3 yielding NO + NO2 + O2 from 273 to 313 K

    Science.gov (United States)

    Cantrell, Chris A.; Shetter, Richard E.; Mcdaniel, Anthony H.; Calvert, Jack G.

    1990-01-01

    The ratio of rate constants for the reaction NO3 + NO yielding 2 NO2 (k3) and the reaction NO2 + NO3 yielding NO + NO2 + O2 (k4) were determined by measuring of NO and NO2 concentrations of NO and NO2 in an N2O5/NO2/N2 mixture over the temperature range 273-313 K. The measured ratio was found to be expressed by the equation k3/k4 = 387 exp(-1375/T). The results are consistent with those of Hammer et al. (1986).

  14. Emergence of Klebsiella pneumoniae ST273 Carrying blaNDM-7and ST656 Carrying blaNDM-1in Manila, Philippines.

    Science.gov (United States)

    Chou, Andrew; Roa, Marylette; Evangelista, Michael A; Sulit, Arielle Kae; Lagamayo, Evelina; Torres, Brian C; Klinzing, David C; Daroy, Maria Luisa G; Navoa-Ng, Josephine; Sucgang, Richard; Zechiedrich, Lynn

    2016-10-01

    We sought to determine the epidemiology of carbapenem-resistant Enterobacteriaceae and to investigate the emergence of carbapenem-resistant Klebsiella pneumoniae in two teaching hospitals in Manila, Philippines. We screened 364 Enterobacteriaceae for carbapenem resistance between 2012 and 2013 and detected four carbapenem-resistant K. pneumoniae isolates from three different patients. We used whole genome sequencing to determine the antibiotic resistance profiles and confirmed the presence of carbapenemase genes by multiplex PCR. We used multilocus sequence typing and PCR-based replicon typing to genetically characterize the carbapenem-resistant isolates. The carbapenemase gene bla NDM was detected in K. pneumoniae isolates from two patients. The first patient had ventilator-associated pneumonia and lumbar shunt infection from K. pneumoniae ST273 carrying bla NDM-7 . The second patient had asymptomatic genitourinary colonization with K. pneumoniae ST656 carrying bla NDM-1 . The third patient had a gluteal abscess with K. pneumoniae ST1 that did not carry a carbapenemase gene, but did carry bla DHA-1 , bla OXA-1 , and bla SHV-1 . In this study, we report the first cases of bla NDM -carrying pathogens in the Philippines and add to the growing evidence of the worldwide spread of ST273 and NDM-7, a more efficient carbapenem hydrolyzer than NDM-1.

  15. The HARPS search for southern extra-solar planets. XLI. A dozen planets around the M dwarfs GJ 3138, GJ 3323, GJ 273, GJ 628, and GJ 3293

    Science.gov (United States)

    Astudillo-Defru, N.; Forveille, T.; Bonfils, X.; Ségransan, D.; Bouchy, F.; Delfosse, X.; Lovis, C.; Mayor, M.; Murgas, F.; Pepe, F.; Santos, N. C.; Udry, S.; Wünsche, A.

    2017-06-01

    Context. Low-mass stars are currently the best targets when searching for rocky planets in the habitable zone of their host star. Over the last 13 yr, precise radial velocities measured with the HARPS spectrograph have identified over a dozen super-Earths and Earth-mass planets (msini ≤ 10M⊕) around M dwarfs, with a well-understood selection function. This well-defined sample provides information on their frequency of occurrence and on the distribution of their orbital parameters, and therefore already constrains our understanding of planetary formation. The subset of these low-mass planets that were found within the habitable zone of their host star also provide prized targets for future searches of atmospheric biomarkers. Aims: We are working to extend this planetary sample to lower masses and longer periods through dense and long-term monitoring of the radial velocity of a small M dwarf sample. Methods: We obtained large numbers of HARPS spectra for the M dwarfs GJ 3138, GJ 3323, GJ 273, GJ 628, and GJ 3293, from which we derived radial velocities (RVs) and spectroscopic activity indicators. We searched for variabilities, periodicities, Keplerian modulations, and correlations, and attribute the radial-velocity variations to combinations of planetary companions and stellar activity. Results: We detect 12 planets, 9 of which are new with masses ranging from 1.17 to 10.5 M⊕. These planets have relatively short orbital periods (P< 40 d), except for two that have periods of 217.6 and 257.8 days. Among these systems, GJ 273 harbor two planets with masses close to the Earth's. With a distance of only 3.8 parsec, GJ 273 is the second nearest known planetary system - after Proxima Centauri - with a planet orbiting the circumstellar habitable zone. Based on observations made with the HARPS instrument on the ESO 3.6 m telescope under the program IDs 180.C-0886(A), 183.C-0437(A), and 191.C-0873(A) at Cerro La Silla (Chile).Radial velocity data (full Tables A.1-A.5

  16. Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 1997

    International Nuclear Information System (INIS)

    1999-01-01

    Los Alamos National Laboratory (the Laboratory) is subject to emissions reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73, (20 NMAC 2.73), Notice of Intent and Emissions Inventory Requirements. The Laboratory has the potential to emit 100 tons per year of suspended particulate matter (PM), nitrogen oxides (NO x ), carbon monoxide (CO), and volatile organic compounds (VOCs). For 1997, combustion products from the industrial sources contributed the greatest amount of regulated air emissions from the Laboratory. Research and development activities contributed the greatest amount of VOCs. Emissions of beryllium and aluminum were reported for activities permitted under 20 NMAC 2.72, Construction Permits

  17. IACHEC CROSS-CALIBRATION OF CHANDRA , NuSTAR , SWIFT , SUZAKU , XMM-NEWTON WITH 3C 273 ANDPKS 2155-304

    Energy Technology Data Exchange (ETDEWEB)

    Madsen, Kristin K.; Forster, Karl [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Beardmore, Andrew P.; Page, Kim L. [X-ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom); Guainazzi, Matteo [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, 3-1-1, Yoshinodai, Sagamihara, Kanagawa, 252-5201 (Japan); Marshall, Herman L.; Miller, Eric D. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Stuhlinger, Martin [European Space Astronomy Centre (ESAC), P.O. Box 78, E-28691 Villanueva de la Caada, Madrid (Spain)

    2017-01-01

    On behalf of the International Astronomical Consortium for High Energy Calibration, we present results from the cross-calibration campaigns in 2012 on 3C 273 and in 2013 on PKS 2155-304 between the then active X-ray observatories Chandra , NuSTAR , Suzaku , Swift, and XMM-Newton . We compare measured fluxes between instrument pairs in two energy bands, 1–5 keV and 3–7 keV, and calculate an average cross-normalization constant for each energy range. We review known cross-calibration features and provide a series of tables and figures to be used for evaluating cross-normalization constants obtained from other observations with the above mentioned observatories.

  18. Clinicopathological characteristics of non-diabetic renal disease in patients with type 2 diabetes mellitus in a northeastern Chinese medical center: a retrospective analysis of 273 cases.

    Science.gov (United States)

    Liu, Shujun; Guo, Qiaoyan; Han, Hongbo; Cui, Peihe; Liu, Xiao; Miao, Lining; Zou, Hongbin; Sun, Guangdong

    2016-10-01

    To investigate the clinical and histopathological features of non-diabetic renal disease (NDRD) superimposed on diabetic nephropathy (DN) in northeastern Chinese patients with type 2 diabetes mellitus (T2D), and compare the changes with those of pure DN and isolated NDRD. Single-center retrospective analysis based on medical records of 273 patients (172 men, mean age: 51.1 ± 12.4 years) with T2D who underwent renal biopsy between February 2000 and October 2015. All patients were diagnosed as cases of pure DN, isolated NDRD or NDRD superimposed on DN. Out of the 273 T2D patients, 68 (24.9 %) had DN, 175 (64.1 %) had NDRD, and 30 (11.0 %) had NDRD superimposed on DN. Idiopathic membranous nephropathy (IMN, 29.7 %) was the most common NDRD followed by IgA nephropathy (IgAN, 22.9 %), and hypertensive renal arteriolar sclerosis was the most common lesion in patients diagnosed as NDRD superimposed on DN. Patients with NDRD had a shorter duration of diabetes and lower frequencies of diabetic retinopathy (DR, 6.9 %) and renal failure (28.0 %), which is consistent with higher estimated glomerular filtration rates (eGFR) and lower systolic blood pressure (SBP). No significant between-group differences were observed with respect to proteinuria and hematuria. Renal biopsy is strongly recommended for T2D patients to distinguish DN, NDRD and NDRD superimposed on DN, especially in patients with no signs of DR. This approach may help in early diagnosis and treatment of NDRD and improve renal outcomes in northeastern Chinese T2D patients.

  19. Mutation analyses in 17 patients with deficiency in acid beta-galactosidase: three novel point mutations and high correlation of mutation W273L with Morquio disease type B.

    Science.gov (United States)

    Paschke, E; Milos, I; Kreimer-Erlacher, H; Hoefler, G; Beck, M; Hoeltzenbein, M; Kleijer, W; Levade, T; Michelakakis, H; Radeva, B

    2001-08-01

    An inherited deficiency in beta-galactosidase can result in GM1 gangliosidosis, with several phenotypes of generalized or chronic psychomotor deterioration, as well as in Morquio disease type B, a characteristic mucopolysaccharidosis free of neurological symptoms. We performed mutation analyses in 17 juvenile and adult patients from various European regions with a deficiency in beta-galactosidase and skeletal abnormalities. Fifteen of these had the Morquio B phenotype and have remained neurologically healthy until now while the two others exhibited psychomotor retardation of juvenile onset. A two-base substitution (851-852TG-->CT; W273L) was present in 14 of the 15 Morquio B cases. Even if one excludes alleles from patients with possible common descent, there was a much higher frequency (79%) among those with Morquio B phenotype for the W273L mutation than previously reported in the literature (37%). That the Morquio phenotype is also expressed in heterozygotes for W273L and alleles typically found in GM1 gangliosidosis makes it possible to predict the phenotype and reliably detect heterozygotes. A single French patient had a novel missense point mutation (Q408P) together with a known mutation (T500A) while the mentally retarded patients were both heterozygous for two mutations known in chronic GM1 gangliosidosis together with two novel missense point mutations (Y270D and H281Y) in the vicinity of W273L. Our results confirm the high impact of Trp 273 for the function of beta-galactosidase and the expression of the Morquio B phenotype. In addition, a second domain around the amino acids 400-500 may also be of significance.

  20. Integrated profiling of microRNAs and mRNAs: microRNAs located on Xq27.3 associate with clear cell renal cell carcinoma.

    Directory of Open Access Journals (Sweden)

    Liang Zhou

    2010-12-01

    Full Text Available With the advent of second-generation sequencing, the expression of gene transcripts can be digitally measured with high accuracy. The purpose of this study was to systematically profile the expression of both mRNA and miRNA genes in clear cell renal cell carcinoma (ccRCC using massively parallel sequencing technology.The expression of mRNAs and miRNAs were analyzed in tumor tissues and matched normal adjacent tissues obtained from 10 ccRCC patients without distant metastases. In a prevalence screen, some of the most interesting results were validated in a large cohort of ccRCC patients.A total of 404 miRNAs and 9,799 mRNAs were detected to be differentially expressed in the 10 ccRCC patients. We also identified 56 novel miRNA candidates in at least two samples. In addition to confirming that canonical cancer genes and miRNAs (including VEGFA, DUSP9 and ERBB4; miR-210, miR-184 and miR-206 play pivotal roles in ccRCC development, promising novel candidates (such as PNCK and miR-122 without previous annotation in ccRCC carcinogenesis were also discovered in this study. Pathways controlling cell fates (e.g., cell cycle and apoptosis pathways and cell communication (e.g., focal adhesion and ECM-receptor interaction were found to be significantly more likely to be disrupted in ccRCC. Additionally, the results of the prevalence screen revealed that the expression of a miRNA gene cluster located on Xq27.3 was consistently downregulated in at least 76.7% of ∼50 ccRCC patients.Our study provided a two-dimensional map of the mRNA and miRNA expression profiles of ccRCC using deep sequencing technology. Our results indicate that the phenotypic status of ccRCC is characterized by a loss of normal renal function, downregulation of metabolic genes, and upregulation of many signal transduction genes in key pathways. Furthermore, it can be concluded that downregulation of miRNA genes clustered on Xq27.3 is associated with ccRCC.

  1. Gastric Medullary Carcinoma with Sporadic Mismatch Repair Deficiency and a TP53 R273C Mutation: An Unusual Case with Wild-Type BRAF

    Directory of Open Access Journals (Sweden)

    Brett M. Lowenthal

    2017-01-01

    Full Text Available Medullary carcinoma has long been recognized as a subtype of colorectal cancer associated with microsatellite instability and Lynch syndrome. Gastric medullary carcinoma is a very rare neoplasm. We report a 67-year-old male who presented with a solitary gastric mass. Total gastrectomy revealed a well-demarcated, poorly differentiated carcinoma with an organoid growth pattern, pushing borders, and abundant peritumoral lymphocytic response. The prior cytology was cellular with immunohistochemical panel consistent with upper gastrointestinal/pancreaticobiliary origin. Overall, the histopathologic findings were consistent with gastric medullary carcinoma. A mismatch repair panel revealed a mismatch repair protein deficient tumor with loss of MLH1 and PMS2 expression. BRAF V600E immunostain (VE1 and BRAF molecular testing were negative, indicating a wild-type gene. Tumor sequencing of MLH1 demonstrated a wild-type gene, while our molecular panel identified TP53 c.817C>T (p.R273C mutation. These findings were compatible with a sporadic tumor. Given that morphologically identical medullary tumors often occur in Lynch syndrome, it is possible that mismatch repair loss is an early event in sporadic tumors with p53 mutation being a late event. Despite having wild-type BRAF, this tumor is sporadic and unrelated to Lynch syndrome. This case report demonstrates that coordinate ancillary studies are needed to resolve sporadic versus hereditary rare tumors.

  2. New Chandra observations of the jet in 3C273. 1. Softer X-ray than radio spectra and the X-ray emission mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Jester, Sebastian; /Fermilab; Harris, D.E.; /Smithsonian Astrophys. Observ.; Marshall, H.L.; /MIT, MKI; Meisenheimer, K.; /Heidelberg, Max Planck Inst. Astron.

    2006-05-01

    The jet in 3C273 is a high-power quasar jet with radio, optical and X-ray emission whose size and brightness allow a detailed study of the emission processes acting in it. We present deep Chandra observations of this jet and analyze the spectral properties of the jet emission from radio through X-rays. We find that the X-ray spectra are significantly softer than the radio spectra in all regions of the bright part of the jet except for the first bright ''knot A'', ruling out a model in which the X-ray emission from the entire jet arises from beamed inverse-Compton scattering of cosmic microwave background photons in a single-zone jet flow. Within two-zone jet models, we find that a synchrotron origin for the jet's X-rays requires fewer additional assumptions than an inverse-Compton model, especially if velocity shear leads to efficient particle acceleration in jet flows.

  3. Solubility measurement and modelling of 1,8-dinitronaphthalene in nine organic solvents from T = (273.15 to 308.15) K and mixing properties of solutions

    International Nuclear Information System (INIS)

    Zhou, Guoquan; Du, Cunbin; Han, Shuo; Meng, Long; Wang, Jian; Li, Rongrong; Zhao, Hongkun

    2015-01-01

    Highlights: • Solubility of 1,8-dinitronaphthalene in nine organic solvents were determined. • The solubility were correlated with Apelblat equation, Wilson and NRTL model. • The mixing properties of solution were calculated based on the Wilson model. - Abstract: The solubility of 1,8-dinitronaphthalene in acetonitrile, methanol, ethanol, trichloromethane, isopropanol, acetone, toluene, ethyl acetate and butyl alcohol were obtained experimentally at temperatures ranging from (273.15 to 308.15) K under 0.1 MPa by using a gravimetric method. The solubility of 1,8-dinitronaphthalene in those solvents increases with an increase in temperature. The solubility values decrease according to the following order: acetone > (acetonitrile, ethyl acetate) > trichloromethane > toluene > methanol > ethanol > isopropanol > butyl alcohol. Three models, the modified Apelblat equation, Wilson and NRTL were used to correlate the solubility of 1,8-dinitronaphthalene in the solvents studied. The calculated solubility by the modified Apelblat equation provides better agreement than those evaluated by the other two models. The regressed results via the three models are all acceptable for the solubility of 1,8-dinitronaphthalene in the selected solvents. Furthermore, the mixing Gibbs energy, mixing enthalpy, and mixing entropy for per 1 mol of mixture of 1,8-dinitronaphthalene and solvents were calculated based on the Wilson model. The dissolution process of 1,8-dinitronaphthalene in the selected solvents is spontaneous and exothermic

  4. Thermodynamic study of solubility for 2-amino-4-chloro-6-methoxypyrimidine in twelve organic solvents at temperatures from 273.15 K to 323.15 K

    International Nuclear Information System (INIS)

    Yao, Ganbing; Xia, Zhanxiang; Li, Zhihui

    2017-01-01

    Highlights: • 2-Amino-4-chloro-6-methoxypyrimidine solubility in twelve solvents were determined. • The solubility were correlated with four models. • The mixing properties were derived. - Abstract: The solubility of 2-amino-4-chloro-6-methoxypyrimidine in methanol, ethanol, chloroform, toluene, ethyl acetate, acetonitrile, n-propanol, acetone, N,N-dimethylformamide, isopropanol, 1,4-dioxane and ethyl benzene was obtained experimentally using the high-performance liquid chromatography analysis at temperatures ranging from (273.15 to 323.15) K under atmospheric pressure. The solubility of 2-amino-4-chloro-6-methoxypyrimidine in a fixed solvent increased with an increase in temperature. At a certain temperature, the mole fraction solubility in different solvents decreased according to the following order: N,N-dimethylformamide > dioxane > acetone > ethyl acetate > chloroform > (acetonitrile, n-propanol) > (ethanol, isopropanol) > methanol > toluene > ethyl benzene. Four models, modified Apelblat equation, λh equation, Wilson model and NRTL model were applied to correlate of the experimental solubility results. The largest values of relative average deviation and root-mean-square deviation acquired by the four models are 1.21% and 10.71 × 10 −4 , respectively. The modified Apelblat model is regarded as the best one for describing the experimental values. Furthermore, the mixing Gibbs energy, mixing enthalpy, and mixing entropy, activity coefficient and reduced excess enthalpy at infinitesimal concentration were obtained based on the mole fraction solubility. The mixing process of 2-amino-4-chloro-6-methoxypyrimidine in the selected solvents is discussed.

  5. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Peleties, F. [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain); Trusler, J.P.M., E-mail: m.trusler@imperial.ac.u [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Vega-Maza, D. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain)

    2010-05-15

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  6. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    International Nuclear Information System (INIS)

    Peleties, F.; Segovia, J.J.; Trusler, J.P.M.; Vega-Maza, D.

    2010-01-01

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  7. The X-ray emission mechanism of large scale powerful quasar jets: Fermi rules out IC/CMB for 3C 273.

    Directory of Open Access Journals (Sweden)

    Georganopoulos Markos

    2013-12-01

    Full Text Available The process responsible for the Chandra-detected X-ray emission from the large-scale jets of powerful quasars is not clear yet. The two main models are inverse Compton scattering off the cosmic microwave background photons (IC/CMB and synchrotron emission from a population of electrons separate from those producing the radio-IR emission. These two models imply radically different conditions in the large scale jet in terms of jet speed, kinetic power, and maximum energy of the particle acceleration mechanism, with important implications for the impact of the jet on the larger-scale environment. Georganopoulos et al. (2006 proposed a diagnostic based on a fundamental difference between these two models: the production of synchrotron X-rays requires multi-TeV electrons, while the EC/CMB model requires a cutoff in the electron energy distribution below TeV energies. This has significant implications for the γ-ray emission predicted by these two models. Here we present new Fermi observations that put an upper limit on the gamma-ray flux from the large-scale jet of 3C 273 that clearly violates the flux expected from the IC/CMB X-ray interpretation found by extrapolation of the UV to X-ray spectrum of knot A, thus ruling out the IC/CMB interpretation entirely for this source. Further, the upper limit from Fermi puts a limit on the Doppler beaming factor of at least δ <9, assuming equipartition fields, and possibly as low as δ <5 assuming no major deceleration of the jet from knots A through D1.

  8. Mitochondrial protection by the mixed muscarinic/σ1 ligand ANAVEX2-73, a tetrahydrofuran derivative, in Aβ25-35 peptide-injected mice, a nontransgenic Alzheimer's disease model

    Directory of Open Access Journals (Sweden)

    Valentine eLahmy

    2015-01-01

    Full Text Available Alzheimer’s disease (AD, the most prevalent dementia in the elderly, is characterized by progressive synaptic and neuronal loss. Mitochondrial dysfunctions have been consistently reported as an early event in AD and appear before Aβ deposition and memory decline. In order to define a new neuroprotectant strategy in AD targeting mitochondrial alterations, we develop tetrahydro-N,N-dimethyl-2,2-diphenyl-3-furanmethanamine (ANAVEX2-73, AE37, a mixed muscarinic receptor ligand and a sigma-1 receptor (σ1R agonist. We previously reported that ANAVEX2-73 shows anti-amnesic and neuroprotective activities in mice injected ICV with oligomeric amyloid-β25-35 peptide (Aβ25-35. The σ1R is present at mitochondria-associated endoplasmic reticulum membranes, where it acts as a sensor/modulator of endoplasmic reticulum (ER stress responses and local Ca2+ exchanges with the mitochondria. We therefore evaluated the effect of ANAVEX2-73 and PRE-084, a reference σ1R agonist, on preservation of mitochondrial integrity in Aβ25-35-injected mice. In isolated mitochondria from hippocampus preparations of Aβ25-35 injected animals, we measured respiration rates, complex activities, lipid peroxidation, Bax/Bcl-2 ratios and cytochrome c release into the cytosol. Five days after Aβ25-35 injection, mitochondrial respiration in mouse hippocampus was altered. ANAVEX2-73 (0.01-1 mg/kg IP restored normal respiration and PRE-084 (0.5-1 mg/kg IP increased respiration rates. Both compounds prevented Aβ25-35-induced increases in lipid peroxidation levels, Bax/Bcl-2 ratio and cytochrome c release into the cytosol, all indicators of increased toxicity. ANAVEX2-73 and PRE-084 efficiently prevented the mitochondrial respiratory dysfunction and resulting oxidative stress and apoptosis. The σ1R, targeted selectively or non-selectively, therefore appears as a valuable target for protection against mitochondrial damages in AD.

  9. Novel beta-galactosidase gene mutation p.W273R in a woman with mucopolysaccharidosis type IVB (Morquio B) and lack of response to in vitro chaperone treatment of her skin fibroblasts.

    Science.gov (United States)

    Gucev, Zoran S; Tasic, Velibor; Jancevska, Aleksandra; Zafirovski, Georgi; Kremensky, Ivo; Sinigerska, Ivanka; Nanba, Eiji; Higaki, Katsumi; Gucev, Filip; Suzuki, Yoshiyuki

    2008-07-01

    The patient is a 24-year-old woman who first came for consultation at age 10 years. Based on clinical phenotype and thin-layer chromatography of urinary oligosaccharides, peripheral leukocytes were sent for beta-galactosidase assay. This testing showed a deficiency in enzyme activity, and gene mutation analysis identified a previously reported mutation p.H281Y (875C > T) and a novel mutation p.W273R (817T > C). Unlike previously reported patients, mutant enzymes in this patient's cultured skin fibroblasts did not respond to treatment with a chaperone compound, N-octyl-4-epi-beta-valienamine. (c) 2008 Wiley-Liss, Inc.

  10. Solution of the Skyrme-Hartree-Fock-Bogolyubovequations in the Cartesian deformed harmonic-oscillator basis. (VIII) HFODD (v2.73y): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; Satuła, W.; Bączyk, P.; Dudek, J.; Gao, Y.; Konieczka, M.; Sato, K.; Shi, Y.; Wang, X. B.; Werner, T. R.

    2017-07-01

    We describe the new version (v2.73y) of the code HFODD which solves the nuclear Skyrme Hartree-Fock or Skyrme Hartree-Fock-Bogolyubov problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following new features: (i) full proton-neutron mixing in the particle-hole channel for Skyrme functionals, (ii) the Gogny force in both particle-hole and particle-particle channels, (iii) linear multi-constraint method at finite temperature, (iv) fission toolkit including the constraint on the number of particles in the neck between two fragments, calculation of the interaction energy between fragments, and calculation of the nuclear and Coulomb energy of each fragment, (v) the new version 200d of the code HFBTHO, together with an enhanced interface between HFBTHO and HFODD, (vi) parallel capabilities, significantly extended by adding several restart options for large-scale jobs, (vii) the Lipkin translational energy correction method with pairing, (viii) higher-order Lipkin particle-number corrections, (ix) interface to a program plotting single-particle energies or Routhians, (x) strong-force isospin-symmetry-breaking terms, and (xi) the Augmented Lagrangian Method for calculations with 3D constraints on angular momentum and isospin. Finally, an important bug related to the calculation of the entropy at finite temperature and several other little significant errors of the previous published version were corrected.

  11. 33 CFR 273.13 - Program policy.

    Science.gov (United States)

    2010-07-01

    ... should constitute investigation of a specific problem weed or weed complex, not generalized surveys of... “obnoxious aquatic plants” under the language of the legislation authorizing the program except as indicated... Control Program, except as such areas may be used for experimental purposes in research performed for the...

  12. Publications | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reality check: Will cellphones really solve Africa's problems? In less than a generation, information and communication technologies (ICTs) have revolutionized the planet. Innovations like personal computers, the Internet, electronic mail, personal digital assistants (PDAs), and mobile.

  13. 33 CFR 273.14 - Planning procedures.

    Science.gov (United States)

    2010-07-01

    ... control project programs which involve pest control operations, such as aquatic plant control, and affect either man's health or his environment (soil, flora, fauna, aesthetics, water resources), are candidates...

  14. 7 CFR 273.15 - Fair hearings.

    Science.gov (United States)

    2010-01-01

    ... clear expression, oral or written, by the household or its representative to the effect that it wishes... request the household to clarify its grievance. The freedom to make a request for a hearing shall not be... accept an oral expression from the household or its representative to withdraw a fair hearing may discuss...

  15. 33 CFR 273.16 - Operations.

    Science.gov (United States)

    2010-07-01

    ... accordance with approved annual work plans and State design memoranda. Questions should be referred to HQDA...(b) and (c)), regarding the training and certification of pesticide supervisors and/or applicators... Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE AQUATIC...

  16. 25 CFR 273.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    .... (e) “Economic enterprise” means any commercial, industrial, agricultural, or business activity that... a contractor for the education of eligible Indian students under this part. (g) “Indian tribe” means... Indians chartered under State or Federal law and which is not included within the definition of “tribal...

  17. 273 LEKSIKOGRAFIE EN LINGUISTIEK Piet Swanepoel UNISA ...

    African Journals Online (AJOL)

    daar die neiging bestaan om die leksikografie eenvoudig te reduseer tot die toegepaste been van die .... vakgebied, wat dit uitsluit dat enige toegepaste taaldissipJine eenvoudig tot die praktiese komponent van die ..... examples of each phenomenon that they study, remaining oblivious to how large or small a set of lexical ...

  18. Publications | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  19. Publications | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Five years after retooling its first recycled computers and finding them a good home, Computers for Schools Kenya (CFSK) has won a coveted Africa-wide prize for its work. CFSK won the 2007 African ICT Achievers Award in the category of... Partnering for accountability. It sounds simple. Setting accountability principles for ...

  20. BDML Metadata: 273 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available wt_N2_030116_02.zip http://ssbd.qbic.riken.jp/data/bdml/Ce_KK_P002/wt_N2_030116_02.bdml0.18.xml... http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/searc

  1. 12 CFR 27.3 - Recordkeeping requirements.

    Science.gov (United States)

    2010-01-01

    ... information only if the applicant has been advised that such information need not be provided and nevertheless... information but is encouraged to do so. The law provides that a lender may neither discriminate on the basis... this title; and (ii) A bank shall record all information required by this paragraph and part 203 of...

  2. 273-IJBCS-Article-M Gbeassor

    African Journals Online (AJOL)

    Dr Gatsing

    . Gadano A, Gurni A, Carballo M. 2006. Argentine folk medicine; genotoxic effects of Chenopodiaceae family. J. Ethnopharmacol., 103: 246-251. Gisby J, Bryant J. 2002. Efficacy of a new cream formulation of mupirocin: comparison with oral ...

  3. 7 CFR 273.7 - Work provisions.

    Science.gov (United States)

    2010-01-01

    ... participant can arrange other dependent care or can show that such refusal will not prevent or interfere with... responsible for verifying the exemption. (iv) A parent or other household member responsible for the care of a... certification period, the State agency must work register the individual responsible for the care of the child...

  4. 40 CFR 52.273 - Open burning.

    Science.gov (United States)

    2010-07-01

    ... Article V, and paragraph (f) of Article VI, submitted on November 10, 1976. (11) Merced County APCD. (i... 410(c)(2), submitted on May 7, 1979. (10) Merced County APCD. (i) Rule 416.1(I)(A)(2), submitted on...

  5. Suicide Prevention: 1-800-273-8255

    Science.gov (United States)

    ... the Media Room Public Affairs News Releases Speeches Videos Publications National Observances Veterans Day Memorial Day Celebrating America's Freedoms Special Events Adaptive Sports Program Creative Arts Festival Golden Age Games Summer Sports Clinic Training - Exposure - Experience (TEE) Tournament ...

  6. DESCRIPCIÓN DE COMPONENTES QUÍMICOS Y COEFICIENTES ALOMÉTRICOS EN CERDOS CASTRADOS HASTA LOS 273 DÍAS EN EL TRÓPICO ALTO COLOMBIANO

    Directory of Open Access Journals (Sweden)

    GA Casas

    2007-01-01

    Full Text Available Las relaciones entre la ingestión de nutrientes y la composición química y física corporal son afectadas a nivel práctico por un rango de factores asociados con la nutrición, el genotipo, el ambiente y el estado de madurez, y constituyen la base para manipular la calidad de la carne y la eÀciencia en un contexto especíÀco de producción. El objetivo de esta investigación fue describir los componentes químicos de un genotipo de cerdos, y las relaciones de tipo alométrico que se generan entre los diferentes componentes, teniendo como referencia la proteína en la canal y en el peso corporal vacío, en un contexto especíÀco y comercial de producción. Se utilizaron 39 cerdos castrados del cruce Duroc-Landrace x Yorkshire, desde el nacimiento hasta los 273 días de edad, los cuales fueron sometidos a prácticas convencio-nales comerciales de manejo. Después de los 70 días los animales fueron trasladados a 2600 msnm (14 ºC. Cuatro cerdos fueron sacriÀcados a 1, 21, 63, 99, 126, 154, 175, 210, 239 y 273 días de. Se estimaron los contenidos de agua, proteína, lípidos y cenizas en canal, vísceras rojas y vísceras blancas, mediante análisis proximal. Los animales fueron alimentados con dietas comerciales cuya composición fue determinada. Se evaluaron seis ecuaciones para estimar la predicción de las relaciones alométricas entre los componentes químicos y la pro-teína. Se conÀrmó que la proteína, los lípidos y el agua se incrementaron de forma lineal y cuadrática mientras que la ceniza lo hizo de forma lineal, tanto en la canal como en el cuerpo vacío. La proporción de los componentes químicos en la canal y cuerpo vacío mostraron diferentes comportamientos a lo largo del ciclo de crecimiento. Se obtuvieron relaciones lípido:proteína de 2,14, agua:proteína de 3,22, y cenizas:proteína de 0,16. Las ecuaciones alométricas aumentadas y linealizadas fueron las que mejor describieron los datos, mostran-do coe

  7. Determination and correlation of terephthaldialdehyde solubility in (ethanol, isopropanol, ethyl acetate, isopentanol) + N,N-dimethylformamide mixed solvents at temperatures from 273.15 K to 318.15 K

    International Nuclear Information System (INIS)

    Wang, Jian; Xu, Anli; Xu, Renji

    2017-01-01

    Highlights: • Solubility of terephthaldialdehyde in four binary mixed solvents were measured. • The obtained solubility data were correlated and calculated via five models. • The standard dissolution enthalpy for the dissolution processes were calculated. - Abstract: In this work, the solubility of terephthaldialdehyde in mono-solvent of ethyl acetate and binary solvent mixtures of (ethanol + N,N-dimethylformamide), (isopropanol + N,N-dimethylformamide), (ethyl acetate + N,N-dimethylformamide) and (isopentanol + N,N-dimethylformamide) were investigated by the isothermal dissolution equilibrium method under 101.1 kPa. This study was carried out at different mass fractions of ethanol, isopropanol, or isopentanol ranging from 0.1 to 0.9; and of ethyl acetate, from 0.1 to 1 at T = (273.15–318.15) K. For the solubility of each solvent mixture studied, the mole fraction solubility of terephthaldialdehyde in mixed solutions increased with increasing temperature and mass fraction of ethanol, isopropanol, ethyl acetate or isopentanol for the four systems of (ethanol + N,N-dimethylformamide), (isopropanol + N,N-dimethylformamide), (ethyl acetate + N,N-dimethylformamide) and (isopentanol + N,N-dimethylformamide). At the same temperature and mass fraction of ethanol, isopropanol, ethyl acetate or isopentanol, the mole fraction solubility of terephthaldialdehyde in (ethyl acetate + N,N-dimethylformamide) was greater than that in the other three systems. In addition, five models (Jouyban–Acree model, van’t Hoff–Acree model, modified Apelblat–Acree model, Sun model and CNIBS/R-K model) were employed to correlate the experimental solubility data. The Jouyban–Acree model gave best representation of the experimental solubility values. Furthermore, the standard molar enthalpy of terephthaldialdehyde dissolving in these mixed solvents (Δ sol H o ) was calculated in this work, and the results showed that the dissolution process was endothermic.

  8. Alternative synthetic route for the heterometallic CO-releasing [Sb@Rh12(CO27]3− icosahedral carbonyl cluster and synthesis of its new unsaturated [Sb@Rh12(CO24]4− and dimeric [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− derivatives

    Directory of Open Access Journals (Sweden)

    Cristina Femoni

    2016-10-01

    Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.

  9. 14 CFR 171.273 - Maintenance and operations requirements.

    Science.gov (United States)

    2010-01-01

    ... localizer course alignment, width, and clearance, glide path elevation angle and course width, and marker... emission and frequencies of the ISMLS localizer, glide path, beacon markers, and associated compass... owner or his maintenance representative must provide a sufficient stock of spare parts, including solid...

  10. 47 CFR 27.3 - Other applicable rule parts.

    Science.gov (United States)

    2010-10-01

    ... standards and procedures concerning the marketing and importation of radio frequency devices, and for.... This part sets forth the requirements and conditions applicable to commercial mobile radio service providers. (h) Part 22. This part sets forth the requirements and conditions applicable to public mobile...

  11. 33 CFR 27.3 - Penalty Adjustment Table.

    Science.gov (United States)

    2010-07-01

    ... Quality Assurance Records (first offense) 4,000 14 U.S.C. 645(i) Confidentiality of Medical Quality.... 10508(b) Coastwise Voyages: Seamen Protection; General 7,000 46 U.S.C. 10711 Effects of Deceased Seamen....S.C. 11105(c) Wages on Discharge 800 46 U.S.C. 11303(a) Log Books; Master Failing to Maintain 300 46...

  12. 25 CFR 273.46 - Liability and motor vehicle insurance.

    Science.gov (United States)

    2010-04-01

    ... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT General Contract... part. However, where the Bureau contracting officer determines that the risk of death, personal injury...

  13. Dicty_cDB: VFF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 46 0.001 2 BQ512190 |BQ512190.1 EST619605 Generation... Solanum tuberosum cDNA clone STMHW74 5' end, mRNA sequence. 46 0.001 2 BQ512191 |BQ512191.1 EST619606 Generation

  14. 7 CFR 273.9 - Income and deductions.

    Science.gov (United States)

    2010-01-01

    ... qualified health professional. (ii) Hospitalization or outpatient treatment, nursing care, and nursing home... to entering a hospital or nursing home provided by a facility recognized by the State. (iii... health and accident policies such as those payable in lump sum settlements for death or dismemberment or...

  15. 40 CFR 273.18 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... originating shipper. The EPA regional office will provide instructions for managing the hazardous waste. (h... or local solid waste regulations. ...

  16. 40 CFR 273.38 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....38 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED.... The EPA regional office will provide instructions for managing the hazardous waste. (h) If a large... may manage the waste in any way that is in compliance with applicable federal, state or local solid...

  17. 31 CFR 27.3 - Assessment of civil penalties.

    Science.gov (United States)

    2010-07-01

    ..., Tobacco and Firearms,” “Bureau of the Public Debt,” “Bureau of Engraving and Printing,” “Comptroller of... Engraving and Printing,” “Comptroller of the Currency,” “Director of the Federal Law Enforcement Training... reasonably be interpreted or construed as conveying the false impression that such advertisement...

  18. 7 CFR 273.12 - Requirements for change reporting households.

    Science.gov (United States)

    2010-01-01

    ... issue a supplementary ATP for the amount of the increase by June 10. (iii) The State agency may elect to...; (iii) Changes in residence and the resulting change in shelter costs; (iv) The acquisition of a... recertification. (iii) Failure to file a complete form by the specified filing date. If a household fails to file...

  19. 7 CFR 273.18 - Claims against households.

    Science.gov (United States)

    2010-01-01

    ... (iii) A person connected to the household, such as an authorized representative, who actually trafficks... by a household transacting an untampered expired Authorization to Participate (ATP) card. (c...: (i) The individual's admission; (ii) Adjudication; or (iii) The documentation that forms the basis...

  20. 15 CFR 904.273 - Administrative review of decision.

    Science.gov (United States)

    2010-01-01

    ... (Continued) NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE GENERAL REGULATIONS CIVIL..., Department of Commerce, Room 5128, 14th Street and Constitution Avenue, NW., Washington, DC 20230. Copies of... form articulated in section 904.206(b); and (7) Issues of fact or law not argued before the Judge may...

  1. 40 CFR 264.273 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... the facility permit how the owner or operator will design, construct, operate, and maintain the land..., construct, operate, and maintain the treatment zone to minimize run-off of hazardous constituents during the... maintain a run-on control system capable of preventing flow onto the treatment zone during peak discharge...

  2. Translations on Narcotics and Dangerous Drug No. 273

    Science.gov (United States)

    1976-11-26

    on his arrival by taxi from Johore Baru last December 20. DPP Alan Wong, prosecuting, said Lim in a cautioned statement stated that he was paid...150 to carry the heroin earlier that day by someone in Johore Baru , known to him only by the nickname of "Tua Bak" (big eyes). Mr. S. K. Lee

  3. Flow-induced vibration -- 1994. PVP-Volume 273

    International Nuclear Information System (INIS)

    Au-Yang, M.K.; Fujita, K.

    1994-01-01

    Flow-induced vibration is a subject of practical interest to many engineering disciplines, including the power generation, process, and petrochemical industries. In the nuclear industry, flow-induced vibration reaches a higher level of concern because of safety issues and the huge cost associated with down time and site repair. Not surprisingly, during the last 25 years a tremendous amount of effort has been spent in the study of flow-induced vibration phenomena related to nuclear plant components, notably nuclear steam generator tube banks and nuclear fuel bundles. Yet, in spite of this concentrated effort, the industry is still not free from flow-induced vibration-related problems. This explains why in this volume almost half of the papers address the issue of cross-flow induced vibration in tube bundles, with applications to the nuclear steam generator and nuclear fuel bundles in mind. Unlike 10 or 15 years ago, when flow-induced vibration studies almost always involved experimentation and empirical studies, the advent of high-speed computers has enabled numerical calculation and simulation of this complex phenomenon to take place. Separate abstracts were prepared for 27 papers in this volume

  4. 1935 15' Quad #273 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  5. 25 CFR 273.13 - Proposals eligible for contracts.

    Science.gov (United States)

    2010-04-01

    ... contract for operational support, a public school district shall be required to establish as part of the... without regard to contract funds pursuant to this part. (vii) It shall not budget or project a deficit by... residing in Federal boarding facilities for the purpose of attending public schools within the school...

  6. 7 CFR 273.4 - Citizenship and alien status.

    Science.gov (United States)

    2010-01-01

    ... still married or the spouse is deceased. (1) A spouse may not get credit for quarters of a spouse when... exists under another status. (6) For purposes of determining eligible alien status in accordance with... not exceed 130 percent of the poverty income guideline for the household's size. The State agency must...

  7. 25 CFR 273.49 - Freedom of information.

    Science.gov (United States)

    2010-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE... disclosure only when both of the following conditions exist: (1) The reports and information fall within one... where disclosure would be a clearly unwarranted invasion of personal privacy. (2) Disclosure is...

  8. 77 FR 273 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-01-04

    ... Numbers: QF12-120-000. Applicants: The Coca-Cola Company. Description: Form 556--Notice of self-certification of qualifying cogeneration facility status of The Coca-Cola Company. Filed Date: 12/21/2011...; ER10-2675-004. Applicants: Choctaw Generation Limited Partnership, Hot Spring Power Company, LLC,GDF...

  9. All projects related to | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-10

    The Fifth International Conference on Information and Communication Technologies and Development (ICTD2012) will take place 12-15 March 2012 at the Georgia Institute of Technology (Georgia Tech) in Atlanta, USA. Start Date: January 10, 2012. End Date: January 10, 2013. Topic: RESEARCH RESULTS ...

  10. Dicty_cDB: VFH273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ewvh*mfvhlyqlem*qwknv*ivqknlvkef qkrlvyqyfymkkhqlnhivnnwnkldkvnmkv*krn*rkkngn--- ...---ptigfnvcqrfr*ivrlknsctrwwlclcthrcygcrfgcydwlddfw*keirsfrf nhertlttir*snerfnsih*cry*rfq*lhqsngyskrstkryrhr

  11. 25 CFR 273.18 - Additional requirements for education plan.

    Science.gov (United States)

    2010-04-01

    ...) Program goals and objectives related to the learning needs of potential target students. (2) Procedures and methods to be used in achieving program objectives, including ways whereby parents, students and... the Indian students to be served by the contract. (b) Incorporate the program or programs developed...

  12. 40 CFR 273.81 - Factors for petitions to include other wastes under 40 CFR part 273.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Petitions To Include... likelihood that the waste will be diverted from non-hazardous waste management systems (e.g., the municipal...) Systems to be used for collecting the waste or category of waste (including packaging, marking, and...

  13. Study of the solubility, viscosity and density in Na+, Zn2+/Cl− − H2O, Na+ − Zn2+ − (H2PO2)− − H2O, Na+, Cl−/(H2PO2)− − H2O, and Zn2+, Cl−/(H2PO2)− − H2O ternary systems, and in Na+, Zn2+/Cl−, (H2PO2)−//H2O reciprocal quaternary system at 273.15 K

    International Nuclear Information System (INIS)

    Adiguzel, Vedat; Erge, Hasan; Alisoglu, Vahit; Necefoglu, Hacali

    2014-01-01

    Highlights: • The physicochemical properties of ternary and one quaternary have been studied. • Reciprocal quaternary systems’ solubility and phase equilibrium have been studied. • In all systems the solid phases have been found. • It was found that Zn(H 2 PO 2 ) 2 salt contains 70% of the general crystallization field. - Abstract: The solubility and the physicochemical properties (density, viscosity) in the Na-Zn- Cl-H 2 O), (Na + Zn + H 2 PO 2 + H 2 O), (Na + Cl + H 2 PO 2 + H 2 O), and (Zn + Cl + H 2 PO 2 + H 2 O) ternaries, and in Na + , Zn 2+ /Cl − , (H 2 PO 2 ) − //H 2 O reciprocal quaternary systems at T = 273.15 K were investigated by using the isothermal method. The diagrams of ternary salts systems, (NaCl + ZnCl 2 + H 2 O), (NaCl + NaH 2 PO 2 + H 2 O), (NaH 2 PO 2 + Zn(H 2 PO 2 ) 2 + H 2 O), (ZnCl 2 + Zn(H 2 PO 2 ) 2 + H 2 O), are plotted in figures 1–4. However, whole ions of reciprocal quaternary salt systems are plotted in figure 5. Additionally, the density and viscosity values of ternary systems vs. their corresponding composition values in weight per cent are plotted in figures 6–10. At the (i) (ZnCl 2 + Zn(H 2 PO 2 ) 2 + H 2 O), (ii) (NaCl + ZnCl 2 + H 2 O), (iii) (NaCl + NaH 2 PO 2 + H 2 O), (iv) (NaH 2 PO 2 + Zn(H 2 PO 2 ) 2 + H 2 O) ternary systems the solid phase compositions have been determined as: (i) Zn(H 2 PO 2 ) 2 ⋅ H 2 O, Zn(H 2 PO 2 ) 2 , ZnCl 2 ⋅ 2H 2 O, (ii) NaCl, 2NaCl ⋅ ZnCl 2 ⋅ 2H 2 O, and ZnCl 2 ⋅ 2H 2 O, (iii) NaCl and NaH 2 PO 2 ⋅ H 2 O, (iv) Zn(H 2 PO 2 ) 2 ⋅ H 2 O and NaH 2 PO 2 ⋅ H 2 O, respectively. On the other hand reciprocal quaternary system was observed as: ZnCl 2 ⋅ 2H 2 O, 2NaCl ⋅ ZnCl 2 ⋅ 2H 2 O, Zn(H 2 PO 2 ) 2 ⋅ H 2 O, NaH 2 PO 2 ⋅ H 2 O, NaCl. According to results, the least soluble salt was Zn(H 2 PO 2 ) 2 . The crystallization field of this salt, being the largest in comparison with those of other salts, occupied 70% of the general crystallization field

  14. 48 CFR 719.273-9 - Obligations under the Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International... submit to the USAID Office of Small and Disadvantaged Business Utilization (OSDBU) annual reports on...

  15. 48 CFR 719.273-4 - Eligibility of Mentor and Protégé firms.

    Science.gov (United States)

    2010-10-01

    ... INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International... business entities approved as Mentors may enter into agreements (hereafter referred to as “Mentor-Protégé... subcontractors. Eligible small business entities capable of providing developmental assistance may be approved as...

  16. 48 CFR 719.273-3 - Incentives for prime contractor participation.

    Science.gov (United States)

    2010-10-01

    ... INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International...) Under the Small Business Act, 15 U.S.C. 637(d)(4)(E), USAID is authorized to provide appropriate incentives to encourage subcontracting opportunities for small business consistent with the efficient and...

  17. 3C 273 with NuSTAR: Unveiling the Active Galactic Nucleus

    DEFF Research Database (Denmark)

    Madsen, Kristin K.; Fürst, Felix; Walton, Dominic J.

    2015-01-01

    for a weak (EW = 23 ± 11 eV) neutral iron line. We interpret these features as arising from coronal emission plus reflection off an accretion disk or distant material. Beyond 80 keV INTEGRAL data show clear excess flux relative to an extrapolation of the active galactic nucleus model fit to NuSTAR. This high...

  18. 273 Etude de la culture en couloirs de manioc (Manihot esculenta ...

    African Journals Online (AJOL)

    administrateur

    La culture en couloirs a enregistré un rendement moyen général en racines tubéreuses fraîches de 40 t/ha contre 13 t/ha dans ..... Le soja vert a eu des taux moyens de germination supérieurs à la moyenne (50% d'émergence) sur les deux années de ..... Afrique, 14 – 19 août 1983, Douala, Cameroun. Ottawa, Ont., CRDI.

  19. 7 CFR 273.23 - Simplified application and standardized benefit projects.

    Science.gov (United States)

    2010-01-01

    ... implementation costs and, on an annual basis, operating costs, administrative costs, error reduction, and benefit... Exchange (SDX) tape. TANF or Medicaid applications may need to be modified, or be subject to an addendum in... historical data on deductions claimed by such households. Such deductions must be updated, as necessary, on...

  20. : tous les projets | Page 273 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Financement total : CA$ 1,317,190.00. Renforcement des capacités de réalisation d'essais en matière de prévention du VIH/sida grâce au réseau TanZamBo. Projet. Cette subvention soutiendra l'acquisition d'une expertise relativement aux essais en matière de prévention du VIH/sida au Botswana, en Tanzanie et en ...

  1. 14 CFR 135.273 - Duty period limitations and rest time requirements.

    Science.gov (United States)

    2010-01-01

    ... board the aircraft are not required; and (iii) Include provisions to add one flight attendant to the... least one flight attendant in addition to the minimum flight attendant complement required for the... than 20 hours, if the scheduled duty period includes one or more flights that land or take off outside...

  2. Characteristics of heterojunctions of amorphous LaAlO2.73 on Si

    International Nuclear Information System (INIS)

    Huang Yanhong; Zhao Kun; Lu Huibin; Jin Kuijuan; He Meng; Chen Zhenghao; Zhou Yueliang; Yang Guozhen

    2006-01-01

    High-quality heterojunctions consisting of n-type amorphous LaAlO 3- δ and p-type Si without Si interfacial layer were prepared using a thin film deposition system normally used for laser-molecular beam epitaxy. Good I-V rectifying property, ferroelectricity of interface enhancement and fast photovoltaic effect have been observed in the LaAlO 3- δ /Si p-n heterojunctions. We expect that the multifunctional properties of rectification, ferroelectricity and photovoltaic effect should open up new possibilities in device development and other applications

  3. 7 CFR 273.11 - Action on households with special circumstances.

    Science.gov (United States)

    2010-01-01

    ... to notices of adverse action and fair hearings. (iii) DAA centers in areas without EBT systems may... systems may redeem benefits in various ways depending on the State's EBT system design. The designs may... retailers with EBT access via POS at the center, DAA use of a center EBT card that is an aggregate of...

  4. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The hardness ratio for hard and soft bands shows irregular variation but there was no correlation between them. There is no distinct variation of the photon index in the case of simple power law model fitting. For power law + free absorption model fitting, the average photon index () is 2.08.

  5. VizieR Online Data Catalog: 22GHz image of 3C 273 (Bruni+, 2017)

    Science.gov (United States)

    Bruni, G.; Gomez, J. L.; Casadio, C.; Lobanov, A.; Kovalev, Y. Y.; Sokolovsky, K. V.; Lisakov, M. M.; Bach, U.; Marscher, A.; Jorstad, S.; Anderson, J. M.; Krichbaum, T. P.; Savolainen, T.; Vega-Garcia, L.; Fuentes, A.; Zensus, J. A.; Alberdi, A.; Lee, S.-S.; Lu, R.-S.; Perez-Torres, M.; Ros, E.

    2017-07-01

    A global ground array of 22 antennas was used to perform observations, including VLBA (Sc, Hn, Nl, Fd, La, Kp, Pt, Ov, Br, Mk), EVN (Hh, Mc, Nt, Tr, Jb, Ef, Ys), Long Baseline Array (-LBA- At, Mp, Ho, Cd), and two Kvazar antennas (Sv, Zc), plus Kalyazin (managed by ASC, Russia), and Green Bank (NRAO, USA). The observations took place on January 18-19, 2014, for a total of 16.8 hours, and at three different frequencies: 15GHz, 22GHz, and 43GHz. RA was involved only for the 22GHz part, while for the other bands only the VLBA was used. Both the Green Bank and Pushchino tracking station took part in the experiment. A RA-compatible total bandwidth of 32MHz, split into two 16-MHz IFs, was used. RA was scheduled to observe three consecutive 9.5 minute scans every 1.25 hours, to allow for antenna cooling. (2 data files).

  6. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    The hardness ratio for hard and soft bands shows irregular variation but there was no correlation between them. There is no distinct variation of the photon index in the case of simple power law model fitting. For power law + free absorption model fitting, the average photon index ( ) is 2.08. Key words. Galaxies: individual ...

  7. 49 CFR 178.273 - Approval of Specification UN portable tanks.

    Science.gov (United States)

    2010-10-01

    ...) All applicable provisions of the design and construction have been met to the satisfaction of the... approval agency must: (i) Apply its name, identifying mark or identifying number, and the date upon which... approvals for UN portable tanks authorizing design or construction alternatives (Alternate Arrangements...

  8. BKR 27(3) pp. 123-128 (Lakshmikanth et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-09-30

    Sep 30, 2015 ... As phenols readily undergo oxidation under. Lowry's reaction conditions, they interfere during protein estimation by Lowry's method (Singleton et al., 1999) hence separating the lipoproteins from phenol that was carried over during the isolation of the lipoprotein is essential and was easily accomplished by ...

  9. Re-Analysis of QPO in 3C 273 Light Curve P. Mohan1,∗ , A ...

    Indian Academy of Sciences (India)

    Abstract. We have developed analysis tools to search for quasi perio- dic oscillations in light curves from active galactic nuclei, using the fol- lowing time series techniques: Wavelets, periodogram, Lomb–Scargle periodogram, structure function and multi-harmonic analysis of variance. The analysis tools incorporate different ...

  10. SU-E-J-273: Simulation of the Radiation Response of Hypoxic Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Espinoza, I [Pontificia Universidad Catolica de Chile, Santiago (Chile); Peschke, P; Karger, C [German Cancer Research Center (DKFZ), Heidelberg (Germany)

    2014-06-01

    Purpose: In radiotherapy, it is important to predict the response of tumour to irradiation prior to the treatment. Mathematical modelling of tumour control probability (TCP) based on the dose distribution, medical imaging and other biological information may help to improve this prediction and to optimize the treatment plan. The aim of this work is to develop an image based 3D multiscale radiobiological model, which describes the growth and the response to radiotherapy of hypoxic tumors. Methods: The computer model is based on voxels, containing tumour, normal (including capillary) and dead cells. Killing of tumour cells due to irradiation is calculated by the Linear Quadratic Model (extended for hypoxia), and the proliferation and resorption of cells are modelled by exponential laws. The initial shape of the tumours is taken from CT images and the initial vascular and cell density information from PET and/or MR images. Including the fractionation regime and the physical dose distribution of the radiation treatment, the model simulates the spatial-temporal evolution of the tumor. Additionally, the dose distribution may be biologically optimized. Results: The model describes the appearance of hypoxia during tumour growth and the reoxygenation processes during radiotherapy. Among other parameters, the TCP is calculated for different dose distributions. The results are in accordance with published results. Conclusion: The simulation model may contribute to the understanding of the influence of biological parameters on tumor response during treatment, and specifically on TCP. It may be used to implement dose-painting approaches. Experimental and clinical validation is needed. This study is supported by a grant from the Ministry of Education of Chile, Programa Mece Educacion Superior (2)

  11. SU-E-J-273: Simulation of the Radiation Response of Hypoxic Tumors

    International Nuclear Information System (INIS)

    Espinoza, I; Peschke, P; Karger, C

    2014-01-01

    Purpose: In radiotherapy, it is important to predict the response of tumour to irradiation prior to the treatment. Mathematical modelling of tumour control probability (TCP) based on the dose distribution, medical imaging and other biological information may help to improve this prediction and to optimize the treatment plan. The aim of this work is to develop an image based 3D multiscale radiobiological model, which describes the growth and the response to radiotherapy of hypoxic tumors. Methods: The computer model is based on voxels, containing tumour, normal (including capillary) and dead cells. Killing of tumour cells due to irradiation is calculated by the Linear Quadratic Model (extended for hypoxia), and the proliferation and resorption of cells are modelled by exponential laws. The initial shape of the tumours is taken from CT images and the initial vascular and cell density information from PET and/or MR images. Including the fractionation regime and the physical dose distribution of the radiation treatment, the model simulates the spatial-temporal evolution of the tumor. Additionally, the dose distribution may be biologically optimized. Results: The model describes the appearance of hypoxia during tumour growth and the reoxygenation processes during radiotherapy. Among other parameters, the TCP is calculated for different dose distributions. The results are in accordance with published results. Conclusion: The simulation model may contribute to the understanding of the influence of biological parameters on tumor response during treatment, and specifically on TCP. It may be used to implement dose-painting approaches. Experimental and clinical validation is needed. This study is supported by a grant from the Ministry of Education of Chile, Programa Mece Educacion Superior (2)

  12. Fuller Mia, Moderns abroad, Architecture, cities and Italian imperialism, Londres : Routledge, 2007, 273 p.

    Directory of Open Access Journals (Sweden)

    Mercedes Volait

    2009-05-01

    Full Text Available C’est une synthèse ambitieuse et longuement mûrie qu’offre l’italianiste Mia Fuller sous ce titre évocateur de Moderns abroad. Le texte s’appuie pour partie sur une thèse en anthropologie culturelle soutenue en 1994 à Berkeley sous la direction de Paul Rabinow, qui explorait la dimension architecturale du projet colonial italien envisagé dans sa globalité, temporelle (1860-1943 et spatiale (l’Afrique du Nord, l’Afrique de l’Est et le Dodécanèse. L’enquête l’avait conduite à mettre en relief...

  13. 7 CFR 273.24 - Time limit for able-bodied adults.

    Science.gov (United States)

    2010-01-01

    ....24 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE... receiving temporary or permanent disability benefits issued by governmental or private sources; (ii) Is..., disability, religious creed, national origin, or political beliefs. Such discrimination is prohibited by this...

  14. People and things. CERN Courier, Apr 1987, v. 27(3)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. On Friday February 13, bulldozers began clearing a 200 acre (80 hectare) site at Newport News, Virginia, for the proposed US Continuous Electron Beam Accelerator Facility (CEBAF) to provide high energy electron beams for nuclear physics. The XI International Workshop on Weak Interactions will be held in Santa Fe, New Mexico, from 14- 19 June. Discussion sessions covering current topics in weak interaction physics will allow active participation by workshop attendees. The Division of Particles and Fields of the American Physical Society and the Central Design Group of the proposed US SSC Superconducting Supercollider are organizing a Workshop on Experiments, Detectors and Experimental Areas for the SSC, to be held at Berkeley from 7-17 July. As southern hemisphere astronomers witnessed a gigantic supernova explosion towards the end of February, underground neutrino detectors all over the world picked up bursts of particles

  15. BKR 27(3) pp. 123-128 (Lakshmikanth et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-09-30

    Sep 30, 2015 ... from porcine skin, ammonium persulphate, sephadex G-50 and acrylamide 3X crystals were purchased from Sigma. Aldrich, Chemicals, St. Louis, Missouri, USA; bovine transferrin holoform was from GIBCO life technologies,. Scotland; bovine serum albumin (BSA), Folin and Ciocalteu's phenol reagent and ...

  16. Delta-function Approximation SSC Model in 3C 273 S. J. Kang1 ...

    Indian Academy of Sciences (India)

    Abstract. We obtain an approximate analytical solution using δ approximate calculation on the traditional one-zone synchrotron self-. Compton (SSC) model. In this model, we describe the electron energy distribution by a broken power-law function with a sharp cut-off, and non- thermal photons are produced by both ...

  17. 33 CFR Appendix E to Part 273 - Preventive Safety Measures in Handling of Herbicides

    Science.gov (United States)

    2010-07-01

    .... Special care is required to prevent contamination of the inside of gloves. 9. Approved respirators must be... holes in top, bottom, and sides of metal containers or crush them so they cannot collect water or be...

  18. 7 CFR 273.21 - Monthly Reporting and Retrospective Budgeting (MRRB).

    Science.gov (United States)

    2010-01-01

    ... NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF... households are excluded from both monthly reporting and retrospective budgeting: (i) Migrant or seasonal...

  19. A simple formulation for thermodynamic properties of steam from 273 to 523 K, explicit in temperature and pressure

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2009-01-01

    Roč. 32, č. 5 (2009), s. 1123-1125 ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : absorption system * vapour * water * water-lithium bromide Subject RIV: BJ - Thermodynamics Impact factor: 1.537, year: 2009 http://apps.isiknowledge.com/summary.do?qid=1&product=UA&SID=T2f%407aA433c5aJl9C9C&search_mode=GeneralSearch

  20. SU-E-T-273: Do Task Group External Beam QA Recommendations Guarantee Accurate Treatment Plan Dose Delivery?

    International Nuclear Information System (INIS)

    Templeton, A; Liao, Y; Redler, G; Zhen, H

    2015-01-01

    Purpose: AAPM task groups 40/142 have provided an invaluable set of goals for physicists designing QA programs, attempting to standardize what would otherwise likely be a highly variable phenomenon across institutions. However, with the complexity of modalities such as VMAT, we hypothesize that following these guidelines to the letter might still allow unacceptable dose discrepancies. To explore this hypothesis we simulated machines bordering on QA acceptability, and calculated the effect on patient plans. Methods: Two errant machines were simulated in Aria/Eclipse, each just within task group criteria for output, percent depth dose, beam profile, gantry and collimator rotations, and jaw and MLC positions. One machine minimized dose to the PTV (machine A) and the other maximized dose to the OARs (machine B). Clinical treatment plans (3-phase prostate, n=3; hypofractionated lung, n=1) were calculated on these machines and the dose distributions compared. A prostate case was examined for contribution of error sources and evaluated using delivery QA data. Results: The prostate plans showed mean decreases in target D95 of 9.9% of prescription dose on machine A. On machine B, The rectal and bladder V70Gy each increased by 7.1 percentage points, while their V45Gy increased by 16.2% and 15.0% respectively. In the lung plan, the target D95 decreased by 12.8% and the bronchial tree Dmax increased by 21% of prescription dose, on machines A and B. One prostate plan showed target dose errors of 3.8% from MLC changes, 2% from output, ∼3% from energy and ∼0.5% from other factors. This plan achieved an 88.4% gamma passing rate using 3%/3mm using ArcCHECK. Conclusion: In the unlikely event that a machine exhibits all maximum errors allowed by TG 40/142, unacceptably large changes in dose delivered are possible especially in highly modulated VMAT plans, despite the machine passing routine QA

  1. 75 FR 54880 - Eddie Floyd, Licensee of FM Translator Station K273AF, Carson City, NV, Facility ID No. 13529...

    Science.gov (United States)

    2010-09-09

    ... relating to money laundering and his apparent failure to inform the Commission about such misconduct in the...), involving money laundering, and one count of violating 18 U.S.C. 2, aiding and abetting a felony crime, both... the company in exchange for $27,500. The court found these payments constituted money laundering by...

  2. Thermodynamic properties of the LiCl-H2O system at vapor-liquid equilibrium from 273 K to 400 K

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2008-01-01

    Roč. 31, č. 2 (2008), s. 287-303 ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : water * lithium chloride * equation of state Subject RIV: BJ - Thermodynamics Impact factor: 1.458, year: 2008

  3. A computationally effective formulation of the thermodynamic properties of LiBr-H2O solutions from 273 to 500 K over full composition range

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2006-01-01

    Roč. 29, č. 4 (2006), s. 566-578 ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : water-lithium bromide * aqueous solution * thermodynamic properties Subject RIV: BJ - Thermodynamics Impact factor: 0.936, year: 2006

  4. Multibeam collection for TN273: Multibeam data collected aboard Thomas G. Thompson from 2011-12-22 to 2012-01-22, Apra, Guam to Apra, Guam

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  5. Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative Code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 2001

    International Nuclear Information System (INIS)

    Margorie Stockton

    2003-01-01

    Los Alamos National Laboratory is subject to annual emissions-reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73 (20.2.73 NMAC), Notice of Intent and Emissions Inventory Requirements. The applicability of the requirements is based on the Laboratory's potential to emit 100 tons per year of suspended particulate matter, nitrogen oxides, carbon monoxide, sulfur oxides, or volatile organic compounds. For calendar year 2001, the Technical Area 3 steam plant was the primary source of criteria air pollutants from the Laboratory, while research and development activities were the primary source of volatile organic compounds. Emissions of beryllium and aluminum were reported for activities permitted under 20.2.72 NMAC. Hazardous air pollutant emissions from chemical use for research and development activities were also reported

  6. The gene for X-linked myotubular myopathy is located in an 8 Mb region at the border of Xq27.3 and Xq28

    NARCIS (Netherlands)

    Janssen, E. A.; Hensels, G. W.; van Oost, B. A.; Hamel, B. C.; Kemp, S.; Baas, F.; Weber, J. W.; Barth, P. G.; Bolhuis, P. A.

    1994-01-01

    X-linked recessive myotubular myopathy (XLMTM) is a rare and severe neonatal neuromuscular disease characterized by muscle weakness, hypotonia, and respiratory problems. Here we report an extensive linkage analysis in two families with XLMTM. Using 18 markers in the Xq27-Xqter region we found a

  7. 2013 Review of Neutron and Non-Neutron Nuclear Data

    Science.gov (United States)

    Holden, N. E.

    2016-02-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  8. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  9. Corrigendum to “Sorption/desorption of non-hydrophobic and ionisable pharmaceutical and personal care products from reclaimed water onto/from a natural sediment” Sci Total Environ 472 (2014) 273–281

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-Hernández, Virtudes, E-mail: virtudes.martinez@imdea.org [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); Meffe, Raffaella; Herrera, Sonia [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); Arranz, Elena [University of Alcalá, Geography and Geology Department, 28871 Alcalá de Henares, Madrid (Spain); Bustamante, Irene de [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); University of Alcalá, Geography and Geology Department, 28871 Alcalá de Henares, Madrid (Spain)

    2015-02-01

    In the present work, the sorption of pharmaceutical and personal care products (PPCPs) (acetaminophen, atenolol, carbamazepine, caffeine, naproxen and sulphamethoxazole) onto the natural organic matter (NOM) and the inorganic surfaces of a natural sandy loam sediment was quantified separately. The quantification was based on the PPCP charge, their degree of ionisation, their octanol-water partitioning coefficient (K{sub OW}) and the sediment organic carbon fraction (ƒ{sub OC}). PPCP desorption from the sediment was examined under conditions of infiltrating water containing a high concentration of inorganic ions (mimicking infiltrating reclaimed water), and a low concentration (and smaller diversity) of inorganic ions (mimicking rainwater infiltration). Batch tests were performed using a sediment/water ratio of 1:4 and a PPCP initial concentration ranging from 1 to 100 μg L{sup −1}. The results showed the type and degree of PPCP ionisation to strongly influence the sorption of these compounds onto the sediment. The sorption of cationic species onto the sediment was higher than that of anionic species and mostly reversible; the sorption of neutral species was negligible with the exception of caffeine. The anionic species sorbed less onto the sediment, but also desorbed less easily. Most of the compounds showed a sorption that was highly influenced by interaction with mineral surfaces. The presence of inorganic ions had no impact on the desorption of the PPCPs from the sediment. According to the calculated percentages of removal, the mobility followed the order: carbamazepine > acetaminophen > naproxen > atenolol > sulphamethoxazole > caffeine.

  10. Crystal structure of ATVORF273, a new fold for a thermo- and acido-stable protein from the Acidianus two-tailed virus

    DEFF Research Database (Denmark)

    Felisberto-Rodrigues, Catarina; Blangy, Stéphanie; Goulet, Adeline

    2012-01-01

    in the viral world. To understand this intriguing phenomenon, we have undertaken structural studies of ATV virion proteins and here we present the crystal structure of one of these proteins, ATV[Formula: see text]. ATV[Formula: see text] forms tetramers in solution and a molecular envelope is provided...... for the tetramer, computed from small-angle X-ray scattering (SAXS) data. The crystal structure has properties typical of hyperthermostable proteins, including a relatively high number of salt bridges. However, the protein also exhibits flexible loops and surface pockets. Remarkably, ATV[Formula: see text......] displays a new [Formula: see text] protein fold, consistent with the absence of homologues of this protein in public sequence databases....

  11. 48 CFR 812.301 - Solicitation provisions and contract clauses for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ... Hotline poster. (3) 852.207-70, Report of employment under commercial activities. (4) 852.209-70...) 852.273-71, Alternative negotiation techniques. (3) 852.273-72, Alternative evaluation. (4) 852.273-73...

  12. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  13. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2011-05-27

    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  14. Birds of a Feather Flock Together: The Congruence of Personality Types within Librarians’ Subject Specialties. A Review of: Williamson, J.M., A.E. Pemberton, and J.W. Lounsbury. “Personality Traits of Individuals in Different Specialties of Librarianship.” Journal of Documentation 64.2 (2008: 273-86.

    Directory of Open Access Journals (Sweden)

    John Loy

    2008-12-01

    Full Text Available Objectives – To investigate the personality traits of a range of librarians and information professionals using the Personal Style Inventory (PSI, and to investigate whether the personality traits of those in person-orientated library specialties differ from those in technique-orientated specialties.Design – Self-selecting survey.Setting – Solicitations to complete the survey were sent out via 10 e-mail discussion lists, and paper copies were made available at the annual American Library Association conference in 2002.Subjects – 2,075 librarians and information science professionals.Methods – Participants completed the survey either in print format, as an e-mail attachment or a Web form. The survey format was an adaptation of the PSI scale using 13 of the accepted 16 scales, namely: adaptabilityassertivenessautonomyconscientiousnesscustomer service orientation emotional resilienceextraversionopennessoptimismteamworktough-mindednessvisionary-operational work stylework driveResponses were analysed using a two-step cluster analysis technique, and participants were grouped into seven clusters.Main Results – The largest group of respondents was cataloguers at 23.7%, followed by other (health or law 19.1%,academic reference librarians 13.2%, special librarians 12.3% with all other groups in single figures. Respondents were divided up into the following seven clusters. • Cluster 1, the “unadaptive” group -- so labelled because several unadaptive traits such as low emotional resilience, low optimism, low teamwork, and low work drive are included.• Cluster 2, “adaptive academic reference librarians” -- high on customer service orientation, extraversion and teamwork, and low on tough-mindedness.• Cluster 3, “adaptive cataloguers” -- low on customer service orientation and possessing a more operational work style.• Cluster 4, “adaptive special librarians” -- high on autonomy, customer service orientation and extraversion.• Cluster 5, “adaptive distance education librarians, public librarians, records managers, and school librarians” -- possessing a visionary work style and scoring high on adaptability, assertiveness,customer service orientation, emotional resilience, high extraversion, openness, optimism, and teamwork; scoring low on tough-mindedness.• Cluster 6, “adaptive other information professionals” -- also possessing a visionary work style and with high scores on adaptability, assertiveness, autonomy, customer service orientation, emotional resilience, extraversion, openness, optimism, teamwork, and work drive.• Cluster 7, “adaptive archivists and systems librarians” scoring high on assertiveness, openness, and toughmindedness.Most clusters were comprised of a single occupational group, with only Clusters 1 and 5 made up of individuals from more than one group.Conclusion – The results indicate that different librarianship subspecialties can be differentiated by personality traits, and that individuals are likely to be drawn to either person-orientated or technique-orientated library specialties depending on their personality traits.

  15. Report on the behalf of the Commission for finances, general economy and budgetary control on the finance bill project for 2018 (nr 235). Appendix Nr 18 - Ecology, sustainable development and mobility: energy, climate and after-mines, public service for energy, financing the support to communities for rural electrification, energy transition - Nr 273

    International Nuclear Information System (INIS)

    Giraud, Joel; Aubert, Julien

    2017-01-01

    After some general statements and recommendations regarding public policy issues expressed within the mission for Ecology, Sustainable Development and Mobility, and more particularly on some specific budgetary allocations related to the public policy for energy and its specific programmes, this report presents some key budget-related data. It outlines and discusses how the budget for 2018 commits the French energy policy in an ecological and supportive transition, and then states some critics about the bill project readability. It comments the adequacy between the budgetary effort and ambitions of the energy policy, notably by commenting the financing increase or decrease of some specific programmes. In the next part, the author focuses on the way to find a new momentum for nuclear energy in France. In this respect, he discusses known benefits of nuclear power, increasing risks which threaten the sector (ageing reactors, EPR construction delays, unresolved issue of management for some nuclear wastes, AREVA dismantling and EDF's fragile financial situation). He also discusses conditions to be met to find out sustainable solution to this crisis as the application of the energy transition trajectory will require a decrease of the number of operated nuclear reactors, ways to open perspectives by keeping on supporting research and by adopting a dynamic exporting approach, and the importance of a maintained attention in terms of nuclear safety. The report of Commission debates and hearing is provided

  16. Quaderni di filologia e lingue romanze 7 (1992, Supplemento Terza serie, Attidel Convegno "Relazione di viaggi fra Italia e Spagna" Macerata, Università degli Studi, 15-17 dicembre 1992, 259 pp.; 8(1993, 273 pp.; 9(1994, 285 pp.; 10(1995, 346 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1996-12-01

    Full Text Available Il periodico maceratese, nato nel 1979, continua ad apparire a ritmo annuale re­ golare. Avendo recensito i voll. 1985-1992 nel numero 34 di «Linguistica», presen­ tiamo qui le annate citate nel titolo, concentrandoci sempre sui contributi di interesse linguistico (o almeno filologico, che continuano ad essere in minoranza di fronte a quelli di argomento letterario.

  17. Thermoluminescence glow curve involving any extent of retrapping ...

    Indian Academy of Sciences (India)

    Author Affiliations. Jai Prakash1 2. Department of Applied Science & Humanities, Buddha Institute of Technology, CL 1, GIDA, Gorakhpur 273 209, India; Previously at the Department of Physics, D.D.U. Gorakhpur University, Gorakhpur 273 009, India ...

  18. Untitled

    Indian Academy of Sciences (India)

    Godre 1988). Potential P3 {W1X (W2X Expt ry (fm) 000 0-80 140 ro (fm) 20 1-20 120. C (fm) 2.35 1.34 0.99. V (MeV) 3360-0 590-0 495.0. Binding energy (MeV) - 1276 - 127-6 - 1276 - 1276. {ry 112 (fm) 2.73 2.73 2.73 2.73. Compressibility.

  19. A model for the occurrence and analysis of ionic thermocurrent ...

    Indian Academy of Sciences (India)

    Gorakhpur Regional Centre, U.P. Rajarshi Tandon Open University, Maya Bhawan, Canal Road, Daudpur, Gorakhpur 273 001, India; Department of Applied Science & Humanities, Buddha Institute of Technology, CL-1, GIDA, Gorakhpur 273 209, India; Department of Physics, D.D.U. Gorakhpur University, Gorakhpur 273 ...

  20. Pediatric Residents and Interns in an Italian Hospital Perform Improved Bibliographic. A Review of: Gardois, P., Calabrese, R., Colombi, N., Lingua, C., Longo, F., Villanacci, M., Miniero, R., & Piga, A. (2011. Effectiveness of bibliographic searches performed by paediatric residents and interns assisted by librarian. A randomised controlled trial. Health Information and Libraries Journal, 28(4, 273-284. doi: 10.1111/j.1471-1842.2011.00957.x

    Directory of Open Access Journals (Sweden)

    Mathew Stone

    2013-03-01

    Full Text Available Objective – To establish whether the assistance of an experienced biomedical librarian delivers an improvement in the searching of bibliographic databases as performed by medical residents and interns.Design – Randomized controlled trial.Setting – The pediatrics department of a large Italian teaching hospital.Subjects – 18 pediatric residents and interns.Methods – 23 residents and interns from the pediatrics department of a large Italian teaching hospital were invited to participate inthis study, of which 18 agreed. Subjects were then randomized into two groups and asked to spend between 30 and 90 minutes searching bibliographic databases for evidence to answer a real-life clinical question which was randomly allocated to them. Each member ofthe intervention group was provided with an experienced biomedical librarian to provide assistance throughout the search session. The control group received no assistance. The outcome of the search was then measured using an assessment tool adapted for the purpose of this study from the Fresno test of competence in evidence based medicine. This adapted assessment tool rated the “global success” of the search and included criteria such as appropriate question formulation, number of PICO terms translated into search terms, use of Boolean logic, use of subject headings, use of filters, use of limits, and the percentage of citations retrieved that matched a gold standard set of citations found in a prior search by two librarians (who were not involved in assisting the subjects together with an expert clinician. Main Results – The intervention group scored a median average of 73.6 points out of a possible 100, compared with the control group which scored 50.4. The difference of 23.2 points in favour of the librarian assisted group was a statistically significant result (p value = 0.013 with a 95% confidence interval of between 4.8 and 33.2.Conclusion – This study presents credible evidence that assistance provided by an experienced biomedical librarian improves the quality of the bibliographic database searches performed by residents and interns using real-life clinical scenarios.

  1. Bioinformatic Tools for Metagenomic Analysis of Pathogen Backgrounds and Human Microbial Communities

    Science.gov (United States)

    2010-05-01

    265678297|ref|NR_028598.1| Streptococcus pyogenes strain I-273 16S ribosomal RNA, partial sequence 1116890 1118282 gi|228716249|ref|NR_027549.1...gi|265678297|ref|NR_028598.1| Streptococcus pyogenes strain I-273 16S ribosomal RNA, partial sequence 1116890 1118282 Streptococcus pyogenes Bacteria... pyogenes strain I-273 16S ribosomal RNA, partial sequence 1116890 1118282 Streptococcus pyogenes Bacteria; Firmicutes; Lactobacillales

  2. 76 FR 32107 - Nondiscrimination on the Basis of Disability in Air Travel; Accessibility of Aircraft and Stowage...

    Science.gov (United States)

    2011-06-03

    ... that the expected net present value of the rule over 20 years at a 7% discount rate would amount to $243 million to $273 million. Present value (millions) Total Quantified Benefits 20 years, 7...-year period of $243-$273 million present value. This represents revenue derived from seats that would...

  3. Too large or too small? Returns to scale in a retail network

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František; Druska, V.

    -, č. 273 (2005), s. 1-45 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : data envelopment analysis application * linear programming * retail units Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp273.pdf

  4. Colonoscopic features of early intestinal tuberculosis - Report of 11 ...

    African Journals Online (AJOL)

    The colonoscopic findings in 11 patients with early tuberculous colitis included erythema alone in 1 patient (9,1%), mucosal nodules indistinguishable from small adenoma in 8 (72,7%), aphthous ulcers in 3 (27,3%), and a deformed ileocaecal valve in 3 (27,3%). The caecum was the principal site of disease and the ileum ...

  5. Tvistbilæggelse mellem EU-medlemsstaterne ved Den Europæiske Unions Domstol

    DEFF Research Database (Denmark)

    Butler, Graham

    2018-01-01

    Artikel 259 and 273 TEUF giver EU-Domstolen kompetence til at træffe afgø-relse i tvister mellem EU-medlemsstaterne, forudsat at visse betingelser, der er fastsat i traktaterne er opfyldt. Artikel 259 TEUF vedrører håndhævelse af medlemsstaternes unionsretlige forpligtelser, hvorimod artikel 273 ...

  6. 76 FR 59927 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

    Science.gov (United States)

    2011-09-28

    ...-0029] RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were... qualifying aliens whose employment-creation immigrant petitions were approved by the former Immigration and...-273 Provisions C. Summary of the Adjudications Required by Public Law 107-273 III. Aliens Eligible To...

  7. Tvistbilæggelse mellem EU-medlemsstaterne ved Den Europæiske Unions Domstol

    DEFF Research Database (Denmark)

    Butler, Graham

    2018-01-01

    Artikel 259 and 273 TEUF give EU-Domstolen kompetence til at træffe afgørelse i tvister mellem EU-medlemsstaterne, forudsat at visse betingelser, der er fastsat i traktaterne er opfyldt. Artikel 259 TEUF vedrører håndhævelse af medlemsstaternes unionsretlige forpligtelser, hvorimod artikel 273 TE...

  8. The importance and measurement of new production

    Digital Repository Service at National Institute of Oceanography (India)

    Platt, T.; Jauhari, P.; Sathyendranath, S.

    stream_size 12 stream_content_type text/plain stream_name Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt stream_source_info Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  9. Flight activity and habitat preference of bats in a karstic area, as revealed by bat detectors

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Řehák, Z.

    2006-01-01

    Roč. 55, č. 3 (2006), s. 273-281 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : Moravian Karst * echolocation calls * bat community * detectoring Subject RIV: EG - Zoology Impact factor: 0.529, year: 2006 http://www.ivb.cz/folia/55/3/273-281.pdf

  10. Chemical and biological evaluation of Sm-153 and Ho-166 complexes with tetraethylester of DOTP ( DOTPOEt )

    Czech Academy of Sciences Publication Activity Database

    Forsterová, Michaela; Margues, M. M.; Jandurová, Z.; Gano, L.; Hermann, P.; Melichar, František

    2007-01-01

    Roč. 50, č. 1 (2007), s. 273-273 ISSN 0362-4803 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : Phosphonate Complexes Subject RIV: FR - Pharmacology ; Medidal Chemistry

  11. Constraining Models of Twin-Peak Quasi-periodic Oscillations with Realistic Neutron Star Equations of State

    Czech Academy of Sciences Publication Activity Database

    Török, G.; Goluchová, K.; Urbanec, M.; Šrámková, E.; Adámek, K.; Urbancová, G.; Pecháček, T.; Bakala, P.; Stuchlík, Z.; Horák, Jiří; Juryšek, J.

    2016-01-01

    Roč. 833, č. 2 (2016), 273/1-273/11 ISSN 0004-637X R&D Projects: GA ČR GB14-37086G Institutional support: RVO:67985815 Keywords : accretion disks * equation of state * neutron stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016

  12. Disruption of Inhibitory Function in the Ts65Dn Mouse Hippocampus Through Overexpression of GIRK2

    Science.gov (United States)

    2007-10-24

    Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers . J Biol Chem 273:27499-27504. Corey S, Krapivinsky G...regulated inwardly rectifying K+ (GIRK4) channel homomultimers . J Biol Chem 273, 27499- 27504. Corey, S., Krapivinsky, G., Krapivinsky, L., and

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 41; Issue 3. Issue front cover thumbnail. Volume 41, Issue 3. March 2016, pages 273-376. pp 273-282. Ensemble of randomized soft decision trees for robust classification · G KISHOR KUMAR P VISWANATH A ANANDA RAO · More Details Abstract Fulltext PDF. For classification ...

  14. L-Glutamic acid production by Bacillus spp. isolated from vegetable ...

    African Journals Online (AJOL)

    Ogiri” (fermented vegetable proteins) in Nigeria. The isolates were identified as Bacillus subtilis (6), (27.3%), Bacillus pumilus (5), (22.7%), Bacillus licheniformis (5), (27.3%) and Bacillus polymyxa (6), (22.7%). Four species of the Bacillus isolates ...

  15. 40 CFR 264.1 - Purpose, scope and applicability.

    Science.gov (United States)

    2010-07-01

    ... Underground Injection Control (UIC) program approved or promulgated under the Safe Drinking Water Act only to... 273.2; (ii) Pesticides as described in § 273.3 of this chapter; (iii) Mercury-containing equipment as... waste constituents to air, soil, or surface water that could threaten human health or the environment...

  16. Rozdíly v klinickém obraze a laboratorních nálezech v časné fázi aseptického zánětu CNS dle vyvolávajícího agens

    Czech Academy of Sciences Publication Activity Database

    Heinige, P.; Fajt, M.; Šilhánková, I.; Halašková, P.; Jiroušová, M.; Matějčková, Eva; Ješina, Pavel

    2006-01-01

    Roč. 61, č. 5 (2006), s. 273-273 ISSN 0069-2328. [Český pediatrický kongres s mezinárodní účastí /7./. 08.06.2006-11.06.2006, Praha] Keywords : CNS * aseptic inflammation Subject RIV: FG - Pediatrics

  17. The genomic landscape of balanced cytogenetic abnormalities associated with human congenital anomalies

    NARCIS (Netherlands)

    Redin, Claire; Brand, Harrison; Collins, Ryan L; Kammin, Tammy; Mitchell, Elyse; Hodge, Jennelle C; Hanscom, Carrie; Pillalamarri, Vamsee; Seabra, Catarina M; Abbott, Mary-Alice; Abdul-Rahman, Omar A; Aberg, Erika; Adley, Rhett; Alcaraz-Estrada, Sofia L; Alkuraya, Fowzan S; An, Yu; Anderson, Mary-Anne; Antolik, Caroline; Anyane-Yeboa, Kwame; Atkin, Joan F; Bartell, Tina; Bernstein, Jonathan A; Beyer, Elizabeth; Blumenthal, Ian; Bongers, Ernie M H F; Brilstra, Eva H; Brown, Chester W; Brüggenwirth, Hennie T; Callewaert, Bert; Chiang, Colby; Corning, Ken; Cox, Helen; Cuppen, Edwin; Currall, Benjamin B; Cushing, Tom; David, Dezso; Deardorff, Matthew A; Dheedene, Annelies; D'Hooghe, Marc; de Vries, Bert B A; Earl, Dawn L; Ferguson, Heather L; Fisher, Heather; FitzPatrick, David R; Gerrol, Pamela; Giachino, Daniela; Glessner, Joseph T; Gliem, Troy; Grady, Margo; Graham, Brett H; Griffis, Cristin; Gripp, Karen W; Gropman, Andrea L; Hanson-Kahn, Andrea; Harris, David J; Hayden, Mark A; Hill, Rosamund; Hochstenbach, Ron; Hoffman, Jodi D; Hopkin, Robert J; Hubshman, Monika W; Innes, A Micheil; Irons, Mira; Irving, Melita; Jacobsen, Jessie C; Janssens, Sandra; Jewett, Tamison; Johnson, John P; Jongmans, Marjolijn C; Kahler, Stephen G; Koolen, David A; Korzelius, Jerome; Kroisel, Peter M; Lacassie, Yves; Lawless, William; Lemyre, Emmanuelle; Leppig, Kathleen; Levin, Alex V; Li, Haibo; Li, Hong; Liao, Eric C; Lim, Cynthia; Lose, Edward J; Lucente, Diane; Macera, Michael J; Manavalan, Poornima; Mandrile, Giorgia; Marcelis, Carlo L; Margolin, Lauren; Mason, Tamara; Masser-Frye, Diane; McClellan, Michael W; Mendoza, Cinthya J Zepeda; Menten, Björn; Middelkamp, Sjors; Mikami, Liya R; Moe, Emily; Mohammed, Shehla; Mononen, Tarja; Mortenson, Megan E; Moya, Graciela; Nieuwint, Aggie W; Ordulu, Zehra; Parkash, Sandhya; Pauker, Susan P; Pereira, Shahrin; Perrin, Danielle; Phelan, Katy; Aguilar, Raul E Piña; Poddighe, Pino J; Pregno, Giulia; Raskin, Salmo; Reis, Linda; Rhead, William; Rita, Debra; Renkens, Ivo; Roelens, Filip; Ruliera, Jayla; Rump, Patrick; Schilit, Samantha L P; Shaheen, Ranad; Sparkes, Rebecca; Spiegel, Erica; Stevens, Blair; Stone, Matthew R; Tagoe, Julia; Thakuria, Joseph V; van Bon, Bregje W; van de Kamp, Jiddeke; van Der Burgt, Ineke; van Essen, Ton; van Ravenswaaij-Arts, Conny M; van Roosmalen, Markus J; Vergult, Sarah; Volker-Touw, Catharina M L; Warburton, Dorothy P; Waterman, Matthew J; Wiley, Susan; Wilson, Anna; Yerena-de Vega, Maria de la Concepcion A; Zori, Roberto T; Levy, Brynn; Brunner, Han G; de Leeuw, Nicole; Kloosterman, Wigard P; Thorland, Erik C; Morton, Cynthia C; Gusella, James F; Talkowski, Michael E

    Despite the clinical significance of balanced chromosomal abnormalities (BCAs), their characterization has largely been restricted to cytogenetic resolution. We explored the landscape of BCAs at nucleotide resolution in 273 subjects with a spectrum of congenital anomalies. Whole-genome sequencing

  18. The importance of being subtle: small changes in calcium homeostasis control cognitive decline in normal aging

    Czech Academy of Sciences Publication Activity Database

    Toescu, E.C.; Verkhratsky, Alexei

    2007-01-01

    Roč. 6, - (2007), s. 267-273 ISSN 1474-9718 Institutional research plan: CEZ:AV0Z50390512 Keywords : Aging * Ca homeostasis * Cognitive decline Subject RIV: FH - Neurology Impact factor: 5.854, year: 2007

  19. Financial Management: Existence of U.S. Army Corps of Engineers Buildings and Other Structures

    National Research Council Canada - National Science Library

    Granetto, Paul J; Pusey, Ryan W; Ventimiglia, Crmelo G; Zeh, William H; Bryant, Leon D; King, Calvin O; Kntor, Scott C; Kasseler, Trisha L

    2005-01-01

    ...) cost and the associated accumulated depreciation of the assets. As of September 30, 2003, USACE had about 40,000 structures located at about 1,273 field sites in the continental United States, Alaska, and Hawaii.

  20. Impacts of microcystin, a cyanobacterial toxin, on laboratory rodents in vivo

    Czech Academy of Sciences Publication Activity Database

    Ziková, Andrea; Kopp, Radovan

    2008-01-01

    Roč. 56, č. 5 (2008), s. 263-273 ISSN 1211-8516 Institutional research plan: CEZ:AV0Z60050516 Keywords : microcystin * mice, rats * intraperitoneal, oral, intratracheal application Subject RIV: EF - Botanics

  1. Habitats of relict terrestrial snails in southern Siberia: lessons for the reconstruction of palaeoenvironments of full-glacial Europe

    Czech Academy of Sciences Publication Activity Database

    Horsák, M.; Chytrý, M.; Pokryszko, B. M.; Danihelka, Jiří; Ermakov, B. V.; Hájek, Michal; Hájková, Petra; Kintrová, K.; Kočí, M.; Kubešová, S.; Lustyk, P.; Otýpková, Z.; Pelánková, Barbora; Valachovič, M.

    2010-01-01

    Roč. 37, č. 8 (2010), s. 1450-1462 ISSN 0305-0270 Institutional research plan: CEZ:AV0Z60050516 Keywords : Altai Mountains * climate * Gastropoda Subject RIV: EF - Botanics Impact factor: 4.273, year: 2010

  2. Kontroling jakości zarzadzania bezpieczeństwem pracy realizowany metoda audytu stanowiskowego

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Hana; Doležal, M.; Mikoláš, M.; Kondras, I.; Korban, Z.

    -, č. 273 (2006), s. 95-102 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : work safety * controlling * post audit method Subject RIV: AQ - Safety, Health Protection, Human - Machine

  3. Mental Health Concerns: Veterans & Active Duty

    Science.gov (United States)

    ... dialing 1-800-273-8255 and pressing 1. Mental Health Concerns There are three primary mental health concerns ... care or call 911. How Will Asking for Mental Health Treatment Affect My Career? Military personnel have always ...

  4. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... on this page please perform the following steps. 1. Please switch auto forms mode to off. 2. ... us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete ...

  5. African Zoology - Vol 11, No 2 (1976)

    African Journals Online (AJOL)

    Patterns in the Distribution of Southern African Terrestrial Tortoises (Cryptodira: Testudinidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. John Comrie Greig, Peter D. Burdett, 251-273 ...

  6. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Awareness About the Website Site Map Content Inventory Accessibility Privacy and Security Updating of Web Site Web ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  7. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Us: ncptsd@va.gov Also see: VA Mental Health Connect with us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  8. 27 CFR 26.272 - General requirements.

    Science.gov (United States)

    2010-04-01

    ... § 26.272 General requirements. Except as provided in § 26.273, every person, other than a tourist... under this part with respect of liquors while in customs custody. (Approved by the Office of Management...

  9. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... List of All Measures Treatment Treatment Overview Early Intervention Veterans Cultural Considerations Women Children Older Adults Working ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  10. 75 FR 14595 - Notice of Public Information Collection Being Reviewed by the Federal Communications Commission...

    Science.gov (United States)

    2010-03-26

    ... Cost Assignment Rules, WC Docket Nos. 07-21, 05-342, Memorandum Opinion and Order, 23 FCC Rcd 7302..., 07-273, 07-21, Memorandum Opinion and Order and Notice of Proposed Rulemaking, 23 FCC Rcd 13647 (2008...

  11. V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Markl, Martin; Somer, L.

    2013-01-01

    Roč. 58, č. 4 (2013), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

  12. Association of ADAM33 gene polymorphisms with adult-onset ...

    Indian Academy of Sciences (India)

    onset asthma and its severity in an Indian adult population. Priya Tripathi, Shally Awasthi, Rajendra Prasad, Nuzhat Husain and Subramaniam Ganesh. J. Genet. 90, 265–273. Figure 1. Gel pictures of five genotyped ADAM33 gene polymorphisms ...

  13. Analysis of geodetic surveying on the margin of subsidence depression

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Hana; Müller, Karel; Bláha, P.

    -, č. 273 (2006), s. 103-112 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : subsidence depression * levelling * height changes Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  14. Stats About Paralysis

    Science.gov (United States)

    ... resulting in difficulty or inability to move the upper or lower extremities. The leading cause of paralysis was stroke (33.7 percent), followed by spinal cord injury (27.3 percent) and multiple sclerosis (18.6 ...

  15. Eragrostis tef (Zucc.) Trotter

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-16

    3): 295-299. Mengesha MH (1966). Chemical composition of tef (Eragrostis tef) compared with that of wheat, barley, and grain sorghum. Econ. Bot. 20: 268-273. Raghavendra AS, Rama Das VS (1993). C4 photosynthesis and ...

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    -Krishna ... Black Holes in Blazars. Variability of Spectral Energy Distribution of Blazar S5 0716+714 ... 2013 pp 273-296. On the Photometric Error Calibration for the Differential Light Curves of Point-like Active Galactic Nuclei.

  17. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  18. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... e Vet Prescriptions Refills Schedule a VA Appointment Crisis Prevention Mental Health PTSD Public Health Veterans Access, ... Connect with us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social ...

  19. Depression Treatment

    Science.gov (United States)

    ... Health Infertility White Paper CDC Programs and Activities Assisted Reproductive Technology (ART) Depression Among Women Depression Treatment ... department for emergency medical treatment. Call the National Suicide Prevention Lifeline at 1-800-273-TALK (8255), ...

  20. 78 FR 5407 - Agency Information Collection Activities: Proposed Collection; Comment Request-Supplemental...

    Science.gov (United States)

    2013-01-25

    ... for Office of Management and Budget approval of the information collection. All comments will become a... participating in SNAP be assigned certification periods of a definite length. Under section 273.14, in order to...

  1. Light shines through the spindrift – Phylogeny of African torrent frogs (Amphibia, Anura, Petropedetidae)

    Czech Academy of Sciences Publication Activity Database

    Barej, M. F.; Rödel, M.-O.; Loader, S. P.; Menegon, M.; Gonwouo, N.L.; Penner, J.; Gvoždík, Václav; Günther, R.; Bell, R. C.; Nagel, B.; Schmitz, A.

    2014-01-01

    Roč. 71, č. 2 (2014), s. 261-273 ISSN 1055-7903 Institutional support: RVO:68081766 Keywords : Africa * Amphibians * Taxonomy * Arthroleptides * Petropedetes * Odontobatrachus gen. nov Sub ject RIV: EG - Zoology Impact factor: 3.916, year: 2014

  2. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Us: ncptsd@va.gov Also see: VA Mental Health Connect with us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button ...

  3. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Website Site Map Content Inventory Accessibility Privacy and Security Updating of Web Site Web Site Policies Important ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  4. South African Journal of Animal Science - Vol 34, No 4 (2004)

    African Journals Online (AJOL)

    A genetic analysis of epistaxis as associated with EIPH in the Southern African Thoroughbred · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Weideman, SJ Schoeman, GF Jordaan, 265-273 ...

  5. Abelovu cenu za matematiku získal v roce 2014 Jakov G. Sinaj

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2014-01-01

    Roč. 59, č. 4 (2014), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : billiards * entropy * binary sequences Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144076

  6. Removal of Carbon Dioxide from Gas Mixtures Using Ion-Exchanged Silicoaluminophosphates

    Science.gov (United States)

    Hernandez-Maldonado, Arturo J (Inventor); Rivera-Ramos, Milton E (Inventor); Arevalo-Hidalgo, Ana G (Inventor)

    2017-01-01

    Na+-SAPO-34 sorbents were ion-exchanged with several individual metal cations for CO2 absorption at different temperatures (273-348 K) and pressures (removal from CH4 mixtures, especially at low concentrations.

  7. Structure and Function of p53-DNA Complexes with Inactivation and Rescue Mutations: A Molecular Dynamics Simulation Study.

    Directory of Open Access Journals (Sweden)

    Balu Kamaraj

    Full Text Available The tumor suppressor protein p53 can lose its function upon DNA-contact mutations (R273C and R273H in the core DNA-binding domain. The activity can be restored by second-site suppressor or rescue mutations (R273C_T284R, R273H_T284R, and R273H_S240R. In this paper, we elucidate the structural and functional consequence of p53 proteins upon DNA-contact mutations and rescue mutations and the underlying mechanisms at the atomic level by means of molecular dynamics simulations. Furthermore, we also apply the docking approach to investigate the binding phenomena between the p53 protein and DNA upon DNA-contact mutations and rescue mutations. This study clearly illustrates that, due to DNA-contact mutants, the p53 structure loses its stability and becomes more rigid than the native protein. This structural loss might affect the p53-DNA interaction and leads to inhibition of the cancer suppression. Rescue mutants (R273C_T284R, R273H_T284R and R273H_S240R can restore the functional activity of the p53 protein upon DNA-contact mutations and show a good interaction between the p53 protein and a DNA molecule, which may lead to reactivate the cancer suppression function. Understanding the effects of p53 cancer and rescue mutations at the molecular level will be helpful for designing drugs for p53 associated cancer diseases. These drugs should be designed so that they can help to inhibit the abnormal function of the p53 protein and to reactivate the p53 function (cell apoptosis to treat human cancer.

  8. Author Index

    Indian Academy of Sciences (India)

    Chen, J. L., 333. Chen, L., 193. Chen, X., 261. Chen, X. H., 185. Chen, Y., 269. Chen, Y. J., 25, 61. Chen, Z. F., 243, 269, 273, 277, 315. Chen, Z.-Y., 273. Ciprini, S., 169. Cui, L., 47, 281. Dai, B. Z., 113. Deng, G. G., 79. Ding, Z., 29, 47. Dong, F. T., 227. Fan, J. H., 53, 67, 79, 97, 125, 127,. 179, 203, 307, 331. Fossati, G., 185.

  9. "I Pedal, therefore I am"

    DEFF Research Database (Denmark)

    Christiansen, Ask Vest

    2012-01-01

    Jesús Ilundáin-Agurruza & Michael W.Austin (red) Cycling: A Philosophical Tour De Force 273 pages, pb.Oxford, Oxon.: Wiley Blackwell 2010 (Philosophy for Everyone) ISBN 978-1-4443-3027-4......Jesús Ilundáin-Agurruza & Michael W.Austin (red) Cycling: A Philosophical Tour De Force 273 pages, pb.Oxford, Oxon.: Wiley Blackwell 2010 (Philosophy for Everyone) ISBN 978-1-4443-3027-4...

  10. Mercury removal from natural gas and associated condensates

    Energy Technology Data Exchange (ETDEWEB)

    Hennico, A.; Barthel, Y.; Courty, P. (Institut Francais du Petrole, 31 - Rueil-Malmaison (France). Direction Industrielle)

    1990-01-01

    IFP mercury trapping systems are based on CMG 273, the recently developed Procatalyse product which is the heart of IFP's gas phase and liquid phase mercury removal technology. This material, made of highly macroporous alumina supporting a metal sulfide, presents a very high reactivity towards mecury within a broad range of operating conditions, including those operating in the liquid phase. Characteristics of CMG 273 are presented. (orig.).

  11. 40 CFR 9.1 - OMB approvals under the Paperwork Reduction Act.

    Science.gov (United States)

    2010-07-01

    ...-0078 Books and Records of Pesticide Production and Distribution 169.2 2070-0028 Worker Protection... 271.20-271.21 2050-0041 271.23 2050-0041 Standards for Universal Waste Management 273.14 2050-0145 273... Planning and Community Right-to-Know; Health Professionals 350.5-350.16 2050-0078 350.27 2050-0078 350.40...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 273 of 273 ... DN Iortsuun, AM Chia, AF Adeola. Vol 2, No 4 (2007), The effect of seed mass and cotyledon removal on the germination and growth of fluted pumpkin (telfaria occidentalis hook. F), Abstract PDF. D.N Iortsuun, A.M Chia, A.F Adeola. Vol 12, No 2 (2017), The effect of some estimators of between-study ...

  13. Stability and Rheology of Dilute TiO2 – Water Nanofluids

    Czech Academy of Sciences Publication Activity Database

    Pěnkavová, Věra; Tihon, Jaroslav; Wein, Ondřej

    2011-01-01

    Roč. 6, č. 1 (2011), s. 273 ISSN 1931-7573 R&D Projects: GA ČR GA104/08/0428; GA ČR GA104/09/0972 Institutional research plan: CEZ:AV0Z40720504 Keywords : nanofluids * zeta potential * aws viscometry Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.726, year: 2011 http://www.nanoscalereslett.com/content/6/1/273

  14. Baseline Characteristics in PRIORITY Study: Proteomics and Mineralocorticoid Receptor Antagonism for Prevention of Diabetic Nephropathy in Type 2 Diabetes

    DEFF Research Database (Denmark)

    Tofte, Nete

    have included 1811 patients. The high- and low-risk populations differ in terms of gender, age, diabetes duration, UACR and eGFR (table). Univariate regression analyses of CKD273 vs each baseline variable demonstrated weak associations (R2 of 0.03, p ... and eGFR. In a logistic regression model predicting CKD273 risk strata, including all baseline variables, eGFR and UACR remain statistically significant (p

  15. Author Index

    Indian Academy of Sciences (India)

    Cai, Q., 109. Cao, X. W., 223. Chand, H., 117. Chen, J. L., 333. Chen, L., 193. Chen, X., 261. Chen, X. H., 185. Chen, Y., 269. Chen, Y. J., 25, 61. Chen, Z. F., 243, 269, 273, 277, 315. Chen, Z.-Y., 273. Ciprini, S., 169. Cui, L., 47, 281. Dai, B. Z., 113. Deng, G. G., 79. Ding, Z., 29, 47. Dong, F. T., 227. Fan, J. H., 53, 67, 79, 97, ...

  16. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  17. Generation of a novel live rabies vaccine strain with a high level of safety by introducing attenuating mutations in the nucleoprotein and glycoprotein.

    Science.gov (United States)

    Nakagawa, Keisuke; Nakagawa, Kento; Omatsu, Tsutomu; Katayama, Yukie; Oba, Mami; Mitake, Hiromichi; Okada, Kazuma; Yamaoka, Satoko; Takashima, Yasuhiro; Masatani, Tatsunori; Okadera, Kota; Ito, Naoto; Mizutani, Tetsuya; Sugiyama, Makoto

    2017-10-09

    The current live rabies vaccine SAG2 is attenuated by only one mutation (Arg-to-Glu) at position 333 in the glycoprotein (G333). This fact generates a potential risk of the emergence of a pathogenic revertant by a back mutation at this position during viral propagation in the body. To circumvent this risk, it is desirable to generate a live vaccine strain highly and stably attenuated by multiple mutations. However, the information on attenuating mutations other than that at G333 is very limited. We previously reported that amino acids at positions 273 and 394 in the nucleoprotein (N273/394) (Leu and His, respectively) of fixed rabies virus Ni-CE are responsible for the attenuated phenotype by enhancing interferon (IFN)/chemokine gene expressions in infected neural cells. In this study, we found that amino acid substitutions at N273/394 (Phe-to-Leu and Tyr-to-His, respectively) attenuated the pathogenicity of the oral live vaccine ERA, which has a virulent-type Arg at G333. Then we generated ERA-N273/394-G333 attenuated by the combination of the above attenuating mutations at G333 and N273/394, and checked its safety. Similar to the ERA-G333, which is attenuated by only the mutation at G333, ERA-N273/394-G333 did not cause any symptoms in adult mice after intracerebral inoculation, indicating a low level of residual pathogenicity of ERA-N273/394-G333. Further examination revealed that infection with ERA-N273/394-G333 induces IFN-β and CXCL10 mRNA expressions more strongly than ERA-G333 infection in a neuroblastoma cell line. Importantly, we found that the ERA-N273/394-G333 stain has a lower risk for emergence of a pathogenic revertant than does the ERA-G333. These results indicate that ERA-N273/394-G333 has a potential to be a promising candidate for a live rabies vaccine strain with a high level of safety. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Glutathionylation of Yersinia pestis LcrV and Its Effects on Plague Pathogenesis

    Directory of Open Access Journals (Sweden)

    Anthony Mitchell

    2017-05-01

    Full Text Available Glutathionylation, the formation of reversible mixed disulfides between glutathione and protein cysteine residues, is a posttranslational modification previously observed for intracellular proteins of bacteria. Here we show that Yersinia pestis LcrV, a secreted protein capping the type III secretion machine, is glutathionylated at Cys273 and that this modification promotes association with host ribosomal protein S3 (RPS3, moderates Y. pestis type III effector transport and killing of macrophages, and enhances bubonic plague pathogenesis in mice and rats. Secreted LcrV was purified and analyzed by mass spectrometry to reveal glutathionylation, a modification that is abolished by the codon substitution Cys273Ala in lcrV. Moreover, the lcrVC273A mutation enhanced the survival of animals in models of bubonic plague. Investigating the molecular mechanism responsible for these virulence attributes, we identified macrophage RPS3 as a ligand of LcrV, an association that is perturbed by the Cys273Ala substitution. Furthermore, macrophages infected by the lcrVC273A variant displayed accelerated apoptotic death and diminished proinflammatory cytokine release. Deletion of gshB, which encodes glutathione synthetase of Y. pestis, resulted in undetectable levels of intracellular glutathione, and we used a Y. pestis ΔgshB mutant to characterize the biochemical pathway of LcrV glutathionylation, establishing that LcrV is modified after its transport to the type III needle via disulfide bond formation with extracellular oxidized glutathione.

  19. Catalytic isotope exchange reaction between deuterium gas and water pre-adsorbed on platinum/alumina

    International Nuclear Information System (INIS)

    Iida, Itsuo; Kato, Junko; Tamaru, Kenzi.

    1976-01-01

    The catalytic isotope exchange reaction between deuterium gas and the water pre-adsorbed on Pt/Al 2 O 3 was studied. At reaction temperatures above 273 K, the exchange rate was proportional to the deuterium pressure and independent of the amount of adsorbed water, which suggests that the rate determining step is the supply of deuterium from the gas phase. Its apparent activation energy was 38 kJ mol -1 . Below freezing point of water, the kinetic behaviour was different from that above freezing point. At higher deuterium pressures the rate dropped abruptly at 273 K. Below the temperature the apparent activation energy was 54 kJ mol -1 and the exchange rate depended not on the deuterium pressure but on the amount of the pre-adsorbed water. At lower pressures, however, the kinetic behaviour was the same as the above 273 K, till the rate of the supply of deuterium from the gas phase exceeded the supply of hydrogen from adsorbed water to platinum surface. These results suggest that below 273 K the supply of hydrogen is markedly retarded, the state of the adsorbed water differing from that above 273 K. It was also demonstrated that when the adsorbed water is in the state of capillary condensation, the exchange rate becomes very small. (auth.)

  20. Urinary proteomics predict onset of microalbuminuria in normoalbuminuric type 2 diabetic patients, a sub-study of the DIRECT-Protect 2 study

    DEFF Research Database (Denmark)

    Lindhardt, Morten; Persson, Frederik; Zürbig, Petra

    2016-01-01

    and thirty-seven patients were analysed and 89 developed persistent microalbuminuria (12%) with a mean follow-up of 4.1 years. At baseline the CKD273-classifier predicted development of microalbuminuria during follow-up, independent of treatment (candesartan/placebo), age, gender, systolic blood pressure....... Patients were allocated to candesartan or placebo, with the aim of slowing the progression of retinopathy. The secondary endpoint was development of persistent microalbuminuria (three of four samples). We used a previously defined chronic kidney disease risk score based on proteomic measurement of 273...... urinary peptides (CKD273-classifier). A Cox regression model for the progression of albuminuria was developed and evaluated with integrated discrimination improvement (IDI), continuous net reclassification index (cNRI) and receiver operating characteristic curve statistics. RESULTS: Seven hundred...

  1. Reactive oxygen metabolites (ROMs) are associated with cardiovascular disease in chronic hemodialysis patients.

    Science.gov (United States)

    Bossola, Maurizio; Vulpio, Carlo; Colacicco, Luigi; Scribano, Donata; Zuppi, Cecilia; Tazza, Luigi

    2012-02-11

    The aim of our study was to measure reactive oxygen metabolites (ROMs) in chronic hemodialysis (HD) patients and evaluate the possible association with cardiovascular disease (CVD) and mortality. We measured ROMs in 76 HD patients and correlated with CVD, cardiovascular (CV) events in the follow-up and all-cause and CVD-related mortality. The levels of ROMs presented a median value of 270 (238.2-303.2) CARR U (interquartile range). We created a ROC curve (ROMs levels vs. CVD) and we identified a cut-off point of 273 CARR U. Patients with ROMs levels ≥273 CARR U were significantly older, had higher C-reactive protein levels and lower creatinine concentrations. The prevalence of CVD was higher in patients with ROMs levels ≥273 (87.1%) than in those with ROMs levels <273 CARR U (17.7%; p<0.0001). ROMs levels were significantly higher in patients with CVD (317±63.8) than in those without (242.7±49.1; p<0.0001). At multiple regression analysis, age, creatinine and C-reactive protein were independent factors associated with ROMs. At multiple logistic regression analysis the association between ROMs and CVD was independent (OR: 1.02, 95% CI: 1.00-1.05; p=0.03). Twenty six patients developed cardiovascular (CV) events during the follow-up. Of these, seven were in the group with ROMs levels <273 CARR U and 19 in the group with ROMs levels ≥273 CARR U. The logistic regression analysis showed that both age (OR: 1.06, 95% CI: 1.01-1.12; p=0.013) and ROMs levels (OR: 1.10, 95% CI: 1.00-1.02; p=0.045) were independently associated with CV events in the follow-up. ROMs are independently associated with CVD and predict CV events in chronic HD patients.

  2. Cadherin-6 type 2, K-cadherin (CDH6) is regulated by mutant p53 in the fallopian tube but is not expressed in the ovarian surface.

    Science.gov (United States)

    Karthikeyan, Subbulakshmi; Lantvit, Daniel D; Chae, Dam Hee; Burdette, Joanna E

    2016-10-25

    High-grade serous ovarian cancer (HGSOC) is the most lethal gynecological malignancy and may arise in either the fallopian tube epithelium (FTE) or ovarian surface epithelium (OSE). A mutation in p53 is reported in 96% of HGSOC, most frequently at R273 and R248. The goal of this study was to identify specific gene targets in the FTE that are altered by mutant p53, but not in the OSE. Gene analysis revealed that both R273 and R248 mutant p53 reduces CDH6 expression in the oviduct, but CDH6 was not detected in murine OSE cells. p53R273H induced SLUG and FOXM1 while p53R248W did not induce SLUG and only modestly increased FOXM1, which correlated with less migration as compared to p53R273H. An oviduct specific PAX8Cre/+/p53R270H/+ mouse model was created and confirmed that in vivo mutant p53 repressed CDH6 but was not sufficient to stabilize p53 expression alone. Overexpression of mutant p53 in the p53 null OVCAR5 cells decreased CDH6 levels indicating this was a gain-of-function. SLUG knockdown in murine oviductal cells with p53R273H restored CDH6 repression and a ChIP analysis revealed direct binding of mutant p53 on the CDH6 promoter. NSC59984, a small molecule that degrades mutant p53R273H, rescued CDH6 expression. In summary, CDH6 is expressed in the oviduct, but not the ovary, and is repressed by mutant p53. CDH6 expression with further validations may aide in establishing markers that inform upon the cell of origin of high grade serous tumors.

  3. Nucleotide sequence of the leading region adjacent to the origin of transfer on plasmid F and its conservation among conjugative plasmids.

    Science.gov (United States)

    Loh, S; Cram, D; Skurray, R

    1989-10-01

    The leading region of the Escherichia coli K12 F plasmid is the first segment of DNA to be transferred into the recipient cell during conjugal transfer. We report the nucleotide sequence of the 64.20-66.77F portion of the leading region immediately adjacent to the origin of transfer, oriT. The 2582 bp region encodes three open reading frames, ORF95, ORF169 and ORF273; the product of ORF273, is equivalent in size and map location to the 35 kDa protein, 6d, previously described (Cram et al. 1984). S1 nuclease analyses of mRNA transcripts have identified a potential promoter for ORF95 and ORF273 and indicated that these ORFs are transcribed as a single transcript; in contrast, ORF169 appears to be transcribed from two overlapping promoters on the complementary DNA strand. The products of ORF95 and ORF273 are mainly hydrophilic and are probably located in the cytoplasm. ORF273 shares some homology with DNA-binding proteins. There is a signal peptide sequence at the NH2-terminus of ORF169 and the mature form of ORF169 probably resides in the periplasm due to its hydrophilic nature. Both ORF273 and ORF169 are well conserved among conjugative F-like and a few non-F-like plasmids. On the other hand, ORF95 sequences are only present on some of these plasmids. Several primosome and integration host factor recognition sites are present implicating this region in DNA metabolism and/or replication functions.

  4. Effect of copper, tin, phosphorous and arsenic on the surface cracking of a 18-8 stainless steel during hot compression tests

    International Nuclear Information System (INIS)

    Botella, J.; Fernandez, M.T.; Fernandez de Castillo, I.

    1998-01-01

    The effect of certain different concentrations of Cu, Sn, P and As on the surface cracking of 18-8 austenitic stainless steel hot compressed specimens has been studied, at 1,123 and 1,273 K, in an oxidizing atmosphere (air). A procedure for determining surface cracking has been established, and the cracking factor obtained in this ways is correlated with the chemical composition of the materials at both temperatures. The cracking factors obtained at 1,273 K have been compared with the reduction of area drops obtained by hot tension tests at the same temperature. (Author) 5 refs

  5. CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

    Directory of Open Access Journals (Sweden)

    Ana Arenillas

    2013-10-01

    Full Text Available Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar and capacities (>2 mmol·g−1 at 273 K. Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes.

  6. CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

    Science.gov (United States)

    Bermúdez, José M.; Dominguez, Pablo Haro; Arenillas, Ana; Cot, Jaume; Weber, Jens; Luque, Rafael

    2013-01-01

    Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar) and capacities (>2 mmol·g−1 at 273 K). Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes. PMID:28788352

  7. 100 Companies Receiving the Largest Dollar Volume of Prime Contract Awards, Fiscal Year 1963

    Science.gov (United States)

    1963-01-01

    Chrysler Corp. 3. North American Aviation, Inc. 98. Clark Equipment Co. 24. Northrop Corp. 39. Collins Radio Co. 45. Continental Motors Corp. 56. Olin...Willamette Iron & Steel Co. 27.3 0.1 Total 27.3 0.1 73.5 9. CARRIER CORP. 26.8 0. Spectrol Electronics Corp. 0.1 jd Total 2 0.1 73.6 98. CLARK EQUIEMENT...venture of Morrison-Knudsen Co., Inc., Paul Hardeman, Inc., Perini Corp., C. H. Leavell & Co., and Utah Construction & Mining Co. Office of the Secretary of Defense 13

  8. Mass strandings of various ommastrephid squid species have been ...

    African Journals Online (AJOL)

    spamer

    escape reaction, to jet backwards at speed, is commonly observed. Appearing to work their jets at top pressure with ... north-east of the continental shelf break, in an area influenced by the confluence of Antarctic circumpolar ..... the Indian Ocean sector of the Southern Ocean. Polar Biol. 11(4): 273–275. PRESCOTT, R. 1977 ...

  9. An Exploration of Adlerian Lifestyle Themes and Alcohol-Related Behaviors among College Students

    Science.gov (United States)

    Lewis, Todd F.; Osborn, Cynthia J.

    2004-01-01

    The aim of this study was to investigate college student drinking through the lens of Adlerian theory. In a sample of 273 participants, multiple regression analyses confirmed that certain lifestyle themes were associated with alcohol-related behaviors and that men and women who engage in drinking differ in their convictions and goals as defined by…

  10. 78 FR 49490 - Commission Information Collection Activities (Ferc-511); Comment Request; Extension

    Science.gov (United States)

    2013-08-14

    ... bodies of water over which Congress has jurisdiction under its authority to regulate commerce with... public comment on the currently approved information collection, FERC-511 (Transfer of Electric License... (202) 502-8663, and fax at (202) 273-0873. SUPPLEMENTARY INFORMATION: Title: Transfer of Electric...

  11. 48 CFR 552.238-70 - Identification of Electronic Office Equipment Providing Accessibility for the Handicapped.

    Science.gov (United States)

    2010-10-01

    ... Electronic Office Equipment Providing Accessibility for the Handicapped. 552.238-70 Section 552.238-70... Equipment Providing Accessibility for the Handicapped. As prescribed in 538.273(a)(1), insert the following clause: Identification of Electronic Office Equipment Providing Accessibility for the Handicapped (SEP...

  12. An Investigation of Academic Procrastination, Locus of Control, and Emotional Intelligence

    Science.gov (United States)

    Deniz, M. Engin; Tras, Zeliha; Aydogan, Didem

    2009-01-01

    In this research, the effects of emotional intelligence on the academic procrastination and locus of control tendencies of a group of university students are investigated. The sample of this study consists of 435 university students including 273 female students and 162 male students who were randomly selected from the population of Selcuk…

  13. Upper Abdominal Ultra-Sonography Findings in HIV Patients at ...

    African Journals Online (AJOL)

    Design: A descriptive cross-sectional study. Setting: Kenyatta National Hospital and the Defence Forces Memorial Hospital, Nairobi, Kenya. Subjects: HIV infected patients referred for upper abdominal sonography within the study duration of eight months. Results: Two hundred and seventy three (273) patients were ...

  14. Women's Issues and Epilepsy: A Look at Health Care Practitioners ...

    African Journals Online (AJOL)

    About thirty six percent of the respondents were neurologists, 27.3% were in Internal Medicine while the rest comprised of general practitioners, pediatric neurologists, neurosurgeons, neuroscience nurses and neurophysiologists. There was poor knowledge of the effect of sex hormones on seizure threshold during ...

  15. Generativity in College Students: Comparing and Explaining the Impact of Mentoring

    Science.gov (United States)

    Hastings, Lindsay J.; Griesen, James V.; Hoover, Richard E.; Creswell, John W.; Dlugosh, Larry L.

    2015-01-01

    Preparing college students to be active contributors to the next generation is an important function of higher education. This assumption about generativity forms a cornerstone in this mixed methods study that examined generativity levels among 273 college students at a 4-year public university. MANCOVA results indicated that college students who…

  16. The Delphi Method and Its Applications: A Bibliography

    Science.gov (United States)

    1976-06-01

    1969. 273p. Asimov, Isaac, The Solar System and the Future., Social Speculations, Richard Kostelantez. 13p. Asimov, Isaac, The Next 100 Years...University Press, 1959. 17 iI Si l•_. _ m II-- - Cooker , George To Jrs, and Miller, David C. "Corporation Oracles j Peer into the Future: A Rep’art of a

  17. Recenzie: Oferta „diferenţei”: feminismul românesc interbelic (Book review: The Offer of ”Difference”: Romanian Interwar Feminism

    Directory of Open Access Journals (Sweden)

    Viorella MANOLACHE

    2015-09-01

    Full Text Available Anemari Monica Negru (editor, Alexandrina Cantacuzino și mişcarea feministă din anii interbelici, Vol. I, Editura Cetatea de Scaun, Târgovişte, 2014, 320 p., (ISBN 978-606-537-273-3.

  18. Newly isolated Nodularia phage influences cyanobacterial community dynamics

    Czech Academy of Sciences Publication Activity Database

    Coloma, S.E.; Dienstbier, Ana; Bamford, D.H.; Sivonen, K.; Roine, E.; Hiltunen, T.

    2017-01-01

    Roč. 19, č. 1 (2017), s. 273-286 ISSN 1462-2912 Institutional support: RVO:61388971 Keywords : Baltic sea cyanobacteria * Blue-green-algae * Nitrogen-fixation Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 5.395, year: 2016

  19. Notch co-operates with Lozenge/Runx to lock hemocytes into a differentiation programme

    Czech Academy of Sciences Publication Activity Database

    Terriente-Felix, A.; Li, J.; Collins, S.; Mulligan, A.; Reekie, I.; Bernard, F.; Krejčí, Alena; Bray, S.

    2013-01-01

    Roč. 140, č. 4 (2013), s. 926-937 ISSN 0950-1991 R&D Projects: GA ČR(CZ) GAP305/11/0126 Grant - others:MRC programme(GB) G0800034 Institutional support: RVO:60077344 Keywords : Lozenge/Runx * Notch * chromatin immunoprecipitation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.273, year: 2013

  20. Cambodian Parental Involvement: The Role of Parental Beliefs, Social Networks, and Trust

    Science.gov (United States)

    Eng, Sothy; Szmodis, Whitney; Mulsow, Miriam

    2014-01-01

    The role of social capital (parental beliefs, social networks, and trust) as a predictor of parental involvement in Cambodian children's education was examined, controlling for human capital (family socioeconomic status). Parents of elementary students (n = 273) were interviewed face to face in Cambodia. Teacher contact scored highest, followed by…

  1. HIV-infectie en riskant gedrag onder druggebruikers in Arnhem

    NARCIS (Netherlands)

    Wiessing LG; Houweling H; van den Akker R; Katchaki JN; Servaas JHJ; van Rossum JMA

    1993-01-01

    Objectives: 1) To get information about the spread of HIV among drug users in the Netherlands outside Amsterdam and 2) to develop tools for surveillance research among drug users. Methods: In 1991-1992 273 drug users with (protocol 1 ; n=181) and without contact with the methadonepost (protocol 2

  2. Dovedně zvládnutá přítomnost přináší příjemnou budoucnost: Sociální reprezentace smrti na Srí Lance u Theravádových mnichů a jejich podpůrců

    Czech Academy of Sciences Publication Activity Database

    Hytych, Roman

    2006-01-01

    Roč. 50, č. 3 (2006), s. 273-284 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : social representations * death * cultural psychology Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  3. Download this PDF file

    African Journals Online (AJOL)

    boys aged 8.5 ± 3.84 years, attending the genetic clinics at Menoufiya Univer‑ sity hospitals. They represented ... site 46, Fra(X) (q27.3), inv (Y). conclusion: So, in a child with isolated mental retardation or autism of un‑ ... A national multicenter genetic study of fragile X syndrome among affected children and their families is ...

  4. Energetic Materials - Technology, Manufacturing and Processing, 27th International Annual Conference of ICT June 25 - June 28, 1996 Karisruhe, Federal Republic of Germany.

    Science.gov (United States)

    1997-02-01

    Jouguet Detonations. Report NASA SP 273, NASA Lewis Research Center. Heuz6, 0., 1989. C6lculo Num~rico das Propriedades das Misturas Gasosas em Equilibrio ...Gasosas em Equilibrio Termodindmico, Universidade de Coimbra, Portugal. Heuz6, 0., Presles, H. N., Bauer, P., (1985). Computation of Chemical

  5. Novelty Elements and Changes brought to Adoption Procedure by Law No. 57/2016

    Directory of Open Access Journals (Sweden)

    Creț Daniela

    2017-06-01

    Full Text Available Adoption is chief among the measures of alternative protection that can be taken to protect a child in Romania. According to Law no. 273/2004 on adoption procedure, current forms under which adoption can be found are domestic adoption and international adoption.

  6. Molecular diversity and genetic relationships in Secale

    Indian Academy of Sciences (India)

    Molecular diversity and genetic relationships in Secale. E. Santos, M. Matos, P. Silva, A. M. Figueiras, C. Benito and O. Pinto-Carnide. J. Genet. 95, 273–281. Table 1. RAPD and ISSR primers used in this study. Primer. 5 –3. Primer. 5 –3. RAPDs (Operon). A1. CAGGCCCTTC. C5. CATGACCGCC. A4. AATCGGGCTG. C6.

  7. Spectral Variability in Hard X-rays and the Evidence for a 13.5 Years ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Abstract. We report the observation of nearest quasar 3C273 made with LASE instrument on November 20th, 1998 as a part of our continuing programme of balloon borne hard X-ray observations in the 20–200 keV band using high sensitivity Large Area Scintillation counter Experiment. Our data clearly show a steep ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 273 ... Vol 38, No 3 (2012), New Glucopyranosylglyceryl-N-Octenyl Adipate and Bioactivity of Retro and Condensed Chalcones from Toussaintia Orientalis ... Vol 38, No 3 (2012), Organochlorine Pesticides and Degradation Products in Soil around a Former Formulation Plant in Morogoro Municipality, ...

  9. Structure of the motor subunit of type I restriction-modification complex EcoR124I

    Czech Academy of Sciences Publication Activity Database

    Lapkouski, Mikalai

    2009-01-01

    Roč. 1, č. 16 (2009), s. 94-95 ISSN 1545-9985 Institutional research plan: CEZ:AV0Z60870520 Keywords : SWI2/SNF2 ATPASE * DNA * ENDONUCLEASE Subject RIV: CE - Biochemistry Impact factor: 12.273, year: 2009

  10. Structure of the motor subunit of type I restriction-modification complex EcoR124I

    Czech Academy of Sciences Publication Activity Database

    Lapkouski, Mikalai; Panjikar, S.; Janscak, P.; Kutá-Smatanová, Ivana; Carrey, J.; Ettrich, Rüdiger; Cséfalvay, Eva

    2009-01-01

    Roč. 16, č. 1 (2009), s. 94-95 ISSN 1545-9985 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60870520 Keywords : SWI2/SNF2 ATPASE * DNA * endonuclease * protein * translocation * helicase * treckings * enzymes * core * time Subject RIV: CE - Biochemistry Impact factor: 12.273, year: 2009

  11. Significant enhancement of gas uptake capacity and selectivity via the judicious increase of open metal sites and Lewis basic sites within two polyhedron-based metal-organic frameworks.

    Science.gov (United States)

    Liu, Bing; Yao, Shuo; Shi, Chao; Li, Guanghua; Huo, Qisheng; Liu, Yunling

    2016-02-21

    Two new isomorphous polyhedron-based MOFs ( and ), with dual functionalities of OMSs and LBSs, have been synthesized by using the SBB strategy. By judiciously avoiding the DABCO axial ligand, possesses more OMSs than , and exhibits a significant enhancement of CO2 uptake capacity 210 versus 162 cm(3) g(-1) for at 273 K under 1 bar.

  12. Mediating team effectiveness in the context of collaborative learning: The importance of team and task awareness

    NARCIS (Netherlands)

    Fransen, Jos; Kirschner, Paul A.; Erkens, Gijsbert

    2010-01-01

    Fransen, J., Kirschner, P. A., & Erkens, G. (2011). Mediating team effectiveness in the context of collaborative learning: The importance of team and task awareness. Computers in Human Behavior, 27(3), 1103-1113. doi:10.1016/j.chb.2010.05.017

  13. Molecular cloning, expression and regulation of the avian tubby-like protein 1 (.I.tulp./I.1) gene

    Czech Academy of Sciences Publication Activity Database

    Heikenwalder, M. F.; Koritschoner, N. P.; Pajer, Petr; Chaboissier, M.; Kurz, S. M.; Briegel, K. J.; Bartůněk, Petr; Zenke, M.

    2001-01-01

    Roč. 273, č. 1 (2001), s. 131-139 ISSN 0378-1119 Institutional research plan: CEZ:AV0Z5052915 Keywords : tulp * tubby * thyroid hormone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.041, year: 2001

  14. Long-term Periodicity Analysis of Polarization Variation for Radio ...

    Indian Academy of Sciences (India)

    Kochanev, P. Yu., Gabuzda, D. C. 1998, In: Radio Emission From Galactic and Extragalactic. Compact Sources (eds) Zensus, J. A., Taylor, G. B., Wrobel, J. M., San Francisco: ASP, p. 273. Lomb, N. R. 1976, ApS&S, 39, 447. Mead, A. R. G., Ballard, K. R., Brand, P. W. J. L. et al. 1990, Astron. Astrophys. Suppl. Ser.,. 83, 183.

  15. Climatic factors affecting radial growth of Betula ermanii and Betula platypylla in Kamchatka

    Czech Academy of Sciences Publication Activity Database

    Doležal, Jiří; Ishii, H.; Kyncl, Tomáš; Takahashi, K.; Vetrova, V. P.; Homma, K.; Sumida, A.; Hara, T.

    2010-01-01

    Roč. 40, č. 2 (2010), s. 273-285 ISSN 0045-5067 R&D Projects: GA ČR GA206/05/0119; GA AV ČR IAA600050802 Institutional research plan: CEZ:AV0Z60050516 Keywords : tree-ring widths * boreal forest * Central Japan Subject RIV: EF - Botanics Impact factor: 1.574, year: 2010

  16. Exome Genotyping Identifies Pleiotropic Variants Associated with Red Blood Cell Traits

    NARCIS (Netherlands)

    Chami, N. (Nathalie); M.-H. Chen (Ming-Huei); Slater, A.J. (Andrew J.); Eicher, J.D. (John D.); E. Evangelou (Evangelos); Tajuddin, S.M. (Salman M.); Love-Gregory, L. (Latisha); T. Kacprowski (Tim); U.M. Schick (Ursula); Nomura, A. (Akihiro); Giri, A. (Ayush); Lessard, S. (Samuel); J. Brody (Jennifer); C. Schurmann (Claudia); V.S. Pankratz (Shane); L.R. Yanek (Lisa); A. Manichaikul (Ani); R. Pazoki (Raha); E. Mihailov (Evelin); W.D. Hill (W. David); Raffield, L.M. (Laura M.); A.D. Burt (Alastair); T.M. Bartz (Traci M.); D.M. Becker (Diane); L.C. Becker (Lewis); E.A. Boerwinkle (Eric); J. Bork-Jensen (Jette); E.P. Bottinger (Erwin); M.L. O'Donoghue (Michelle L.); D.R. Crosslin (David); de Denus, S. (Simon); Dubé, M.-P. (Marie-Pierre); P. Elliott (Paul); G. Engström; M. Evans (Michele); J. Floyd (James); M. Fornage (Myriam); Gao, H. (He); A. Greinacher (Andreas); V. Gudnason (Vilmundur); T. Hansen (T.); T.B. Harris (Tamara); C. Hayward (Caroline); Hernesniemi, J. (Jussi); H. Highland (Heather); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Irvin, M.R. (Marguerite R.); M. Kähönen (Mika); E.M. Lange (Ethan); Launer, L.J. (Lenore J.); T. Lehtimäki (Terho); Li, J. (Jin); D.C. Liewald (David C.); A. Linneberg (Allan); Y. Liu (YongMei); Y. Lu (Yingchang); L.-P. Lyytikäinen (Leo-Pekka); R. Mägi (Reedik); J. Mathias (Jasmine); O. Melander (Olle); A. Metspalu (Andres); K. Mononen (Kari); M.A. Nalls (Michael); D.A. Nickerson (Deborah); K. Nikus (Kjell); C.J. O'Donnell (Christopher); M. Orho-Melander (Marju); O. Pedersen (Oluf); A. Petersmann (Astrid); Polfus, L. (Linda); B.M. Psaty (Bruce); O.T. Raitakari (Olli T.); Raitoharju, E. (Emma); Richard, M. (Melissa); K.M. Rice (Kenneth); F. Rivadeneira Ramirez (Fernando); Rotter, J.I. (Jerome I.); Schmidt, F. (Frank); A.V. Smith (Albert Vernon); J.M. Starr (John); K.D. Taylor (Kent); A. Teumer (Alexander); Thuesen, B.H. (Betina H.); Torstenson, E.S. (Eric S.); R.P. Tracy (Russell); I. Tzoulaki; N.A. Zakai (Neil); Vacchi-Suzzi, C. (Caterina); C.M. van Duijn (Cornelia); F.J.A. van Rooij (Frank); M. Cushman (Mary Ann); I.J. Deary (Ian J.); Velez Edwards, D.R. (Digna R.); Vergnaud, A.-C. (Anne-Claire); L.C. Wallentin (Lars); D. Waterworth (Dawn); White, H.D. (Harvey D.); J.F. Wilson (James); A.B. Zonderman; S. Kathiresan (Sekar); N. Grarup (Niels); T. Esko (Tõnu); R.J.F. Loos (Ruth); L.A. Lange (Leslie); Faraday, N. (Nauder); Abumrad, N.A. (Nada A.); T.L. Edwards (Todd L.); S.K. Ganesh (Santhi); P. Auer (Paul); A.D. Johnson (Andrew); A. Reiner (Alexander); G. Lettre (Guillaume)

    2016-01-01

    textabstractRed blood cell (RBC) traits are important heritable clinical biomarkers and modifiers of disease severity. To identify coding genetic variants associated with these traits, we conducted meta-analyses of seven RBC phenotypes in 130,273 multi-ethnic individuals from studies genotyped on an

  17. Exome Genotyping Identifies Pleiotropic Variants Associated with Red Blood Cell Traits

    DEFF Research Database (Denmark)

    Chami, Nathalie; Chen, Ming-Huei; Slater, Andrew J

    2016-01-01

    Red blood cell (RBC) traits are important heritable clinical biomarkers and modifiers of disease severity. To identify coding genetic variants associated with these traits, we conducted meta-analyses of seven RBC phenotypes in 130,273 multi-ethnic individuals from studies genotyped on an exome ar...

  18. Degradation of natural toxins by phthalocyanines-example of cyanobacterial toxin, microcystin

    Czech Academy of Sciences Publication Activity Database

    Jančula, D.; Blahová, L.; Karásková, M.; Maršálek, Blahoslav

    2010-01-01

    Roč. 62, č. 2 (2010), s. 273-278 ISSN 0273-1223 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : microcystin * phthalocyanine * singled oxygen Subject RIV: EF - Botanics Impact factor: 1.056, year: 2010

  19. Extended metal–organic solids based on benzenepolycarboxylic ...

    Indian Academy of Sciences (India)

    ... Symposia · Live Streaming. Home; Journals; Journal of Chemical Sciences; Volume 112; Issue 3. Extended metal-organic solids based on benzenepolycarboxylic and aminobenzoic acids. R Murugavel G Anantharaman D Krishnamurthy M Sathiyendiran M G Walawalkar. Volume 112 Issue 3 June 2000 pp 273-290 ...

  20. Classifying cubic edge-transitive graphs of order 8p8p8p

    Indian Academy of Sciences (India)

    Annals of Discrete. Math. 34 (1987) 273–286. [14] Klin M L, On edge but not vertex transitive regular graphs, Colloq-Math. Soc. Janos. Bolyai, 25, Algebric Methods in Graph Theory (Szeged, Hungary, Budapest) (1981) pp. 399–403. [15] Lu Z, Wang C Q and Xu M Y, On semisymmetric cubic graphs of order 6p2, Science in.

  1. Atomistic modeling of diffuse scattering in cubic PbZrO.sub.3./sub..

    Czech Academy of Sciences Publication Activity Database

    Pasciak, Marek; Welberry, T.R.; Heerdegen, A.P.; Laguta, Valentyn; Ostapchuk, Tetyana; Leoni, S.; Hlinka, Jiří

    2015-01-01

    Roč. 88, č. 3 (2015), s. 273-282 ISSN 0141-1594 R&D Projects: GA ČR GA13-15110S Institutional support: RVO:68378271 Keywords : diffuse scattering * local structure * soft modes * anti-ferroelectricity * zirconates * molecular dynamics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.858, year: 2015

  2. Prevalence and economic loss of bovine tuberculosis in a municipal ...

    African Journals Online (AJOL)

    A 12 month cross-sectional study was carried out at Lafenwa Abattoir Abeokuta, Southwestern Nigeria from July, 2011 to June, 2012. This was to determine the prevalence and economic loss of bovine tuberculosis in this abattoir. A total of 928 cases of bovine tuberculosis out of 52,273 cattle slaughtered during this period ...

  3. African Journal of Neurological Sciences 2013 - Vol. 32, No 2 http ...

    African Journals Online (AJOL)

    Gukiusu

    Epilepsia. 2010;51(9):1889-1893. 2. ASADI-POOYA AA, EMAMI M, NIKSERESHT A. Early-onset versus typical childhood absence epilepsy; clinical and electrographic characteristics. Seizure. 2012;21(4):273-5. 3. DESGUERRE I. Données épidémiologiques sur l'épilepsie de l'enfant. Cours de perfectionnement en.

  4. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... College Station, TX 77843. Present address: Barrens Consulting Co., 273 Pepe's Farm Road, Milford, CT 06470. Department of Physics, Sam Houston State University, Huntsville, TX 77341. Present address: SN4, NASA-JSC, Houston, TX 77858. Shell Development Corporation, P.O. Box 481, Houston, Texas 77001.

  5. Volumetric studies of some amino acids in binary aqueous solutions ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volumetric studies of some amino acids in binary aqueous solutions of MgCl2.6H2O at 288.15, and 308.15 K. Amalendu Pal Suresh Kumar. Volume 117 Issue 3 May 2005 pp 267-273 ...

  6. Detection and characterization of feline Bartonella henselae in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Melter, O.; Hercík, Kamil; Weyant, R. S.; Janeček, Jiří; Němec, A.; Mecera, J.; Gonzorová, L.; Branny, Pavel

    2003-01-01

    Roč. 93, - (2003), s. 261-273 ISSN 0378-1135 R&D Projects: GA ČR GA310/98/0417; GA ČR GP204/02/D121 Institutional research plan: CEZ:AV0Z5020903 Keywords : bartonella henselae * cat * molecular typing Subject RIV: EE - Microbiology, Virology Impact factor: 1.571, year: 2003

  7. Depth-recursive tomography of the Bohemian Massif at the CEL09 transect—Part B: Interpretation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Miroslav

    2012-01-01

    Roč. 33, č. 2 (2012), s. 243-273 ISSN 0169-3298 R&D Projects: GA MŠk LA08036 Institutional research plan: CEZ:AV0Z30120515 Keywords : depth-recursive refraction tomography * Bohemian Massif * CEL09 profile Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.125, year: 2012

  8. The Relationship among Transformational Teaching and Student Motivation and Learning

    Science.gov (United States)

    Noland, Aaron; Richards, Keith

    2014-01-01

    Transformational leadership is a well-documented and validated leadership perspective studied in management and organizational contexts that has recently been applied to the instructional context. The current study predicted a positive relationship between teacher transformational leadership and learning, and motivation. A population of 273

  9. Molecular mapping of a stripe rust resistance gene in wheat line C51

    Indian Academy of Sciences (India)

    2014-08-18

    Aug 18, 2014 ... McIntosh R. A., Dubcovsky J., Rogers W. J., Morris C., Appels R. and Xia X. C. 2010 Catalogue of gene symbols for wheat: 2010. Supplement. Annu. Wheat Newslett. 56, 273–282. McIntosh R. A., Yamazaki Y., Dubcovsky J., Rogers J., Morris C.,. Somers D. J. et al. 2008 Catalogue of gene symbols for wheat ...

  10. On the pumping effect in a pipe/tank flow configuration with friction

    Czech Academy of Sciences Publication Activity Database

    Cid, J.A.; Propst, G.; Tvrdý, Milan

    273-274, April (2014), s. 28-33 ISSN 0167-2789 R&D Projects: GA ČR(CZ) GA14-06958S Institutional support: RVO:67985840 Keywords : valveless pumping * singular problem * periodic solution Subject RIV: BA - General Mathematics Impact factor: 1.636, year: 2014 http://www.sciencedirect.com/science/article/pii/S0167278914000190

  11. 75 FR 65489 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2010-10-25

    ... humans are, therefore, often uncertain or unknown, particularly, for many new or ``emerging'' chemicals... with materials containing these chemicals. Furthermore, young children eat and drink more per pound of.... There is no cost to respondents other than their time. The total estimated annual burden hours are 273...

  12. A review on recent developments in solar distillation units

    Indian Academy of Sciences (India)

    tries to produce distillate by using the solar energy; however, the efficiencies of such ..... obtained from industrial distillation plants. Further the tests .... (1) Still production sponge cubes effect of enhanced from 18 in basin sponge cube to 273% size, volume of compared to that sponge, water without sponge depth, use of.

  13. COMBUSTION MODIFICATION CONTROL OF NITROGEN OXIDES (EPA/600/F-95/012)

    Science.gov (United States)

    EPA's efforts in research and development of nitrogen oxide (NOx) control technologies bymeans of modifying the combustion process have played a major role in reducing stationarysource NOx emissions by over 3 million tons (2.73 x 10^6 tonnes) annually, and have led to at<...

  14. Targeting Sphingosine-1-Phosphate Axis in Obesity-Promoted Breast Cancer

    Science.gov (United States)

    2016-05-01

    201600394R. [Epub ahead of print] Exogenous ceramide-1-phosphate (C1P) and phospho-ceramide analogue-1 (PCERA-1) regulate key macrophage activities...Equal contributor Avni D, Levkovitz S, Maltz L, Oron U. Protection of skeletal muscles from ischemic injury: low-level laser therapy increases antioxidant activity. Photomed Laser Surg. 2005 Jun;23(3):273-7. 11 Blank Page

  15. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Development of multimodel ensemble based district level medium range rainfall forecast system for Indian region. S K Roy Bhowmik V R Durai. Volume 121 Issue 2 April 2012 pp 273-285 ...

  16. Pattern and antimicrobial sensitivity of pathogens in acute bacterial ...

    African Journals Online (AJOL)

    using 3 diagnostic methods (Gram stain, culture and LPA). The 3 commonest organisms were Streptococcus pneumoniae 34 (51.5%), Haemophilus influenzae 18 (27.3%), and Neisseria meningitidis 12 (11.2%). The sensitivity of the isolates to three commonly used noncephalosporin antibiotics was chloramphenicol 74.4% ...

  17. Here comes the bad news: Doctor robot taking over

    NARCIS (Netherlands)

    Hoorn, J.F.; Winter, S.D.

    2017-01-01

    To test in how far the Media Equation and Computers Are Social Actors (CASA) validly explain user responses to social robots, we manipulated how a bad health message was framed and the language that was used. In the wake of Experiment 2 of Burgers et al. (Patient Educ Couns 89(2):267–273, 2012.

  18. Composite conductors for high pulsed magnetic fields

    International Nuclear Information System (INIS)

    Dupouy, F.; Askenazy, S.; Peyrade, J.P.; Legat, D.

    1995-01-01

    In this paper, two kinds of reinforced conductors, with high strength and high conductivity are discussed: stainless steel clad copper wires (σ uts (77 K)=1370 MPa for 50% of stainless steel) and copper wires with 9 million continuous filaments of niobium (σ uts (77 K)=1050 MPa for 25% of niobium; resistivity ratio from 273 to 77 K: 5.43). (orig.)

  19. Motivation and Engagement in the "Asian Century": A Comparison of Chinese Students in Australia, Hong Kong, and Mainland China

    Science.gov (United States)

    Martin, A. J.; Yu, Kai; Hau, Kit-Tai

    2014-01-01

    The present study investigated multidimensional motivation and engagement among Chinese middle school students in Australia (N?=?273), Hong Kong (N?=?528), and Mainland China (N?=?2106; randomly selected N?=?528). Findings showed that a multidimensional model of motivation and engagement fit very well for all three groups. Multi-group invariance…

  20. Gaseous Ni+ complexes with BINOL derivatives and chiral esters in the gas phase: An experimental and theoretical investigation

    Czech Academy of Sciences Publication Activity Database

    Novara, F. R.; Zhang, X.; Schröder, Detlef; Schwarz, H.

    2009-01-01

    Roč. 74, č. 2 (2009), s. 255-273 ISSN 0010-0765 R&D Projects: GA AV ČR KJB400550704 Institutional research plan: CEZ:AV0Z40550506 Keywords : BINOL * enantioselectivity * ethyl butyrate * ethyl lactate * nickel Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.856, year: 2009

  1. Vocabulary Development in Greek Children: A Cross-Linguistic Comparison Using the Language Development Survey

    Science.gov (United States)

    Papaeliou, Christina F.; Rescorla, Leslie A.

    2011-01-01

    This study investigated vocabulary size and vocabulary composition in Greek children aged 1 ; 6 to 2 ; 11 using a Greek adaptation of Rescorla's Language Development Survey (LDS; Rescorla, 1989). Participants were 273 toddlers coming from monolingual Greek-speaking families. Greek LDS data were compared with US LDS data obtained from the…

  2. Emotional Intelligence, Self-Efficacy, and Coping among Chinese Prospective and In-Service Teachers in Hong Kong

    Science.gov (United States)

    Chan, David W.

    2008-01-01

    Emotional intelligence (intrapersonal and interpersonal) and general teacher self-efficacy were assessed to represent personal resources facilitating active and passive coping in a sample of 273 Chinese prospective and in-service teachers in Hong Kong. Intrapersonal emotional intelligence and interpersonal emotional intelligence were found to…

  3. Classification of Spectra of Emission Line Stars Using Machine Learning Techniques

    Czech Academy of Sciences Publication Activity Database

    Bromová, P.; Škoda, Petr; Vážný, Jaroslav

    2014-01-01

    Roč. 11, č. 3 (2014), s. 265-273 ISSN 1476-8186 R&D Projects: GA ČR GA13-08195S Institutional support: RVO:67985815 Keywords : Be star * stellar spectrum * feature extraction Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  4. The Correspondence of Mary Stuart, Princess Royal and Princess of Orange (currently 352 letters)

    NARCIS (Netherlands)

    Huysman, E.C.M.

    2016-01-01

    Currently this catalogue contains the metadata for 352 letters, 273 of which are conserved in the Royal Collections at The Hague. The letters are written in German, French, and Dutch, and they date from 1641 to 1660. Mary’s outgoing letters are kept in a letter book which is held at the Dutch Royal

  5. Chinese Children's Conceptions of Shyness: A Prototype Approach

    Science.gov (United States)

    Xu, Yiyuan; Farver, Jo Ann M.; Yang, Yu; Zeng, Qiang

    2008-01-01

    Three studies were conducted to explore Chinese children's understanding of shyness. In Study 1 (N = 174, M age = 10.18) interviews with Chinese children revealed a group of diverse attributes that characterized their conceptions of shyness. In Study 2 (N = 273, M age = 10.19) a rating procedure was used to identify attributes that were…

  6. SERDP and ESTCP Technical Exchange Meeting on DoD Operational Range Assessment and Management Approaches

    Science.gov (United States)

    2007-10-01

    fluidized bed reactor. Ground Water Monitoring and Remediation 27(3) 1-6. Gerald, J.A. and M.S. Dortch. 2004. Predicting range UXO source quantity and its...Traditional methodologies for contaminated groundwater, which include pump and treat followed by granulated activated carbon filtration (Bricka and

  7. Presence and analysis of plasmids in human and animal associated Arcobacter species

    DEFF Research Database (Denmark)

    Douidah, Laid; De Zutter, Lieven; Van Nieuwerburgh, Filip

    2014-01-01

    In this study, we report the screening of four Arcobacter species for the presence of small and large plasmids. Plasmids were present in 9.9% of the 273 examined strains. One Arcobacter cryaerophilus and four Arcobacter butzleri plasmids were selected for further sequencing. The size of three sma...

  8. Herbal dietary supplements and knowledge of appropriate use ...

    African Journals Online (AJOL)

    %) and Aloe vera (32.2%). Fifty eight (71.6%) out of the 81 respondents on prescription drugs were using it alongside HDS. Respondents with poor, fair and good knowledge of appropriate use of HDS were 69.1%, 27.3% and 3.6% respectively.

  9. Improvement of dynamic absorber by means of weak stops

    Czech Academy of Sciences Publication Activity Database

    Půst, Ladislav

    2003-01-01

    Roč. 48, č. 48 (2003), s. 273-299 ISSN 0001-7043 R&D Projects: GA AV ČR IBS2076301 Institutional research plan: CEZ:AV0Z2076919 Keywords : damping of vibrations * 2DOF system * Hert's Impacts Subject RIV: BI - Acoustics

  10. Pupils' Self-Regulation in Physical Education: The Role of Motivational Climates and Differential Achievement Goals

    Science.gov (United States)

    Ommundsen, Yngvar

    2006-01-01

    This study examined the relationship of motivational climate and differential achievement goals to meta-cognitive self-regulation, regulation of effort, help-seeking and self-handicapping in physical education (PE). The sample consisted of 273 pupils (boys n = 125; girls n = 148) attending 10th grade PE classes in Norway. Both motivational…

  11. Shumwayite,[(UO.sub.2./sub.)(SO.sub.4./sub.)(H.sub.2./sub.O).sub.2./sub.].sub.2./sub.·H.sub.2./sub.O, a new uranyl sulfate mineral from Red Canyon, San Juan County, Utah, USA

    Czech Academy of Sciences Publication Activity Database

    Kampf, A.R.; Plášil, Jakub; Kasatkin, A.V.; Marty, J.; Čejka, J.; Lapčák, L.

    2017-01-01

    Roč. 81, č. 2 (2017), s. 273-285 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : shumwayite * new mineral * uranyl sulfate * crystal structure * infrared and Raman spectroscopy Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.285, year: 2016

  12. Nové minerály uranu popsané v nedávné minulosti

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 25, č. 3 (2017), s. 261-273 ISSN 1213-0710 R&D Projects: GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : uranium minerals * Red Canyon area * Blue Lizard mine Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology

  13. Navigation Method for Autonomous Robots in a Dynamic Indoor Environment

    Czech Academy of Sciences Publication Activity Database

    Věchet, Stanislav; Chen, K.-S.; Krejsa, Jiří

    2013-01-01

    Roč. 3, č. 4 (2013), s. 273-277 ISSN 2223-9766 Institutional support: RVO:61388998 Keywords : particle filters * autonomous mobile robots * mixed potential fields Subject RIV: JD - Computer Applications, Robotics http://www.ausmt.org/index.php/AUSMT/article/view/214/239

  14. C:\\Users\\AISA\\Desktop\\SORO S..xps

    African Journals Online (AJOL)

    AISA

    Agronomie Africaine 26 (3) : 261 - 273 (2014). 261 ... 1Centre Suisse de Recherche Scientifique. E-mail ... des résultats. Mots clés : Chou, Ergofito Defense, engrais organique, insecticide. ABSTRACT. STUDY OF INSECTICIDE AND FERTILIZING PROPERTIES OF LIQUID ORGANIC FERTILIZER «Ergofito defense».

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:

  16. ISSN 2073-9990 East Cent. Afr. J. surg

    African Journals Online (AJOL)

    Valued eMachines Customer

    chose the type of anaesthesia after discussion with the surgeon before surgery. ... anesthesia was used in 273 patients in Lichtenstein group and 490 patients in the Desarda group. All those 763 (55.2%) .... The author made a search about the inguinal canal anatomy through books or publications made by stalwarts in this ...

  17. Marine mammal surveys in Dutch waters in 2014

    NARCIS (Netherlands)

    Geelhoed, S.C.V.; Lagerveld, S.; Verdaat, J.P.; Scheidat, M.

    2014-01-01

    In July 2014 aerial surveys to estimate the abundance of Harbour porpoises Phocoena phocoena on the Dutch Continental Shelf were conducted. In total, 229 sightings of 273 individual Harbour Porpoises were collected. Porpoise densities varied between 0.37-3.08 animals/km² in the (four) different

  18. Effects of nutrient and water level changes on the composition and size structure of zooplankton communities in shallow lakes under different climatic conditions: a pan-European mesocosm experiment

    Czech Academy of Sciences Publication Activity Database

    Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.

    2017-01-01

    Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016

  19. Promoting Peer Acceptance of Females with Higher-Functioning Autism in a Mainstream Education Setting: A Replication and Extension of the Effects of an Autism Anti-Stigma Program

    Science.gov (United States)

    Ranson, Natalia J.; Byrne, Mitchell K.

    2014-01-01

    This study evaluated the effects of an eight-session female higher-functioning autism anti-stigma program on the knowledge, attitudes and behavioural intentions of adolescent girls. Participants were seventh-, eighth- and ninth-grade students (N = 273) in a mainstream school. Two-eighth-grade classes were randomly allocated to the intervention…

  20. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    International Nuclear Information System (INIS)

    Roser, T.

    1999-01-01

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; ampersand 7.6.2- Proton Beam Polarimeters

  1. Health and function assessments in two adjacent Danish birth cohorts of centenarians

    DEFF Research Database (Denmark)

    Vestergaard, Sonja; Andersen-Ranberg, Karen; Skytthe, Axel

    2016-01-01

    Using the results from measures of functional ability, cognitive and physical performance from two adjacent birth cohorts of 100-year-old adults, we aimed to elucidate the possible impact of difference in participation rates, design, and interviewer mode. Participants were birth cohort members born...... in DK-1910 (66.9 % (273/408)) (p home was significantly lower (44 vs. 54 %, respectively). Higher...

  2. Long-term adaptation of methanol-fed thermophilic (55°C) sulfate-reducing reactors to NaCl

    NARCIS (Netherlands)

    Vallero, M.V.G.; Lettinga, G.; Lens, P.N.L.

    2003-01-01

    A laboratory-scale upflow anaerobic sludge bed (UASB) reactor was operated during 273 days at increasing NaCl concentrations (0.5-12.5 g NaCl l(-1)) to assess whether the stepwise addition of the salt NaCl results in the acclimation of that sludge. The 6.5-1 thermophilic (55 degreesC), sulfidogenic

  3. A Developmental Approach to Characterizing the Tissue-Invasion Gene Program in Breast Cancer

    Science.gov (United States)

    2001-09-01

    well as novel targets for therapeutic intervention can be rapidly identified. II. BODY In the original proposal, we intended to generate cDNA libraries...induced host response. Am J. Pathol. 149:273-282, 1996. 4. Wolf, c., Rouyer, N., Lutz, Y., Adida , C., Loriot, M., Bellocq, J.P., Chambon, P., and Basset

  4. Nano copper ferrite: A reusable catalyst for the synthesis of β, γ ...

    Indian Academy of Sciences (India)

    clearly evident that there was no leaching of catalyst and was confirmed by performing the reaction with the filtrate. Atomic absorption spectroscopy was employed to determine the copper content of copper ferrite nano particles and it was found to be 27.3%. The leaching of metal after three cycles was found to be 0.156%.

  5. Palaeoecology of a medieval fishpond system (Vajgar, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Jankovská, Vlasta; Pokorný, Jan

    2002-01-01

    Roč. 37, - (2002), s. 253-273 ISSN 0015-5551 R&D Projects: GA ČR GA206/94/1821; GA ČR GA206/99/0774 Institutional research plan: CEZ:AV0Z6005908 Keywords : chemical composition of sediment * palaeoalgology * pollen analysis Subject RIV: EF - Botanics Impact factor: 0.564, year: 2002

  6. Scattering of very slow (3-10 eV) hydrocarbon ions CD3+, CD4 center dot+ and CD5+ from room-temperature carbon (HOPG) surfaces

    Czech Academy of Sciences Publication Activity Database

    Pysanenko, Andriy; Žabka, Ján; Zappa, F.; Märk, T. D.; Herman, Zdeněk

    2008-01-01

    Roč. 273, 1-2 (2008), s. 35-47 ISSN 1387-3806 R&D Projects: GA AV ČR KAN400400651 Institutional research plan: CEZ:AV0Z40400503 Keywords : ion-surface scattering * low energy collision * C1 hydrocarbon ions * carbon surface Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.445, year: 2008

  7. DETERMINANTS OF PRIVATE INVESTMENT IN ETHIOPIA A Time ...

    African Journals Online (AJOL)

    Fitsum

    multivariate single equation ECM estimation methodology on integrated of order one, I(1), variables using annual time-series ... SSA economic and geographic disadvantages (Sachs, 2005, P. 273). It seems why almost all nations try ...... Empirical works have also been reporting mixed evidences. As discussed above, one.

  8. Climate of the upper atmosphere

    Czech Academy of Sciences Publication Activity Database

    Bremer, J.; Laštovička, Jan; Mikhailov, A. V.; Altadill, D.; Pal, B.; Burešová, Dalia; Franceschi de, G.; Jacobi, C.; Kouris, S. S.; Perrone, L.; Turunen, E.

    2009-01-01

    Roč. 52, 3/4 (2009), s. 273-299 ISSN 1593-5213 R&D Projects: GA MŠk OC 091 Institutional research plan: CEZ:AV0Z30420517 Keywords : Ionosphere * trends * atmospheric waves * ionospheric variability * incoherent radar * space weather Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.548, year: 2009

  9. Effect of exogenous stress on UCP2 level and apoptosis in neonatal rat cardiomyocytes

    Czech Academy of Sciences Publication Activity Database

    Modrianský, M.; Psotová, J.; Smolková, Katarína; Šantorová, Jitka; Ježek, Petr

    2006-01-01

    Roč. 273, č. S1 (2006), s. 163-163 ISSN 1474-3833. [FEBS Congress /31./. 24.06.2006-29.06.2006, Istanbul] R&D Projects: GA ČR(CZ) GA301/05/0221 Keywords : mitochondrial uncoupling proteins * apoptosis * antioxidant defence Subject RIV: CE - Biochemistry

  10. Modifiable risk factors of coronary heart disease in male first time ...

    African Journals Online (AJOL)

    The following parameters were recorded: personal details, health status, smoking habits, mass, height, body composition, blood pressure, total cholesterol, physical working capacity and predicted aerobic capacity. The majority of subjects (50.9 %) displayed two or more, 27.3 % three or more and 8.2 % four or more, risk ...

  11. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 121 Issue 2 April 2012 pp 273-285. Development of multimodel ensemble based district level medium range rainfall forecast system for Indian region .... 123 Issue 7 October 2014 pp 1637-1652. Forecasting of cyclone Viyaru and Phailin by NWP-based cyclone prediction system (CPS) of IMD – an evaluation.

  12. Volumetric studies of some amino acids in binary aqueous solutions

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volumetric studies of some amino acids in binary aqueous solutions of MgCl2.6H2O at 288.15, and 308.15 K. Amalendu Pal Suresh Kumar. Volume 117 Issue 3 May 2005 pp 267-273 ...

  13. Superconducting Qubits and Quantum Resonators

    NARCIS (Netherlands)

    Forn-Díaz, P.

    2010-01-01

    Superconducting qubits are fabricated "loss-free" electrical circuits on a chip with size features of tens of nanometers. If cooled to cryogenic temperatures below -273 °C they behave as quantum elements, similar to atoms and molecules. Such a qubit can be manipulated by fast-oscillating magnetic

  14. 12 Layout PPP adjusted.pmd

    African Journals Online (AJOL)

    Nubidga

    , USA], 200 units/mL penicillin, 200 μg/mL streptomycin and 2.5 μg/mL ..... Ethnobotanical Survey of Anti-Cancer Plants in Ogun. State, Nigeria. Annals of Biological Research, 1 (4), 261-. 273. TDR (Tropical Disease Research) (2007): A new.

  15. Parturition difficulties in sheep

    NARCIS (Netherlands)

    Grommers, F. J.; Elving, L.; Eldik, P. van

    1985-01-01

    The incidence of difficult parturition was recorded in Texel Sheep lambs (224), Milk Sheep lambs (273) and various crossbreeds (1043) in ten spring lambing seasons. at lambing time the ewes were under 24-hour observation. Difficult parturition is defined as necessity for obstetrical assistance as

  16. Importance of emotional intelligence in conceptualizing collegial ...

    African Journals Online (AJOL)

    Importance of emotional intelligence in conceptualizing collegial leadership in education. P Singh, P Manser, R Mestry. Abstract. No Abstract. South African Journal of Education Vol. 27(3) 2007: pp. 541-563. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  17. Women's use of information and communication technology in ...

    African Journals Online (AJOL)

    Women's use of information and communication technology in accessing maternal and child health information in Nigeria. ... MCH information was accessed through mobile phones (76.0%), radio (66.9%), television (55.1%), the Internet (27.3%) and the public address system/projector (2.5%). The MCH information themes ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 273 ... Vol 27, No 2 (2001): Special Issue, The emplacement age of gabbroic rocks and associated granitoids of the Liganga-Msanyo complex, south eastern ... in the sukumaland greenstone belt of Geita, northern Tanzania: evidence for mixing of hydrothermal and clastic sources of the chemical elements ...

  19. Establishment of immunohematological reference values among ...

    African Journals Online (AJOL)

    Data were entered in to Epi Info version 3.5, checked for completeness and exported to SPSS version 20 software for analysis. The mean ± SD and 95% Confidence Interval (95% CI) values were calculated for different immunohematological parameters. Results: A total of 400 women with mean age ±SD (27.3 ±4.7) ranging ...

  20. 'No one may be refused emergency medical treatment' – ethical ...

    African Journals Online (AJOL)

    Enshrined in section 27(3) of the Constitution of South Africa is the right that 'no one may be refused emergency medical treatment'. While this universal human right is altruistic in its simplistic meaning and appears to be in tune with the requirement of freedom, equality and dignity for all in South Africa, in-depth analysis ...

  1. A Genuine Way to Mimic the Solar-Light Conditions in UV Driven Heterogeneous Photocatalytic Reactions

    Czech Academy of Sciences Publication Activity Database

    Klusoň, Petr; Hejda, S.; Hejdová, M.; Krýsa, J.

    2011-01-01

    Roč. 104, č. 2 (2011), s. 273-280 ISSN 1878-5190 R&D Projects: GA MPO(CZ) FR-TI1/065 Institutional research plan: CEZ:AV0Z40720504 Keywords : photocatalysis * titania * solar light Subject RIV: CI - Industrial Chemistry , Chemical Engineering Impact factor: 0.829, year: 2011

  2. Consumer demand system estimation and value added tax reforms in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Janský, Petr

    2014-01-01

    Roč. 64, č. 3 (2014), s. 246-273 ISSN 0015-1920 R&D Projects: GA TA ČR(CZ) TD010033 Institutional support: RVO:67985998 Keywords : consumer behavior * Quadratic Almost Ideal Demand System * tax reforms Subject RIV: AH - Economics Impact factor: 0.420, year: 2014 http://journal.fsv.cuni.cz/storage/1301_jansky.pdf

  3. K problému univerzalistických pretenzí v etice. Formalismus a některé pokusy o založení hodnotové etiky

    Czech Academy of Sciences Publication Activity Database

    Hála, Vlastimil

    2007-01-01

    Roč. 62, č. 4 (2007), s. 273-281 ISSN 0046-385X R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : ethics * values * universalism Subject RIV: AA - Philosophy ; Religion

  4. Prevalence of paramphistomes in camels slaughtered at Maiduguri ...

    African Journals Online (AJOL)

    slaughtered in Maiduguri, Nigeria. A total of 100 camels were examined, of which 29 (29%) were infected, with a total burden of 308. The common species harvested were Paramphistomum cervi with a burden of 105 (34.0%), Eurytrema pancreaticum 73 (27.3%), Cotylophoron cotylophorum 77 (25.0%), and Gastrothylax ...

  5. Binary mixtures of carbon dioxide and dimethyl ether as alternative ...

    African Journals Online (AJOL)

    Vapor-liquid equilibrium (VLE) data were predicted for the binary mixture of carbon dioxide (CO2) and dimethyl ether (DME) at ten temperatures ranging from 273.15 to 386.56 K and pressure upto 7.9 MPa to observe this mixture's potential of COP enhancement and capacity modulation as a working fluid in a refrigeration ...

  6. Educational leadership and management: theory, policy and practice

    African Journals Online (AJOL)

    No Abstract. South African Journal of Education Vol. 27(3) 2007: pp. 391-406. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  7. Comparison of the effects of different linefishing methods on catch ...

    African Journals Online (AJOL)

    The effects of hook size, bait type, water depth and fishing effort on the selectivity and capture mortality of reef fish were investigated in a standardised fishing experiment on the temperate south coast of South Africa. A total of 2 406 fish was caught at 273 stations, distributed according to a random-stratified design.

  8. Molecular Mechanisms of Nonlinearity in Response to Low Dose Ionizing Radiation

    Science.gov (United States)

    2007-10-12

    fibroblasts. J Biol Chem1998;273:32889-94. 41. Shankar B, Sainis KB. Cell cycle regulators modulat- IntJ Radiat Biol 2003;79:759-75. 25. Kim AH...the esophageal adenocarcinoma cell line Oncol 2005;24;33-43. mouse lymphocytes after y irradiation in vivo and OE-33. IntJ Oncol 2003;23:1593-9. 42

  9. Povodně a ryby

    Czech Academy of Sciences Publication Activity Database

    Lusk, Stanislav

    2002-01-01

    Roč. 50, č. 6 (2002), s. 273-276 ISSN 0044-4812 R&D Projects: GA ČR GA514/95/0203; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : ichthyofauna * floods Subject RIV: EH - Ecology, Behaviour

  10. Using stable isotopes to trace resource acquisition and trophic position in four Afrotropical birds with different diets

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Reif, J.; Hořák, D.; Klvaňa, P.; Lee, R. W.; Yohannes, E.

    2010-01-01

    Roč. 81, č. 3 (2010), s. 273-275 ISSN 0030-6525 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : stable isotope analysis * diet ary niche * Cameroon Mountains Subject RIV: EG - Zoology Impact factor: 0.338, year: 2010

  11. Integrating the Medical Home into the EHDI Process

    Science.gov (United States)

    Munoz, Karen F.; Nelson, Lauri; Bradham, Tamala S.; Hoffman, Jeff; Houston, K. Todd

    2011-01-01

    State coordinators of early hearing detection and intervention (EHDI) programs completed a strengths, weaknesses, opportunities, and threats, or SWOT, analysis that examined 12 areas within state EHDI programs. Related to how the medical home is integrated into the EHDI process, 273 items were listed by 48 coordinators, and themes were identified…

  12. The EHDI and Early Intervention Connection

    Science.gov (United States)

    Nelson, Lauri; Bradham, Tamala S.; Houston, K. Todd

    2011-01-01

    State coordinators of early hearing detection and intervention (EHDI) programs completed a strengths, weaknesses, opportunities, and threats, or SWOT, analysis that examined 12 areas within state EHDI programs. For the early intervention focus question, 48 coordinators listed 273 items, and themes were identified within each SWOT category. A…

  13. March 2010 Final for Publicat...

    African Journals Online (AJOL)

    User

    buttocks (36.4%) and the thigh (27.3%) while the least affected site were the upper arm (6.8%) and the face (4.5%). Table 2. Five (11.4%) cases had the clinical form of furious rabies; aggressive behavior and hydrophobia, muscle spasms hyperexcitability. Only 1(20%) of the patients developed aerophobia. None of them.

  14. Implications of Work Values to Job Satisfaction in the Maryland Cooperative Extension Service.

    Science.gov (United States)

    Milliken, W. James; Whaples, Gene C.

    A study was done to determine if work values of the Maryland Cooperative Extension Service faculty were related to Herzberg's job satisfaction elements. The design was ex post facto, exploratory field research. Subjects included 273 extension faculty members. A mail questionnaire composed of Hughes and Flowers'"Values for Working" and an…

  15. probing the cob(ii)alamin conductor hypothesis with glutamate ...

    African Journals Online (AJOL)

    dell

    Glutamate mutase activity was also demonstrated upon incubation of GlmS and E with 3',5'- ... overproduced in E.coli (Huhta et al. 2001,. Huhta et ..... Biochemistry. 37: 9704-9715. Buckel W 2001 Unusual enzymes involved in five pathways of glutamate fermentation. Appl. Microbiol. Biotechnol. 57: 263-273. Buckel W and ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 273 ... Vol 27, No 1 (2001), Incidence of injuries and mortality in the leopard tortoise, Geochelone pardalis, in northern Tanzania, Abstract PDF. J Kabugumila. Vol 40, No 1 (2014), Indigenous tree uses, use-values and impact of human population on forest size, structure and species richness in Uluguru, ...

  17. In Vitro Digestibility of Aluminum from Hibiscus sabdariffa Hot Watery Infusion and Its Concentration in Urine of Healthy Individuals

    Czech Academy of Sciences Publication Activity Database

    Frankova, A.; Malik, J.; Drabek, O.; Szakova, J.; Sperlingova, I.; Kloucek, P.; Novy, P.; Tejnecky, V.; Landa, Přemysl; Leuner, O.; Kokoska, L.

    2016-01-01

    Roč. 174, č. 2 (2016), s. 267-273 ISSN 0163-4984 Institutional support: RVO:61389030 Keywords : dialysis dementia * tea * bioavailability * speciation * toxicity * Aluminum * In vitro digestion * Hot watery infusion * Urine * Hibiscus sabdariffa L Subject RIV: EF - Botanics Impact factor: 2.399, year: 2016

  18. Market-Based Housing Finance Efficiency in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Sunega, Petr; Lux, Martin

    2007-01-01

    Roč. 7, č. 3 (2007), s. 241-273 ISSN 1461-6718 R&D Projects: GA ČR GA403/06/0915 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing finance * transition economies * finance efficiency Subject RIV: AO - Sociology, Demography

  19. Auxin inhibits endocytosis and promotes its own efflux from cells

    Czech Academy of Sciences Publication Activity Database

    Paciorek, T.; Zažímalová, Eva; Ruthardt, N.; Petrášek, Jan; Stierhof, Y. D.; Kleine-Vehn, J.; Morris, David; Emans, N.; Jürgens, G.; Geldner, N.; Friml, J.

    2005-01-01

    Roč. 435, č. 7046 (2005), s. 1251-1256 ISSN 0028-0836 R&D Projects: GA AV ČR IAA6038303 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phytohormones * polar auxin transport * plasma membrane Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 29.273, year: 2005

  20. Usutu Virus in Blackbirds (Turdus merula), Czech Republic, 2011-2012

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Čapek, Miroslav; Bakonyi, T.; Betášová, Lenka; Nowotny, N.

    2014-01-01

    Roč. 61, č. 3 (2014), s. 273-276 ISSN 1865-1674 Institutional support: RVO:68081766 Keywords : Usutu virus * blackbird * Turdus merula * Czechland Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.944, year: 2014

  1. Aboveground biomass subdivisions in woody species of the savanna ecosystem project study area, Nylsvley

    CSIR Research Space (South Africa)

    Rutherford, MC

    1979-01-01

    Full Text Available Aboveground peak season biomass is given for 11 woody species in each of five belt transects under study. Mean aerial biomass for all species was 16 273 kg ha, made up of 14 937 kg ha wood, 236 kg ha current season's twigs and 1 100 kg ha leaves...

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 273 ... Vol 4, No 3 (2009), Markov queue game with virtual reality strategies, Abstract PDF. C.C Nwobi-Okoye. Vol 2, No 3 (2007), Mathematical annuity models application in cash flow analysis, Abstract PDF. D.J Galadima, D.N Choji, U.E Okon. Vol 7, No 2 (2012), Measurement of indoor background ionizing ...

  3. Effects of learned flavour cues on short-term regulation of food intake in a realistic setting

    NARCIS (Netherlands)

    Zandstra, E.H.; Stubenitsky, K.; Graaf, de C.; Mela, D.J.

    2002-01-01

    The present study examined the effects of repeated midmorning consumption of novel-flavoured low- and high-energy yoghurt drinks on subsequent energy intake at lunch in 69 adults under actual use conditions. Subjects consumed 200 ml of low- and high-energy yoghurt drinks (67 and 273 kcal/200 ml,

  4. Highly sensitive urea sensing with ion-irradiated polymer foils

    Czech Academy of Sciences Publication Activity Database

    Fink, Dietmar; Hernandez, G. M.; Alfonta, L.

    2012-01-01

    Roč. 273, č. 2 (2012), s. 164-170 ISSN 0168-583X Institutional research plan: CEZ:AV0Z10480505 Keywords : NANOPORES * BIOSENSOR * SAMPLES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.266, year: 2012

  5. South African Journal of Philosophy - Vol 21, No 4 (2002)

    African Journals Online (AJOL)

    Self-Formation and the speculative: Gadamer and Lacan · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Andrea Hurst, 258-273. http://dx.doi.org/10.4314/sajpem.v21i4.31351 ...

  6. Anti-cancer effects of blue-green alga Spirulina platensis, a natural source of bilirubin-like tetrapyrrolic compounds

    Czech Academy of Sciences Publication Activity Database

    Koníčková, R.; Vaňková, K.; Vaníková, J.; Váňová, K.; Muchová, L.; Subhanová, I.; Zadinová, M.; Zelenka, Jaroslav; Dvořák, Aleš; Kolář, Michal; Strnad, Hynek; Rimpelová, S.; Ruml, T.; Wong, R.J.; Vítek, L.

    2014-01-01

    Roč. 13, č. 2 (2014), s. 273-283 ISSN 1665-2681 Institutional support: RVO:67985823 ; RVO:68378050 Keywords : bilirubin * chlorophyll * heme oxygenase * phycocyanin * phycocyanobilin * Spirulina platensis * tetrapyrroles Subject RIV: FD - Oncology ; Hematology Impact factor: 2.065, year: 2014

  7. Subjective Happiness of Lebanese College Youth in Lebanon: Factorial Structure and Invariance of the Arabic Subjective Happiness Scale

    Science.gov (United States)

    Moghnie, Lamia; Kazarian, Shahe S.

    2012-01-01

    The present study evaluated the subjective happiness of Lebanese college youth using a multi-item rather than a single-item subjective happiness measure. An Arabic translation of the Subjective Happiness Scale (SHS) was administered to 273 Lebanese college youth from state- and private-run higher institutions of learning, as was the Arabic Adult…

  8. 76 FR 50752 - Proposed Information Collection; Comment Request for the Landslide Report: Did You See It?

    Science.gov (United States)

    2011-08-16

    ... Collection; Comment Request for the Landslide Report: Did You See It? AGENCY: United States Geological Survey... the USGS Landslide Hazards Program's Landslide Report: Did You See It? As required by the Paperwork... telephone at 303-273-8610. To see a copy of the entire ICR submitted to OMB, go to http://www.reginfo.gov...

  9. Eosinophils from patients with type 1 diabetes mellitus express high level of myeloid alpha-defensins and myeloperoxidase

    Czech Academy of Sciences Publication Activity Database

    Neuwirth, Aleš; Dobeš, Jan; Oujezdská, Jana; Ballek, Ondřej; Benešová, Martina; Sumnik, Z.; Včeláková, J.; Koloušková, S.; Obermannová, B.; Kolář, Michal; Štechová, K.; Filipp, Dominik

    2012-01-01

    Roč. 273, č. 2 (2012), s. 158-163 ISSN 0008-8749 R&D Projects: GA MŠk 2B08066 Institutional research plan: CEZ:AV0Z50520514 Keywords : type 1 diabetes * alpha-defensin * myeloperoxidase * granulocyte * eosinophil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.743, year: 2012

  10. Lampanyctodes hectoris, the “Cape onderbaaidjie”, is one of the ...

    African Journals Online (AJOL)

    denise

    Genetic and morphological variation within the southern African population of Lampanyctodes hectoris was analysed. A total of 15 enzymes, encoding 22 isozyme loci, was examined (n = 327); seven were polymorphic. The percentage of polymorphic loci ranged from 13.6 to 27.3%. The mean heterozygosity was generally ...

  11. Investigations on Tl-2223 thin films fabricated through ultrasonic ...

    Indian Academy of Sciences (India)

    Unknown

    Present Address: Department of Physics, SGR Post Graduate College, Dobhi, Jaunpur 222 ..... Singh H K, Saxena A K and Srivastava O N 1997 Physica C273. 181. Su L Y, Grovener C R M, Goringe M S, Deuhurst C D, Card- well D A, Jenkins R ...

  12. Prehistoric dark soils/sediments of Central Sudan, case study from the Mesolithic landscape at the Sixth Nile Cataract

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Bajer, A.; Pacina, J.; McCool, J-P.; Cílek, Václav; Rohovec, Jan; Matoušková, Šárka; Kallistová, Anna; Gottvald, Z.

    2017-01-01

    Roč. 149, č. 1 (2017), s. 273-282 ISSN 0341-8162 Institutional support: RVO:67985831 Keywords : climate change * micromorphology * sahel * saprolite * soil chemistry Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.191, year: 2016

  13. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  14. Targeting the Checkpoint to Kill Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Benada, Jan; Macůrek, Libor

    2015-01-01

    Roč. 6, č. 3 (2015), s. 1912-1937 ISSN 2218-273X R&D Projects: GA ČR(CZ) GA14-34264S Institutional support: RVO:68378050 Keywords : checkpoint * DNA damage response * cancer Subject RIV: EB - Genetics ; Molecular Biology

  15. Directional versus central-force bonding in studies of the structure and glide of 1/2 < 111 > screw dislocations in bcc transition metals

    Czech Academy of Sciences Publication Activity Database

    Gröger, Roman; Vítek, V.

    2009-01-01

    Roč. 89, č. 34 (2009), s. 3163-3178 ISSN 1478-6435 R&D Projects: GA AV ČR IAA100100920 Institutional research plan: CEZ:AV0Z20410507 Keywords : transition metals * dislocation core * directional bonding Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.273, year: 2009

  16. The effect of an overpass on pedestrian injuries on a major highway ...

    African Journals Online (AJOL)

    A bigger proportion of females (49.1%) crossed on the overpass compared to males (29.2%). More children (79.7 %) than adults (27.3%) used the overpass. The majority of pedestrians (77.9%) were worried about their safety in traffic but only 6.6% thought of the overpass as an appropriate means to avoid traffic accidents.

  17. Variation in genome composition of blue-aleurone wheat

    Czech Academy of Sciences Publication Activity Database

    Burešová, Veronika; Kopecký, David; Bartoš, Jan; Martinek, P.; Watanabe, N.; Vyhnánek, T.; Doležel, Jaroslav

    2015-01-01

    Roč. 128, č. 2 (2015), s. 273-282 ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : TRITICUM-AESTIVUM L * COMMON WHEAT * THINOPYRUM-PONTICUM Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.900, year: 2015

  18. Coincidence imaging system with electron optics

    Czech Academy of Sciences Publication Activity Database

    Kroupa, M.; Jakubek, J.; Krejčí, F.; Žemlička, J.; Horáček, Miroslav; Radlička, Tomáš; Vlček, Ivan

    2011-01-01

    Roč. 633, Supl. 1 (2011), S270-S273 ISSN 0168-9002 R&D Projects: GA AV ČR IAA100650803 Institutional research plan: CEZ:AV0Z20650511 Keywords : electron optics * coincidence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.207, year: 2011

  19. General Relativity and the Accelerated Expansion of the Universe

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:

  20. Central and peripheral clocks in ontogeny

    Czech Academy of Sciences Publication Activity Database

    Sumová, Alena; Bendová, Zdeňka; Sládek, Martin; El-Hennamy, Rehab; Laurinová, Kristýna; Jindráková, Zuzana; Illnerová, Helena

    2006-01-01

    Roč. 273, č. S1 (2006), s. 6-6 ISSN 1742-464X. [FEBS Congress /31./. 24.06.2006-29.06.2006, Istanbul] Institutional research plan: CEZ:AV0Z50110509 Keywords : circadian clock * peripheral tissue * ontogeny Subject RIV: FH - Neurology

  1. Descriptive survey of personal hygiene and knowledge of exposure ...

    African Journals Online (AJOL)

    Majority of the poultry workers have adequate personal hygiene while use of antiseptics as part of hand washing practices is relatively low. Forty-three percent of poultry workers have some knowledge of occupational exposure factors and 27.3% have some knowledge of non-occupational exposure factors to zoonotic ...

  2. Possible Suppression of Magnetorotational Instability by Rapid Radial Flow

    Czech Academy of Sciences Publication Activity Database

    Abramowicz, M. A.; Horák, Jiří; Kluzniak, W.

    2013-01-01

    Roč. 63, č. 2 (2013), s. 267-273 ISSN 0001-5237 R&D Projects: GA ČR(CZ) GAP209/11/2004 Institutional support: RVO:67985815 Keywords : accretion disks * magnetohydrodynamics * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.955, year: 2013

  3. Individual Differences in Reactions to Inequitable Exchanges.

    Science.gov (United States)

    Ellis, Barbara B.; Penner, Louis A.

    1983-01-01

    Investigates the role of sociopathic tendencies in reactions to inequitable exchanges in 273 males and females classified as high or low in sociopathy. Subjects read narratives of inequitable exchanges and assumed the role of the exploiter and the role of the victim in each. (Author/RH)

  4. The effects of nutrition rehabilitation at three Family Life Training Centres in Central Province, Kenya

    NARCIS (Netherlands)

    Hoorweg, J.C.; Niemeijer, R.

    1982-01-01

    During the course of 1978, the three Family Life Training Centres studied admitted 273 women accompanied by 674 children. Women with malnourished children (and their siblings) are admitted to these centres for a 3-week course consisting primarily of nutrition and health education, but also covering

  5. Knowledge of Tyre Pressures and Tyre Care among Vehicle Drivers ...

    African Journals Online (AJOL)

    The purpose of this study was to evaluate the knowledge of normal tyre pressures and tyre care among motor vehicle drivers in Benin City. Three hundred and one drivers were interviewed consisting of 273 males and 28 females. There were 100 private and 201 commercial drivers. Of the 100 private drivers 67 use brand ...

  6. The Future of Statistics as a Discipline.

    Science.gov (United States)

    1981-09-01

    foundations of our discipline or investigation providing now insights on properties of kmm methodology - we must value both. Scum examples of perceived problem...215-273. Hotelling, Harold (1940), "The Teachlin of Statistics," Annats of Aftthematioat Statietics, 11, 457-470. Howrd, Niles ad Antilla, Susan

  7. Nutrition and the Aging Eye

    Science.gov (United States)

    ... the participating clinics and/or to enroll in the AREDS2 study, call 1-877-273-3780 or look online at www.nei.nih.gov/AREDS2 . Pat ... sensing cells, destroying the ability to see straight ahead. ... start until the 60s or later," says study chair Dr. Emily Chew of the National Eye ...

  8. The burden of gunshot injuries on orthopaedic healthcare resources ...

    African Journals Online (AJOL)

    Additionally, SA lacks a public national injury surveillance system to track fatal and .... Instead, the hospital allocates collective budgets rather than disaggregated ... Guatemala. 34.8. Saint Kitts and Nevis. 32.4. Trinidad and Tobago. 27.3. Colombia. 27.1. Belize. 21.8. Puerto Rico. 18.3. Brazil. 18.1. Dominican Republic. 16.3.

  9. Hyperspectral predictors for monitoring biomass production in Mediterranean mountain grasslands: Majella national park, Italy

    CSIR Research Space (South Africa)

    Cho, Moses A

    2009-01-01

    Full Text Available approaches. Remote Sensing of Environment, 66: 273-440 285. 441 BLACKBURN, G.A. and PITMAN, J.I., 1999. Biophysical controls on the directional spectral 442 reflectance properties of bracken (Pteridium aquilinum) canopies: results of a field experiment...

  10. A Cross-Sectional Study in Addis Ababa

    African Journals Online (AJOL)

    abp

    2017-06-02

    Jun 2, 2017 ... design, we interviewed 273 HIV-infected adolescents receiving ART from three hospitals in Addis Ababa. ... encouraged, more targeted adherence support should be planned for those who present at an early stage of their illness. ... acquired infection, adolescents and young adults are vulnerable to.

  11. Developmental biology and field performance of Platygaster ...

    African Journals Online (AJOL)

    use

    2011-10-24

    Oct 24, 2011 ... reproduction was facultative parthenogenetic. The number of ovarian mature eggs was 648, however the average number of eggs laid per female was. 95.2. The complete life cycle averaged 27.3 days. Newly emerged adults remained in the host for about four additional days before escaping from the gall.

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    April 2003, pages 248-358. Viral Evasion of Host Responses ... pp 273-285 Articles. Lessons in Détente or know thy host: The immunomodulatory gene products of myxoma virus .... pp 337-348 Articles. Molecular interactions of 'high risk' human papillomaviruses E6 and E7 oncoproteins: implications for tumour progression.

  13. Evolutionary regime shifts in age and size at maturation of exploited fish stocks

    Czech Academy of Sciences Publication Activity Database

    de Roos, A. M.; Boukal S., David; Persson, L.

    2006-01-01

    Roč. 1596, č. 273, (2006), s. 1873-1880 ISSN 0962-8452 R&D Projects: GA ČR GP201/02/D088 Institutional research plan: CEZ:AV0Z50070508 Keywords : complex adaptive systems * life-history evolution * ecological feedbacks Subject RIV: ED - Physiology Impact factor: 3.612, year: 2006

  14. Attention training with auditory hallucinations : A case study

    NARCIS (Netherlands)

    Valmaggia, L.R.; Bouman, Theo K.; Schuurman, L

    The case presented in this paper illustrates how Attention Training (ATT; [Wells, A. (1990). Panic disorder in association with relaxation induced anxiety: An attentional training approach to treatment. Behavior Therapy, 21, 273-280.]) can be applied in an outpatient setting in the treatment of

  15. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 88, Issue 3. December 2009, pages 267-391. pp 267-272 Research Article ... pp 273-279 Research Article. Evaluation of RAPD-PCR and protein profile analysis to .... More Details Fulltext PDF. pp 345-348 Research Note. Genetic variation in colchicine-treated regenerated plants of Eucalyptus globulus Labill.

  16. 48 CFR 225.7014 - Restrictions on military construction.

    Science.gov (United States)

    2010-10-01

    ..., see 236.273(a). (b) For restriction on acquisition of steel for use in military construction projects... construction. 225.7014 Section 225.7014 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... construction. (a) For restriction on award of military construction contracts to be performed in the United...

  17. The influence of community ecology and behaviour on the ...

    African Journals Online (AJOL)

    Four hundred and ninety-four (494) faecal samples were examined for various intestinal helminth parasites in four communities of Asari-Toru Local Government Area, Niger Delta, Nigeria . Buguma, Ido, Minnama, and Omekwe-ama. Of the number examined, 273 (55.3%) were positive for Ascaris, hookworm, Trichuris, ...

  18. Does the sequence of plant dominants affect mycorrhiza development in simulated succession on spoil banks?

    Czech Academy of Sciences Publication Activity Database

    Püschel, David; Rydlová, Jana; Vosátka, Miroslav

    2008-01-01

    Roč. 302, 1-2 (2008), s. 273-282 ISSN 0032-079X R&D Projects: GA MŠk(CZ) 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : arbuscular mycorrhizal fungi * plant succession * spoil banks Subject RIV: EF - Botanics Impact factor: 1.998, year: 2008

  19. Abelovu cenu za matematiku získal v roce 2007 Srinivasa Varadhan

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Vrkoč, Ivo

    2007-01-01

    Roč. 52, č. 4 (2007), s. 265-273 ISSN 0032-2423 R&D Projects: GA MŠk 1P05ME749 Institutional research plan: CEZ:AV0Z10190503 Keywords : law of large deviatious * evolution equations * Markov process Subject RIV: BA - General Mathematics

  20. A new [(1R,2R)-1,2-diaminocyclohexane]platinum(II) complex: formation by nitrate-acetonitrile ligand exchange

    Czech Academy of Sciences Publication Activity Database

    Pažout, R.; Housková, J.; Dušek, Michal; Maixner, J.; Cibulková, J.; Kačer, P.

    2010-01-01

    Roč. 66, Part 10 (2010), m273-m275 ISSN 0108-2701 Institutional research plan: CEZ:AV0Z10100521 Keywords : platinum complexes * structure analysis * disorder * cyclohexane * diamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.745, year: 2010

  1. Lead removal in aqueous solution by activated carbons prepared ...

    African Journals Online (AJOL)

    AJL

    Desalination, 206(1–3): 270–278. Bedoui K, Bekri-Abbes I, Srasra E (2008). Removal of Cadmium (II) from aqueous solution using pure smectite and lewatite S 100: the effect of time and metal concentration. Desalination. 223:269-273. Bohem HP (1994). Some aspects of the chemistry of carbon blacks and other carbons.

  2. Targeting of Drugs to ICAM for Treatment of Acute Lung Injury

    Science.gov (United States)

    2005-04-01

    endocytosis in pulmonary artery endothelium. Am J Physiol 1997; 273(2 Pt 1): cultured human breast carcinoma cells and in vivo biodistribution L315-21...the pulmonar , endothelium. applied to asthma u-ill: improve patient and caregiver uality of life (QOL); reduce disease severity. as measured by reduced

  3. The Codevelopment of Sympathy and Overt Aggression from Middle Childhood to Early Adolescence

    Science.gov (United States)

    Zuffianò, Antonio; Colasante, Tyler; Buchmann, Marlis; Malti, Tina

    2018-01-01

    We assessed the extent to which feelings of sympathy and aggressive behaviors codeveloped from 6 to 12 years of age in a representative sample of Swiss children (N = 1,273). Caregivers and teachers reported children's sympathy and overt aggression in 3-year intervals. Second-order latent curve models indicated general mean-level declines in…

  4. Zircon in highly evolved hercynian Homolka granite, Moldanubian zone, Czech Republic: indicator of magma source and petrogenesis

    Czech Academy of Sciences Publication Activity Database

    Uher, P.; Breiter, K.; Klečka, M.; Pivec, Edvín

    1998-01-01

    Roč. 49, č. 3 (1998), s. 151-160 ISSN 0016-7738 Grant - others:SK(CZ) VEGA 4078 Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.273, year: 1998 http://www.geologicacarpathica.sk/src/main.php

  5. 75 FR 47839 - Notice of Quarterly Report (January 1, 2010-March 31, 2010)

    Science.gov (United States)

    2010-08-09

    ... accounts. Paper-based payments. Electronic payments. Value of contract services signed. Debit/smart cards... drinking water. Number of schools available in the Alatona. Number of health centers available in the...) legislation passed. Health Project $16,969,757 Increase the $1,273,192 Diabetes and adoption of hypertension...

  6. Exploring the Impact of Historically Black Colleges in Promoting the Development of Undergraduates' Self-Concept.

    Science.gov (United States)

    Berger, Joseph B.; Milem, Jeffrey F.

    2000-01-01

    Study explores how institutional context affects the development of self-concept in a sample of 273 African American college students. Findings suggest that students attending church affiliated historically Black colleges develop significantly higher self-ratings in three domains of self-concept-psychosocial wellness, academic, and achievement…

  7. Fulltext PDF

    Indian Academy of Sciences (India)

    Asteroseismology ofγ Scuti Stars: Problems and Prospects (M.-J. Goupil, M. A. Dupret,. R. Samadi, T. Boehm, E. Alecian, J. C. Suarez, Y. Lebreton & C. Catala), 249. Pulsations in Subdwarf B Stars (C. Simon Jeffery), 261. Lessons for Asteroseismology from White Dwarf Stars (Travis S. Metcalfe), 273. On the Analysis of Light ...

  8. Pillai, Prof. Madhavan Radhakrishna

    Indian Academy of Sciences (India)

    Date of birth: 18 August 1960. Specialization: Tumour Biology, Tumour Virology Address: Director, Rajiv Gandhi Centre for Biotechnology, Jagathi, Thiruvananthapuram 695 014, Kerala Contact: Office: (0471) 234 7973, (0471) 234 1716. Residence: (0471) 273 3819. Mobile: 94471 45776. Fax: (0471) 234 9303

  9. Molecular diversity and genetic relationships in Secale

    Indian Academy of Sciences (India)

    Supplementary data: Molecular diversity and genetic relationships in Secale. E. Santos, M. Matos, P. Silva, A. M. Figueiras, C. Benito and O. Pinto-Carnide. J. Genet. 95, 273–281. Table 1. RAPD and ISSR primers used in this study. Primer. 5 –3. Primer. 5 –3. RAPDs (Operon). A1. CAGGCCCTTC. C5. CATGACCGCC. A4.

  10. Retribution or Reconciliation: Young Americans' Attitudes toward Peaceful Transitions of Power

    Science.gov (United States)

    Gallay, Leslie; Flanagan, Constance A.; Duo, Samuel

    2011-01-01

    This exploratory study assessed the associations of age, gender, and a school climate of solidarity and pride with adolescents' endorsements of democratic regime change. Middle- and high-school students (N = 273) in the United States responded to three vignettes concerning how a society should transition from dictatorship to democracy and…

  11. Multipurpose Sediment Passive Sampler with Improved Tissue Mimicry to Measure the Bioavailable Fraction

    Science.gov (United States)

    2016-11-01

    Thompson, and James P. Shine. "Use of passive samplers to mimic uptake of polycyclic aromatic hydrocarbons by benthic polychaetes." Environmental science...Toxicology letters, 112, 273-282. 20. Witt , G., Lang, S. C., Ullmann, D., Schaffrath, G., Schulz-Bull, D., & Mayer, P. (2013). Passive Equilibrium

  12. Trabaja y aprende: Libro de actividades, 3 (Work and Learn: Workbook 3).

    Science.gov (United States)

    Martinez, Emiliano; And Others

    This workbook, designed to be used with the textbook of the same title (FL 004 273), contains exercises, riddles, puzzles, coloring activities, and reinforcement of various word-perception skills and sentences. Included is a step-by-step procedure of phonetic analysis. The intention of the workbook is to enable students to increase their ability…

  13. Authors: G Ferreira and A Ferreira-Snyman

    African Journals Online (AJOL)

    10332324

    views public international law and municipal law as a single system of law, whereas the latter regards ... evident from the outset that South Africa is prepared to adhere to public international law insofar as the preamble ..... Minister of State for Immigration and Ethnic Affairs v Teoh [1995] 183 CLR 273 286-287. 29. Glenister ...

  14. Radiolysis of C5-BTBP in cyclohexanone irradiated in the absence and presence of an aqueous phase

    Czech Academy of Sciences Publication Activity Database

    Fermvik, A.; Aneheim, E.; Grüner, Bohumír; Hájková, Zuzana; Kvíčalová, Magdalena; Ekberg, C.

    2012-01-01

    Roč. 100, č. 4 (2012), s. 273-282 ISSN 0033-8230 Grant - others:ACSEPT(XE) FP7-CP-2007-211 267 Institutional research plan: CEZ:AV0Z40320502 Keywords : radiolysis * degradation product * solvent extraction * partitioning * BTBP Subject RIV: CA - Inorganic Chemistry Impact factor: 1.373, year: 2012

  15. Invaze netýkavky žláznaté v České republice

    Czech Academy of Sciences Publication Activity Database

    Skálová, Hana; Čuda, Jan

    2014-01-01

    Roč. 62, č. 2 (2014), s. 271-273 ISSN 0044-4812 R&D Projects: GA ČR GA206/07/0668 Institutional support: RVO:67985939 Keywords : plant species biology * reproduction * growth Subject RIV: EF - Botanics

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 273 ... Vol 12, No 4 (2017), In vivo ameliorative effect of methanolic extract of Boswellia dalzielli Hutch (Mebdh) stem bark on Triton X-100 induced hyperlipidaemia, Abstract PDF. Mohammed Sani Jaafaru, Ibrahim Deborah Kyomson, Hauwa'u Yakubu Bako, Peter Maitalata Waziri, Yahaya Yakubu, Mohammed ...

  17. sexual risk behaviour among hiv-positive persons in kumasi, ghana

    African Journals Online (AJOL)

    David Ofori-Adjei

    2012-03-01

    Mar 1, 2012 ... cent CD4 cell count, current health status, year partici- pants first tested HIV positive, HIV related ..... 17. Kalichman SC, Ramachandran B, Catz S. Adher- ence to combination antiretroviral therapies in HIV patients of low health literacy. J Gen Int Med. 1999; 14:267-273. 18. Ghana Statistical Survey and ...

  18. 77 FR 72873 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-12-06

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Domestic Assistance Program Nos. 93.273, Alcohol Research Programs; National Institutes of Health, HHS...

  19. 75 FR 7458 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-02-19

    ...: Revision. Title: Early Childhood Longitudinal Study, Kindergarten Class of 2010-11 (ECLS-K:2011) Full-Scale... Hour Burden: Responses: 104,749. Burden Hours: 52,273. Abstract: The Early Childhood Longitudinal Study... and (2) the Fall 2011 first grade recruitment and data collection, Spring 2012 first grade recruitment...

  20. Examining Ethnocentrism, Emotionalization, and Life Syllabus in Foreign Language Achievement

    Science.gov (United States)

    Shakeebaee, Golshan; Pishghadam, Reza; Khajavy, Gholam Hassan

    2017-01-01

    Given the importance of ethnocentrism in social interactions and its influence on language learning and teaching, the present study intends to explore the possible relationships between using life syllabus and "emotionalization" on ethnocentric views using the foreign language achievement (FLA) scores. To this end, 273 Iranian English…

  1. Fulltext PDF

    Indian Academy of Sciences (India)

    Administrator

    the pH measurements were made with Philips pH meter. Electrochemical studies were carried out using. EG&G Princeton Applied Research Potentiostat/. Galvanostat Model 273 A, controlled by M-270 software. Cyclic voltammetric measurements were performed using three electrode assembly of glassy carbon electrode ...

  2. South African Journal of Geomatics - Vol 4, No 3 (2015)

    African Journals Online (AJOL)

    Geospatial subsidence hazard modelling at Sterkfontein Caves · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Ashraf, F Cawood, 273-284. http://dx.doi.org/10.4314/sajg.v4i3.8 ...

  3. Enzyme production in the traps of aquatic Utricularia species

    Czech Academy of Sciences Publication Activity Database

    Adamec, Lubomír; Sirová, Dagmara; Vrba, J.; Rejmánková, E.

    2010-01-01

    Roč. 65, č. 2 (2010), s. 273-278 ISSN 0006-3088 R&D Projects: GA ČR GP206/05/P520 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60170517 Keywords : aquatic carnivorous plants * extracellular enzyme activity * phosphatase Subject RIV: EF - Botanics Impact factor: 0.609, year: 2010

  4. AcEST: DK943813 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Chaet... 35 3.7 tr|A4KBN9|A4KBN9_PICV Capsid protein OS=Pigeon circovirus ...0 >tr|A4KBN9|A4KBN9_PICV Capsid protein OS=Pigeon circovirus GN=Cap PE=4 SV=1 Length = 273 Score = 34.3 bits

  5. Final Environmental Assessment for the Installation of a Range Safety Lighting System at Avon Park Air Force Range, Florida

    Science.gov (United States)

    2010-08-01

    of passes), weight of the vehicle, tire pressure, soil type, ground cover, and soil properties, particularly soil moisture content and texture ... Corona (Eric Schreiner) at 951.273.5032 Appendix C Range Safety Lighting Specifications August 2010 APAFR Range Safety Lighting System

  6. A kinetic study of the formation of organic solids from formaldehyde: Implications for the origin of extraterrestrial organic solids in primitive Solar System objects

    Science.gov (United States)

    Kebukawa, Yoko; Cody, George D.

    2015-03-01

    Aqueous organic solid formation from formaldehyde via the formose reaction and subsequent reactions is a possible candidate for the origin of complex primitive chondritic insoluble organic matter (IOM) and refractory carbon in comets. The rate of formation of organic solids from formaldehyde was studied as a function of temperature and time, with and without ammonia, in order to derive kinetic expressions for polymer yield. The evolution in molecular structure as a function of time and temperature was studied using infrared spectroscopy. Using these kinetic expressions, the yield of organic solids is estimated for extended time and temperature ranges. For example, the half-life for organic solid formation is ∼5 days at 373 K, ∼200 days at 323 K, and ∼70 years at 273 K with ammonia, and ∼25 days at 373 K, ∼13 years at 323 K, and ∼2 × 104 years at 273 K without ammonia. These results indicate that organic solids could form during the aqueous alteration in meteorite parent bodies. If liquid water existed early in the interiors of Kuiper belt objects (KBOs), formaldehyde could convert into organic solids at temperatures close to 273 K, and possibly even below 273 K in the ammonia-water system.

  7. Intermittent Preventive Therapy and Treatment of Malaria during ...

    African Journals Online (AJOL)

    54.9%) of these women were multigravidae who have had 3 or more pregnancies at the time of interview. Most 273 (58.1 %) of the participants were in the age group of 20 - 35 years, and 58.1 % of all women had attained formal education.

  8. Molecular Interaction of the Shigella Flexneri Protein H-NS and Its Significance in the Temperature Regulation of Virulence

    Science.gov (United States)

    1999-01-22

    al gene control mechanisms. Mol. Micro. 29 : 677-684. 24 . Drlica, K. 1984. Biology of bacteri al deoxyribonucleic acid topoi somerases. Microbiol...Rev. 48: 273-289. 25. Drlica, K., G. J. Pruss, R. M. Burger, R. J. Franco, L. S. Hsiesh, and B. A. Berger. 1990. Roles of DNA topoi somera ses In

  9. 78 FR 26286 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2013-05-06

    ...-0425; Directorate Identifier 2011-NM-273-AD] RIN 2120-AA64 Airworthiness Directives; The Boeing Company... directive (AD) for all The Boeing Company Model 717-200 airplanes. That NPRM proposed requiring repetitive... identified in this proposed AD, contact Boeing Commercial Airplanes, Attention: Data & Services Management...

  10. Social Support and Heart Failure: Differing Effects by Race

    Science.gov (United States)

    2015-05-11

    dissertation committee chair Dr. Tracy Sbrocco, and members, Dr. Jeffrey Goodie and Dr. Cara Olsen for their incredible encouragement and input into...73. Pilisuk M, & Froland C. 1978. Kinship, social networks, social support and health. Soc. Sci. & Med. 128: 273-80 74. Plant EA, Sach -Ericsson N

  11. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

  12. Physical Education Pedagogy Faculty Perceptions of Journal Quality

    Science.gov (United States)

    Silverman, Stephen; Kulinna, Pamela Hodges; Phillips, Sharon R.

    2013-01-01

    This study examined perceived journal quality by physical education pedagogy faculty members. Participants (N = 273) were identified in three ways and recruited through e-mail. Based on research in other fields investigating journal quality and on publication patterns in physical education, a web-based survey was used to examine (a) whether…

  13. Computer program for calculation of complex chemical equilibrium compositions and applications. Supplement 1: Transport properties

    Science.gov (United States)

    Gordon, S.; Mcbride, B.; Zeleznik, F. J.

    1984-01-01

    An addition to the computer program of NASA SP-273 is given that permits transport property calculations for the gaseous phase. Approximate mixture formulas are used to obtain viscosity and frozen thermal conductivity. Reaction thermal conductivity is obtained by the same method as in NASA TN D-7056. Transport properties for 154 gaseous species were selected for use with the program.

  14. Quality assessment of palm oil sold in major markets in Abia State ...

    African Journals Online (AJOL)

    This paper examines the quality of palm oil samples obtained from different locations in Abia State, Nigeria in terms of their physicochemical properties. The results obtained showed that the saponification value (SV) ranged from 129.04 – 198.03KOH/g of oil. The free fatty acid (FFA) of the palm oil samples ranged from 2.73 ...

  15. 40 CFR 430.15 - New source performance standards (NSPS).

    Science.gov (United States)

    2010-07-01

    ....4 TSS 27.3 14.3 7.5 pH (1) (1) (1) Maximum for any 1 day Kg/kkg (or pounds per 1,000 lb) of product... GUIDELINES AND STANDARDS THE PULP, PAPER, AND PAPERBOARD POINT SOURCE CATEGORY Dissolving Kraft Subcategory...

  16. 41 CFR 101-27.303 - Reducing long supply.

    Science.gov (United States)

    2010-07-01

    ... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.3-Maximizing Use of Inventories § 101-27.303 Reducing long supply. Through effective interagency matching of... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Reducing long supply. 101...

  17. Využití brassinosteroidů k regulaci stresu během růstu a tvorby výnosu řepy cukrové

    Czech Academy of Sciences Publication Activity Database

    Hradecká, D.; Urban, J.; Kohout, Ladislav; Pulkrábek, J.; Hnilička, R.

    2009-01-01

    Roč. 125, 9/10 (2009), s. 271-273 ISSN 1210-3306 R&D Projects: GA AV ČR 1QS510680561 Institutional research plan: CEZ:AV0Z40550506 Keywords : sugar beet * yield * technological quality * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 0.645, year: 2009

  18. Assessment of anxiety and depression in hospitalized cardiac ...

    African Journals Online (AJOL)

    Results: The anxiety and depression level in hospitalized cardiac patient's was 79.5% (318), compared with 68.25 % (273) of the control ... Close monitoring is required and patients with psychiatric illness should be referred for appropriate treatment ..... which may include personality disorder like aggression may be related ...

  19. NJP VOLUME 42 NO 1

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-08-09

    Aug 9, 2014 ... Sixty six percent of the teachers have heard of the word autism,. 34.8% heard it by social interac- tion while 27.3% heard it through the media. Of those who have ... shad poor academic performance while 19.4% were good in ... Autistic children in a typical school in Nigeria face a scaring challenge early on ...

  20. Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

    Czech Academy of Sciences Publication Activity Database

    Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.

    2015-01-01

    Roč. 473, 1 January (2015), s. 267-273 ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.557, year: 2015

  1. Letter to the Editor

    Directory of Open Access Journals (Sweden)

    Thomas K. Karikari

    2015-02-01

    Full Text Available This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2:273–274, 2013.

  2. ORIGINAL ARTICLES Prevalence of drug-drug interactions of ...

    African Journals Online (AJOL)

    2008-02-02

    Feb 2, 2008 ... Table II. Frequency of level 2 interactions between ARVs and the other drugs. Interacting ARVs and other drugs. N. %*. Didanosine + ketoconazole. 1. 0.91. Didanosine + ofloxacin. 1. 0.91. Didanosine + ciprofloxacin. 2. 1.82. Didanosine + iraconazole. 3. 2.73. Didanosine + ketoconazole. 2. 1.82. Efavirenz ...

  3. Gclust Server: 103939 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 103939 PoTR_594761 Cluster Sequences Related Sequences(127) 273 eugene3.66280001 1 ...1.00e-60 14.29 0.0 0.0 0.0 0.0 0.0 Show 103939 Cluster ID 103939 Sequence ID PoTR_594761 Link to cluster seq

  4. Magnetoacoustic Wave Trains in the 11 July 2005 Radio Event with Fiber Bursts

    Czech Academy of Sciences Publication Activity Database

    Mészárosová, Hana; Karlický, Marian; Rybák, J.

    2011-01-01

    Roč. 273, č. 2 (2011), s. 393-402 ISSN 0038-0938 R&D Projects: GA AV ČR IAA300030701 Grant - others:SAV(SK) Vega 2/0064/09 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * corona * flares Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.776, year: 2011

  5. Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23

    Czech Academy of Sciences Publication Activity Database

    Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.

    2005-01-01

    Roč. 36, - (2005), s. 272-273 ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005

  6. S Chaturvedi

    Indian Academy of Sciences (India)

    Symmetries and Conservation Laws in Classical and Quantum Mechanics - Classical Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda · More Details Fulltext PDF. Volume 16 Issue 3 March 2011 pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum ...

  7. New observations on Micropleura australiensis (Nematoda, Dracunculoidea), a parasite of crocodiles in Australia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Spratt, D. M.; Kay, W. R.

    2006-01-01

    Roč. 51, č. 4 (2006), s. 273-278 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Micropleura * Crocodylus * Australia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.772, year: 2006

  8. Download this PDF file

    African Journals Online (AJOL)

    acer

    of Methicillin Resistant Staphylococcus aureus (MRSA) and Clostridium difficile infection (CDI) have not been so prominent in these areas. ..... COUNT. %. Cephalosporins. 215. 67.4. Metronidazole. 185. 58.0. Quinolones. 162. 50.8. Penicillins. 87. 27.3. Carbapenems. 22. 6.9. Anti-tuberculous. 22. 6.9. Glycopeptides. 8. 2.5.

  9. (Hqcf) for Bread Production

    African Journals Online (AJOL)

    OSE

    inclusion policy (r = -0.273); awareness of potential value of HQCF inclusion in bread production (r = -. 0.340) and the bakers' willingness to .... per week from bread production. 148. Haematological Indices and Cost Benefits of Growing Pigs ..... branches and zone with every members present and with each member given a ...

  10. 49 CFR 192.150 - Passage of internal inspection devices.

    Science.gov (United States)

    2010-10-01

    ... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY... transmission lines 103/4 inches (273 millimeters) or more in outside diameter on which construction begins... on investigation or experience, that there is no reasonably practical alternative under the design...

  11. Examination of Youth Team Athletes' Social Values According to Some Variables

    Science.gov (United States)

    Özdenk, Serhat; Karabulut, Ebru Olcay

    2018-01-01

    In this study, it was aimed to examine of youth team athletes' social values according to some variables. The study was carried out by screening model and includes in range of 9-17 years 273 youth team athletes who take part in individual and team sports such as Taekwondo, Handball, Badminton, Wrestling, Volleyball and Football. "A Tool for…

  12. Nucleoside Inhibitors of Zika Virus

    Czech Academy of Sciences Publication Activity Database

    Eyer, L.; Nencka, Radim; Huvarová, I.; Palus, Martin; Alves, M. J.; Gould, E. A.; De Clercq, E.; Růžek, Daniel

    2016-01-01

    Roč. 214, č. 5 (2016), s. 707-711 ISSN 0022-1899 Institutional support: RVO:61388963 ; RVO:60077344 Keywords : Zika virus * flavivirus * nucleoside analogue * antiviral * therapy Subject RIV: CC - Organic Chemistry; EE - Microbiology, Virology (BC-A) Impact factor: 6.273, year: 2016

  13. A rare severe enamel defect on an upper pig molar from an early medieval stronghold in Prague (Czech Republic) - short communication

    Czech Academy of Sciences Publication Activity Database

    Teegen, W.-R.; Kyselý, René

    2016-01-01

    Roč. 86, č. 2 (2016), s. 273-285 ISSN 0372-5480 Institutional support: RVO:67985912 Keywords : enamel hypoplasia * severe dental malformation * infection * pig (Sus domesticus) * Middle Ages * weaning Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.302, year: 2016 http://www-staro.vef.unizg.hr/vetarhiv/papers/2016-86-2-11.pdf

  14. The functional interactions between CD98, beta 1-integrins, and CD147 in the induction of U937 homotypic aggregation

    Czech Academy of Sciences Publication Activity Database

    Cho, J. Y.; Fox, D. A.; Hořejší, Václav; Sagawa, K.; Skubitz, K. M.; Katz, D. R.; Chain, B.

    2001-01-01

    Roč. 98, č. 2 (2001), s. 374-382 ISSN 0006-4971 R&D Projects: GA ČR GA310/99/0349 Institutional research plan: CEZ:AV0Z5052915 Keywords : integrin * CD98 * CD147 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.273, year: 2001

  15. Experiment list: SRX524973 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX524973 hg19 Histone H3K4me1 Uterus Endometrial stromal cells NA 30874750,99.0,35....9,273 GSM1372865: H3K4me1 case2 w/ EP; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

  16. A RhoGDP dissociation inhibitor spatially regulates growth in root hair cells

    Czech Academy of Sciences Publication Activity Database

    Carol, R.J.; Takeda, S.; Linstead, P.; Durrant, M.C.; Toupalová, Hana; Derbyshire, P.; Drea, S.; Žárský, Viktor; Dolan, L.

    2005-01-01

    Roč. 438, č. 7070 (2005), s. 1013-1016 ISSN 0028-0836 R&D Projects: GA ČR GA204/02/1461 Institutional research plan: CEZ:AV0Z50380511 Keywords : NADPH OXIDASE * MEDICAGO-TRUNCATULA * TIP GROWTH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 29.273, year: 2005

  17. Social Connectedness, Discrimination, and Social Status as Mediators of Acculturation/Enculturation and Well-Being

    Science.gov (United States)

    Yoon, Eunju; Hacker, Jason; Hewitt, Amber; Abrams, Matthew; Cleary, Sarah

    2012-01-01

    The present study proposed and tested a conceptual model of acculturation/enculturation and subjective well-being (SWB) by including social connectedness in mainstream society, social connectedness in the ethnic community, perceived discrimination, and expected social status as mediators. Survey data from 273 Asian American college students in the…

  18. File list: Oth.ALL.50.Biotin.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Biotin.AllCell mm9 TFs and others Biotin All cell types SRX477548,SRX273...57049,SRX1057045,SRX1057047,SRX019779,SRX1057043,SRX1057051 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Biotin.AllCell.bed ...

  19. Emotional Intelligence, Communication Competence, and Student Perceptions of Team Social Cohesion

    Science.gov (United States)

    Troth, Ashlea C.; Jordan, Peter J.; Lawrence, Sandra A.

    2012-01-01

    Students generally report poor experiences of group work in university settings. This study examines whether individual student perceptions of team social cohesion are determined by their level of emotional intelligence (EI) and whether this relationship is mediated by their communication skills. Business students (N = 273) completed the 16-item…

  20. 2. Home 3. Journals 4. Bulletin of Materials Science 5. Volume 23 6 ...

    Indian Academy of Sciences (India)

    Unknown

    BaTiO3. Conductivity, dielectric behaviour and magnetoelectric effect in copper ferrite–barium titanate composites. 273. Bioceramics. On the development of an .... Dielectric properties. Dielectric properties of NaF–B2O3 glasses doped with certain transition metal ions. 285. Dielectric properties of nanophase Ag2HgI4 and ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 273 ... AMS Nyomora. Vol 38, No 2 (2012), Distribution and Potential Impact of Feral Cotton on the Reintroduction of Cotton in the Southern Highlands, Tanzania, Abstract PDF. O Shilla, TP Hauser, FI Tibazarwa. Vol 31 (2005):, Distribution of hourly variability index of sky clearness, Abstract PDF. A Madhlopa.

  2. 28 CFR 0.122 - Office on Violence Against Women.

    Science.gov (United States)

    2010-07-01

    ... Section 0.122 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE 2... Department of Justice Appropriations Authorization Act (Pub. L. 107-273); and (2) Perform such other duties... Attorney General, consistent with constitutional limits on the Federal Government's authority to act in...

  3. 28 CFR 79.2 - General definitions.

    Science.gov (United States)

    2010-07-01

    ... Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) CLAIMS UNDER THE RADIATION EXPOSURE COMPENSATION... Department of Justice Appropriations Authorization Act, Public Law 107-273. (b) Child means a recognized... Program means the component of the Constitutional and Specialized Torts Litigation Section of the Torts...

  4. Mahalanobis distance screening of Arabidopsis mutants with chlorophyll fluorescence

    Czech Academy of Sciences Publication Activity Database

    Codrea, C. C.; Hakala-Yatkin, M.; Karlund-Marttila, A.; Nedbal, Ladislav; Aittokallio, T.; Nevalainen, O. S.; Tyystjärvi, E.

    2010-01-01

    Roč. 105, č. 3 (2010), s. 273-283 ISSN 0166-8595 Institutional research plan: CEZ:AV0Z60870520 Keywords : arabidopsis thaliana * chlorophyll fluorescence * fluorescence imaging * mutant detection * outlier detection Subject RIV: EH - Ecology, Behaviour Impact factor: 2.410, year: 2010 http://www.springerlink.com/content/x3586512462pn006/

  5. Numerical modelling of permafrost in bedrock in northern Fennoscandia during the Holocene

    Czech Academy of Sciences Publication Activity Database

    Kukkonen, I. T.; Šafanda, Jan

    2001-01-01

    Roč. 29, 3/4 (2001), s. 259-273 ISSN 0921-8181 Institutional research plan: CEZ:AV0Z3012916 Keywords : permafrost * Holocene * climate change * freezing * thawing * Fennoscandia Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.381, year: 2001

  6. Resonance Scattering Analysis by Autoregressive Models Applied to Air-Filled, Cylindrical, Thin Walled Shells in Water

    Science.gov (United States)

    1997-10-01

    cylindrical shells. Journal Acoustique , 4, 1991: 509-523. [13] Magand F., and Chevret P., Time frequency analysis of energy distribution for...application a 1’etude des ondes de Lamb Journal Acoustique , 3, 1990: 273-280. [17] Kay S.M., Modem spectral estimation: theory and application, New York

  7. East African Medical Journal - Vol 94, No 4 (2017)

    African Journals Online (AJOL)

    Sero prevalence of hepatitis B and C viruses among HIV infected patients in a HIV care program in Kenya: a cross sectional study · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S.B. Okoth, O.F. Rehmani, M.J. Karoney, L Diero, P.O. Ayuo, 266-273 ...

  8. Frequency of fragile-x in x-linked mental retardation

    African Journals Online (AJOL)

    introduction: Fragile X syndrome (FXS) is the most common form of inher‑ ited mental retardation and accounts for about one third of all cases of X linked mental retardation (XLMR). It is inherited as an X‑linked dominant trait with a fragile site at Xq27.3 locus named fragile X mental retardation gene (FMR‑1). The FMR‑1 ...

  9. Week 48 efficacy and central nervous system analysis of darunavir/ritonavir monotherapy versus darunavir/ritonavir with two nucleoside analogues

    DEFF Research Database (Denmark)

    Antinori, Andrea; Clarke, Amanda; Svedhem-Johansson, Veronika

    2015-01-01

    BACKGROUND: In previous studies in virologically suppressed patients, protease inhibitor monotherapy has shown trends for more low-level elevations in HIV-1 RNA compared with triple therapy, but no increase in the risk of drug resistance. METHODS: A total of 273 patients with HIV-1 RNA less than 50...

  10. The leucine zipper region of Myb oncoprotein regulates the commitment of hematopoietic progenitors

    Czech Academy of Sciences Publication Activity Database

    Karafiát, Vít; Dvořáková, Marta; Pajer, Petr; Králová, Jarmila; Hořejší, Václav; Čermák, Vladimír; Bartůněk, Petr; Zenke, M.; Dvořák, Michal

    2001-01-01

    Roč. 2001, č. 98 (2001), s. 3668-3676 ISSN 0006-4971 R&D Projects: GA AV ČR IPP2052002 Institutional research plan: CEZ:AV0Z5052915 Keywords : BLOOD-CELL DIFFERENTIATION * TRANSCRIPTION FACTOR * V-MYB Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.273, year: 2001

  11. A Checklist Of Desmids In Nigeria | Kadiri | Global Journal of Pure ...

    African Journals Online (AJOL)

    The paper presents a checklist of diversity and distribution of desmid flora in Nigeria. Samples of desmids were collected by means of 55-micrometer mesh plankton net from different locations. There was a high diversity of desmids. A total of 478 taxa are listed in this report. These are categorized into 27 genera, 273 ...

  12. Complications of tube thoracostomy for chest trauma | Maritz | South ...

    African Journals Online (AJOL)

    A self-reporting system recorded complications, and additional data were obtained by searching the department's records and monthly statistics. Results. A total of 3 989 patients with trauma injuries were seen in the front room trauma bay during the study period; 273 (6.8%) patients with an ICD in situ or requiring an ICD

  13. TRAIL/APO2L inhibits myelodysplasia and myeloid leukemia progenitor growth while it does not affect normal progenitors in vitro and normal CD3+ cell repopulation in NOD/SCID mice

    Czech Academy of Sciences Publication Activity Database

    Plašilová, M.; Živný, J.; Jelínek, J.; Neuwirtová, R.; Čermák, J.; Nečas, E.; Anděra, Ladislav; Stopka, T.

    2001-01-01

    Roč. 98, č. 11 (2001), s. 3043 ISSN 0006-4971 R&D Projects: GA AV ČR IAA5052001 Institutional research plan: CEZ:AV0Z5052915 Keywords : TRAIL * leukemia * apoptosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.273, year: 2001

  14. Seasonal and diel changes in photosynthetic activity of the snow algae Chlamydomonas nivalis (Chlorophyceae) from Svalbard determined by PAM fluorometry

    Czech Academy of Sciences Publication Activity Database

    Stibal, Marek; Elster, Josef; Šabacká, Marie; Kaštovská, Klára

    2007-01-01

    Roč. 59, - (2007), s. 265-273 ISSN 0168-6496 R&D Projects: GA AV ČR KJB6005409 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlamydomonas nivalis * photosynthetic activity * PAM fluorometry Subject RIV: EF - Botanics Impact factor: 3.039, year: 2007

  15. 76 FR 41824 - NASA Advisory Council; Science Committee; Meeting

    Science.gov (United States)

    2011-07-15

    .../ , meeting number on August 2 is 999 757 273, and password [email protected]; the meeting number on August 3 is 995 402 118, and password [email protected] The agenda for the meeting includes the following topics... and to comply with NASA security requirements, including the presentation of a valid picture ID to...

  16. Micro‐CT analyses of apical enlargement and molar root canal complexity

    DEFF Research Database (Denmark)

    Markvart, M.; Darvann, Tron Andre; Larsen, P.

    2012-01-01

    Markvart M, Darvann TA, Larsen P, Dalstra M, Kreiborg S, Bjørndal L. Micro‐CT analyses of apical enlargement and molar root canal complexity. International Endodontic Journal, 45, 273–281, 2012. Aim To compare the effectiveness of two rotary hybrid instrumentation techniques with focus on apical...

  17. Social Influence as Reinforcement Learning

    Science.gov (United States)

    2016-01-13

    eating behavior (submitted), Health Psychology (01 2016) TOTAL: 2 Books Number of Manuscripts: Patents Submitted Patents Awarded Awards Graduate...497-529. 6. Knowlton, B.J., J.A. Mangels, and L.R. Squire, A neostriatal habit learning system in humans. Science, 1996. 273(5280): p. 1399-402

  18. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  19. Computer image analysis of seed shape and seed color for flax cultivar description

    Czech Academy of Sciences Publication Activity Database

    Wiesnerová, Dana; Wiesner, Ivo

    2008-01-01

    Roč. 61, č. 2 (2008), s. 126-135 ISSN 0168-1699 R&D Projects: GA ČR GA521/03/0019 Institutional research plan: CEZ:AV0Z50510513 Keywords : image analysis * cultivar description * flax Subject RIV: EA - Cell Biology Impact factor: 1.273, year: 2008

  20. Colorimetric Determination of Cefadroxil and Ceftriazone in ...

    African Journals Online (AJOL)

    Erah

    and in biological fluids. These methods mainly involve ... combined with other drugs in various dosage forms. CFL and cefotaxime in ..... 263-273. 7. Parasrampuria J, Das Gupta V. Quantitation of cefadroxil in pharmaceutical dosage forms using high-performance liquid chromatography. Drug Dev. Ind. Pharm. 1990; 16: ...