
Sample records for meitnerium 271

  1. 33 CFR 117.271 - Blackwater River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blackwater River. 117.271 Section 117.271 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.271 Blackwater River. The draw of the...

  2. 49 CFR 27.1 - Purpose. (United States)


    ... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 27.1 Purpose. The purpose of this part is to... 49 Transportation 1 2010-10-01 2010-10-01 false Purpose. 27.1 Section 27.1 Transportation Office... subjected to discrimination under any program or activity receiving Federal financial assistance. ...

  3. 14 CFR 271.9 - Discrimination prohibited. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Discrimination prohibited. 271.9 Section... TRANSPORTATION § 271.9 Discrimination prohibited. (a) All air carriers receiving subsidy under this part shall comply with the following: (1) The Age Discrimination Act of 1975; (2) The Civil Rights Act of 1964 and...

  4. 36 CFR 271.4 - Commercial license. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial license. 271.4... BEARâ SYMBOL § 271.4 Commercial license. (a) The Chief may authorize the commercial manufacture... a use or royalty charge which is reasonably related to the commercial enterprise has been...

  5. 40 CFR 264.271 - Treatment program. (United States)


    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Treatment program. 264.271 Section 264... Treatment § 264.271 Treatment program. (a) An owner or operator subject to this subpart must establish a land treatment program that is designed to ensure that hazardous constituents placed in or on the...

  6. 14 CFR 271.6 - Profit element. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Profit element. 271.6 Section 271.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... element. The reasonable return for a carrier for providing essential air service at an eligible place...

  7. 48 CFR 1352.271-76 - Performance. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1352.271-76... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-76 Performance. As prescribed in 48 CFR 1371.107, insert the following clause: Performance (APR 2010) (a) The contractor shall...

  8. 40 CFR 60.271a - Definitions. (United States)


    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Definitions. 60.271a Section 60.271a Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Steel Plants: Electric Arc Furnaces and...

  9. 48 CFR 1842.271 - NASA clause. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA clause. 1842.271 Section 1842.271 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... NASA clause. Insert the clause at 1852.242-70, Technical Direction, when paragraph 3(m) of the NASA...

  10. 47 CFR 0.271 - Authority delegated. (United States)


    ... of Strategic Planning and Policy Analysis § 0.271 Authority delegated. (a) Insofar as authority is... status, the Chief, Office of Strategic Planning and Policy Analysis is delegated authority to deny... Strategic Planning and Policy Analysis has primary authority. (b) [Reserved] [45 FR 10347, Feb. 15, 1980, as...

  11. 27 CFR 25.271 - General. (United States)


    ... TREASURY LIQUORS BEER Pilot Brewing Plants § 25.271 General. (a) Establishment. A person may establish and... developmental purposes relating to beer or brewery operations. Pilot brewing plants will be established as provided in this subpart. (b) Authorized removals. Beer may be removed from a pilot brewing plant only for...

  12. 7 CFR 271.1 - General purpose and scope. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 271.1 Section 271.1... AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM GENERAL INFORMATION AND DEFINITIONS § 271.1 General purpose and scope. (a) Purpose of the food stamp program. The food stamp program is designed to promote...

  13. 40 CFR 271.18 - Coordination with other programs. (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Coordination with other programs. 271.18 Section 271.18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Authorization § 271.18 Coordination with other programs. (a) Issuance of State permits under this subpart may be...

  14. 48 CFR 1352.271-86 - Lay days. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1352.271-86... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-86 Lay days. As prescribed in 48 CFR 1371.117, insert the following clause: Lay Days (APR 2010) (a) A lay day is defined as an...

  15. 48 CFR 1816.405-271 - Base fee. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Base fee. 1816.405-271... CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 1816.405-271 Base fee. (a) A base fee shall not be used on CPAF contracts for which the periodic award fee evaluations are final...

  16. 27 CFR 19.271 - Construction of buildings (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Construction of buildings 19.271 Section 19.271 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Construction of buildings Buildings in which spirits, denatured spirits, articles, or wines are produced...

  17. Gamma spectrometry on MANITU 271-01 gamma scan wires

    International Nuclear Information System (INIS)

    Dassel, G.; Buurveld, H.A.; Minkema, J.


    A series of irradiation experiments (271-series) is being performed of the sustain programme for material development and characterization of the NET (Next European Torus). In the framework of the first irradiation experiment 271-01, with irradiation up to 0.2 dpa, four gamma scan wires have been examined by gamma scanning. The purpose of the gamma scan wires (GSW) is to get information about the neutron fluence distribution in the capsules during irradiation. In the stainless steel wires the nuclides Co-58, Mu-54, Fe-59 and Co-60 are produced, are characteristic for fast and thermal neutron reactions. (orig./HP)

  18. 48 CFR 1352.271-73 - Schedule of work. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Schedule of work. 1352.271... of work. As prescribed in 48 CFR 1371.104, insert the following clause. Schedule of Work (APR 2010... arrival at the contractor's facility: (1) Production Schedule. (2) Work Package Network. (3) Total...

  19. 48 CFR 719.271-3 - USAID contracting officers. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false USAID contracting officers... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-3 USAID contracting officers. With... the Federal Acquisition Regulations; (g) Submitting proposed procurement actions for USAID/Washington...

  20. 12 CFR 27.1 - Scope and OMB control number. (United States)


    ... Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR HOUSING HOME LOAN DATA SYSTEM § 27.1 Scope and OMB control number. (a) Scope. This part applies to the activities of national... information requirements contained in this part were approved by the Office of Management and Budget under OMB...

  1. 48 CFR 719.271-6 - Small business screening procedure. (United States)


    ... certifies in writing that the public exigency will not permit the delay incident to screening (719.271-7(b... supplemented by him/her. (3) The contracting officer shall complete blocks 2, 3, 4, 5, 9, and 10 (when... section 8(a) subcontracting, and furnish him/her with either a written concurrence in his/her...

  2. 48 CFR 852.271-73 - Use and publication of counseling results. (United States)


    ... counseling results. 852.271-73 Section 852.271-73 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-73 Use and publication of counseling results. As prescribed in 871.212, insert the following clause: Use and Publication of Counseling Results (JAN 2008) The contractor agrees that none of...

  3. 48 CFR 852.271-72 - Time spent by counselee in counseling process. (United States)


    ... counseling process. 852.271-72 Section 852.271-72 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-72 Time spent by counselee in counseling process. As prescribed in 871.212, insert the following clause: Time Spent by Counselee in Counseling Process (APR 1984) The contractor agrees that no...

  4. 27 CFR 27.1 - Imported distilled spirits, wines, and beer. (United States)


    ..., wines, and beer. 27.1 Section 27.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Scope of Regulations § 27.1 Imported distilled spirits, wines, and beer. This part, “Importation of...

  5. 49 CFR 40.271 - How are alcohol testing problems corrected? (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false How are alcohol testing problems corrected? 40.271 Section 40.271 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.271 How are alcohol testing...

  6. Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation

    Directory of Open Access Journals (Sweden)

    Giovanna Calabrese


    Full Text Available The Low-Affinity Nerve Growth Factor Receptor (LNGFR, also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271− mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

  7. Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation. (United States)

    Calabrese, Giovanna; Giuffrida, Raffaella; Lo Furno, Debora; Parrinello, Nunziatina Laura; Forte, Stefano; Gulino, Rosario; Colarossi, Cristina; Schinocca, Luciana Rita; Giuffrida, Rosario; Cardile, Venera; Memeo, Lorenzo


    The Low-Affinity Nerve Growth Factor Receptor (LNGFR), also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271- mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

  8. 47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers. (United States)


    ... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...

  9. 48 CFR 1823.271 - NASA Solicitation provision and contract clause. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA Solicitation provision and contract clause. 1823.271 Section 1823.271 Federal Acquisition Regulations System NATIONAL... Renewable Energy 1823.271 NASA Solicitation provision and contract clause. Insert the clause at 1852.223-76...

  10. 48 CFR 853.271 - Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. 853.271 Section 853.271 Federal Acquisition... Guaranty, Education and Vocational Rehabilitation and Counseling Programs. ...

  11. 26 CFR 1.271-1 - Debts owed by political parties. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Debts owed by political parties. 1.271-1 Section... (CONTINUED) INCOME TAXES Items Not Deductible § 1.271-1 Debts owed by political parties. (a) General rule. In... arose, owed by a political party. For example, it is immaterial that the debt may have arisen as a...

  12. 48 CFR 1352.271-83 - Government review, comment, acceptance and approval. (United States)


    ..., acceptance or approval by the Government as required under this contract and applicable specifications shall..., acceptance and approval. 1352.271-83 Section 1352.271-83 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352...

  13. 36 CFR 271.8 - Consultation with Association of State Foresters and the Advertising Council. (United States)


    ... of State Foresters and the Advertising Council. 271.8 Section 271.8 Parks, Forests, and Public... Association of State Foresters and the Advertising Council. These regulations in this part have been issued after consultation with the Association of State Foresters and the Advertising Council. ...

  14. Tumor stem cells (CD271, c-kit, SOX10) in Melanomas: prognostic and outcome implications. (United States)

    Mohamed, Amr; Gonzalez, Raul S; Lawson, Diane; Wang, Jason; Cohen, Cynthia


    Melanoma cells that express stem cell marker CD271 are shown to form tumors when transplanted into nude or immunodeficient mice. These tumors have a higher metastatic potential and worse prognosis than melanomas resulting from transplantation of CD271-negative cells. We studied stem cell markers (CD271, c-kit, SOX1O) in melanomas, correlating their presence with prognostic factors and outcome. A total of 82 melanomas in tissue microarrays were immunostained for CD271, c-kit, and SOX10. Results were correlated with clinicopathologic prognostic parameters (Breslow depth of invasion, Clark level, sentinel lymph node status, and pathologic stage) and outcome (recurrence, metastases, and death). Of the 82 melanomas, CD271 was expressed in 18 (21%), c-kit in 47 (57%), and SOX10 in all (100%). CD271 does show correlation with metastases (P=0.05). c-kit is associated with favorable prognostic parameters [Breslow depth (Pmelanomas studied. In conclusion, CD271 expression in melanomas is associated with increased frequency of metastases, and c-kit immunoreactivity is associated with favorable prognostic parameters and improved outcome.

  15. Single CD271 marker isolates mesenchymal stem cells from human dental pulp. (United States)

    Alvarez, Ruth; Lee, Hye-Lim; Hong, Christine; Wang, Cun-Yu


    Mesenchymal stem cells (MSCs) are a promising tool in regenerative medicine due to their capacity to differentiate into multiple lineages. In addition to MSCs isolated from bone marrow (BMSCs), adult MSCs are isolated from craniofacial tissues including dental pulp tissues (DPs) using various stem cell surface markers. However, there has been a lack of consensus on a set of surface makers that are reproducibly effective at isolating putative multipotent dental mesenchymal stem cells (DMSCs). In this study, we used different combinations of surface markers (CD51/CD140α, CD271, and STRO-1/CD146) to isolate homogeneous populations of DMSCs from heterogeneous dental pulp cells (DPCs) obtained from DP and compared their capacity to undergo multilineage differentiation. Fluorescence-activated cell sorting revealed that 27.3% of DPCs were CD51(+)/CD140α(+), 10.6% were CD271(+), and 0.3% were STRO-1(+)/CD146(+). Under odontogenic conditions, all three subsets of isolated DMSCs exhibited differentiation capacity into odontogenic lineages. Among these isolated subsets of DMSCs, CD271(+) DMSCs demonstrated the greatest odontogenic potential. While all three combinations of surface markers in this study successfully isolated DMSCs from DPCs, the single CD271 marker presents the most effective stem cell surface marker for identification of DMSCs with high odontogenic potential. Isolated CD271(+) DMSCs could potentially be utilized for future clinical applications in dentistry and regenerative medicine.

  16. BKR 27(1) pp. 50-55 (Achuba et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... Biokemistri 27(1): 50–55. 54. Farombi, E.O. (2000) Mechanisms for the hepatoprotective action of kolaviron, studies on hepatic enzymes, microsomal lipids and peroxidation in carbon tetrachloride-treated rats. Pharmacological Research 42: 75–80. Farris MW (1991) Cadmium toxicity: Unique cytoprotective.

  17. 40 CFR 271.12 - Requirements for hazardous waste management facilities. (United States)


    ... Requirements for Final Authorization § 271.12 Requirements for hazardous waste management facilities. The State shall have standards for hazardous waste management facilities which are equivalent to 40 CFR parts 264... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Requirements for hazardous waste...

  18. 7 CFR 2.71 - Director, Office of Risk Assessment and Cost-Benefit Analysis. (United States)


    ... Chief Economist § 2.71 Director, Office of Risk Assessment and Cost-Benefit Analysis. (a) Delegations..., Office of Risk Assessment and Cost-Benefit Analysis: (1) Responsible for assessing the risks to human... analyses and coordinate and review all risk assessments and cost-benefit analyses prepared by any agency of...

  19. 48 CFR 719.271-2 - The USAID Office of Small and Disadvantaged Business Utilization (SDB). (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false The USAID Office of Small... Policies 719.271-2 The USAID Office of Small and Disadvantaged Business Utilization (SDB). (a) SDB is...; (2) Advising and consulting regularly with USAID/Washington procuring activities on all phases of...

  20. 20 CFR 404.271 - When automatic cost-of-living increases apply. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When automatic cost-of-living increases apply... AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.271 When automatic cost-of-living increases apply. Besides increases in the primary insurance amounts...

  1. 48 CFR 719.271-7 - Reports on procurement actions that are exempted from screening. (United States)


    ... the duplicate copy with the documentation required by Block 5 of the form to SDB. The original will be... section 8(a) subcontracting, it shall so advise the contracting officer in writing within five days after... documentation required by Block 5 of the form to SDB. In addition to the documentation called for in 719.271-6...

  2. 25 CFR 1000.271 - What other statutes and regulations apply to FTCA coverage? (United States)


    ... OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Federal Tort Claims § 1000.271 What other statutes and... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to FTCA...

  3. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  4. Examining the feasibility of clinical grade CD271+ enrichment of mesenchymal stromal cells for bone regeneration.

    Directory of Open Access Journals (Sweden)

    Richard J Cuthbert

    Full Text Available Current clinical trials utilize mesenchymal stromal cells (MSCs expanded in culture, however these interventions carry considerable costs and concerns pertaining to culture-induced losses of potency. This study assessed the feasibility of new clinical-grade technology to obtain uncultured MSC isolates from three human intra-osseous tissue sources based on immunomagnetic selection for CD271-positive cells.MSCs were isolated from bone marrow (BM aspirates or surgical waste materials; enzymatically digested femoral heads (FHs and reamer irrigator aspirator (RIA waste fluids. Flow cytometry for the CD45-/lowCD73+CD271+ phenotype was used to evaluate uncultured MSCs before and after selection, and to measure MSC enrichment in parallel to colony forming-unit fibroblast assay. Trilineage differentiation assays and quantitative polymerase chain-reaction for key transcripts involved in bone regeneration was used to assess the functional utility of isolated cells for bone repair.Uncultured CD45-/lowCD271+ MSCs uniformly expressed CD73, CD90 and CD105 but showed variable expression of MSCA-1 and SUSD2 (BM>RIA>FH. MSCs were enriched over 150-fold from BM aspirates and RIA fluids, whereas the highest MSC purities were obtained from FH digests. Enriched fractions expressed increased levels of BMP-2, COL1A2, VEGFC, SPARC and CXCL12 transcripts (BM>RIA>FH, with the highest up-regulation detected for CXCL12 in BM (>1300-fold. Following culture expansion, CD271-selected MSCS were tri-potential and phenotypically identical to plastic adherence-selected MSCs.A CD271-based GMP-compliant immunomagnetic selection resulted in a substantial increase in MSC purity and elevated expression of transcripts involved in bone formation, vascularisation and chemo-attraction. Although this technology, particularly from RIA fluids, can be immediately applied by orthopaedic surgeons as autologous therapy, further improvements in MSC purities and pre-clinical testing of product

  5. Trehalose preincubation increases mesenchymal (CD271+ stem cells post-cryopreservation viability

    Directory of Open Access Journals (Sweden)

    Indra Kusuma


    Full Text Available Background: Dimethyl sulfoxide (Me2SO is a common cryoprotective agent widely used in cell preservation system. Me2SO is currently known to cause epigenetic changes which are  critical in stem cells development and cellular differentiation. Therefore, it is imperative to develop cryopreservation techniques that protect cellular functions and avert Me2SO adverse effect. Trehalose was able to protect organism in extreme condition such as dehydration and cold. This study aimed to verify the protective effect of trehalose preincubation procedure in cryopreservation.Methods: The study was conducted using experimental design. Thawed mesenchymal (CD271+ stem cells from YARSI biorepository were used for the experiment. Trehalose preincubation was performed for 1 hour, internalized trehalose was confirmed by FTIR-ATR measurement. Three groups consisted of (1 cryopreserved without trehalose preincubation, (2 cryopreserved with trehalose preincubation, and (3 did not undergo cryopreservation were evaluated after 24 hours in LN2 for viability in culture. The absorbance from each group was measured at 450 nm. The analysis performed using paired student t test.Results: Viability of thawed mesenchymal (CD271+ stem cells that undergo trehalose preincubation prior cryopreservation was significantly higher (p<0.05 compared to group without trehalose preincubation. Higher viability observed between group with trehalose preincubation compared with controlled group suggests protection to trypsinization. Mesenchymal (CD271+ stem cells incubated for 1 hour in 100 mM trehalose supplemented medium  results in 15%  trehalose loading efficiency.Conclusion: These findings confirm the protective effect of trehalose preincubation in cryopreservation. Future research should be directed to elucidate the trehalose internalization mechanism and eventually the protective mechanism of trehalose in mammalian cell cryopreservation.

  6. Retrospective analysis of 271 arteriovenous fistulas as vascular access for hemodialysis

    Directory of Open Access Journals (Sweden)

    P Sahasrabudhe


    Full Text Available This report describes our experience of arteriovenous fistula (AVF creation as vascular access for hemodialysis (HD. Study has been carried out in Deenanath Mangeshkar Hospital, Pune from January 2004 to December 2009. A total of 271 AVFs were created in 249 patients. Maximum follow up was 7 years and minimum was 1 year. In this study of 271 cases of AVFs, there were 196 (72.3% successful cases and 75 (27.7% failures. Basilic vein was used in 77 (28.4% cases, cephalic vein in 186 (68.6%, and antecubital vein in 8 (3% cases. End (vein to side (artery anastomosis was done in 170 (63% cases. Side to side anastomosis was done in 100 (37% cases. On table bruit was present in 244 (90% and thrill in 232 (85.6% cases. During dialysis, flow rate >250 ml/min was obtained in 136 (50.4% cases. In complications, 16 (5.9% patients developed distal edema, 32 (11.8% developed steal phenomenon. Presence of on table thrill and bruit are indicators of successful AVF. If vein diameter is <2 mm, chances of AVF failure are high. During proximal side to side fistula between antecubital/basilic vein and brachial artery, breaking of first valve toward wrist helps to develop distal veins in forearm by retrograde flow. This technique avoids requirement of superficialization of basilic vein in arm.

  7. CD271⁺ subpopulation of pancreatic stellate cells correlates with prognosis of pancreatic cancer and is regulated by interaction with cancer cells.

    Directory of Open Access Journals (Sweden)

    Kenji Fujiwara

    Full Text Available Pancreatic stellate cells (PSCs play a crucial role in the aggressive behavior of pancreatic cancer. Although heterogeneity of PSCs has been identified, the functional differences remain unclear. We characterized CD271⁺ PSCs in human pancreatic cancer. Immunohistochemistry for CD271 was performed for 31 normal pancreatic tissues and 105 pancreatic ductal adenocarcinomas (PDACs. We performed flow cytometry and quantitative RT-PCR, and assessed CD271 expression in PSCs isolated from pancreatic tissues and the changes in CD271 expression in PSCs cocultured with cancer cells. We also investigated the pattern of CD271 expression in a SCID mouse xenograft model. In the immunohistochemical analyses, the CD271-high staining rates in pancreatic stroma in normal pancreatic tissues and PDACs were 2/31 (6.5% and 29/105 (27.6%, respectively (p = 0.0069. In PDACs, CD271⁺ stromal cells were frequently observed on the edge rather than the center of the tumors. Stromal CD271 high expression was associated with a good prognosis (p = 0.0040. Flow cytometric analyses demonstrated CD271-positive rates in PSCs were 0-2.1%. Quantitative RT-PCR analyses revealed that CD271 mRNA expression was increased in PSCs after coculture with pancreatic cancer cells. However, the level of CD271 mRNA expression subsequently decreased after the transient increase. Furthermore, CD271 mRNA expression was decreased in PSCs migrating toward pancreatic cancer cells through Matrigel. In the xenograft model, CD271⁺ PSCs were present at tumor margins/periphery and were absent in the tumor core. In conclusion, CD271 was expressed in PSCs around pancreatic tumors, but not in the center of the tumors, and expression decreased after long coculture with pancreatic cancer cells or after movement toward pancreatic cancer cells. These findings suggest that CD271⁺ PSCs appear at the early stage of pancreatic carcinogenesis and that CD271 expression is significantly correlated with a

  8. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    International Nuclear Information System (INIS)

    Roser, T.


    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; ampersand 7.6.2- Proton Beam Polarimeters

  9. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.


    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  10. α decay chains from Z = 118 superheavy nuclei in the range 271 ≤A≤ 310 (United States)

    Santhosh, K. P.; Priyanka, B.


    An extensive investigation on the α decay properties of the isotopes of the superheavy nuclei with Z = 118, within the range 271 ≤A≤ 310, has been performed within the Coulomb and proximity potential model for deformed nuclei. The α decay half-lives of 118294 and its decay products, evaluated using our formalisms, are in good agreement with the experimental results. The calculated α half-lives were also found to be matching well with the values computed using the Viola-Seaborg systematic, the universal curve of Poenaru et al. [Phys. Rev. C 83, 014601 (2011), 10.1103/PhysRevC.83.014601;Phys. Rev. C 85, 034615 (2012), 10.1103/PhysRevC.85.034615] and the analytical formulas of Royer [J. Phys. G: Nucl. Part. Phys. 26, 1149 (2000), 10.1088/0954-3899/26/8/305]. So as to identify the mode of decay of these isotopes, the spontaneous-fission half-lives were also evaluated for all the isotopes under study and, our prediction of 3α chains from 118294 go hand in hand with the experimental observations. Our study also unveils that those isotopes of Z = 118 with A ≥ 301 and with A ≤ 275 do not survive fission, thus restricting the α decay within the range of 276 ≤A≤ 300, and we hope that the theoretical prediction of 5α decay chains consistently from 118289-293 isotopes provides a new perspective to experimentalists.

  11. Characterization of endo-β-mannanase from Enterobacter ludwigii MY271 and application in pulp industry. (United States)

    Yang, Miao; Cai, Jun; Wang, Changgao; Du, Xin; Lin, Jianguo


    β-Mannanases are the second most important enzymes for the hydrolysis of hemicelluloses. An endo-β-mannanase from Enterobacter ludwigii MY271 was purified at 11.7 ± 0.2-fold to homogeneity with a final recovery of 15.2 ± 0.2 %. Using purified β-mannanase protein and SDS-PAGE, the molecular mass was found to be 43.16 kDa. The optimal pH and temperature of the enzyme was found to be 7.0 and 55 °C, respectively. The β-mannanase activity was stable over a broad pH range of pH 2.0-10.0. In addition, the purified enzyme was highly activated by several metal ions and chemical reagents, such as Mg 2+ , L-cysteine, glutathione (GSH) and β-mercaptoethanol. Whereas the enzyme was strongly inhibited by Hg 2+ , Cu 2+ , N-bromosuccinimide (NBS), 1-ethyl-3-(3-dimethyl-amino-propyl)-carbodiimide (EDC), phenylmethanesulfonyl fluoride (PMSF), and sodium dodecyl sulfate (SDS). The β-mannanase was highly active towards glucomannan, and showed endo-activity by producing a mixture of oligosaccharides. Moreover, the enzyme displayed a classical endo-type mode on mannooligosaccharides. The β-mannanase coupled with xylanase significantly improved the brightness of kraft pulp, whereas it has no remarkable effect on the tensile strength of the pulp. Our functional studies of the purified β-mannanase indicate that the enzyme is beneficial to industrial applications, in particular, biotechnological processes, such as food, feed and pulp industry.

  12. Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.


    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the appropriate Recommendations of the International Electrotechnical Commission. The radiations in the tests are, in general, selected from the range of reference radiations for instrument calibration being drawn up by the International Standards Organisation. Normally, each report deals with the capabilities and limitations of one model of instrument and no direct comparison with other instruments intended for similar purposes is made, since the significance of particular performance characteristics largely depends on the radiations and environmental conditions in which the instrument is to be used. The results quoted here have all been obtained from tests on instruments in routine production, with the appropriate measurements being made by the NRPB. This report deals with the ESI Nuclear Model 271 C; a general purpose contamination monitor, comprising a GM tube connected by a coiled extensible cable to a ratemeter

  13. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    Directory of Open Access Journals (Sweden)

    Yan-Ling Liang


    Full Text Available From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36.36% of all the 22 strains. Three isolates among the 22 strains showed higher carboxymethyl cellulase (CMCase activity, and isolate ME27-1 exhibited the highest CMCase activity in liquid culture. The strain ME27-1 was identified as Paenibacillus terrae on the basis of 16S rRNA gene sequence analysis as well as physiological and biochemical properties. The optimum pH and temperature for CMCase activity produced by the strain ME27-1 were 5.5 and 50°C, respectively, and the enzyme was stable at a wide pH range of 5.0–9.5. A 12-fold improvement in the CMCase activity (2.08 U/mL of ME27-1 was obtained under optimal conditions for CMCase production. Thus, this study provided further information about the diversity of cellulose-degrading bacteria in the subtropical region of China and found P. terrae ME27-1 to be highly cellulolytic.

  14. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Timofeev, V. I., E-mail:, E-mail:, E-mail: [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Abramchik, Yu. A. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Zhukhlistova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Muravieva, T. I.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)


    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

  15. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail:


    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4{sup K271R} mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4{sup K210R} mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4{sup K271R} was defective in the nuclear localization of itself and LIG4, whereas XRCC4{sup K210R} was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4{sup K271R}, but not M10-XRCC4{sup K210R}, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4{sup WT}. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4{sup K271R} than in M10-XRCC4{sup WT}, whereas it was only marginally increased in M10-XRCC4{sup K210R} as compared to M10-XRCC4{sup WT}. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4{sup K271R} is defective in the nuclear localization of itself and LIG4. • XRCC4{sup K210R} is competent for the nuclear localization of itself and LIG4. • XRCC4{sup K271R} is deficient in DSB repair function. • XRCC4{sup K210R} is mostly normal in DSB repair function.

  16. Generation of an isogenic, gene-corrected control cell line of the spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele Gabriele; Schmid, Benjamin; Tubsuwan, Alisa


    (iPSC) lines of SCA2 patients in order to study a disease-specific phenotype. Here, we demonstrate the gene correction of the iPSC line H271 clone 1 where we have exchanged the expanded CAG repeat of the ATXN2 gene with the normal length found in healthy alleles. This gene corrected cell line...

  17. Percutaneous transluminal forceps biopsy in patients suspected of having malignant biliary obstruction: factors influencing the outcomes of 271 patients

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jung Gu; Jung, Gyoo-Sik; Yun, Jong Hyouk [Kosin University College of Medicine, Department of Radiology, Seo-gu, Busan (Korea, Republic of); Yun, Byung Chul; Lee, Sang Uk; Han, Byung Hoon [Kosin University College of Medicine, Department of Internal Medicine, Busan (Korea, Republic of); Ko, Ji Ho [Busan Medical Center, Department of Radiology, Busan (Korea, Republic of)


    To evaluate predictive factors for false-negative diagnosis of percutaneous forceps biopsies in patients suspected of having a malignant biliary obstruction Two hundred seventy one consecutive patients with obstructive jaundice underwent percutaneous forceps biopsy. In each patient, three to five specimens (mean, 3.5 specimens) were collected from the lesion. The final diagnosis for each patient was confirmed with pathologic findings at surgery, additional histocytologic data, or clinical and radiologic follow-up. Univariate and multivariate logistic regression analysis was used to identify risk factors associated with false-negative diagnosis. One hundred ninety four of 271 biopsies resulted in correct diagnoses of malignancy, while 20 biopsy diagnoses were proved to be true-negative. There were 57 false-negative diagnoses and no false-positive diagnoses. The diagnostic performance of transluminal forceps biopsy in malignant biliary obstructions was as follows: sensitivity, 77.2%; specificity, 100%; and accuracy, 78.9%; positive predictive value, 100%, negative predictive value; 25.9%. Periampullary segment of common bile duct, intrahepatic bile duct and metastatic disease were the significant risk factors of false-negative diagnosis. Percutaneous forceps biopsy provides relatively high accuracy in the diagnosis of malignant biliary obstructions. The predictive factors of false-negative biopsy were determined to be biopsy site and origin of primary tumour. (orig.)

  18. Studies on some agronomic and quality characteristics of 271 induced early mutants of rice (Oryza sativa L. cv. Nizersail)

    International Nuclear Information System (INIS)

    Rahman, Mostafizur; Miah, A.J.; Mansur, M.A.; Kaul, A.K.


    Nizersail, the most popular, recommended rice variety in Bangladesh, was subjected to gamma-irradiation (10 - 25 kR) or ethyl methane sulfonate (EMS) (0.75 - 1.50%) treatments to obtain the mutants with stiff straw and early maturity. In the M 2 generation, 29 gamma-ray- and 8 EMS-induced mutants were selected mainly for short culm length and earliness. Further selections were made in the segregating M 3 and M 4 populations, and finally 400 plants with short culm length were obtained. These 400 selections were grown in M 5 lines, and 271 of these lines were analyzed for several characters. Heading time had singificantly shifted towards earliness in 40 lines. Yield per plant, 1,000-kernel weight, the length/breadth ratio of kernels, alkali spreading index value (indicator of amylose content) and dye-binding capacity (indicator of protein content) were significantly higher than those in the mother variety in 10 - 30% of the lines examined. However, no positive correlation among these characters was observed. Significant negative correlations were observed between heading time and 1,000-kernel weight, and between yield per plant and dye-binding capacity. These results suggest that the early heading plants may produce fewer tillers with bolder seeds, and that high yielding types may not simultaneously show high protein content. (Kaihara, S.)

  19. Early maladaptive schema factors, chronic pain and depressiveness: a study with 271 chronic pain patients and 331 control participants. (United States)

    Saariaho, Tom; Saariaho, Anita; Karila, Irma; Joukamaa, Matti


    Chronic pain and depression are coexisting entities with high simultaneous prevalence. Both are linked with early adversities. Early maladaptive schemas (EMS) can be seen as a reflection of these adversities. EMSs extensively indicate underlying psychic patterns and provide a good opportunity to detect covert processes and psychic shapes (latent factors), which create the basis of how people rate their schemas. The purpose of this study was to explore these latent, higher order schema factors (SF) and to find out how they are associated with pain intensity or depression in chronic pain patients and a control sample. The study subjects consisted of 271 first-visit pain patients and 331 control participants. Sociodemographic and pain data were gathered by questionnaire; 18 EMSs were measured with the Young Schema Questionnaire (short form) and depressiveness was measured with the Beck Depression Inventory, Version II. Exploratory factor and regression analyses were used. The chronic pain patient group showed two SFs. The first SF showed a shameful, defective, socially isolated, failure, emotionally inhibited, deprived, submissive and resigned pattern. The second SF showed a demanding, approval seeking, self-sacrificing and punitive pattern. SF1 predicted more than half of the depressiveness in the pain patient sample. A three-factor structure was found in the control sample, and SFs 1 and 3 together predicted almost one-third of depressiveness. The pain patient and the control groups had a different, higher order factor structure. We assume that SF1 in the pain patients reflected a rather serious, undefined early psychic trauma and was also associated with their depressiveness. Copyright © 2011 John Wiley & Sons, Ltd.

  20. The stem cell signature of CHH/CHG methylation is not present in 271 cancer associated 5'UTR gene regions. (United States)

    Pulverer, Walter; Wielscher, Matthias; Panzer-Grümayer, Renate; Plessl, Tanja; Kriegner, Albert; Vierlinger, Klemens; Weinhäusel, Andreas


    Non-CpG methylation is frequently present in stem cell DNA. We investigated the value of this epigenetic modification in cancerous DNA in order to establish the implications of CHH/CHG methylation for biomarker development. Therefore we used the restriction enzymes BstNI and PspGI within a combined multiplex PCR and targeted microarray approach for the elucidation of non-CpG (CCWGG) methylation. Targeting 544 CCWGG sites in 271 5' gene regions, the CHH/CHG methylation status of the MCF7 breast cancer cell line and blood from healthy volunteers and childhood ALL was analyzed. Statistical analysis of microarray data and subsequent SYBR green based qPCR on DNA digests was applied to confirm the results from the microarray screen. The microarray experiments identified for the MCF7 cell line the genes MSH2 (p CHH/CHG methylation, and in childhood ALL the genes HIST1H2AG (p = 0.003), PGF (p = 0.02), CPEB4 (p = 0.039) and TJP2 (p = 0.04). Validation using qPCR upon restriction digestion did not confirm the presence of CHH/CHG methylation in MCF7 DNA. In ALL samples only TJP2 was found harboring CHH/CHG methylation (p = 0.02). However, applying Bonferroni-correction for multiple testing that qPCR-result was not rated as statistically significant anymore. We concluded that non-CpG methylation in 544 CCWGG sites analyzed did not change in tumor cells. Thus any change of the CHH/CHG methylation pattern is a minor event in tumorigenesis, even if the stem cell markers OCT4, NANOG, STELLAR and GDF3 are expressed like in the MCF7 breast cancer cell line. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  1. Multiple Autologous Bone Marrow-Derived CD271+Mesenchymal Stem Cell Transplantation Overcomes Drug-Resistant Epilepsy in Children. (United States)

    Milczarek, Olga; Jarocha, Danuta; Starowicz-Filip, Anna; Kwiatkowski, Stanislaw; Badyra, Bogna; Majka, Marcin


    There is a need among patients suffering from drug-resistant epilepsy (DRE) for more efficient and less toxic treatments. The objective of the present study was to assess the safety, feasibility, and potential efficacy of autologous bone marrow cell transplantation in pediatric patients with DRE. Two females and two males (11 months to 6 years) were enrolled and underwent a combined therapy consisting of autologous bone marrow nucleated cells (BMNCs) transplantation (intrathecal: 0.5 × 10 9 ; intravenous: 0.38 × 10 9 -1.72 × 10 9 ) followed by four rounds of intrathecal bone marrow mesenchymal stem cells (BMMSCs) transplantation (18.5 × 10 6 -40 × 10 6 ) every 3 months. The BMMSCs used were a unique population derived from CD271-positive cells. The neurological evaluation included magnetic resonance imaging, electroencephalography (EEG), and cognitive development assessment. The characteristics of BMMSCs were evaluated. Four intravenous and 20 intrathecal transplantations into the cerebrospinal fluid were performed. There were no adverse events, and the therapy was safe and feasible over 2 years of follow-up. The therapy resulted in neurological and cognitive improvement in all patients, including a reduction in the number of epileptic seizures (from 10 per day to 1 per week) and an absence of status epilepticus episodes (from 4 per week to 0 per week). The number of discharges on the EEG evaluation was decreased, and cognitive improvement was noted with respect to reactions to light and sound, emotions, and motor function. An analysis of the BMMSCs' characteristics revealed the expression of neurotrophic, proangiogenic, and tissue remodeling factors, and the immunomodulatory potential. Our results demonstrate the safety and feasibility of BMNCs and BMMSCs transplantations and the considerable neurological and cognitive improvement in children with DRE. Stem Cells Translational Medicine 2018;7:20-33. © 2017 The Authors Stem Cells Translational Medicine

  2. The -271 G>A polymorphism of kinase insert domain-containing receptor gene regulates its transcription level in patients with non-small cell lung cancer

    International Nuclear Information System (INIS)

    An, She-Juan; Chen, Zhi-Hong; Lin, Qiu-Xiong; Su, Jian; Chen, Hua-Jun; Lin, Jia-Ying; Wu, Yi-Long


    Kinase insert domain-containing receptor (KDR) plays a critical role in the metastasis of cancer and is used as a molecular target in cancer therapy. We investigated the characteristics of the -271 G>A polymorphism of the KDR gene to gain information that may benefit the development of individualized therapies for patients with non-small cell lung cancer (NSCLC). The -271 G>A polymorphism of the KDR gene in 106 lung cancer patients and 203 healthy control individuals was analyzed by polymerase chain reaction (PCR) and DNA sequencing methods. Real-time quantitative PCR and immunohistochemical methods were used to evaluate KDR mRNA and protein expression levels, respectively, in frozen tumor specimens. The -271 G>A polymorphism was associated with the mRNA expression level of the KDR gene in tumor tissues (t = 2.178, P = 0.032, independent samples t-test). Compared with the AG/GG genotype, the AA genotype was associated with higher KDR mRNA expression in tumor tissues. We found no relationship between the genotype and the KDR protein expression level and no significant difference in the distribution of the KDR gene polymorphism genotypes between lung cancer patients and the control group (χ 2 = 1.269, P = 0.264, Fisher's exact test). This study is the first to show that the -271 G>A polymorphism of the KDR gene may be a functional polymorphism related to the regulation of gene transcription. These findings may have important implications for therapies targeting KDR in patients with NSCLC

  3. The Improving Effect of HL271, a Chemical Derivative of Metformin, a Popular Drug for Type II Diabetes Mellitus, on Aging-induced Cognitive Decline. (United States)

    Bang, Eunyoung; Lee, Boyoung; Park, Joon-Oh; Jang, Yooncheol; Kim, Aekyong; Kim, Sungwuk; Shin, Hee-Sup


    In recent years, as the aging population grows, aging-induced cognitive impairments including dementia and Alzheimer's disease (AD) have become the biggest challenges for global public health and social care. Therefore, the development of potential therapeutic drugs for aging-associated cognitive impairment is essential. Metabolic dysregulation has been considered to be a key factor that affects aging and dementia. Adenosine monophosphate (AMP)-activated protein kinase (AMPK) is a primary sensor of cellular energy states and regulates cellular energy metabolism. Metformin (1,1-dimethylbiguanide hydrochloride) is a well-known AMPK activator and has been widely prescribed for type 2 diabetes mellitus (T2DM). Since the incidence of T2DM and dementia increases with aging, metformin has been considered to be one of the most promising drugs to target dementia and its related disorders. To that end, here, we tested the efficacy of metformin and HL271, a novel metformin derivative, in aging-induced cognitive decline. Water (control), metformin (100 mg/kg) or HL271 (50 mg/kg) were orally administered to aged mice for two months; then, the mice were subjected to behavioral tests to measure their cognitive function, particularly their contextual, spatial and working memory. AMPK phosphorylation was also measured in the drug-treated mouse brains. Our results show that oral treatment with HL271 (50 mg/kg) but not metformin (100 mg/kg) improved cognitive decline in aged mice. AMPK activation was correlated with behavior recovery after aging-induced cognitive decline. Taken together, these results suggest that the newly synthesized AMPK activator, HL271, could be a potential therapeutic agent to treat age-related cognitive decline.

  4. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

    Directory of Open Access Journals (Sweden)

    C H J Albers-Wolthers

    Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

  5. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    International Nuclear Information System (INIS)


    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  6. Corrective Action Investigation Plan for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada (Rev. 0, April 2001)

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office


    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 271 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 271 consists of 15 Corrective Action Sites (CASs) including: thirteen Septic Systems (25-04-01, 25-04-03, 25-04-04, 25-04-08, 25-04-09, 25-04-10, 25-04-11, 26-04-01, 26-04-02, 26-05-03, 26-05-04, 26-05-05, and 27-05-02), one Contaminated Water Reservoir (26-03-01), and one Radioactive Leachfield (26-05-01). The CASs addressed by CAU 271 are located at Guard Station 500, the Reactor Control Point (RCP), Bare Reactor Experiment - Nevada Tower, and Engine Test State-1 (ETS-1) facilities in Area 25; the Port Gaston and Project Pluto facilities in Area 26; and the Baker Site in Area 27 of the Nevada Test Site. Between 1 958 and 1973, the RCP and ETS-1 facilities supported the development and testing of nuclear reactors for space propulsion as part of the Nuclear Rocket Development Station. The Project Pluto facilities supported nuclear reactor testing for use as a ramjet propulsion system between 1961 and 1964, followed by similar use for other projects through the early 1980s. The Baker Site facilities were constructed in the 1960s to serve as the staging point where the manufactured components of nuclear devices were assembled, disassembled, and modified. The scope of the investigation strategy at these sites will involve biased and random soil sampling in leachfields using excavation (with drilling as a contingency), collection of soil samples underlying the base of proximal and distal ends of septic tanks and distal ends of distribution structures, defining the lateral and vertical extent of contamination through discrete field and possible stepout location sampling, collection system line

  7. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    Energy Technology Data Exchange (ETDEWEB)



    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  8. Performance Characterization of Loctite (Registered Trademark) 242 and 271 Liquid Locking Compounds (LLCs) as a Secondary Locking Feature for International Space Station (ISS) Fasteners (United States)

    Dube, Michael J.; Gamwell, Wayne R.


    Several International Space Station (ISS) hardware components use Loctite (and other polymer based liquid locking compounds (LLCs)) as a means of meeting the secondary (redundant) locking feature requirement for fasteners. The primary locking method is the fastener preload, with the application of the Loctite compound which when cured is intended to resist preload reduction. The reliability of these compounds has been questioned due to a number of failures during ground testing. The ISS Program Manager requested the NASA Engineering and Safety Center (NESC) to characterize and quantify sensitivities of Loctite being used as a secondary locking feature. The findings and recommendations provided in this investigation apply to the anaerobic LLCs Loctite 242 and 271. No other anaerobic LLCs were evaluated for this investigation. This document contains the findings and recommendations of the NESC investigation

  9. Identification of urban agglomerations according to Directive 91/271/EC on urban wastewaters treatment: methodological proposal and application to the territory of Veneto Region

    International Nuclear Information System (INIS)

    Carcereri, M.; Parati, P.; Ostoich, M.; Penzo, A.


    The study discusses the problem of the identification and definition of the agglomerations for the Veneto regional territory according to Directive 91/271/EC to guarantee an adequate level of treatment for urban wastewaters and the achievement of the quality objectives for water bodies. The followed methodology, taking account of the existing planning in the water service sector, has been based on available data from ISTAT (National Statistical Institute) relative to the census sections, on the Regional Water Restoration Plan (PRRA), plan to be substituted with the Water Protection Plan, on the predictions of Water Service Plans prepared by each Water Authority (AATO and on the detailed indications of the same AATO. Moreover some considerations on the obtained results are presented and discussed. [it

  10. Closure Report for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada with Errata Sheet, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Mark Krauss


    The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.

  11. Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] in a Pregnant Thai Woman. (United States)

    Panyasai, Sitthichai; Thongsuk, Pollawat; Pornprasert, Sakorn


    Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] is a very rare β-globin chain variant. We report for the first time this hemoglobinopathy in a pregnant 20-year-old Thai woman. She was seen by an obstetrician at her 14th week of gestation. She was pale and had an inflammatory lesion of her lower left leg. The hemoglobin (Hb) analysis by high performance liquid chromatography (HPLC) and low pressure liquid chromatography (LPLC) showed a peak of abnormal Hb at the C window. On capillary electrophoresis (CE), the abnormal Hb peak was observed at electrophoretic zone 4 that corresponded to the Hb E (HBB: c.79G>A) peak. Direct DNA sequencing revealed a GAG>AAG mutation at codon 90 of the β-globin gene. Thus, even though Hb Agenogi is very rare, it can be found in Thai people. The knowledge and understanding of this hemoglobinopathy will be used to assist in diagnosis, management and counseling for patients.

  12. Long-term posttraumatic stress symptoms among 3,271 civilian survivors of the September 11, 2001, terrorist attacks on the World Trade Center. (United States)

    DiGrande, Laura; Neria, Yuval; Brackbill, Robert M; Pulliam, Paul; Galea, Sandro


    Although the September 11, 2001, terrorist attacks were the largest human-made disaster in US history, there is little extant research documenting the attacks' consequences among those most directly affected, that is, persons who were in the World Trade Center towers. Data from a cross-sectional survey conducted 2-3 years after the attacks ascertained the prevalence of long-term, disaster-related posttraumatic stress symptoms and probable posttraumatic stress disorder (PTSD) in 3,271 civilians who evacuated World Trade Center towers 1 and 2. Overall, 95.6% of survivors reported at least 1 current posttraumatic stress symptom. The authors estimated the probable rate of PTSD at 15.0% by using the PTSD Checklist. Women and minorities were at an increased risk of PTSD. A strong inverse relation with annual income was observed. Five characteristics of direct exposure to the terrorist attacks independently predicted PTSD: being on a high floor in the towers, initiating evacuation late, being caught in the dust cloud that resulted from the tower collapses, personally witnessing horror, and sustaining an injury. Working for an employer that sustained fatalities also increased risk. Each addition of an experience of direct exposure resulted in a 2-fold increase in the risk of PTSD (odds ratio = 2.09, 95% confidence interval: 1.84, 2.36). Identification of these risk factors may be useful when screening survivors of large-scale terrorist events for long-term psychological sequelae.

  13. G:\\Potentiel 27(1)\\PMKER 27(1)\\

    African Journals Online (AJOL)


    de pollution notables (Doelsch et al., 2011). En effet, les PRO tels que les boues de station d'épuration (Baize et al., 2006) et les fientes de volailles (Omeira et al., 2006 ; Sistani et al.,. 2003) par exemple, peuvent contenir des teneurs élevées en éléments traces métalliques (ETM) qui sont des polluants inorganiques ...

  14. G:\\Potentiel 27(1)\\PMKER 27(1)\\

    African Journals Online (AJOL)


    aussi par sa vulnérabilité.dont plusieurs contraintes ont été identifiées dans les systèmes agricoles de la zone des Niayes dues à une surexploitation des terres et une dégradation progressive des sols causée par un appauvrissement et un épuisement des sols, une salinisation et une pollution des nappes phréatiques ...

  15. G:\\Potentiel 27(1)\\PMKER 27(1)\\

    African Journals Online (AJOL)


    alimentaires ont changé. Si la banane plantain et le manioc .... bien développée entraînant un bon drainage interne. Sur deux horizons (0 - 20 et. 20 - 40 cm), le taux d'argile passe de 10 % en surface à 25 % en profondeur. Le taux de sable ... fumure de couverture est assurée par l'apport d'urée à la dose de 100 kg/ha en ...

  16. Evidence for an induced conformational change in the catalytic mechanism of homoisocitrate dehydrogenase for Saccharomyces cerevisiae: Characterization of the D271N mutant enzyme. (United States)

    Hsu, Chaonan; West, Ann H; Cook, Paul F


    Homoisocitrate dehydrogenase (HIcDH) catalyzes the NAD(+)-dependent oxidative decarboxylation of HIc to α-ketoadipate, the fourth step in the α-aminoadipate pathway responsible for the de novo synthesis of l-lysine in fungi. A mechanism has been proposed for the enzyme that makes use of a Lys-Tyr pair as acid-base catalysts, with Lys acting as a base to accept a proton from the α-hydroxyl of homoisocitrate, and Tyr acting as an acid to protonate the C3 of the enol of α-ketoadipate in the enolization reaction. Three conserved aspartate residues, D243, D267 and D271, coordinate Mg(2+), which is also coordinated to the α-carboxylate and α-hydroxyl of homoisocitrate. On the basis of kinetic isotope effects, it was proposed that a conformational change to close the active site and organize the active site for catalysis contributed to rate limitation of the overall reaction of the Saccharomyces cerevisiae HIcDH (Lin, Y., Volkman, J., Nicholas, K. M., Yamamoto, T., Eguchi, T., Nimmo, S. L., West, A. H., and Cook, P. F. (2008) Biochemistry47, 4169-4180.). In order to test this hypothesis, site-directed mutagenesis was used to change D271, a metal ion ligand and binding determinant for MgHIc, to N. The mutant enzyme was characterized using initial rate studies. A decrease of 520-fold was observed in V and V/KMgHIc, suggesting the same step(s) limit the reaction at limiting and saturating MgHIc concentrations. Solvent kinetic deuterium isotope effects (SKIE) and viscosity effects are consistent with a rate-limiting pre-catalytic conformational change at saturating reactant concentrations. In addition, at limiting MgHIc, an inverse (SKIE) of 0.7 coupled to a significant normal effect of viscosogen (2.1) indicates equilibrium binding of MgHIc prior to the rate-limiting conformational change. The maximum rate exhibits a small partial change at high pH suggesting a pH-dependent conformational change, while V/KMgHIc exhibits the same partial change observed in V, and a

  17. The effects of kisspeptin agonist canine KP-10 and kisspeptin antagonist p271 on plasma LH concentrations during different stages of the estrous cycle and anestrus in the bitch. (United States)

    Albers-Wolthers, C H J; de Gier, J; Rutten, V P M G; van Kooten, P J S; Leegwater, P A J; Schaefers-Okkens, A C; Kooistra, H S


    Kisspeptin (KP) plays a key role in the regulation of the hypothalamic-pituitary-gonadal axis via the release of GnRH. As normal KP signaling is essential for reproductive function, it could be an interesting new target for therapeutic interventions, e.g., nonsurgical contraception in dogs. The aims of the present study were to investigate the effect of KP-10 administration on plasma LH concentration in different stages of the reproductive cycle and to investigate the suitability of p271 as KP antagonist in the bitch. Two groups of six adult Beagle bitches were used. In one group, plasma LH concentration was determined before (40 and 0 minutes) and 10, 20, 40, and 60 minutes after the intravenous administration of 0.5-μg/kg body weight (BW) canine KP-10. In the other group, the bitches received a continuous intravenous infusion with p271 (50 μg/kg BW/h) for 3 hours, and 0.5-μg/kg BW canine KP-10 was administered intravenously 2 hours after the start of the p271 infusion. Their plasma LH concentration was determined before (-40 and 0 minutes) and 30, 60, 90, 120, 130, 140, 160, and 180 minutes after the start of the p271 infusion. In both groups, the experiments were performed during the follicular phase, the first and second half of the luteal phase, and during anestrus. Canine KP-10 induced an increase of plasma LH concentration during all estrous cycle stages and anestrus. There was no difference in LH response between the two groups. The lowest LH response was seen during the follicular phase and the highest response during anestrus. The area under the curve (AUC) for LH and LH increment in the follicular phase were lower than those in anestrus. The AUC LH and LH increment in the first half of the luteal phase were lower than those in the second half of the luteal phase and anestrus. The AUC LH and LH increment in the second half of the luteal phase were not different from those in anestrus. Continuous administration of the antagonist p271 did not alter

  18. Wilson disease mutation pattern with genotype-phenotype correlations from Western India: confirmation of p.C271* as a common Indian mutation and identification of 14 novel mutations. (United States)

    Aggarwal, Annu; Chandhok, Gursimran; Todorov, Theodor; Parekh, Saloni; Tilve, Sharada; Zibert, Andree; Bhatt, Mohit; Schmidt, Hartmut H-J


    Wilson disease (WD) is an autosomal recessive disorder resulting from mutations in the ATP7B gene, with over 600 mutations described. Identification of mutations has made genetic diagnosis of WD feasible in many countries. The heterogeneity of ATP7B mutants is, however, yet to be identified in the Indian population. We analyzed the mutational pattern of WD in a large region of Western India. We studied patients (n = 52) for ATP7B gene mutations in a cohort of families with WD and also in first-degree relatives (n = 126). All 21 exon-intron boundaries of the WD gene were amplified and directly sequenced. We identified 36 different disease-causing mutations (31 exonic and five intronic splice site variants). Fourteen novel mutations were identified. Exons 2, 8, 13, 14, and 18 accounted for the majority of mutations (86.4%). A previously recognized mutation, p.C271*, and the novel mutation p.E122fs, were the most common mutations with allelic frequencies of 20.2% and 10.6%, respectively. Frequent homozygous mutations (58.9%) and disease severity assessments allowed analysis of genotype-phenotype correlations. Our study significantly adds to the emerging data from other parts of India suggesting that p.C271* may be the most frequent mutation across India, and may harbor a moderate to severely disabling phenotype with limited variability. © 2013 John Wiley & Sons Ltd/University College London.

  19. Influence of the Texture and Strain on the Behaviour of Ni53.6Mn27.1Ga19.3 and Ni54.2Mn29.4Ga16.4 Shape Memory Alloys

    Directory of Open Access Journals (Sweden)

    Alexandra Rudajevova


    Full Text Available Polycrystalline samples of Ni53.6Mn27.1Ga19.3 and Ni54.2Mn29.4Ga16.4 shape memory alloys were investigated using dilatometry. The longitudinal axes of the samples were perpendicular to the columnar grains. Both alloys showed positive shape memory effects. The martensitic phase transformation occurred without hysteresis in both alloys with transformation temperatures of 174°C for the Ni53.6Mn27.1Ga19.3 alloy and 253°C for the Ni54.2Mn29.4Ga16.4 alloy. The dilatation characteristics for both alloys were determined in three perpendicular directions. The strain associated with the internal stress at the interface between the two martensitic structures and the two grains affected the dilatation characteristics in the y and z directions (perpendicular to the longitudinal axis of the sample. The microstructure was determined for all the directions investigated. To investigate the mechanical history, a round cross-section of the Ni54.2Mn29.4Ga16.4 sample was machined using a milling machine along the longitudinal axis so that both sides of the sample were symmetrical. This sample treatment changed the dilatation characteristics of the martensite and austenite. The study and analysis of the dilatation characteristics of the thermal cycle showed the relaxation of internal stresses and the reorientation of the martensitic variants.

  20. Paternity testing with VNTR DNA systems. II. Evaluation of 271 cases of disputed paternity with the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11

    DEFF Research Database (Denmark)

    Hansen, Hanna Elsebeth; Morling, N


    Paternity testing was carried out in 271 cases of disputed paternity using the 5 VNTR systems D2S44 (YNH24), D5S43 (MS8), D7S21 (MS31), D7S22 (g3), and D12S11 (MS43a), and 10-15 conventional marker systems including the HLA-A,B system. By means of the matching criteria for the VNTR systems...... established elsewhere (Morling & Hansen 1992), all 70 unrelated men who had been excluded by conventional typing were also excluded with 2 or more VNTR systems. Based on the observed exclusion frequencies for the 5 VNTR systems, a theoretical exclusion rate exceeding 0.999 could be obtained. A total of 350...... father/child pairs were studied and in 3 paternity cases and one immigrant family, the alleged fathers were excluded solely by one of the 5 VNTR systems possibly reflecting mutations. No mother/child exclusions were observed among 350 mother/child pairs. Linkage analysis between the syntenic systems D7S...

  1. 7 CFR 271.2 - Definitions. (United States)


    ..., pushcart, or other mobile vehicle. Identification (ID) card means a card which identifies the bearer as... this chapter as determined by visual inspection, marketing structure, business licenses, accessibility...

  2. 12 CFR 271.3 - Published information. (United States)


    ...) Substantive rules of general applicability, and statements of general policy and interpretations of general... preceding year upon all matters of policy relating to open market operations, showing the reasons underlying... from the Publications Services of the Federal Reserve Board, 20th Street and Constitution Avenue, N.W...

  3. 7 CFR 1822.271 - Processing applications. (United States)


    ... Obligation-Fund Analysis 2 2 1 1 1 1 Data input to Finance Office through field office terminals. (f... under Public Law 103-354 can appropriately finance. (iii) There is an immediate and ready market for the... obligation of funds and fund analysis. Form RD 3560-51, “Multiple Family Housing Obligation Fund Analysis...

  4. 7 CFR 1150.271 - Definitions. (United States)


    ... and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Procedure for Certification of... for commercial use; (f) Dairy products means products manufactured for human consumption which are derived from the processing of milk, and includes fluid milk products; and (g) Fluid milk products means...

  5. Publications | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... Income from illegal opium poppy cultivation helps sustain the livelihoods of millions of rural Afghans, but also provides significant revenues to criminals and armed groups fighting ...

  6. Publications | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Investigating the impact of pesticides on potato farmers in Ecuador. Potato farmers in the province of Carchi in northern Ecuador suffer from decreased mental capacity caused by high exposure to chemical insecticides. This is lowering their productivity by impairing their ability to make good farming.

  7. Array CGH characterization of an unbalanced X-autosome translocation associated with Xq27.2-qter deletion, 11q24.3-qter duplication and Xq22.3-q27.1 duplication in a girl with primary amenorrhea and mental retardation. (United States)

    Chen, Chih-Ping; Lin, Shuan-Pei; Chern, Schu-Rern; Kuo, Yu-Ling; Wu, Peih-Shan; Chen, Yu-Ting; Lee, Meng-Shan; Wang, Wayseen


    We present array comparative genomic hybridization (aCGH) characterization of an unbalanced X-autosome translocation with an Xq interstitial segmental duplication in a 16-year-old girl with primary ovarian failure, mental retardation, attention deficit disorder, learning difficulty and facial dysmorphism. aCGH analysis revealed an Xq27.2-q28 deletion, an 11q24.3-q25 duplication, and an inverted duplication of Xq22.3-q27.1. The karyotype was 46,X,der(X)t(X;11)(q27.2;q24.3) dup(X)(q27.1q22.3). We discuss the genotype-phenotype correlation in this case. Our case provides evidence for an association of primary amenorrhea and mental retardation with concomitant unbalanced X-autosome translocation and X chromosome rearrangement. Copyright © 2013 Elsevier B.V. All rights reserved.

  8. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.


    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  9. Dicty_cDB: VHE271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  10. 38 CFR 3.271 - Computation of income. (United States)


    ... period (e.g., an inheritance). Pension computations of income will include nonrecurring income for a full... amount of a person's earnings or wages before any deductions are made for such things as taxes, insurance... goods sold, or expenditures for rent, taxes, and upkeep, or costs of repairs or replacements. The value...

  11. Worldwide Report, Telecommunications Policy, Research and Development, No. 271 (United States)


    and not as educational or cultural instru- ments is the fact that the director of Radio Educacion is now appointed by the Govern- ment Secretariat...Journalists, Froyland Rascon of Radio Educacion , Jose Alvarez Icaza of Cencos [National Mass Media Center]; Leopoldo de Gyves, the mayor of Juchitan

  12. 77 FR 271 - Privacy Act of 1974; System of Records (United States)


    ... submissions available for public viewing on the Internet at as they are received....'' * * * * * Categories of records in the system: Delete entry and replace with ``Name; Social Security Number (SSN); home... date; badge number; vehicle ID and decal number; special intelligence access; expiration date, agency...

  13. 40 CFR 271.1 - Purpose and scope. (United States)


    ... the recycling of hazardous wastes in the coke by-products industry 57 FR 27888 June 22, 1992. Aug. 18... Land Disposal Restrictions Phase III—Decharacterized Wastewaters, Carbamate Wastes, and Spent Aluminum... surface impoundment retrofit exemption application 3005(j)(5) Do. Feb. 7, 1985 Fuel labeling requirements...

  14. 40 CFR 271.16 - Requirements for enforcement authority. (United States)


    ...: To the extent the State judgments or settlements provide penalties in amounts which EPA believes to... adverse effects upon human health and the environment resulting from the unauthorized activity, whether or... settlements of civil enforcement actions, except in cases where a settlement requires some immediate action (e...

  15. 40 CFR 52.271 - Malfunction, startup, and shutdown regulations. (United States)


    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Malfunction, startup, and shutdown..., startup, and shutdown regulations. (a) The following regulations are disapproved because they would permit... malfunctions and/or fail to sufficiently limit startup and shutdown exemptions to those periods where it is...

  16. 47 CFR 25.271 - Control of transmitting stations. (United States)


    ... technical servicing and maintenance of the remote stations. (5) International VSAT system operators are... within the VSAT network immediately upon notification of harmful interference. (d) The licensee shall...

  17. 48 CFR 538.271 - MAS contract awards. (United States)


    ... price/discount relationship between the Government and the identified commercial customer (or category... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false MAS contract awards. 538... CATEGORIES OF CONTRACTING FEDERAL SUPPLY SCHEDULE CONTRACTING Establishing and Administering Federal Supply...

  18. 12 CFR 271.9 - Fee schedules; waiver of fees. (United States)


    ... information in support of a request for a waiver or reduction of fees. (4) Determination by Secretary. The... microfiche, per frame .10 Duplicate microfiche, per microfiche .35 Search and review: Clerical/Technical....00 Computer search and production: Computer operator search, hourly rate 32.00 Tapes (cassette), per...

  19. 1935 15' Quad #271 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  20. Dicty_cDB: VSI271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rs**krpktyl*rfsspp*tpqirchgrikeqtrlys*s*ssrfhgktspnfsl qkwscqinpsrscfnqr*thpcw*tisqrsifprpc*ipkalrfsfnlpiswwssrsscp *ngqeqlik...cfnqr*thpcw*tisqrsifprpc*ipkalrfsfnlpiswwssr sscp*ngqeqlikr*rrkln**k*plyr Frame B: rllenssflmkktqnvslkvqlssv...rtprs**krpktyl*rfsspp*tpqirchgrikeqtrlys*s*ssrfhgktspnfsl qkwscqinpsrscfnqr*thpcw*tisqrsifprpc*ipkalrfsfnlpiswwssrsscp *ngqeqlik

  1. Dicty_cDB: SHL271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kds...*stfkeflyhrtclglkl hrsydq**r*tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kd

  2. All projects related to | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    How can science, technology, and innovation contribute to poverty reduction and inclusive development, especially in Brazil, Russia, India, China, and South Africa, otherwise known as the BRICS countries? Start Date: March 16, 2012. End Date: September 16, 2013. Topic: SCIENCE AND TECHNOLOGY POLICY, ...

  3. 25 CFR 700.271 - Requests for notification of existence of records: Submission. (United States)


    ... contact the system manager for assistance in determining which official is most likely to be in possession... whether a system of records contains records pertaining to him shall address his inquiry to the system manager having responsibility for the system unless the system notice describing the system prescribes or...

  4. 271 A New Approach in the Social Field – Law No. 62/2011

    Directory of Open Access Journals (Sweden)

    Radu Răzvan Popescu


    Full Text Available Law no. 62/2011 of social dialogue, as it was regulated by the lawmaker, comes and reuniteswithin it a series of fundamental institutions in social matters, such as: social dialogue (trade unions,employees’ representatives, owners’ associations, the Economic and Social Council, the collectiveemployment contract, labour conflicts and, not lastly, a series of elements pertaining to labour jurisdiction. Itthus abrogates the old regulations in the matter: Law no. 54/2003 with respect to trade unions, Law no.356/2001 regarding owners’ associations, Law no. 109/1997 regarding the organizing and functioning of theEconomic and Social Council, Law no. 130/1996 with respect to the collective employment contracts, Lawno. 168/1999 regarding the settling of labour conflicts and Government Decision (G.D. no. 369/2009regarding the establishment and functioning of the social dialogue commissions at the level of the centralpublic administration and at the territorial level.

  5. 48 CFR 1352.271-85 - Documentation of requests for equitable adjustment. (United States)


    ... DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and... individual item or element of the request: (1) A description of the unperformed work required by the contract... adjustment to the contract price for a change or an act or omission on the part of the Government, the...

  6. 48 CFR 1352.271-74 - Foreseeable cost factors pertaining to different shipyard locations. (United States)


    ... System DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... Different Shipyard Locations (APR 2010) (a) The Contracting Officer will evaluate certain foreseeable costs... elements of foreseeable costs consist of the following: (1) Vessel Transit: (i) Vessel delivery costs will...

  7. BKR 27(1) pp. 44-49 (Achuba et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... haemoglobin (Hb) content, red blood cell (RBC) count, packed cell volume (PCV) and platelet count but a significant increase in ... plasma membrane by hydrocarbons result in various altered membrane properties and ... Honey has been proven to be rich in both enzymatic and non- enzymatic antioxidants ...

  8. BKR 27(1) pp. 39-43 (Ibrahim et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    promoting characteristics, ... phytochemical constituents of plants has led to the synthesis and improvement in the availability of scarce ... as chalcones, flavones, flavonols, flavonones, anthocyanins and isoflavonoids. Together with ...

  9. BKR 27(1) pp. 33-38 (Egwim et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... decomposing bioreactors of wood on earth (Brune, 1998;. João et.,al, 2011). They are well known for their contribution to efficient degradation of lignin. However ... A reddish hollow zone in the plates indicated a lignin peroxidase producer as described by. (Savitha et al., 2011). All the isolated organisms ...

  10. 271 Dislodging the “University of Nkwo Nnewi” through Open and ...

    African Journals Online (AJOL)

    First Lady


    Jan 28, 2013 ... proudly that he is now at UNN (University of Nigeria, Nsukka) and the uniformed listener believes him not ... technology has rendered moderate education inadequate for the business transactions. .... of teaching in which learners are removed in time and space from the teacher. It uses a variety of media ...

  11. : tous les projets | Page 271 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2011. End Date: 1 mars 2016. Région: North and Central America, South America, Brazil, Chile, Colombia, Canada. Financement total : CA$ 2,500,000.00. Changements climatiques et santé des autochtones. Projet. Les populations autochtones figurent parmi celles qui sont les plus touchées par les ...

  12. Dickson et al., Afr J Tradit Complement Altern Med. (2012) 9(2):271 ...

    African Journals Online (AJOL)


    Euadenia eminens Hook f. (Capparaceae) has traditional uses in the management of conjunctivitis, iritis, ophthalmia, tuberculosis, otalgia and rectal prolapse. The fruit pulp is also eaten as an aphrodisiac. In this paper, we report on the anti- inflammatory, antioxidant and antibacterial effects of its roots. A 70 % ethanol ...

  13. Mechanical properties of weldings by electron beams on alloy 8090 (CP 271)

    International Nuclear Information System (INIS)

    Le Poac, P.; Nomine, A.M.; Miannay, D.


    Weldings by electron beams got on rings in alloy 8090 in the T4 and T6 state are mechanically tested in traction in the original state of welding or after a thermal processing of 12 hours at 210 0 C [fr

  14. BKR 27(1) pp. 22-25 (Ufelle et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... 2Department of Medical Biochemistry, College of Medicine, Enugu State University of Science and Technology (ESUT),. Enugu, Nigeria. ... Despite the availability of orthodox medical treatments, significant parts of the ... and crude protein that contains the nutritionally essential amino acids (Onwuliri et.

  15. Sud du Sahara | Page 271 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

  16. People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September

  17. IAEA Newsbriefs. V. 11, no. 2(71). Apr-May 1996

    International Nuclear Information System (INIS)


    This issue gives brief information on the following topics: Chernobyl Conference sums up Scientific Understanding, International Forum on the Safety of RBMK Reactors, IAEA Board of Governors, Radiological Study of the Mururoa and Fangataufa Atolls, Safeguards Support, Workshop on Modelling Methods for Water Systems, Uranium Market Trends, Security Council Resolution on Iraq, South East Asian NWFZ, Radioactive Waste Management, Nuclear Seminar in Poland, and other short information

  18. Dominance of multidrug resistant CC271 clones in macrolide-resistant streptococcus pneumoniae in Arizona

    Directory of Open Access Journals (Sweden)

    Bowers Jolene R


    Full Text Available Abstract Background Rates of resistance to macrolide antibiotics in Streptococcus pneumoniae are rising around the world due to the spread of mobile genetic elements harboring mef(E and erm(B genes and post-vaccine clonal expansion of strains that carry them. Results Characterization of 592 clinical isolates collected in Arizona over a 10 year period shows 23.6% are macrolide resistant. The largest portion of the macrolide-resistant population, 52%, is dual mef(E/erm(B-positive. All dual-positive isolates are multidrug-resistant clonal lineages of Taiwan19F-14, mostly multilocus sequence type 320, carrying the recently described transposon Tn2010. The remainder of the macrolide resistant S. pneumoniae collection includes 31% mef(E-positive, and 9% erm(B-positive strains. Conclusions The dual-positive, multidrug-resistant S. pneumoniae clones have likely expanded by switching to non-vaccine serotypes after the heptavalent pneumococcal conjugate vaccine release, and their success limits therapy options. This upsurge could have a considerable clinical impact in Arizona.

  19. Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

    CERN Document Server

    Burgess, P H


    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the a...

  20. Pediatric Infectious Endophthalmitis: A 271-case Retrospective Study at a Single Center in China

    Directory of Open Access Journals (Sweden)

    Meng Zhang


    Conclusions: Penetrating ocular trauma is the most frequent cause of pediatric endophthalmitis in China. Streptococcus and Staphylococcus species are the most commonly identified organisms in exogenous pediatric endophthalmitis whereas Fusarium species are commonly seen in endogenous endophthalmitis. In this research, in spite of aggressive management with antibiotics and vitrectomy, the visual prognosis was found to be generally poor.

  1. S. A{r. Tldskr. Veek. 4, 271-274 (1974) NWTSTE ONTWIKKELINGE ...

    African Journals Online (AJOL)

    mineraalvenorging van herkorrcrs in Suid-Afrils in pen- pekf,ief te stel. Mincraalmetabolbrre cn mineraalversorgiag .... aanrullings in die vorm van 'n boenrneel*out lek. Daar was egter pen rcrgelykbare proteienaanwllings nie en geen ... Reed, Elliott & Topps (1965) het bv. gevinddat by voorkraalbeeste op hoe kragvoerdieet ...

  2. BKR 27(1) pp. xx-xx (Dick et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... This article is available online in PDF format at INTRODUCTION. Bacterial resistance to ... pathogenic organisms (Davies, 1996; Armstrong et al., 1995). Antimicrobials themselves act as a ..... Dairy Science 1: 70-83. Vyvyan, S., R. W. Hedges and N. Datta (1972). Two Modes of.

  3. BKR 27(1) pp. 8-13 (Falodun et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... 15:15:15 inorganic fertilizer at 0, 40, 80 and 120 kg/ha NPK laid out as a randomized complete block ... of 25 cm x 25 cm and 20 cm x 20 cm were statistically similar and enhanced the growth and yield of onion in .... Table 1: Weather conditions at NIFOR station, Benin from October 2010 to March 2012.

  4. Generation of spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele Gabriele; Tubsuwan, Alisa; Schmid, Benjamin


    Spinocerebellar ataxia type 2 (SCA2) is a neurodegenerative disease primarily affecting the cerebellum. Very little is known about the molecular mechanisms underlying the disease and, to date, no cure or treatment is available. Here, we demonstrate the generation of an induced pluripotent stem ce...

  5. 48 CFR 1352.271-70 - Inspection and manner of doing work. (United States)


    ... receipt of proposals. If the contractor, as a result of inspection or otherwise, discovers any error in... of the error and proceed in accord with instructions received from the Contracting Officer. The... railway, the contractor shall be responsible for the closing, before the end of working hours, of all...

  6. BKR 27(1) pp. 39-43 (Ibrahim et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Mar 31, 2015 ... active components in order to develop it further for safe medicinal use. KEYWORDS: Phytochemical ... as chalcones, flavones, flavonols, flavonones, anthocyanins ... ascribed to them. Some of the activities attributed to flavonoids include: anti-allergic, anti-cancer, antioxidant, anti- inflammatory and anti-viral.

  7. 48 CFR 2923.271 - Purchase and use of environmentally sound and energy efficient products and services. (United States)


    ... the Government Through Leadership in Environmental Management Systems, dated April 21, 2000. This... to maximize cost efficient energy management: (a) The GSA Federal Supply Schedule Products Guide...) Executive Order 13123, Greening the Government Through Efficient Energy Management, dated June 8, 1999...

  8. Analysis and Interpretation of Artifact Collections from Site 3CT271, Randolph Estate Development, Crittenden County, Arkansas (United States)


    U.K., Rota, Mariana Islands, Micronesia and Barbados, West Indies. I Publications and Major Manuscripts Weaver, Guy G., and John L. Hopkins 1991 Data...Recovery at La Iglesia de Maraquez (Site P0-39), Ponce, Puerto Rico: Phase I Report. Garrow & Associates, Inc. Report submitted to the Jacksonville...Inc., Atlanta. 1988b "Stone and Coral Tools." In Archaeological Investigations on Rota, Mariana Islands, Micronesia, edited by Brian Butler, pp. 255

  9. Sugar-Sweetened Beverage Consumption among U.S. Youth, 2011-2014. NCHS Data Brief. Number 271 (United States)

    Rosinger, Asher; Herrick, Kirsten; Gahche, Jaime; Park, Sohyun


    Sugar-sweetened beverages contribute calories and added sugars to the diets of U.S. children. Studies have suggested a link between the consumption of sugar-sweetened beverages and dental caries, weight gain, type 2 diabetes, dyslipidemia, and nonalcoholic fatty liver disease in children. The 2015-2020 Dietary Guidelines for Americans recommend…

  10. Crystal structure of La0.4Sr0.6CoO2.71 investigated by TEM and XRD

    International Nuclear Information System (INIS)

    Gspan, C.; Grogger, W.; Bitschnau, B.; Bucher, E.; Sitte, W.; Hofer, F.


    The structure of the oxygen-deficient perovskite La 0.4 Sr 0.6 CoO 3-δ (δ=0.29) was investigated by transmission electron microscopy (TEM) and X-ray powder diffraction (XRD). Domains between 50 and 250 nm in size were observed in the electron microscope. Weak superstructure reflections were found with both X-ray and electron diffraction. Investigations of these superstructure reflections by selected area electron diffraction (SAED) and convergent beam electron diffraction (CBED) showed that the domains in a crystal are orientated in a 90 deg. relationship. High-resolution transmission electron microscopy (HRTEM) images from the domain boundary also revealed a 90 deg. orientation dependency. Using the symmetry of CBED patterns, the point group 4/mmm was determined. By comparing reflections from the SAED pattern with possible reflections, the space group I4/mmm (No. 139) could be isolated and finally the crystal structure was refined by Rietveld refinement. - Graphical abstract: Two adjacent domains show different orientation of the c-axis of the tetragonal unit cell in the according convergent beam electron diffraction patterns

  11. What Is the Evidence Base to Support Reading Interventions for Improving Student Outcomes in Grades 1-3? REL 2017-271 (United States)

    Gersten, Russell; Newman-Gonchar, Rebecca; Haymond, Kelly S.; Dimino, Joseph


    Response to intervention (RTI) is a comprehensive early detection and prevention strategy used to identify and support struggling students before they fall behind. An RTI model usually has three tiers or levels of support. Tier 1 is generally defined as classroom instruction provided to all students, tier 2 is typically a preventive intervention…

  12. Isolation of neural progenitor cells from the human adult subventricular zone based on expression of the cell surface marker CD271

    NARCIS (Netherlands)

    van Strien, Miriam E.; Sluijs, Jacqueline A.; Reynolds, Brent A.; Steindler, Dennis A.; Aronica, Eleonora; Hol, Elly M.


    Neural progenitor cells (NPCs) in the subventricular zone (SVZ) hold promise for future therapy for neurodegenerative disorders, because the stimulation of adult neurogenesis could potentially restore the function of degenerating neurons and glia. To obtain more knowledge on these NPCs, we developed

  13. Isolation of neural progenitor cells from the human adult subventricular zone based on expression of the cell surface marker CD271

    NARCIS (Netherlands)

    van Strien, Miriam E; Sluijs, Jacqueline A; Reynolds, Brent A; Steindler, Dennis A; Aronica, Eleonora; Hol, Elly M

    Neural progenitor cells (NPCs) in the subventricular zone (SVZ) hold promise for future therapy for neurodegenerative disorders, because the stimulation of adult neurogenesis could potentially restore the function of degenerating neurons and glia. To obtain more knowledge on these NPCs, we developed

  14. 2013 Review of Neutron and Non-Neutron Nuclear Data (United States)

    Holden, N. E.


    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  15. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.


    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  16. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos


    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  17. Política Externa em Perspectiva: um balanço sobre a diplomacia dos presidentes Collor, Itamar, Cardoso e Lula 10.5102/uri.v4i1.271

    Directory of Open Access Journals (Sweden)

    Carlos Ribeiro Santana


    Full Text Available A key characteristic of Brazilian diplomacy is its capacity to expand and diversify the country’s international relations. During the last two decades Brazil has had four presidents who led foreign policy according to their individual styles. This article aims to study in both practical and conceptual terms Brazilian foreign policy, its domestic and international constraints, and the country’s bilateral and multilateral relations during the last four presidencies.

  18. Erratum: Correction to Table 3, in: Equivalent threshold sound pressure levels (ETSPL) for Sennheiser HDA 280 supra-aural audiometric earphones in the frequency range 125 Hz to 8000 Hz (International Journal of Audiology (2009) 48 (271-276))

    DEFF Research Database (Denmark)

    Poulsen, Torben


    The main results in Poulsen & Oakley (2009) are given as the equivalent threshold sound pressure level, ETSPL, measured in an acoustic coupler specifi ed in IEC 60318-3. These results are all correct. The ETSPL values for the ear simulator specifi ed in IEC 60318-1 were calculated from acoustic l...

  19. Resenha: NEGRI, A.; COCCO, G. Global: biopoder e luta em uma América Latina globalizada. Rio de Janeiro: Record, 2005. 271 páginas. (tradução: Eliana Aguiar

    Directory of Open Access Journals (Sweden)

    André Souto Rezende


    Full Text Available Uma obra envolvente, de escrita ágil e vertendo para a esquerda política. Com autoria de Antonio Negri e Giuseppe Cocco (2005, o texto nos enriquece de argumentos com pensamento crítico sobre o tardio capitalismo que se instalou na América Latina e como a estruturação nacional pode ser uma resposta ao mundo globalizado. O livro faz uma análise sobre a América Latina ante uma economia atrelada à tese que esta região é insustentável por si só, dentro de um contexto de enfraquecimento crônico do desenvolvimento independente, retratando ainda o colapso do plano neoliberal. A abordagem central é a mudança de compreensão no estudo da mútua dependência e da reformulação do plano político e das teorias na compreensão da atual circunstância latino-americana. A obra está dividida em cinco partes, nas quais são feitas referências desde o período pós-guerra, passando pelo fracasso do projeto neoliberal na década de 1990, até a subida esquerdista nos países latino-americanos.

  20. Corrigendum to "Chemical composition and acidity of size-fractionated inorganic aerosols of 2013-14 winter haze in Shanghai and associated health risk of toxic elements" [Atmos. Environ. (2015) 259-271 (United States)

    Behera, Sailesh N.; Cheng, Jinping; Huang, Xian; Zhu, Qiongyu; Liu, Ping; Balasubramanian, Rajasekhar


    The authors regret that the sources from which the RfC (reference concentration) and the IUR (inhalation unit risk) values were obtained for estimation of RfD (reference dose, presented in Table 2) and SF (slope factor, presented in Table 3) were not clearly indicated in the published article due to an oversight. The revised tables with improved clarity are given below. a The Risk Assessment Information System ( b USEPA Integrated Risk Information System (IRIS) ( c The California EPA, the office of Environmental Health Hazard Assessment (OEHHA) ( d Behera, S.N., Xian, H. and Balasubramanian, R., 2014. Human health risk associated with exposure to toxic elements in mainstream and sidestream cigarette smoke. Science of the Total Environment, 472, pp.947-956.

  1. Current status of laparoscopy for acute abdomen in Italy: a critical appraisal of 2012 clinical guidelines from two consecutive nationwide surveys with analysis of 271,323 cases over 5 years. (United States)

    Agresta, Ferdinando; Campanile, Fabio Cesare; Podda, Mauro; Cillara, Nicola; Pernazza, Graziano; Giaccaglia, Valentina; Ciccoritti, Luigi; Ioia, Giovanna; Mandalà, Stefano; La Barbera, Camillo; Birindelli, Arianna; Sartelli, Massimo; Di Saverio, Salomone


    Several authors have demonstrated the safety and feasibility of laparoscopy in selected cases of abdominal emergencies. The aim of the study was to analyse the current Italian practice on the use of laparoscopy in abdominal emergencies and to evaluate the impact of the 2012 national guidelines on the daily surgical activity. Two surveys (42 closed-ended questions) on the use of laparoscopy in acute abdomen were conducted nationwide with an online questionnaire, respectively, before (2010) and after (2014) the national guidelines publication. Data from two surveys were compared using Chi-square or Fisher's exact test, and data were considered significant when p laparoscopy increased in all the considered clinical scenarios, with statistical significance in acute appendicitis (44 vs. 64.7 %; p = 0.004). The percentage of units approaching Hinchey III acute diverticulitis with laparoscopy in 26-75 % of cases (14.0 vs. 29.7 %; p = 0.009), those with >25 % of surgeons confident with laparoscopic approach to acute diverticulitis (29.9 vs. 54 %; p = 0.0009), the units with >50 % of surgeons confident with laparoscopic approach to acute appendicitis, cholecystitis and perforated duodenal ulcer, all significantly increased in the time frame. The majority of respondents declared that the 2012 national guidelines influenced their clinical practice. The surveys showed an increasing use of laparoscopy for patients with abdominal emergencies. The 2012 national guidelines profoundly influenced the Italian surgical practice in the laparoscopic approach to the acute abdomen.

  2. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)


    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  3. Novo padrão de relações de trabalho e de ação sindical no setor de telecomunicações brasileiro: contribuição ao debate a partir do caso da Paraíba. doi:10.5007/2175-7984.2011v10n18p271

    Directory of Open Access Journals (Sweden)

    Roberto Véras de Oliveira


    Full Text Available Apresentamos aqui os resultados de pesquisa empreendida em 2008, junto aos trabalhadores em telecomunicações da Paraíba, que analisou os efeitos da privatização do Sistema Telebrás sobre as relações de trabalho e a ação sindical. Foca sobre os processos de terceirização, de introdução de uma dinâmica de rotatividade, de informalização, de heterogeneização dos tipos de relações de trabalho, de fragmentação das identidades dos trabalhadores, de precarização do trabalho e de alteração na dinâmica da ação sindical. Foram usados os seguintes procedimentos metodológicos: pesquisa documental e bibliográfica, aplicação de questionários e entrevistas junto aos diversos tipos de trabalhadores ativos e aposentados do setor na Paraíba, observação participante junto ao I Congresso de Trabalhadores em Telecomunicações, realizado em novembro de 2008.

  4. Logical analysis of biological systems

    DEFF Research Database (Denmark)

    Mardare, Radu Iulian


    R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005.......R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005....

  5. 12 CFR 230.9 - Enforcement and record retention. (United States)


    ... listed in that section. (b) Civil liability. Section 271 of the Act contains the provisions relating to civil liability for failure to comply with the requirements of the act and this part; Section 271 is...

  6. Telemetry Standards, RCC Standard 106-17, Chapter 27, RF Network Access Layer (United States)


    Figure 27-1. OSI Model as related to the TmNS RF Network ............................................... 27-1 Figure 27-2. Data Link Layer Framing... network . The network implements an Open Systems Interconnection ( OSI ) model approach (Figure 27-1) to data transmission, where data moves arrives. Figure 27-1. OSI Model as related to the TmNS RF Network This chapter describes the low-level waveform content (e.g., Frequency

  7. Skin-resident stem cells and wound healing. (United States)

    Iwata, Yohei; Akamatsu, Hirohiko; Hasebe, Yuichi; Hasegawa, Seiji; Sugiura, Kazumitsu


    CD271 is common stem cell marker for the epidermis and dermis. We assessed a kinetic movement of epidermal and dermal CD271 + cells in the wound healing process to elucidate the possible involvement with chronic skin ulcers. Epidermal CD271 + cells were proliferated and migrated from 3 days after wounding. Purified epidermal CD271 + cells expressed higher TGFβ2 and VEGFα transcripts than CD271 - cells. Delayed wound healing was observed in the aged mice compared with young mice. During the wound healing process, the peak of dermal CD271 + cell accumulation was delayed in aged mice compared with young mice. The expression levels of collagen-1, -3, -5, F4-80, EGF, FGF2, TGFβ1, and IL-1α were significantly increased in young mice compared with aged mice. Furthermore, purified dermal CD271 + cells expressed higher FGF2, EGF, PDGFB, and TGFβ1 gene transcripts than CD271 - cells. These results suggested that epidermal and dermal CD271 + cells were closely associated with wound healing process by producing various growth factors. Epidermal and dermal CD271 + cells in chronic skin ulcer patients were significantly reduced compared with healthy controls. Thus, both epidermal and dermal stem cells can play an important role in wound healing process.

  8. Existing Analytical Frameworks for Information Behaviour Don’t Fully Explain HIV/AIDS Information Exchange in Rural Communities in Ontario, Canada. A Review of: Veinot, T., Harris, R., Bella, L., Rootman, I., & Krajnak, J. (2006. HIV/AIDS Information exchange in rural communities: Preliminary findings from a three‐province study. Canadian Journal of Information and Library Science, 30(3/4, 271‐290.

    Directory of Open Access Journals (Sweden)

    Kate Kelly


    Full Text Available Objective – To explore and analyze, against three theoretical frameworks of information behaviours, how people with HIV/AIDS, their friends, and their family living in rural communities find information on HIV/AIDS.Design – Qualitative, individual, in‐depth, semi‐structured interviews.Setting – Two rural regions in Ontario, Canada.Subjects – Sixteen participants; 10 people with HIV/AIDS (PHAs and 6 family members or friends.Methods – Participants were recruited through health care providers, social service agencies and through snowball sampling. Semi‐structure interviews were conducted focusing on participants’ experience with HIV/AIDS, how they find and use information on HIV/AIDS, networks for information exchange and the effect of technology on information exchange. Interviews were taped, transcribed, analyzed qualitatively using NVivo software. Results were compared to three theoretical frameworks for information behaviour: 1. purposeful information seeking (i.e., the idea that people purposefully seek information to bridge perceived knowledge gaps; 2. non‐purposeful or incidental information acquisition (i.e., the idea that people absorb information from going about daily activities; and 3. information gate keeping (i.e., the concept of private individuals who act as community links and filters for information gathering and dissemination.Main Results – Consistent with the theories:•PHAs prefer to receive information from people they have a personal relationship with, particularly their physician and especially other PHAs.•PHAs’ friends and families rely on their friends and family for information, and are particularly reliant upon the PHA in their lives.•Fear of stigma and discrimination cause some to avoid seeking information or to prefer certain sources of information, such as healthcare providers, who are bound by codes of professional conduct.•Emotional support is important in information provision and its presence supersedes the professional role of the provider (social workers and counsellors were identified as key information sources over medical professionals in this instance. Participants responded negatively to the perceived lack of support from providers including doubting the information provided.•PHAs monitor their worlds and keep up to date about HIV/AIDS.Inconsistent with theories:•Reliance on caregivers for information is not solely explained by fear of stigma or exposure. Rather, it is the specialized knowledge and immersion in HIV/AIDS which is valued.•The distinction between peer or kin sources of information and institutional information sources is less clear and relationships with professionals can turn personal over time.•Inter‐personal connections include organisations, not just individuals, particularly AIDS Service Organizations and HIV specialist clinics.•Relatively few incidents of finding useful information about HIV/AIDS incidentally were described. The concept of information just being “out there” was not really applicable to rural settings, likely due to the lack of discussion within participant communities and local media. When it was discussed, participants reported being more likely to gain misinformation through their personal networks.•Incidental information acquisition originates mostly from professional and organisational sources. Participants identified posters, leaflets, and, for those who interacted with organisations, information via mail as contributing to current awareness.•The gate keeping concept does not capture all the information sharing activities undertaken by “gate keepers” in rural areas, and neither does it include formal providers of information, yet all PHAs interviewed identified formal providers as key sources.Conclusion – The findings reinforce some of the existing analytical framework theories, particularly the importance of affective components (i.e. emotional supports of information seeking, the presence of monitoring behaviours, and of interpersonal sources of information. However, alternate theories may need to be explored as the role of institutional information sources in the lives of PHAs doesn’t match the theoretical predication and the “gate keeper” concept doesn’t capture a significant portion of that role in rural HIV/AIDS information exchange.

  9. 40 CFR 9.1 - OMB approvals under the Paperwork Reduction Act. (United States)


    ...-0078 Books and Records of Pesticide Production and Distribution 169.2 2070-0028 Worker Protection... 271.20-271.21 2050-0041 271.23 2050-0041 Standards for Universal Waste Management 273.14 2050-0145 273... Planning and Community Right-to-Know; Health Professionals 350.5-350.16 2050-0078 350.27 2050-0078 350.40...

  10. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. AcEST: DK951051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 271 2e-71 tr|A7QUM9|A7QU...RGGL+K +W+ APFVS Sbjct: 180 FFPNEKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVS 217 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Ann...ona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 271

  12. Moulting and moult quality in eye-stalk ablated penaeid prawn, Metapenaeus monoceros (Fabricius)

    Digital Repository Service at National Institute of Oceanography (India)

    Venkitaraman, P; Sivadas, P

    stream_size 3 stream_content_type text/plain stream_name 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt stream_source_info 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  13. Use of acoustic systems for underwater archaeology

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.

    stream_size 2 stream_content_type text/plain stream_name J_Mar_Archaeol_2_71.pdf.txt stream_source_info J_Mar_Archaeol_2_71.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Age-related prodiabetogenic effects of transgenic resistin in spontaneously hypertensive rats

    Czech Academy of Sciences Publication Activity Database

    Pravenec, Michal; Zídek, Václav; Landa, Vladimír; Kazdová, L.; Kurtz, T.


    Roč. 23, Suppl. 4 (2006), s. 271-271 ISSN 0742-3071. [World Diabetes Congress /19./. 03.12.2006-07.12.2006, Cape Town] R&D Projects: GA ČR(CZ) GA301/06/0028 Institutional research plan: CEZ:AV0Z50110509 Keywords : resistin * autocrine effects * transgenic Subject RIV: ED - Physiology

  15. Dicty_cDB: VSF223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 196315 |pid:none) Auxenochlorella protothecoides rib... 271 2e-71 BC054263_1( BC054263 |pid:none) Xenopus la...F402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 271 2e-71 FJ196315_1( FJ

  16. Oriented stochastic data envelopment models: ranking comparison to stochastic frontier approach

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František

    -, č. 271 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : stochastic data envelopment analysis * linear programming * rice farm Subject RIV: AH - Economics

  17. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 125; Issue 3. Issue front cover thumbnail. Volume 125, Issue 3. August 2015, pages 271-447. pp 271-276. A note on neighborhood total domination in graphs · Nader Jafari Rad · More Details Abstract Fulltext PDF. Let = ( ,) be a graph without isolated ...

  18. Disease: H01995 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available undborg disease (ULD), also known as progressive myoclonic epilepsy type 1 (EPM1), is an autosomal recessive...tatin B in progressive myoclonus epilepsy (EPM1) ... JOURNAL ... Science 271:1731-4 (1996) DOI:10.1126/science.271.5256.1731 ...

  19. Fresh water influx and particle flux variability in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Schafer, P.; Ittekkot, V.; Bartsch, M.; Nair, R.R.; Tiemann, J.

    stream_size 22 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  20. Sleep, Sleepiness and Medical College Students: A Comparative ...

    African Journals Online (AJOL)

    Subjects and Methods: Validated questionnaires (PSQI, ESS and Sleep 50) along with sleep diary and demographic sheet were used to study sleep duration, daytime sleepiness and sleep associated problems in 271 students of medical and paramedical course. Results: Study group included MBBS (76.4%, 207/271) and ...

  1. PDB: CBRC-GGOR-01-0300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0300 3ODU,3OE0,3OE6,3OE8,3OE9, Region:8-271(Identity=98%) PDB:3ODU Chain:A (X-ray Resolution...=2.5),Region:8-271(Identity=98%) PDB:3OE0 Chain:A (X-ray Resolution=2.9),Region:8-271(...Identity=98%) PDB:3OE6 Chain:A (X-ray Resolution=3.2),Region:8-271(Identity=98%) PDB:3OE8 Chain:A (X-ray Resolution...=3.1),Region:8-271(Identity=98%) PDB:3OE9 Chain:A (X-ray Resolution=3.1), ...

  2. Assessment of adherence to the CONSORT statement for quality of reports on randomized controlled trial abstracts from four high-impact general medical journals. (United States)

    Ghimire, Saurav; Kyung, Eunjung; Kang, Wonku; Kim, Eunyoung


    The extended Consolidated Standards of Reporting Trials (CONSORT) Statement for Abstracts was developed to improve the quality of reports of randomized controlled trials (RCTs) because readers often base their assessment of a trial solely on the abstract. To date, few data exist regarding whether it has achieved this goal. We evaluated the extent of adherence to the CONSORT for Abstract statement for quality of reports on RCT abstracts by four high-impact general medical journals. A descriptive analysis of published RCT abstracts in The New England Journal of Medicine (NEJM), The Lancet, The Journal of American Medical Association (JAMA), and the British Medical Journal (BMJ) in the year 2010 was conducted by two reviewers, independently extracting data from a MEDLINE/PubMed search. We identified 271 potential RCT abstracts meeting our inclusion criteria. More than half of the abstracts identified the study as randomized in the title (58.7%; 159/271), reported the specific objective/hypothesis (72.7%; 197/271), described participant eligibility criteria with settings for data collection (60.9%; 165/271), detailed the interventions for both groups (90.8%; 246/271), and clearly defined the primary outcome (94.8%; 257/271). However, the methodological quality domains were inadequately reported: allocation concealment (11.8%; 32/271) and details of blinding (21.0%; 57/271). Reporting the primary outcome results for each group was done in 84.1% (228/271). Almost all of the abstracts reported trial registration (99.3%; 269/271), whereas reports of funding and of harm or side effects from the interventions were found in only 47.6% (129/271) and 42.8% (116/271) of the abstracts, respectively. These findings show inconsistencies and non-adherence to the CONSORT for abstract guidelines, especially in the methodological quality domains. Improvements in the quality of RCT reports can be expected by adhering to existing standards and guidelines as expressed by the CONSORT group.

  3. La temperatura alcanzada es casi un grado más frio que el universo, informó el centro de investigaciones CERN

    CERN Document Server


    The first section of what will be the biggest particle accelerator in the world, the LHC, near Geneva, reached the temperature in which it will work: -271 degre Celsius, about one degree colder than the Universe. (1/2 page)

  4. Gclust Server: 191761 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences 1 Homologs 1 Clustering threshold 1.00e-99 Plants and algae (7species) (%) 0.0 Other Bikonts (Chr...e annotation hypothetical protein (translation) (271 aa); no annotation Number of

  5. School's Still out on Internal Auditing. (United States)

    Cuzzetto, Charles E.; Moran, Daniel D.


    Survey responses from 271 members of the Association of School Business Officials International were analyzed to determine the extent and use of internal auditing in school districts and the characteristics of districts with internal auditing positions. (MLF)

  6. Lipstick and Lead: Questions and Answers (United States)

    ... pose a health risk. FDA’s Draft Guidance for Industry on Lead in Cosmetic Lip Products and Externally ... Stargazer Lipstick 101 c 180808 2.71 23 Fashion Fair Johnson Publishing Company Forever Matte 8207 Forever ...

  7. Epidemiology of non-fatal injuries due to external causes in ...

    African Journals Online (AJOL)


    tween 1989 and 1990 in the course of 271 hospital ward rounds and 43 casualty watches. The overall trauma incidence was 2886 new cases per annum per 100000 population, rising to 19872 for coloured males aged 20 - 24.

  8. Prathap, Dr Gangan

    Indian Academy of Sciences (India)

    Date of birth: 6 June 1951. Specialization: Structural Mechanics, Finite Element Method, Information Science and Composite Materials Address: Honorary Professor, APJ Abdul Kalam Tech University, CET Campus, Thiruvananthapuram 695 016, Kerala Contact: Office: (0471) 278 5627. Residence: (0471) 271 1956

  9. Data of evolutionary structure change: 1YDVA-1AW2A [Confc[Archive

    Lifescience Database Archive (English)


  10. GLDAS Noah Land Surface Model L4 3 Hourly 1.0 x 1.0 degree Subsetted V001 (United States)

    National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

  11. Measurements of seismic vibrations induced by Quarry blasts at the Mostecká basin

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk

    -, č. 271 (2006), s. 49-58 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : seismic vibration * slope stability * quarry blast Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  12. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.


    Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  13. 77 FR 15273 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision (United States)


    ...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act...

  14. Leadership Style Paradigm Shift and Organisational Performance: A ...

    African Journals Online (AJOL)

    Mrs Afam

    acquisition context. Specifically, the result also showed a ... between changes in leadership styles and organizational performance in a cement production firm in Nigeria. Specifically ..... created social climate. Journal of Social Psychology, 10, 271-299.

  15. Chiral Separations by Capillary Electrochromatography on Multiple-Interaction Based Stationary Phases

    Czech Academy of Sciences Publication Activity Database

    Honzátko, Aleš; Aturki, Z.; Flieger, Miroslav; Messina, A.; Sinibaldi, M.


    Roč. 58, - (2003), s. 271-275 ISSN 0009-5893 Institutional research plan: CEZ:AV0Z5020903 Keywords : enantioseparations * capillary * electromatography Subject RIV: EE - Microbiology, Virology Impact factor: 1.145, year: 2003

  16. Fellowship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Date of birth: 6 June 1951. Specialization: Structural Mechanics, Finite Element Method, Information Science and Composite Materials Address: Honorary Professor, APJ Abdul Kalam Tech University, CET Campus, Thiruvananthapuram 695 016, Kerala Contact: Office: (0471) 278 5627. Residence: (0471) 271 1956

  17. 78 FR 14352 - Notice of Approved Class III Tribal Gaming Ordinances (United States)


    .... Manchester Band of Pomo Indians of the Manchester-Point Arena Rancheria 128. Manzanita Band of Mission...-Nine Palms Band of Mission Indians 269. United Auburn Indian Community 270. Upper Sioux Community 271...

  18. Krajanská lidová léčba a ritualizované praktiky u Čechů z Ukrajiny a Kazachstánu přesídlených do České republiky

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika


    Roč. 23, č. 4 (2013), s. 264-271 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Ukraine * Kazakhstan * Czech Republic * migration * folk medicine * ethno-medicine * complementary medicine * compatriots Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Československo-jugoslávské vztahy v přelomovém roce 1929

    Czech Academy of Sciences Publication Activity Database

    Škerlová, Jana


    Roč. 100, č. 2 (2014), s. 271-296 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : political relations * Czechoslovakia * Kingdom of Serbs * Croats and Slovenes * Kingdom of Yugoslavia * Royal Dictatorship Subject RIV: AB - History

  20. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.


    Roč. 61, č. 6 (2014), s. 265-271 ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  1. Comparison of five tests for identification of Staphylococcus aureus from clinical samples

    NARCIS (Netherlands)

    A. Luijendijk (Ad); A.F. van Belkum (Alex); J.A.J.W. Kluytmans (Jan); H.A. Verbrugh (Henri)


    textabstractFive different laboratory tests for the identification of Staphylococcus aureus were compared. Analyses of 271 presumptive S. aureus strains, supplemented with 59 well-defined methicillin-resistant S. aureus (MRSA) isolates, were performed. Only the

  2. 77 FR 14012 - Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I (United States)


    ...; DA 12-271] Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I... Wireless Telecommunications and Wireline Competition Bureaus describe the process and requirements for applicants seeking Eligible Telecommunications Carrier (ETC) Designation from the Commission for...

  3. Antibiotic Resistance Among Genital Tract Isolates from Sexually ...

    African Journals Online (AJOL)

    transmitted disease (STD) patients was carried out at the University of Benin Teaching Hospital (UBTH), Benin City, between February 2001 and September 2003. The isolates which were associated with 22 cases of gonorrhoea, 271 cases of ...

  4. 12 CFR 707.9 - Enforcement and record retention. (United States)


    ... comply with the requirements of TISA and this part. (b) Civil liability. Section 271 of TISA (12 U.S.C. 4310) contains the provisions relating to civil liability for failure to comply with the requirements...

  5. Genomic evidence for divergence with gene flow in host races of the larch budmoth

    Czech Academy of Sciences Publication Activity Database

    Emelianov, I.; Marec, František; Mallet, J.


    Roč. 271, - (2003), s. 97-105 ISSN 0962-8452 Institutional research plan: CEZ:AV0Z5007907 Keywords : speciation * gene flow * selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.544, year: 2003

  6. Rarotonga Sr/Ca and SST Reconstruction Data for 1726 to 1997 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 271 year record of Sr/Ca variability in a coral from Rarotonga in the South Pacific gyre. Calibration with monthly sea surface temperature (SST) from satellite and...

  7. Technical progress report. Private sector initiatives between the United States and Japan. January 1990 - December 1990

    International Nuclear Information System (INIS)


    OAK A271 This annual report for calendar year 1990 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

  8. Non vidi nec fas. Afrodita Knidská v antické textové a obrazové tradici

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    -, č. 11 (2016), s. 28-40 ISSN 2453-7284 Institutional support: RVO:67985955 Keywords : Aphrodite * Praxiteles * legends Subject RIV: AB - History

  9. Copepoda: Pandaridae

    African Journals Online (AJOL)


    ,27(1) finely striated marginal membrane is present along the anterior and lateral margins of the cephalothorax of D. latifolia (Figure 1 & 4c), which no doubt fonns an effective seal against the host tissue. Posteriorly, however ...

  10. The mitochondrial genome and ribosomal operon of Brachycladium goliath (Digenea: Brachycladiidae) recovered from a stranded minke whale

    Czech Academy of Sciences Publication Activity Database

    Briscoe, A.G.; Bray, R. A.; Brabec, Jan; Littlewood, D. T. J.


    Roč. 65, č. 3 (2016), s. 271-275 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : Digenea * Balaenoptera acutorostrata * Cetacea * Hologenophore * NGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.744, year: 2016

  11. Hepatitis A Test (United States)

    ... 1805. Henry's Clinical Diagnosis and Management by Laboratory Methods. 21st ed. McPherson RA and Pincus MR, eds. Philadelphia: 2007, Pp 271. See More See Less Ask a Laboratory Scientist Your questions will be answered by a laboratory ...

  12. Roubované polymerní kartáče

    Czech Academy of Sciences Publication Activity Database

    Riedel, Tomáš; Rodriguez-Emmenegger, Cesar; Pop-Georgievski, Ognen


    Roč. 94, č. 10 (2015), s. 580-582 ISSN 0042-4544 Institutional support: RVO:61389013 Keywords : polymer brushes * biosensors Subject RIV: CD - Macromolecular Chemistry

  13. Confirmation of a theory: reconstruction of an alluvial plain development in a flume experiment

    Czech Academy of Sciences Publication Activity Database

    Bertalan, L.; Tóth, C. A.; Szabó, G.; Nagy, G.; Kuda, František; Szabó, S.


    Roč. 70, č. 3 (2016), s. 271-285 ISSN 0014-0015 Institutional support: RVO:68145535 Keywords : fluvial geomorphology * flume experiment * avulsion Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.923, year: 2016

  14. Sankcionovat

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna


    Roč. 99, č. 5 (2016), s. 271-275 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : sanction * origin * different meanings * dictionary Subject RIV: AI - Linguistics

  15. GLDAS Noah Land Surface Model L4 Monthly 1.0 x 1.0 degree V001 (United States)

    National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

  16. Structure and Bonding in Binuclear Metal Carbonyls. Classical Paradigms vs. Insights from Modern Theoretical Calculations

    Czech Academy of Sciences Publication Activity Database

    Ponec, Robert


    Roč. 1053, SI (2015), s. 195-213 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015

  17. GLDAS Noah Land Surface Model L4 Monthly 0.25 x 0.25 degree V001 (United States)

    National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

  18. GLDAS Noah Land Surface Model L4 3 Hourly 0.25 x 0.25 degree Subsetted V001 (United States)

    National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

  19. Neurological and Neurophysiological Findings in Workers with Chronic 2,3,7,8-Tetrachlorodibenzo-p-Dioxin Intoxication 50 Years After Exposure

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Urban, P.; Fenclová, Z.; Vlčková, Š.; Ridzoň, P.; Kupka, K.; Mecková, Z.; Bezdíček, O.; Navrátil, Tomáš; Rosmus, J.; Zakharov, S.

    Č. 122 (2), s. 271-277 ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : neurological findings * intoxication * TCDD Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  20. Technical progress report. Private sector initiatives between the United States and Japan. January 1992 - December 1992

    International Nuclear Information System (INIS)


    OAK A271 This annual report for calendar year 1992 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

  1. MILITARY BASE CLOSURES: Questions Concerning the Proposed Sale of Housing at Mather Air Force Base

    National Research Council Canada - National Science Library


    This report responds to your request that we review the proposed negotiated sale of 1,271 surplus family housing units at Mather Air Force Base, California, to the Sacramento Housing and Redevelopment Agency (SHRA...

  2. Replication of recently identified systemic lupus erythematosus genetic associations: a case-control study

    Czech Academy of Sciences Publication Activity Database

    Suarez-Gestal, M.; Calaza, M.; Endreffy, E.; Pullmann, R.; Ordi-Ros, J.; Sebastiani, D.G.; Růžičková, Šárka; Santos, J.M.; Papasteriades, C.; Marchini, M.; Skopouli, F.N.; Suarez, A.; Blanco, F.J.; D'Alfonso, S.; Bijl, M.; Carreira, P.; Witte, T.; Migliaresi, S.; Gomez-Reino, J.J.; Gonzalez, A.


    Roč. 11, č. 3 (2009), R69 ISSN 1478-6362 Keywords : Single nucleotide polymorphism susceptibility * sytemic lupus erythematosus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.271, year: 2009

  3. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 1804 ... Alternative Measure of Wellbeing: Bhutan's Gross National Happiness 2010. There is growing demand for innovative yet rigorous measures of national wellbeing beyond gross domestic product. Project ...

  4. Effectiveness of Group-Delivered Cognitive Therapy and Treatment Length in Women Veterans with PTSD


    Castillo, Diane T.; Lacefield, Katharine; C’de Baca, Janet; Blankenship, Abby; Qualls, Clifford


    The effectiveness and length of group-delivered cognitive treatment for Posttraumatic Stress Disorder (PTSD) was examined in a sample of women veterans. The sample included 271 primarily non-Hispanic white (61%) and Hispanic (25%) women veterans treated in 8-, 10-, or 12-group length sessions with manualized cognitive therapy for PTSD. Outcome was measured with the PTSD Symptom Checklist (PCL) in an intention-to-treat analysis (N = 271), in completer subjects (n = 172), and with group as the ...

  5. Long-term trends in the ionosphere and upper atmosphere parameters

    Czech Academy of Sciences Publication Activity Database

    Bremer, J.; Alfonsi, L.; Pal, B.; Laštovička, Jan; Mikhailov, A. V.; Rogers, N.

    47 /suppl./, 2/3 (2004), s. 1009-1029 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : long-term trends * ionosphere * upper atmosphere Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  6. Optimization of Nanoscale Zero-Valent Iron for the Remediation of Groundwater Contaminants (United States)


    G. Pan, Rapid and complete destruction of perchlorate in water and ion-exchange brine using stabilized zero-valent iron nanoparticles, Water Res. 41...nanoparticles with sodium carboxymethyl cellulose for catalytic reduction of para- nitrochlorobenzene in water, Desalination 271 (2011), pp. 11-19. [61] W.X...with sodium carboxymethyl cellulose for catalytic reduction of para- nitrochlorobenzene in water. Desalination . 2011, 271, 11-19. [24

  7. Untitled

    African Journals Online (AJOL)

    From goats, 8.9% (n=271) were positive by RBPT and 7% (n=271) by SAT. The prevalence was higher on farms with indigenous, 16.15% (n=291), than on farms with exotic breeds of cattle, 7.51% (n=303); and this was attributed to the better sanitary and husbandry methods in farms with exotic breeds. This has been the first ...

  8. An Overview of Production Systems (United States)


    DISTRIBUTED BY: Matonal Tochnica! Infonu srice U. S. DEPARTMENT OF COMMERCE 028143 Stanford Artificil Inteligence Laboratory October 1975 Memo AIM-271...ORGANIZATION NAMEL AND ADDRESS 18. PROGRAM ELEMENT. PROJECT. TASK Artificial Intelligence Laboratory AE OKUI UBR Stanford University ARPA Order 249...014-64011I j SEC-jRITY CLASSIFICATION OF THIS PAGE (When, Data bHISP011 A Stanford Artificial ktteligncs Laboratory October 1975 Memo AIM-271 Computer

  9. Nowcasting, forecasting and warning for ionospheric propagation: tools and methods

    Czech Academy of Sciences Publication Activity Database

    Stamper, R.; Belehaki, A.; Burešová, Dalia; Cander, Lj. R.; Kutiev, I.; Pietrella, M.; Stanislawska, I.; Stankov, S.; Tsagouri, I.; Tulunay, J. K.; Zolesi, B.


    Roč. 47, 2/3 (2004), s. 957-981 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionospheric measurements * nowcasting * forecasting Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  10. Operation Brain Trauma Therapy Extended Studies (United States)


    development of cerebral edema . Insults and behavioral testing of therapy 8, AER-271 have been completed and data are being analyzed. Therapy 9, amantadine is...necessary fluid resuscitation—highlights the development of cerebral edema and intracranial hypertension (Blasiole et al, Anesthesiology, 118:649...8. AER 271 (a more speculative therapy tested on OBTT-ES) Treatment of cerebral edema after TBI has largely been accomplished via five

  11. Age-Related Yield of Adipose-Derived Stem Cells Bearing the Low-Affinity Nerve Growth Factor Receptor

    Directory of Open Access Journals (Sweden)

    Raquel Cuevas-Diaz Duran


    Full Text Available Adipose-derived stem cells (ADSCs are a heterogeneous cell population that may be enriched by positive selection with antibodies against the low-affinity nerve growth factor receptor (LNGFR or CD271, yielding a selective cell universe with higher proliferation and differentiation potential. This paper addresses the need for determining the quantity of ADSCs positive for the CD271 receptor and its correlation with donor's age. Mononuclear cells were harvested from the lower backs of 35 female donors and purified using magnetic beads. Multipotency capacity was tested by the expression of stemness genes and through differentiation into preosteoblasts and adipocytes. A significant statistical difference was found in CD271+ concentrations between defined age intervals. The highest yield was found within women on the 30–40-year-old age range. CD271+ ADSCs from all age groups showed differentiation capabilities as well as expression of typical multipotent stem cell genes. Our data suggest that the amount of CD271+ cells correlates inversely with age. However, the ability to obtain these cells was maintained through all age ranges with a yield higher than what has been reported from bone marrow. Our findings propose CD271+ ADSCs as the primary choice for tissue regeneration and autologous stem cell therapies in older subjects.

  12. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia


    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  13. Alzheimer's Disease in Social Media: Content Analysis of YouTube Videos. (United States)

    Tang, Weizhou; Olscamp, Kate; Choi, Seul Ki; Friedman, Daniela B


    Approximately 5.5 million Americans are living with Alzheimer's disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Videos uploaded to YouTube from 2013 to 2015 were searched with the term "Alzheimer's disease" on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher's exact tests. Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current study highlight a potential gap between available information

  14. Alzheimer’s Disease in Social Media: Content Analysis of YouTube Videos (United States)

    Tang, Weizhou; Olscamp, Kate; Friedman, Daniela B


    Background Approximately 5.5 million Americans are living with Alzheimer’s disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. Objective This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Methods Videos uploaded to YouTube from 2013 to 2015 were searched with the term “Alzheimer’s disease” on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher’s exact tests. Results Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). Conclusions This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current

  15. Planetary and gravity wave signatures in the F region ionosphere with impact on radio propagation predictions and variability

    Czech Academy of Sciences Publication Activity Database

    Altadill, D.; Apostolov, E. M.; Boška, Josef; Laštovička, Jan; Šauli, Petra


    Roč. 47, 2/3 (2004), s. 1109-1119 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth- space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA ČR GA205/01/1071; GA ČR GP205/02/P077 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere * planetary waves * gravity waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  16. Frequência de anticorpos contra o vírus da língua azul em ovinos do estado do Ceará, Brasil


    Pinheiro,R.R.; Souza,T.S.; Feitosa,A.L.V.L.; Aragão,M.A.C.; Lima,C.C.V.; Costa,J.N.; Andrioli,A.; Teixeira,M.F.S.; Brito,R.L.L.


    O objetivo deste trabalho foi avaliar a ocorrência de ovinos soropositivos para o vírus da língua azul (VLA) no Estado do Ceará, Brasil, e analisar as proteínas imunogênicas das cepas virais circulantes nesses rebanhos. O teste de imunodifusão em gel de agarose (IDGA) foi utilizado para pesquisar 271 amostras de soro oriundas de 16 rebanhos. Os resultados demonstraram que 27,3% (74/271) das amostras analisadas apresentaram anticorpos contra o agente e 68,8% (11/16) das propriedades tiveram an...

  17. Ionospheric effects on terrestrial communications: Working Group 3 overview

    Czech Academy of Sciences Publication Activity Database

    Laštovička, Jan; Bourdillon, A.


    Roč. 47, 2/3 (2004), s. 1269-1277 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA AV ČR IBS3012007 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionospheric reflection * telecommunications * gravity waves * planetary waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  18. Regional variations in the fluxes of foraminifera carbonate, coccolithophorid carbonate and biogenic opal in the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaswamy, V.; Gaye

    species. r 2005 Elsevier Ltd. All rights reserved. Keywords: Northern Indian Ocean; Particle flux; Calcium carbonate; Biogenic opal; Sediment traps; Temporal and spatial variability 1. Introduction northern Indian Ocean V. Ramaswamy a,C3 , B. Gaye b a... coccolithophorid carbonate and biogenic opal in the 271–293 ARTICLE IN PRESS V. Ramaswamy, B. Gaye / Deep-Sea Research I 53 (2006) 271–293272 lesser extent pteropods. Diatom frustules are made up of opal while coccolithophorids...

  19. Behaviour of the F1-region, and Es and spread-F phenomena at European middle latitudes

    Czech Academy of Sciences Publication Activity Database

    Pal, B.; Burešová, Dalia; Laštovička, Jan; Marcz, F.


    Roč. 47, 2/3 (2004), s. 1131-1143 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA AV ČR IAA3042102; GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere-radio propagation * F1 region * ionospheric irregularities Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  20. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo


    Roč. 135, 3-4 (2009), s. 267-271 ISSN 0378-1135 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  1. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status (United States)

    Wolters, Nina; Knoors, Harry; Cillessen, Antonius H. N.; Verhoeven, Ludo


    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of deaf adolescents' peer status in Grade 8 from Grade…

  2. Theoretical study on the complexation of bambus[6]uril with the fluoride anion

    Czech Academy of Sciences Publication Activity Database

    Toman, Petr; Makrlík, E.; Vaňura, P.


    Roč. 989, 1 June (2012), s. 97-99 ISSN 2210-271X R&D Projects: GA ČR(CZ) GAP205/10/2280 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : bambus[6]uril * fluoride anion * complexation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.139, year: 2012

  3. Cytokinin oxidase/dehydrogenase genes in barley and wheat. Cloning and heterologous expression

    Czech Academy of Sciences Publication Activity Database

    Galuszka, P.; Frébortová, Jitka; Werner, T.; Yamada, M.; Strnad, Miroslav; Schmülling, T.; Frébort, I.


    Roč. 271, č. 20 (2004), s. 3990-4002 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5038910 Keywords : cereals * cloning * cytokinin oxidase/dehydrogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.260, year: 2004

  4. Influence of surface wave plasma deposition conditions on diamond growth regime

    Czech Academy of Sciences Publication Activity Database

    Babchenko, Oleg; Potocký, Štěpán; Ižák, Tibor; Hruška, Karel; Bryknar, Z.; Kromka, Alexander


    Roč. 271, Jun (2015), s. 74-79 ISSN 0257-8972 R&D Projects: GA ČR(CZ) GA14-05053S Institutional support: RVO:68378271 Keywords : surface wave plasma * diamond thin films * growth kinetics * scanning electron microscopy * Raman spectroscopy * optical emission spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.139, year: 2015

  5. Suitability of food plants for Oxycarenus lavaterae (Heteroptera: Lygaeidae), a mediterranean bug invasive in Central and South-East Europe

    Czech Academy of Sciences Publication Activity Database

    Kalushkov, P.; Nedvěd, Oldřich


    Roč. 63, č. 2 (2010), s. 271-276 ISSN 1310-1331 Grant - others:Bulgarian National Science Fund, Ministry of Education and Science(BG) B-1508 Institutional research plan: CEZ:AV0Z50070508 Keywords : Oxycarenus lavaterae * host plant specificity * fecundity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.219, year: 2010

  6. Phenolic acid content and radical scavenging activity of extracts from medlar (Mespilus germanica L.) fruit at different stages of ripening

    Czech Academy of Sciences Publication Activity Database

    Grúz, Jiří; Ayaz, F. A.; Torun, H.; Strnad, Miroslav


    Roč. 124, č. 1 (2011), s. 271-277 ISSN 0308-8146 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phenolic acids * HPLC * Mass spectrometry * Fruit * Ripening Subject RIV: EF - Botanics Impact factor: 3.655, year: 2011

  7. Publishing and perishing: The critical importance of educational design research

    NARCIS (Netherlands)

    Reeves, Thomas; McKenney, Susan; Herrington, Jan


    Reeves, T. C., McKenney, S., & Herrington, J. (2011). Publishing and perishing: The critical importance of educational design research. Australian Journal of Educational Technology, 27(1), 55-65.

  8. 76 FR 79258 - Self-Regulatory Organizations; Chicago Mercantile Exchange, Inc.; Notice of Filing and Order... (United States)


    .../Brazilian Real (USD/BRL) Spot, Forwards and Swaps); CME Chapter 260H (Cleared OTC U.S. Dollar/Russian Ruble... positive or negative. This language had been adopted previously by CME for many of the cleared OTC FX NDF... 271H. These changes would add language to the cash settlement provisions in the rules governing four...

  9. Geology and Re-Os molybdenite geochronology of the Kurišková U-Mo deposit (Western Carpathians, Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Kohút, M.; Trubač, J.; Novotný, L.; Ackerman, Lukáš; Demko, R.; Bartalský, B.; Erban, V.


    Roč. 58, č. 3 (2013), s. 271-282 ISSN 1802-6222 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : U–Mo ore deposit * Re–Os * molybdenite geochronology * genetic model * Gemeric Unit * Western Carpathians Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.744, year: 2013

  10. Cytoplasmic organelles determine complexity and specificity of calcium signalling in adrenal chromaffin cells

    Czech Academy of Sciences Publication Activity Database

    Garsia-Sancho, J.; Verkhratsky, Alexei


    Roč. 192, č. 2 (2008), s. 263-271 ISSN 1748-1708 Institutional research plan: CEZ:AV0Z50390512 Keywords : Ca2+ signalling * calcium microdomains * chromaffin cells Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 2.455, year: 2008

  11. The Use of Atmospheric Pressure Chemical Ionization Mass Spectrometry with High Performance Liquid Chromatography and Other Separation Techniques for Identification of Triacylglycerols

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Sigler, Karel


    Roč. 3, - (2007), s. 252-271 ISSN 1573-4110 R&D Projects: GA ČR GA203/06/0219 Institutional research plan: CEZ:AV0Z50200510 Keywords : triacylglycerols * atmospheric presssure chemical ionization * mass spectrometry Subject RIV: EE - Microbiology, Virology Impact factor: 1.815, year: 2007

  12. Effect of cyanobacterial peptides and proteins on coagulation of kaolinite

    Czech Academy of Sciences Publication Activity Database

    Novotná, Kateřina; Barešová, Magdalena; Čermáková, Lenka; Načeradská, Jana; Pivokonský, Martin


    Roč. 6, č. 2 (2016), s. 83-89 ISSN 1805-0174 Institutional support: RVO:67985874 Keywords : cellular organic matter * coagulation * complex formation * Microcystis aeruginosa * water treatment Subject RIV: DA - Hydrology ; Limnology

  13. School Stress, Teachers' Abusive Behaviors, and Children's Coping Strategies. (United States)

    Piekarska, Anna


    A study of 271 Polish students (ages 13-14) found that their most frequent stressors were teachers' abusive behaviors in classroom teaching and assessment. Students' coping strategies, and their school results, were determined by the intensity of school stress, anxiety, and temperamental characteristics. (Contains 15 references.) (Author/CR)

  14. New method to analyze internal disruptions with tomographic reconstructions

    NARCIS (Netherlands)

    Tanzi, C. P.; de Blank, H. J.


    Sawtooth crashes have been investigated on the Rijnhuizen Tokamak Project (RTP) [N. J. Lopes Cardozo ed al., Proceedings of the 14th international Conference on Plasma Physics and Controlled Nuclear Fusion Research, Wurzburg, 1992 (International Atomic Energy Agency, Vienna, 1993), Vol. 1, p. 271].

  15. Early Life Processes, Endocrine Mediators and Number of Susceptible Cells in Relation to Breast Cancer Risk (United States)


    Sweden, for overseeing the DNA isolation from the blood sam- ples; Heng Khai Koon and Ong Eng Hu Jason for genotyping; Lim Siew Lan and Irene Chen for...polymorphisms with sporadic breast cancer. Int J Cancer 2001, 95:271-275. 35. Dunning AM, Healey CS, Pharoah PD, Teare MD, Ponder BA, Eas- ton DF: A systematic

  16. Species richness and above-ground biomass of poor and calcareous spring fens in the flysch West Carpatians, and their relationships to water and soil chemistry

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, Michal


    Roč. 75, - (2003), s. 271-287 ISSN 0032-7786 R&D Projects: GA ČR GA206/99/1240; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : bryophytes * Central Europe * diversity Subject RIV: EF - Botanics

  17. Aqueous Extract of Oldenlandia diffusa Suppresses LPS-Induced ...

    African Journals Online (AJOL)


    plant used worldwide. Aqueous extract of O. diffusa (AEOD) has especially been used in ... this plant species - are as effective as antibiotics, and anti-cancer, liver protection and transaminase-degrading agents ..... chalcone analog from Alpinia conchigera. J. Pharmacol Exp Ther 2006; 316: 271–278. 8. Islam MS, Akhtar M, ...

  18. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6333 ... IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles ... Large-scale land deals can bring benefits such as jobs, infrastructure, and access to food and markets. But when badly managed, ...

  19. Laboratory research of coal geocomposits - some results

    Czech Academy of Sciences Publication Activity Database

    Souček, Kamil; Staš, Lubomír; Šňupárek, Richard


    Roč. 15, č. 1 (2005), s. 271-275 ISSN 1003-6326 R&D Projects: GA AV ČR(CZ) IBS3086351 Institutional research plan: CEZ:AV0Z30860518 Keywords : chemical grouting * reinforcing * geocomposite material Subject RIV: JI - Composite Material s Impact factor: 0.302, year: 2005

  20. 38 CFR 17.802 - Application provisions. (United States)


    ..., (D) Names of at least two references of government or community groups whom the organization has... operating policies addressing structure for democratic self-government, expulsion policies for nonpayment... plans for use of the loan proceeds. (Authority: Sec. 8 of Pub. L. 102-54, 105 Stat. 271, 38 U.S.C. 501) ...

  1. 77 FR 35104 - Notice of Request To Release Airport Property at Merrill Field Airport, Anchorage, AK (United States)


    ... delivered to: Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041 B Street, Anchorage, AK 99503...- 271-3665, email [email protected] or Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041... Section 6.13 of the State of Alaska Right of Way Manual. This purchase offer was predicated on DOT&PF's...

  2. Adenosine triphosphate analogs can efficiently inhibit the Zika virus RNA-dependent RNA polymerase

    Czech Academy of Sciences Publication Activity Database

    Hercík, Kamil; Kozák, Jaroslav; Šála, Michal; Dejmek, Milan; Hřebabecký, Hubert; Zborníková, Eva; Smola, Miroslav; Růžek, Daniel; Nencka, Radim; Bouřa, Evžen


    Roč. 137, Jan (2017), s. 131-133 ISSN 0166-3542 R&D Projects: GA ČR GA15-09310S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : hepatitis C virus * borne encephalitis virus * crystal structure Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

  3. High-Frequency Network Activity, Global Increase in Neuronal Activity, and Synchrony Expansion Precede Epileptic Seizures in Vitro

    Czech Academy of Sciences Publication Activity Database

    Jiruška, P.; Csicsvari, J.; Powell, A.V.; Fox, J.E.; Chang, W.C.; Vreugdenhil, M.; Li, X.; Paluš, Milan; Bujan, A.F.; Dearden, R.W.; Jefferys, J. G. R.


    Roč. 30, č. 16 (2010), s. 5690-5701 ISSN 0270-6474 Institutional research plan: CEZ:AV0Z10300504 Keywords : mammalian hippocampus invitro * temporal-lobe epilepsy * nonsynaptic epileptogenesis * spatiotemporal dynamics * after-discharges * pyramidal cells * oscillations * rat * calcium * slice Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

  4. SINET: Ethiopian Journal of Science - Vol 22, No 2 (1999)

    African Journals Online (AJOL)

    ... evaluation of Phytomyza orobanchia (Diptera: Agromyzidae) as a controller of Orobanche spp in Ethiopia, EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A E M Elzein, J Kroschel, Assefa Admasu, Masresha Fetene, 271-282.

  5. Lifetime and baseline alcohol intake and risk of cancer of the upper aero-digestive tract in the European prospective investigation into cancer and nutrition (EPIC) study

    NARCIS (Netherlands)

    Weikert, Cornelia; Dietrich, Thomas; Boeing, Heiner; Bergmann, Manuela M.; Boutron-Ruault, Marie Christine; Clavel-Chapelon, Francoise; Allen, Naomi; Key, Tim; Lund, Eiliv; Olsen, Anja; Tjonneland, Anne; Overvad, Kim; Rohrmann, Sabine; Linseisen, Jakob; Pischon, Tobias; Trichopoulou, Antonia; Weinehall, Lars; Johansson, Ingegerd; Sanchez, Maria-Jose; Agudo, Antonio; Barricarte, Aurelio; Amiano, Pilar; Chirlaque, Maria-Dolores; Ramon Quiros, J.; Wirfalt, Elisabet; Peeters, Petra H.; Bueno-de-Mesquita, H. Bas; Vrieling, Alina; Pala, Valeria; Palli, Domenico; Vineis, Paolo; Tumino, Rosario; Panico, Salvatore; Bingham, Sheila; Khaw, Kay-Tee; Norat, Teresa; Jenab, Mazda; Ferrari, Pietro; Slimani, Nadia; Riboli, Elio


    Recent alcohol consumption is all established risk factor for squamous cell carcinoma (SCC) or the upper aero-digestive tract. In contrast, the role or lifetime exposure to alcohol with regard to risk of SCC is not well established. Historical data oil alcohol use are available in 271,253

  6. Cost effective and shape controlled approach to synthesize ...

    Indian Academy of Sciences (India)

    Cost effective and shape controlled approach to synthesize hierarchically assembled NiO nanoflakes for the removal of toxic heavy metal ions in aqueous solution. K Yogesh Kumar H B Muralidhara Y Arthoba Nayaka H Hanumanthappa M S Veena S R Kiran Kumar. Volume 38 Issue 1 February 2015 pp 271-282 ...

  7. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Issue 3. Issue front cover thumbnail. Volume 89, Issue 3. September 2010, pages 269-390. Special issue - How is sex determined in insects? pp 269-270. Preface · J. Nagaraju Giuseppe Saccone · More Details Fulltext PDF. pp 271-277 Review Article. The role of the ...

  8. Yankee Nuclear Power Station. Semiannual operating report, January--June 1975

    International Nuclear Information System (INIS)


    The plant operated at power with brief shutdowns and load reductions during this period. Net electrical power generated was 741,551,035 MWh with the generator on line 4,271.30 hrs. Data is presented concerning power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational personnel radiation exposures, release of radioactive materials, and abnormal occurrences. (FS)

  9. An annotated catalog of the Iranian Pentatomoidea (Hemiptera: Heteroptera: Pentatomomorpha). (United States)

    Ghahari, Hassan; Moulet, Pierre; Rider, David A


    Seven families of Pentatomoidea including Acanthosomatidae, Dinidoridae, Pentatomidae, Plataspididae, Scutelleridae, Thaumastellidae, and Thyreocoridae are discussed in this catalog. The Iranian fauna of Pentatomoidea (excl. Cydnidae) is represented by 99 genera and 271 species and subspecies. Elasmostethus interstinctus (Linnaeus, 1758) (Acanthosomatidae) and Derula flavoguttata Mulsant & Rey, 1856 (Pentatomidae) are new records for Iran. 

  10. Factors influencing the choice of surgery as a career by ...

    African Journals Online (AJOL)

    Methods: A descriptive cross-sectional study of 271 interns was conducted using structured self administered questionnaires. The data obtained included demographic details, details of internship rotations, choice of specialty, reasons for nonconsideration of surgery and if the interns had role models, staff advisers and first ...

  11. Pollution: Problems and Solutions. Grade Nine, Unit One, 9.1 Comprehensive Social Studies Curriculum for the Inner City. (United States)

    Jamison, Sandra; Campbell, Bruce

    The ninth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) studies the economic and political realities of the inner city. This document, the first unit of the 9th grade section, deals with the ecological crises involving pollution and its causes. Specific problems include air pollution, pesticides, herbicides,…

  12. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C S Jha. Articles written in Journal of Earth System Science. Volume 122 Issue 2 April 2013 pp 271-281. Landscape level assessment of critically endangered vegetation of Lakshadweep islands using geo-spatial techniques · C Sudhakar Reddy Bijan Debnath P Hari ...

  13. Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study

    Czech Academy of Sciences Publication Activity Database

    Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.


    Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  14. Magnetic fabric and modeled strain distribution in the head of a nested granite diapir, the Melechov pluton, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Trubač, Jakub; Žák, J.; Chlupáčová, M.; Janoušek, V.


    Roč. 66, September (2014), s. 271-283 ISSN 0191-8141 Institutional support: RVO:67985831 Keywords : anisotropy of magnetic susceptibility (AMS) * diapir * emplecement * fabric * granite * strain Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.884, year: 2014

  15. Natural Orifice Transluminal Endoscopic Surgery (NOTES) - současný stav, vlastní zkušenosti

    Czech Academy of Sciences Publication Activity Database

    Ryska, O.; Martínek, J.; Doležel, R.; Filípková, T.; Juhás, Štefan; Juhásová, Jana; Zavoral, M.; Ryska, M.


    Roč. 65, č. 5 (2011), s. 264-271 ISSN 1210-7824 R&D Projects: GA MZd NS9994 Institutional research plan: CEZ:AV0Z50450515 Keywords : NOTES * endoscopy * minimal invasive surgery Subject RIV: FJ - Surgery incl. Transplants

  16. Tenure and forest income

    DEFF Research Database (Denmark)

    Jagger, Pamela; Luckert, Martin K.; Duchelle, Amy E.


    We explore the relationship between tenure and forest income in 271 villages throughout the tropics. We find that state-owned forests generate more forest income than private and community-owned forests both per household and per hectare. We explore whether forest income varies according to the e...

  17. Discursive Hierarchical Patterning in Law and Management Cases (United States)

    Lung, Jane


    This paper investigates the differences in the discursive patterning of cases in Law and Management. It examines a corpus of 271 Law and Management cases and discusses the kind of information that these two disciplines call for and how discourses are constructed in discursive hierarchical patterns. A discursive hierarchical pattern is a model…

  18. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Overcoming barriers in the implementation of Mexico's school food regulation. Mexico has one of the highest rates of overweight and obesity in the world. One in three children in the country are overweight and/or obese and one in three children born after 2010 are expected to suffer from diabetes ...

  19. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment (United States)

    D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands


    Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

  20. Reassessing Spin-Coupled (Full Generalized Valence Bond) Descriptions of Ozone Using Three-Center Bond Indices.

    Czech Academy of Sciences Publication Activity Database

    Cooper, D.L.; Penotti, F.E.; Ponec, Robert


    Roč. 1116, Sl (2017), s. 40-49 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : full GVB and spin-coupled * PI-system in O3 * domain-averaged fermi holes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.549, year: 2016

  1. Research Paper ISSN 0189-6016©2009

    African Journals Online (AJOL)

    because some sensitive chewers may experience episodes of increased blood pressure during khat chewing. A study done on Yemeni .... 271. Table 1: The total amount yielded by a solvent-solvent fractionation of the methanol extract (2 g) of Catha edulis. Used fractionation solvent. KL / Yield in mg. KD / Yield in mg.

  2. 75 FR 25271 - Office of Refugee Resettlement; Urgent Single Source Grant to Survivors of Torture International... (United States)


    ... services, SOTI will train area providers to effectively serve this population and leverage resources within... health care providers outside of treatment centers, or programs for the purpose of enabling such providers to provide the services described in paragraph (1).'' Amount of Award: $271,000. Project Period...

  3. Indian Academy of Sciences Conference Series | Indian Academy of ...

    Indian Academy of Sciences (India)

    ... A CERDEIRA4 NEELIMA GUPTE1. Department of Physics, Indian Institute of Technology Madras, Chennai 600036, India; Department of Physics, University of Dschang Cameroon; São Paulo State University (UNESP), Instituto de Física Teórica, Rua Dr. Bento Teobaldo Ferraz 271, Bloco II, 01140-070 São Paulo, Brazil ...

  4. 6Li MAS NMR Study of Lithium Insertion into Hydrothermally Prepared Li-Ti-O Spinel

    Czech Academy of Sciences Publication Activity Database

    Krtil, Petr; Dědeček, Jiří; Kostlánová, Tereza; Brus, Jiří


    Roč. 7, č. 7 (2004), A163-A166 ISSN 1099-0062 R&D Projects: GA ČR GA203/03/0823 Institutional research plan: CEZ:AV0Z4040901 Keywords : lithium insertion * spinel * NMR Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.271, year: 2004

  5. Genital Ulcers and Sexual Transmitted Disease in Rural Nigeria ...

    African Journals Online (AJOL)

    Patients with STDs were clinically assessed and investigated microbiologically, histopathologically and serologically and thereafter reclassified aetiologically. The incidence rate of STDs was 271.3 per 100,000 (.03%) populations per year. Male/female ratio was 1.7:1. The frequency of genital ulcers was 18.9% while that of ...

  6. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 374 ... In Latin America and the Caribbean (LAC) an estimated 300 million city dwellers generate 225 000 tons of solid waste every day (Pan. ... As the presence and influence of information and communication technologies (ICTs) continues to widen and deepen, so too does its impact on economic ...

  7. 76 FR 61746 - Western Digital Technologies, Inc.: Hard Drive Development Engineering Group Irvine (Formerly at... (United States)


    ... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...

  8. How many species of whipworms do we share? Whipworms from man and other primates form two phylogenetic lineages

    Czech Academy of Sciences Publication Activity Database

    Doležalová, J.; Oborník, M.; Hajdušková, E.; Jirků, M.; Petrželková, Klára Judita; Bolechová, P.; Cutillas, C.; Callejon, R.; Jaroš, J.; Beránková, Z.; Modrý, D.


    Roč. 62, č. 063 (2015) ISSN 0015-5683 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Trichuris * phylogeny * diversity * zoonotic potential * humans Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.271, year: 2015

  9. How many species of whipworms do we share? Whipworms from man and other primates form two phylogenetic lineages

    Czech Academy of Sciences Publication Activity Database

    Doležalová, J.; Oborník, Miroslav; Hajdušková, Eva; Jirků, Milan; Petrželková, Klára Judita; Bolechová, P.; Cutillas, C.; Callejón, R.; Jaroš, J.; Beránková, Z.; Modrý, David


    Roč. 62, December 3, 2015 (2015), s. 063 ISSN 1803-6465 R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Trichuris * phylogeny * diversity * zoonotic potential * humans Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.271, year: 2015

  10. PRF

    African Journals Online (AJOL)


    271 from centrifuge tube with tweezer and placed on a sterile gauze piece. Figure 2: (a) Blood drawn into the tube without anticoagulant, (b) Blood centrifuged for 15 min at. 3000rpm, (c) Pliers inserted into the tube to gently grab the fibrin clot with attached. RBC's, (d) platelet rich fibrin. Figure 3: Different layer in centrifuged ...

  11. Production of marker-free and RSV-resistant transgenic rice using a ...

    Indian Academy of Sciences (India)


    Jul 22, 2013 ... Breitler JC, Meynard D, Van Boxtel J, Royer M, Bonnot F,. Cambillau L and Guiderdoni E 2004 A novel two T-DNA binary vector allows efficient generation of marker-free transgenic plants in three elite cultivars of rice (Oryza sativa L.). Trans- genic Res. 13 271–287. Chen PY, Wang CK, Soong SC and To ...

  12. Oxidation of the arsenic-rich concentrate at the Přebuz abandoned mine (Erzgebirge Mts., CZ): mineralogican evolution

    Czech Academy of Sciences Publication Activity Database

    Filippi, Michal


    Roč. 322, 1/3 (2004), s. 271-282 ISSN 0048-9697 Grant - others:EMOZMiD(XX) 79-502 881 Institutional research plan: CEZ:AV0Z3013912 Keywords : arsenic concentrate * oxidation * arsenopyrite Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.925, year: 2004

  13. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8494 ... IDRC supported five regional consultations to explore the role of think tanks and academic institutions in the SDG implementation and monitoring. Published date. September ... in Sub-Saharan Africa. What limits women's ability to become financially self-sufficient from an early age in Africa? Project ...

  14. Vaccinia complement control protein: Multi-functional protein and a ...

    Indian Academy of Sciences (India)


    molecule and potential drug. [Jha P and Kotwal G J 2003 Vaccinia complement control protein: Multi-functional protein and a potential wonder drug; J. Biosci. 28 265–271]. 1. Introduction. The pathogen-host interaction is a dynamic phenomenon which involves generation of defense mechanism by host and its evasion by ...

  15. Highlights of the 30th International Conference on Antiviral Research

    Czech Academy of Sciences Publication Activity Database

    Andrei, G.; Carter, K.; Janeba, Zlatko; Sampath, A.; Schang, L. M.; Tarbet, E. B.; Vere Hodge, R. A.; Bray, M.; Esté, J. A.


    Roč. 145, Sep (2017), s. 184-196 ISSN 0166-3542 Institutional support: RVO:61388963 Keywords : chronic hepatitis C * dengue virus * in vitro Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

  16. A decision support framework for extension of time claims for the ...

    African Journals Online (AJOL)

    Third parties or incidents beyond the control of the client and the contractor, and ... 2.3 Critical delays. According to Pickavance (2000: 218-271), a delay in progress is not the same as a delay in completion. A delay in progress is a significant shift in the ... techniques and critical-path method-based techniques) and different ...

  17. Latest results from CERES/NA45

    Czech Academy of Sciences Publication Activity Database

    Wessels, JP.; Adamová, Dagmar; Agakichiev, G.; Appelshäuser, H.; Braun-Munzinger, P.; Campagnolo, R.; Castillo, A.D.S.; Dietel, T.D.L.; Drees, A.; Esumi, S. I.; Filomonov, K.; Fomenko, K.; Fraenkel, Z.; Garabatos, C.; Glässel, P.; Hering, G.; Holeczek, J.; Kushpil, Vasilij; Lenkeit, B.; Ludolphs, W.; Maas, A.; Marín, A.; Messer, F.; Milošević, J.; Milov, A.; Miśkowiec, D.; Musa, L.; Panebrattsev, Yu.; Petchenova, O.; Petráček, Vojtěch; Pfeiffer, A.; Rak, J.; Ravinovich, I.; Rehak, P.; Richter, M.; Sako, H.; Schmitz, W.; Schukraft, J.; Sedykh, S.; Seipp, W.; Sharma, A.; Shimansky, S.; Slívová, J.; Specht, H. J.; Stachel, J.; Šumbera, Michal; Tilsner, H.; Tserruya, I.; Wienold, T.; Windelband, B.; Wurm, J.P.; Xie, W.; Yurevich, S.; Yurevich, V.


    Roč. 715, - (2003), s. 262C-271C ISSN 0375-9474 R&D Projects: GA ČR GA202/03/0879 Institutional research plan: CEZ:AV0Z1048901 Keywords : Pb-Au collisions * pair production Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.761, year: 2003

  18. Impact of the PPAR gamma-2 gene polymorphisms on the metabolic ...

    Indian Academy of Sciences (India)

    The relationship Pro12Ala (rs1801282) and C1431T (rs3856806) polymorphisms of PPAR gamma-2 with glucose and lipid metabolism is not clear after menopause. We investigated the impact of the Pro12Ala and C1431T silentsubstitution in the 6th exon in PPAR gamma-2 gene on nutritional and metabolic status in 271 ...

  19. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.


    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  20. Understanding Collagen Organization in Breast Tumors to Predict and Prevent Metastasis (United States)


    Dschietzig et al., “The pregnancy hormone relaxin binds to and acti- vates the human glucocorticoid receptor,” Ann. N. Y. Acad. Sci. 1041, 256–271...more fibrous, such as pancreatic cancer. Conclusions In summary, we have identified the F/B, a simple and easily automated, intensity-based

  1. 41 CFR 101-27.101 - General. (United States)


    ... FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 101-27.101 General. Each agency shall establish and maintain such control of personal property inventories as will assure that the total cost involved will be kept to the minimum consistent with program...

  2. Aquifers and municipal sewage: controlled infiltration. Los acuiferos y las aguas residuales urbanas : la inflitracion controlada

    Energy Technology Data Exchange (ETDEWEB)

    Nieto, P. (Instituto Geologico y Minero de Espana, Madrid (Spain))


    A wide scope on the possible integration of controlled infiltration, in a systematic way, is provided. This method is included in the new National Program required by the European Directive 91/271/CEE. The main characteristics of municipal sewage and aquifers where this techniques might be applied are given. (Author)

  3. 77 FR 47797 - Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9713-2] Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  4. 76 FR 19004 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9290-9] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  5. 78 FR 32223 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0821; 9817-5] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental Protection Agency (EPA... changes to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA...

  6. 77 FR 38566 - Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA--R06-RCRA-2012-0367; FRL-9692-6] Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  7. 78 FR 54200 - Virginia: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2012-0294; FRL-9900-37-Region3] Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... of revisions to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA...

  8. 76 FR 37048 - Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9323-8] Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  9. 77 FR 15343 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0054; FRL-9647-8] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  10. 77 FR 13248 - Texas: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2011-0478; FRL-9642-5] Texas: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental Protection Agency (EPA... changes to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA...

  11. 78 FR 15338 - New York: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R02-RCRA-2013-0144; FRL-9693-3] New York: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of changes to its hazardous waste program under the Solid Waste Disposal Act, as amended, commonly...

  12. 76 FR 44376 - Vermont Yankee Nuclear Power Station; Notice of Withdrawal of Application for Amendment to... (United States)


    ... NUCLEAR REGULATORY COMMISSION [Docket No. 50-271, NRC-2011-0168] Vermont Yankee Nuclear Power... Regulatory Commission (NRC or the Commission) has granted the request of Vermont Yankee Nuclear Power Station... Operating License No. DPR-28 for the Vermont Yankee Nuclear Power Station, located in Vernon, Vermont. The...

  13. 75 FR 12311 - Entergy Nuclear Operations, Inc; Vermont Yankee Nuclear Power Station Environmental Assessment... (United States)


    ...; Vermont Yankee Nuclear Power Station Environmental Assessment and Finding of No Significant Impact The U.S... licensee), for operation of Vermont Yankee Nuclear Power Station (Vermont Yankee), located in Windham... Statement for Vermont Yankee Nuclear Power Station, Docket No. 50-271, dated July 1972, as supplemented...

  14. Confocal microscopy of chloroplast morphology and ontogeny in three strains of Dictyochloropsis (Trebouxiophyceae, Chlorophyta)

    Czech Academy of Sciences Publication Activity Database

    Škaloud, P.; Neustupa, J.; Radochová, Barbora; Kubínová, Lucie


    Roč. 44, č. 3 (2005), s. 261-269 ISSN 0031-8884 Grant - others:FRVŠ(CZ) 2826/2003; IGA MŠk(CZ) 139/2002/B Institutional research plan: CEZ:AV0Z5011922 Keywords : chloroplast ontogeny * confocal microscopy * Dichtyochloropsis Subject RIV: EF - Botanics Impact factor: 1.271, year: 2005

  15. New and noteworthy bird records from the Mt. Wilhelm elavational gradient, Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Marki, P. Z.; Sam, Kateřina; Koane, B.; Kristensen, J. B.; Kennedy, J. D.; Jonsson, K. A.


    Roč. 136, č. 4 (2016), s. 263-271 ISSN 0007-1595 R&D Projects: GA ČR(CZ) GP14-32024P Institutional support: RVO:60077344 Keywords : bird records * Mt. Wilhelm * Papua New Guinea Subject RIV: EG - Zoology

  16. The Structure of a Rhodium/Titania Catalyst in the Strong Metal-Support Interaction State as Determined by EXAFS

    NARCIS (Netherlands)

    Koningsberger, D.C.; Martens, J.H.A.; prins, R.; Short, D.R.; Sayers, D.E.


    Reduction of a highly dispersed 2.85 wt % Rh/Ti02 catalyst at 473 K after previous calcination at 623 K resulted in EXAFS whose primary contributions are due to nearest rhodium (average coordination number of 3.1 and distance of 2.67 A) and oxygen neiphbors (coordination 2.5 and distance 2.71 A).

  17. Experience of parental cancer in childhood is a risk factor for psychological distress during genetic cancer susceptibility testing

    NARCIS (Netherlands)

    van Oostrom, I.; Meijers-Heijboer, H.; Duivenvoorden, H. J.; Bröcker-Vriends, A. H. J. T.; van Asperen, C. J.; Sijmons, R. H.; Seynaeve, C.; van Gool, A. R.; Klijn, J. G. M.; Tibben, A.


    This study explores the effect of age at the time of parental cancer diagnosis or death on psychological distress and cancer risk perception in individuals undergoing genetic testing for a specific cancer susceptibility. Cancer-related distress, worry and risk perception were assessed in 271

  18. K Ramesha

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Ramesha. Articles written in Bulletin of Materials Science. Volume 34 Issue 2 April 2011 pp 271-277. Synthesis of new (Bi, La)3MSb2O11 phases (M = Cr, Mn, Fe) with KSbO3-type structure and their magnetic and photocatalytic properties · K Ramesha A S Prakash M Sathiya ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 271 ... Vol 7, No 2 (2008), Secondary sinusitis in a 7-year-old Part-Barb mare, Abstract PDF. WP Mshelia, II Onoja, A Andrew, Q Oparah, M Isiyaku. Vol 9, No 2 (2011), Serodiagnosis of hydatidosis in sheep slaughtered at Sokoto abattoir, Sokoto state, Nigeria, Abstract PDF. MA Saulawa, AA Magaji, OO ...

  20. Development of the Ethmoidal Structures of the Endocranium in Discoglossus pictus (Anura: Discoglossidae)

    Czech Academy of Sciences Publication Activity Database

    Královec, K.; Roček, Zbyněk; Žáková, P.; Mužáková, V.


    Roč. 271, č. 9 (2010), s. 1078-1093 ISSN 0362-2525 Institutional research plan: CEZ:AV0Z30130516 Keywords : Anura * Discoglossidae * Discoglossus * development * cranium Subject RIV: EA - Cell Biology Impact factor: 1.773, year: 2010

  1. Extension needs in quail farming in Imo State, Nigeria | Iwuchukwu ...

    African Journals Online (AJOL)

    ... to information on how to rear quail” (M= 2.71).The study recommended the need to boost research on quail production so that extension workers, farmers and consumers will appreciate the importance of this livestock and enjoy it”s nutritional and economic benefits. Key words: extension needs quail farming Imo State ...

  2. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Usha N Bhosle. Articles written in Proceedings – Mathematical Sciences. Volume 111 Issue 3 August 2001 pp 271-291. Principal -bundles on Nodal Curves · Usha N Bhosle · More Details Abstract Fulltext PDF. Let be a connected semisimple affine algebraic ...

  3. Human Repsonse to Sonic Booms: A Research Program Plan (United States)


    Physiol. 144, 331. Field, H., 1967. "Responses of Newborns to Auditory Stimulation," J. Auditory Res. 7, 271. Finkle, A. and Poppen, J...Mellville, K.I., Blum, B., Shister, H.E., and Silver, M.D., 1963. "Cardiac Ischemic Changes and Arrhythmias Induced by Hypo- thalamic Stimulation," Amer

  4. Teachers' Mastery Goals: Using a Self-Report Survey to Study the Relations between Teaching Practices and Students' Motivation for Science Learning (United States)

    Vedder-Weiss, Dana; Fortus, David


    Employing achievement goal theory (Ames "Journal of Educational psychology," 84(3), 261-271, 1992), we explored science teachers' instruction and its relation to students' motivation for science learning and school culture. Based on the TARGETS framework (Patrick et al. "The Elementary School Journal," 102(1), 35-58, 2001) and…

  5. Koncept polyfokálních sídel na příkladu vývoje obce Opařany na Táborsku

    Czech Academy of Sciences Publication Activity Database

    Dohnal, Martin


    Roč. 38, č. 2 (2012), s. 271-298 ISSN 0323-0988 R&D Projects: GA ČR(CZ) GAP410/11/1287 Keywords : urbanism * medieval settlement * Early Modern settlement * polyfocal settlement * 1400-1900 * Opařany (district of Tábor) Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. 40 CFR 61.273 - Alternative means of emission limitation. (United States)


    ... full-size or scale-model storage vessels that accurately collect and measure all benzene emissions from... for Benzene Emissions From Benzene Storage Vessels § 61.273 Alternative means of emission limitation... achieved by the requirements of § 61.271 (a), (b), or (c) will be evaluated using the following information...

  7. 75 FR 13151 - In the Matter of the Applications of EDGX Exchange, Inc., and EDGA Exchange, Inc. for... (United States)


    ...) (revising the U.S. Exchange Holdings Certificate, the U.S. Exchange Holdings Bylaws, and the Trust Agreement... participation of SFBC.\\25\\ \\21\\ See note 13, supra. \\22\\ In particular, Art. 271 of the Swiss penal code... 19(h) of the Act, 15 U.S.C. 78s(h). [[Page 13154

  8. Partial melting of metavolcanics in amphibolite facies regional ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Petrol. 12 25–62. Holdaway M J 1971 Stability of andalusite and the alu- minum silicate phase diagram; Am. J. Sci.; 271, 97–131. Hollocher K 1985 Geochemistry of metamorphosed vol- canic rocks in the Middle Ordovician Partridge Forma- tion, and amphibole dehydration reactions in the high-grade metamorphic zones of ...

  9. Morphological traits in nitrogen fixing heterocytous cyanobacteria: possible links between morphology and eco-physiology.

    Czech Academy of Sciences Publication Activity Database

    Pinto, P. D.; Kust, Andreja; Devercelli, M.; Kozlíková-Zapomělová, Eliška


    Roč. 764, č. 1 (2016), s. 271-281 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GA14-18067S Institutional support: RVO:60077344 Keywords : traits * heterocyte * akinete * shape * size * phytoplankton Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.056, year: 2016

  10. A Military Relevant Model of Closed Concussive Head Injury: Longitudinal Studies Characterizing and Validating Single and Repetitive mTBI (United States)


    metabolic homeostasis associated with repeated concussion versus a single concussion. More specifically, 3×PCIs resulted in increased levels of glycogen ...carnosine is an endogenous neuroprotector against free radicals. Cell Mol Neurobiol, 17(2), 259-271. 3. Borges, N., Cerejo, A., Santos, A., Sarmento, A

  11. Cohomology of line bundles on Schubert varieties: The rank two case

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Math. 33 (1976) 271–272. [3] Jantzen J C, Representations of algebraic groups, Pure Appl. Math. (Florida: Academic. Press) (1987) vol. 131. [4] Paramasamy K, Thesis, Cohomology of line bundles on Schubert varieties (submitted to the University of Madras) (2004). [5] Sai-Ping Li, Moody R V, Nicolescu M and Patera J, ...

  12. Genetic, Biochemical and Environmental Factors Associated with Pregnancy Outcomes in Newborns from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rössner ml., Pavel; Tabashidze, Nana; Dostál, Miroslav; Nováková, Zuzana; Chvátalová, Irena; Špátová, Milada; Šrám, Radim


    Roč. 119, č. 2 (2011), s. 265-271 ISSN 0091-6765 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390512 Keywords : air pollution * biomarkers * genetic polymorphisms Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.036, year: 2011

  13. Design and implementation of monitoring and evaluation of healthcare organization management (United States)

    Charalampos, Platis; Emmanouil, Zoulias; Dimitrios, Iracleous; Lappa, Evaggelia


    The management of a healthcare organization is monitored using a suitably designed questionnaire to 271 nurses operating in Greek hospital. The data are fed to an automatic data mining system to obtain a suitable series of models to analyse, visualise and study the obtained information. Hidden patterns, correlations and interdependencies are investigated and the results are analytically presented.

  14. Forms of vibration and structural changes in liquid state

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, B.; Šesták, Jaroslav; Koudelka, L.; Mošner, P.; Mareš, Jiří J.


    Roč. 80, - (2005), s. 271-283 ISSN 1388-6150 Institutional research plan: CEZ:AV0Z10100521 Keywords : crossover temperature * deterministic chaos * glass transition * non-linear oscillators * solid-liquid transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.425, year: 2005

  15. The molecular structure of N-fluorobis(trifluoromethanesulfonyl)imide, NF(SO2CF3)(2), as studied in the gas phase by electron diffraction restrained by ab initio calculations

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Brain, P. T.; Rankin, D. W. H.; Robertson, H. E.; Smart, B. A.; Banks, R. E.; Murtagh, V.

    -, č. 2 (2007), s. 265-271 ISSN 1477-9226 Grant - others:EPSRC(GB) GR/J59258 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystalline phases * fluorination * sulfone Subject RIV: CA - Inorganic Chemistry Impact factor: 3.212, year: 2007

  16. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Reducing dietary related risks associated with non-communicable diseases in Bangladesh. Bangladesh ... High salt diets are a major cause of high blood pressure, a leading risk factor for death, and account for close to two-thirds of strokes and one-half of heart disease incidents worldwide. Project ...

  17. Hypolipidemic effect of beer proteins in experiment on rats

    Czech Academy of Sciences Publication Activity Database

    Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.


    Roč. 35, č. 3 (2002), s. 265-271 ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

  18. Centrality dependence of charged jet production in p–Pb collisions at root s(NN)=5.02 TeV

    Czech Academy of Sciences Publication Activity Database

    Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Contreras, J. G.; Eyyubova, G.; Ferencei, Jozef; Horák, D.; Křížek, Filip; Kučera, Vít; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Schulc, M.; Špaček, M.; Šumbera, Michal; Vaňát, Tomáš; Závada, Petr


    Roč. 76, č. 5 (2016), s. 271 ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG15052 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * production Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 5.331, year: 2016

  19. 77 FR 3756 - Nevada Irrigation District; Notice of Application Accepted for Filing, Soliciting Motions To... (United States)


    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2266-102] Nevada Irrigation... Major License. b. Project No.: 2266-102. c. Date filed: April 15, 2011. d. Applicant: Nevada Irrigation... Irrigation District, 1036 West Main Street, Grass Valley, CA 95945, (530) 271-6824 or email [email protected

  20. Fast-track surgery for bilateral total knee replacement

    DEFF Research Database (Denmark)

    Husted, H; Troelsen, A; Otte, K S


    Bilateral simultaneous total knee replacement (TKR) has been considered by some to be associated with increased morbidity and mortality. Our study analysed the outcome of 150 consecutive, but selected, bilateral simultaneous TKRs and compared them with that of 271 unilateral TKRs in a standardised...

  1. Ultrastructure of the anterior organ and posterior funnel-shaped canal of Gyrocotyle urna Wagener, 1852 (Cestoda: Gyrocotylidea)

    Czech Academy of Sciences Publication Activity Database

    Poddubnaya, L. G.; Kuchta, Roman; Bristow, G.A.; Scholz, Tomáš


    Roč. 62, 2015 May 22 (2015), 027 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : scanning electron microscopy * transmission electron microscopy * basal cestodes * ultrastructural characters * phylogeny Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  2. Tropical Trametes lactinea is widely distributed in the eastern USA

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Kout, J.


    Roč. 115, č. 1 (2011), s. 271-279 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Keywords : Basidiomycota, USA new record, taxonomy * USA new record * taxonomy Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  3. 48 CFR 1371.104 - Schedule of work. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Schedule of work. 1371.104 Section 1371.104 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL... of work. Insert clause 1352.271-73, Schedule of Work, in all solicitations and contracts for ship...

  4. Zoonotic mosquito-borne flaviviruses: worldwide presence of agents with proven pathogenicity and potential candidates of future emerging diseases

    Czech Academy of Sciences Publication Activity Database

    Weissenböck, H.; Hubálek, Zdeněk; Bakonyi, T.; Nowotny, N.


    Roč. 140, 3-4 (2010), s. 271-280 ISSN 0378-1135 Institutional research plan: CEZ:AV0Z60930519 Keywords : Flaviviridae * mosquitoes * Culicidae * zoonoses * arboviruses Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.256, year: 2010

  5. Socio-Demographic and Maternal Factors in Anaemia in Pregnancy ...

    African Journals Online (AJOL)

    Low educational attainment [Adjusted Odds Ratio (AOR)=2.13], being single or divorced [AOR=2.02], high parity [AOR=2.06], late booking [AOR=2.71] and short intervals between pregnancies [AOR=2.37] were significant predictors of anaemia in pregnancy. The high prevalence of anaemia in pregnancy related to low ...

  6. 78 FR 32161 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision (United States)


    ... Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA... waste management program. We authorized the following revisions: Oklahoma received authorization for... authorization of its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management...

  7. 76 FR 18927 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision (United States)


    ...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act (``OHWMA'') provides the ODEQ with...

  8. 78 FR 70255 - West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2013-0571; FRL-9903-07-Region 3] West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY... final authorization of revisions to its hazardous waste program under the Resource Conservation and...

  9. 78 FR 43842 - State of Kansas; Authorization of State Hazardous Waste Management Program (United States)


    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R07-RCRA-2013-0447; FRL-9833-6] State of Kansas; Authorization of State Hazardous Waste Management Program AGENCY: Environmental Protection Agency... its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA proposes to...

  10. 75 FR 9345 - Michigan: Final Authorization of State Hazardous Waste Management Program Revision (United States)


    ...] Michigan: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental..., 1986 (51 FR 36804-36805), to implement the RCRA hazardous waste management program. We granted... accordance with 40 CFR 271.21. We have determined that Michigan's hazardous waste management program revision...

  11. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert


    Roč. 747, JUL (2015), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.787, year: 2015

  12. Macroparasites and their communities of the European eel Anguilla anguilla (Linnaeus) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Scholz, Tomáš


    Roč. 62, JUN 30 2015 (2015), 033 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Central Europe * Danube River basin * Elbe River basin * Oder River basin * fish * host specificity * parasite fauna * species diversity Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  13. Reaction enthalpies of Osingle bondH bonds splitting-off in flavonoids: The role of non-polar and polar solvent

    Czech Academy of Sciences Publication Activity Database

    Vagánek, A.; Rimarčík, J.; Dropková, K.; Lengyel, Jozef; Klein, E.


    Roč. 1050, DEC 2014 (2014), s. 31-38 ISSN 2210-271X R&D Projects: GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : flavonoids * polyphenols * antioxidants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

  14. Method for phenotypic detection of extended-spectrum beta-lactamases in enterobacter species in the routine clinical setting

    NARCIS (Netherlands)

    Stuart, J.C.; Diederen, B.; Al Naiemi, N.; Fluit, A.; Arents, N.; Thijsen, S.; Vlaminckx, B.; Mouton, J.W.; Leverstein-van Hall, M.


    In 271 Enterobacter blood culture isolates from 12 hospitals, extended-spectrum beta-lactamase (ESBL) prevalence varied between 0% and 30% per hospital. High prevalence was associated with dissemination, indicating the potential relevance of infection control measures. Screening with cefepime or

  15. Impact of Supernova and Cosmic-Ray Driving on the Surface Brightness of the Galactic Halo in Soft X-Rays

    Czech Academy of Sciences Publication Activity Database

    Thomas, P.; Girichidis, P.; Gatto, A.; Naab, T.; Walch, S.; Wünsch, Richard; Glover, S.C.O.; Clark, P.C.; Klessen, R.S.; Baczynski, C.


    Roč. 813, č. 2 (2015), L27/1-L27/7 ISSN 2041-8205 R&D Projects: GA ČR GAP209/12/1795 Institutional support: RVO:67985815 Keywords : galaxy halo * ISM kinematics and dynamics * stars formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.487, year: 2015

  16. The rise and fall of Czech post-dissident liberalism after 1989

    Czech Academy of Sciences Publication Activity Database

    Kopeček, Michal


    Roč. 25, č. 2 (2011), s. 244-271 ISSN 0888-3254 R&D Projects: GA ČR GA409/07/1189 Institutional research plan: CEZ:AV0Z80630520 Keywords : legacy of dissidence * liberalism * politics of history Subject RIV: AB - History Impact factor: 0.396, year: 2011

  17. Water stress induced changes in antioxidant enzymes, membrane ...

    African Journals Online (AJOL)



    Dec 1, 2009 ... reduction in chloroplasts (Robinson and Bunce, 2000). In fact it has been reported that much of the injury to plants caused by exposure to various ...... stress on soybean and spinach leaf ascorbate-dehydroascorbate level and redox status. Int. J. Plant Sci. 161:271-279. Sairam RK (1994). Effect of moisture ...

  18. Experimental investigation of Reykjavik city footbridge

    DEFF Research Database (Denmark)

    Zivanovic, Stana; Ingólfsson, Einar Thór; Pavic, Aleksandar


    This study describes experimental investigation of a 160 m long footbridge in Reykjavik. The bridge is a continuous post tensioned concrete beam spanning eight spans, the longest being 27.1 m. In plan, the structure has eye-catching spiral shape. Modal testing of the structure was conducted...

  19. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  20. hca: an Arabidopsis mutant exhibiting unusual cambial activity and altered vascular patterning

    Czech Academy of Sciences Publication Activity Database

    Pineau, C.; Amandine, F.; Ranocha, P.; Jauneau, A.; Turner, S.; Lemonnier, G.; Renou, J.P.; Tarkowski, Petr; Sandberg, G.; Jouanin, L.; Sundberg, B.; Boudet, A.M.; Goffner, D.; Pichon, M.


    Roč. 44, č. 2 (2005), s. 271-289 ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis thaliana * cambium * secondary xylem Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.969, year: 2005

  1. Novedades en el diccionario (New Additions to the Dictionary) (United States)

    Carnicer, Ramon


    A total of 271 items--words, phrases and affixes--were added to the common Spanish dictionary in the period between October and December 1974. This article lists the principal additions, each organized within a larger semantic category. (Text is in Spanish.) (TL)

  2. Scientific and technical challenges in remote sensing of plant canopy reflectance and fluorescence

    Czech Academy of Sciences Publication Activity Database

    Malenovský, Z.; Mishra, Kumud; Zemek, František; Rascher, U.; Nedbal, Ladislav


    Roč. 10, č. 60 (2009), s. 2987-3004 ISSN 0022-0957 R&D Projects: GA MZe QH92034; GA MŠk OC09001 Institutional research plan: CEZ:AV0Z60870520 Keywords : Chlorophyll fluorescence * optical remote sensing * photosynthesis dynamics * reflectance Subject RIV: GK - Forestry Impact factor: 4.271, year: 2009

  3. Book Review | Dawka | Internet Journal of Medical Update ...

    African Journals Online (AJOL)

    An Introduction to Medical Teaching by Kathryn N Huggett and William B Jeffries Publisher: Springer International Publishing, Year 2014, 271 pages. Format: PDF and EPUB, Hardcover ISBN 978-94-017-9065-9. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

  4. 46 CFR 199.640 - Alternatives for cargo vessels in a specified service. (United States)


    ... 199.640(g) or 199.640(h). 199.271: Lifebuoy quantity No Alternative 199.640(i) 199.640(i) 199.640(i... specified in table 199.640(i) of this section; or (2) If the vessel is non self-propelled, one lifebuoy on...

  5. Food contamination with salmonella and human health in Kinshasa ...

    African Journals Online (AJOL)



    Oct 31, 2015 ... Objectives: The objective of this study was to assess the level of salmonella contamination of fish and meat .... The prevalence of. Salmonella contamination for beef carcasses at the public abattoir was 27.5% (Table 4) with a mean value of 5.76 ± 2.71 log10 .... Listeria and Enteric bacteria of public health.

  6. Effect of a N, N’-disubstituted phenylenediamine stabilizer and SB/EPDM compatibilizer on toughness and morphology of blends of pre-aged polyethylene with high-impact polystyrene

    Czech Academy of Sciences Publication Activity Database

    Michálková, Danuše; Pospíšil, Jan; Fortelný, Ivan; Šlouf, Miroslav; Kruliš, Zdeněk


    Roč. 12, č. 22 (2006), s. 58-65 ISSN 0193-7197 R&D Projects: GA AV ČR IBS4050008 Institutional research plan: CEZ:AV0Z40500505 Keywords : recycling * compatibilization * stabilization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.271, year: 2005

  7. Balones que inspiran

    Directory of Open Access Journals (Sweden)

    Daniel Samper Pizano


    Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

  8. Biochemical evidence for the activation of distinct subsets of mitogen-activated protein kinases by voltage and defense-related stimuli

    Czech Academy of Sciences Publication Activity Database

    Link, V.; Hofmann, M.; Sinha, A.; Ehness, R.; Strnad, Miroslav; Roitsch, T.


    Roč. 128, č. 1 (2002), s. 271-281 ISSN 0032-0889 R&D Projects: GA MŠk OC 844.10 Institutional research plan: CEZ:AV0Z5038910 Keywords : TOBACCO SUSPENSION CULTURE * CYCLIN DEPENDENT KINASES * CYTOSOLIC CALCIUM ION Subject RIV: CE - Biochemistry Impact factor: 5.800, year: 2002

  9. Calorie Restriction on Drinking Days: An Examination of Drinking Consequences among College Students (United States)

    Giles, Steven M.; Champion, Heather; Sutfin, Erin L.; McCoy, Thomas P.; Wagoner, Kim


    Objective: This study examined the association between restricting calories on intended drinking days and drunkenness frequency and alcohol-related consequences among college students. Participants: Participants included a random sample of 4,271 undergraduate college students from 10 universities. Methods: Students completed a Web-based survey…

  10. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Regulation of Food and Beverage Advertising and Marketing in India. Foods and beverages rich in salt, sugar, calories, and saturated fats, but deficient in micronutrients, have flooded Indian food markets. Indian consumers are showing an increased preference for them.

  11. The burden of gunshot injuries on orthopaedic healthcare resources ...

    African Journals Online (AJOL)

    Additionally, SA lacks a public national injury surveillance system to track fatal and .... Instead, the hospital allocates collective budgets rather than disaggregated ... Guatemala. 34.8. Saint Kitts and Nevis. 32.4. Trinidad and Tobago. 27.3. Colombia. 27.1. Belize. 21.8. Puerto Rico. 18.3. Brazil. 18.1. Dominican Republic. 16.3.

  12. Water SA - Vol 28, No 3 (2002)

    African Journals Online (AJOL)

    The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. ...

  13. An animal model of nonconvulsive status epilepticus: a contribution to clinical controversies

    Czech Academy of Sciences Publication Activity Database

    Kršek, Pavel; Mikulecká, Anna; Druga, Rastislav; Hliňák, Zdeněk; Kubová, Hana; Mareš, Pavel


    Roč. 42, č. 2 (2001), s. 171-180 ISSN 0013-9580 R&D Projects: GA ČR GA309/97/0552; GA AV ČR IAA7011603 Institutional research plan: CEZ:AV0Z5011922 Keywords : complex partial status epilepticus * pilocarpine * epileptic brain damage Subject RIV: ED - Physiology Impact factor: 3.271, year: 2001

  14. Journal of the Royal Naval Scientific Service. Volume 29, Number 5 (United States)


    International Con- ference on CAD, Southampton University, Apr. 1969. Talbot. G. P. and Acland -Hood, E. P. Computer Drawing of Gun Rules and Fuze...Indicators. RARDE Report 2/71. Talbot, G. P. and Acland -Hood, E. P. Computer Drawing of GFT Ballistic Slide Rules. RARDE Memo. 23/71. Gawlik, H. J. MIRA

  15. A telepsychiatry model to support psychiatric outreach in the public ...

    African Journals Online (AJOL)

    Chipps J, Ramlall S, Mars M. Practice Guidelines for. Videoconference-Based Telepsychiatry in South Africa. Afr J. Psychiatry 2012;15(4)271-282. 36. Kavanagh S, Hawker F. The fall and rise of the South Australian telepsychiatry network. J Telemed Telecare 2001;7 Suppl 2:41-43. 37. Grady B, Singleton M. Telepsychiatry ...

  16. Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.


    Roč. 591, Sep (2015), s. 271-275 ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.761, year: 2015

  17. 77 FR 52252 - Defense Federal Acquisition Regulation Supplement: Inflation Adjustment of Threshold for... (United States)


    ... inflation adjustment in accordance with the requirements of 41 U.S.C. 1908. One respondent submitted a... respondent concurred with the inflation threshold increase listed at DFARS 212.271. There were no comments... and safety effects, distributive impacts, and equity). E.O. 13563 emphasizes the importance of...

  18. High-power asymptotics of some weighted harmonic Bergman kernels

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav


    Roč. 271, č. 5 (2016), s. 1243-1261 ISSN 0022-1236 Institutional support: RVO:67985840 Keywords : Bergman kernel * harmonic Bergman kernel * asymptotic expansion Subject RIV: BA - General Mathematics Impact factor: 1.254, year: 2016

  19. Beliefs, Fertility, and Earnings of African American, Hispanic, and Non-Hispanic White Mothers (United States)

    Keil, Jacqueline M.; Christie-Mizell, C. Andre


    This study explores gender ideology, fertility factors (e.g., age at first birth, number of children), and their effects on earnings of African American (n = 413), Hispanic American (n = 271), and White (n = 817) mothers. An analysis of data from the National Longitudinal Survey of Youth over a 10-year period (1988 to 1998) shows that, on average,…

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The relationship Pro12Ala (rs1801282) and C1431T (rs3856806) polymorphisms of PPAR gamma-2 with glucose and lipid metabolism is not clear after menopause. We investigated the impact of the Pro12Ala and C1431T silentsubstitution in the 6th exon in PPAR gamma-2 gene on nutritional and metabolic status in 271 ...

  1. 5-year results comparing mineral trioxide aggregate and adhesive resin composite for root-end sealing in apical surgery

    DEFF Research Database (Denmark)

    von Arx, Thomas; Hänni, Stefan; Jensen, Simon Storgård


    observers). Two different methods of root-end preparation and filling (primary study parameters) were to be compared (mineral trioxide aggregate [MTA] vs adhesive resin composite [COMP]) without randomization. RESULTS: A total of 271 patients and teeth from a 1-year follow-up sample of 339 could be re...

  2. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Scaling Up and Evaluating Salt Reduction Policies and Programs in Latin American Countries. High salt diets are a major cause of high blood pressure, a leading risk factor for death, and account for close to two-thirds of strokes and one-half of heart disease incidents worldwide. Project.

  3. 503-IJBCS-Article-Prof Ag Michele Ake

    African Journals Online (AJOL)


    Vitamine B1. In. Les Vitamines: Données Biochimiques,. Nutritionnelles et Cliniques. Roche: Paris; 107-142. Majumdar SK, Shaw GK, O'Gorman P, Aps. EJ, Offermann EL, Thomson AD. 1982. Blood vitamin status (B1, B2, B6, folic acid and B12) in patients with alcoholic liver disease. Int. J. Vit. Nutr. Res., 52(3):. 266 - 271.

  4. Optimization of the Co-Digestion of Catch Crops with Manure Using a Central Composite Design and Reactor Operation

    DEFF Research Database (Denmark)

    Molinuevo-Salces, Beatriz; Ahring, Birgitte Kiær; Uellendahl, Hinrich


    This study investigates the effect of catch crops as co-substrate on manure-based anaerobic digestion. Batch experiments were carried out for two catch crops, namely Italian ryegrass (IR) and oil seed radish (OSR), in co-digestion with manure. Methane yields in the range of 271–558 and 216–361 ml...

  5. Effects of Physical Training in Military Populations: A Meta-Analytic Summary (United States)


    average. An SPSS syntax program was constructed to implement Borenstein et al.’s (2009) procedures. Program accuracy was verified by repeating the...34(3), 271–278. *Males, B., Sekulic, D., & Katic, R. (2004). Morphological and motor-endurance changes are highly related in Croatian Navy male

  6. Intestinal obstruction in a child with an exceptional ascaris burden ...

    African Journals Online (AJOL)

    Intestinal obstruction in a child with an exceptional ascaris burden - a case report. E A Agbakwuru, O Akinola, O Adejuyigbe, E O Komolafe. Abstract. No Abstract. NQJHM Vol. 8 (4) 1998: pp. 270-271. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  7. Adapting prior knowledge activation: Mobilisation, perspective taking, and learners' prior knowledge

    NARCIS (Netherlands)

    Wetzels, Sandra; Kester, Liesbeth; Van Merriënboer, Jeroen


    Wetzels, S. A. J., Kester, L., & Van Merriënboer, J. J. G. (2011). Adapting prior knowledge activation: Mobilisation, perspective taking, and learners’ prior knowledge [Special issue]. Computers in Human Behavior, 27(1), 16-21. doi: 10.1016/j.chb.2010.05.004


    African Journals Online (AJOL)


    Association classes 3 and 4 (82.9% vs 27.1%). Patients with. MRD had echocardiographic findings of a significantly larger left atrial dimension, lower ejection fraction and fractional shortening and shorter deceleration time. A significantly greater proportion of patients with mild renal disease also had moderate- severe mitral ...

  9. Single-Molecule Manipulation of Double-Stranded DNA Using Optical Tweezers: Interaction Studies of DNA with RecA and YOYO-1

    NARCIS (Netherlands)

    Bennink, Martin L.; Scharer, Orlando D.; Kanaar, Ronald; Sakata-Sogawa, Kumiko; Schins, J.M.; Kanger, Johannes S.; de Grooth, B.G.; Greve, Jan


    By using optical tweezers and a specially designed flow cell with an integrated glass micropipette, we constructed a setup similar to that of Smith et al. (Science 271:795-799, 1996) in which an individual double-stranded DNA (dsDNA) molecule can be captured between two polystyrene beads. The first

  10. Why is the Bond Multiplicity in C2 so Elusive?

    Czech Academy of Sciences Publication Activity Database

    Cooper, D.L.; Penotti, F.E.; Ponec, Robert


    Roč. 1053, SI (2015), s. 189-194 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : bond multiplicity in C2 * spin correlation matrices * full GVB and spin-coupled Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015

  11. The Effect of Coping Knowledge on Emergency Preparedness in Elementary School Students (United States)

    Kim, Shin-Jeong; Kang, So-Ra; Lee, Seung-Hee; Kang, Kyung-Ah


    The purpose of this study was to examine the effect of coping knowledge for emergency preparedness in Korean elementary school students. A school-based coping education program was provided seven times to 271 fourth- and fifth-grade students in two urban schools by researchers with the school nurses. The Process Model of Stress and Coping and…

  12. Parental Employment and Child Behaviors: Do Parenting Practices Underlie These Relationships? (United States)

    Hadzic, Renata; Magee, Christopher A.; Robinson, Laura


    This study examined whether hours of parental employment were associated with child behaviors via parenting practices. The sample included 2,271 Australian children aged 4-5 years at baseline. Two-wave panel mediation models tested whether parenting practices that were warm, hostile, or characterized by inductive reasoning linked parent's hours of…

  13. Remote Sensing of Soil Moisture Using Airborne Hyperspectral Data (United States)


    Soil Moisture Retrievals for Forecasting Rainfall-Runoff Partitioning ," Geophysical Research Letters, 32(18):L 18401 [doi: 10.1029/2005GL023543...Influences on the Remote Estimation of Evapotranspiration Using Multiple Satellite Sensors," Remote Sensing of Envi- ronment, 105(4):271-285. Milfred, C

  14. The Relations between Teasing and Bullying and Middle School Standardized Exam Performance (United States)

    Lacey, Anna; Cornell, Dewey; Konold, Timothy


    This study examined the relations between the schoolwide prevalence of teasing and bullying (PTB) and schoolwide academic performance in a sample of 271 Virginia middle schools. In addition, the study examined the mediating effects of student engagement. A three-step sequence of path models investigated associations between schoolwide PTB and…


    African Journals Online (AJOL)

    403-407,2000. [7] Kettunen, R, P. Keskitalo, Combination of membrane technology and limestone filtration to control drinking water quality. DESALINATION, 131 (1-3): 271-283,2000. [8] Pervov, A G., E.V. Dudkin, O. A. Sidorenko,. V V. Antipov, S. A. Khakhano,v and R. 1. Makarov, RO and NF membrane systems for drinking.

  16. 48 CFR 1371.107 - Performance. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1371.107 Section 1371.107 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL... Performance. Insert clause 1352.271-76, Performance, in all solicitations and contracts for ship construction...

  17. A systematic review of health effects of electronic cigarettes

    DEFF Research Database (Denmark)

    Pisinger, Charlotta; Døssing, Martin


    recommendations were followed. We identified 1101 studies; 271 relevant after screening; 94 eligible. RESULTS: We included 76 studies investigating content of fluid/vapor of ECs, reports on adverse events and human and animal experimental studies. Serious methodological problems were identified. In 34...

  18. Perspectives on halogen bonding and other sigma-hole interactions: Lex parsimoniae (Occam's Razor)

    Czech Academy of Sciences Publication Activity Database

    Politzer, P.; Riley, Kevin Eugene; Bulat, F. A.; Murray, J. S.


    Roč. 998, SI (2012), s. 2-8 ISSN 2210-271X Institutional research plan: CEZ:AV0Z40550506 Keywords : halogen bonding * alpha-Hole bonding * hydrogen bonding * electrostatics /polarization * dispersion * electrostatic potentials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.139, year: 2012

  19. Friends Also Matter: Examining Friendship Adjustment Indices as Moderators of Anxious-Withdrawal and Trajectories of Change in Psychological Maladjustment (United States)

    Markovic, Andrea; Bowker, Julie C.


    The present study evaluated whether 3 indices of friendship adjustment (mutual friendship involvement, friendship stability, friendship quality) are important, but overlooked, moderators of the impact of anxious-withdrawal on trajectories of psychological maladjustment during early adolescence. Participants included 271 young adolescents (51%…

  20. Population Dynamics and Diversity of Synechococcus on the New England Shelf (United States)


    rare taxa in the sponge microbiome. The ISME journal, 8(6):1198–1209, 2014. [87] Gabrielle Rocap, Frank W Larimer, Jane Lamerdin, Stephanie Malfatti... microorganisms shaped by vibrations of the water molecule. The ISME Journal, 1(4):271–282, 2007. [103] Maayke Stomp, Jef Huisman, Lajos Vörös, Frances R Pick

  1. Mechanism of Ras Activation by TGFBeta (United States)


    cells. JBiol Chem 271, 13931-13934. Verschueren, K., Remade, J. E., Collart, C, Kraft , H., Baker, B. S., Tylza- nowski, P., Nelles, L., Wuytens, G...within specific functional domains. Penn State University Dinner and Poster Session, Penn State Univ., University Park, PA, April 2002 Tang, Q., Staub

  2. Characterisation of microsatellite loci in two species of lice, Polyplax serrata (Phthiraptera: Anoplura: Polyplacidae) and/nMyrsidea nesomimi (Phthiraptera: Amblycera: Menoponidae)

    Czech Academy of Sciences Publication Activity Database

    Martinů, Jana; Roubová, V.; Nováková, M.; Smith, V. S.; Hypša, Václav; Štefka, Jan


    Roč. 62, FEB 13 2015 (2015), 016 ISSN 1803-6465 R&D Projects: GA ČR GPP506/12/P529 Institutional support: RVO:60077344 Keywords : ectoparasite * population genetics * coevolution * Polypax * Myrsidea * evolution * Europe * Galapagos Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  3. Present and future strategies for neutrinoless double beta decay ...

    Indian Academy of Sciences (India)

    journal of. August 2010 physics pp. 271–280. Present and future strategies for neutrinoless double beta decay searches. C BROFFERIO. Physics Department ..... by one electron and the other, can be of extreme importance in the comprehension .... The idea is to read both the scintillation channel, with a light detector.

  4. Next Steps for Transforming Education at National Defense University (United States)


    could and should be a humanist approach that emphasizes the importance of meeting the student’s full range of needs: emotional, spiritual, physical...The New Censor- ship: Institutional Review Boards,” Supreme Court Review 271 (2004). 15 Tom Bartlett, “Social- Psychology Researchers Are Very

  5. Mira y lee: Libro de actividades, 1 (Look and Read: Workbook 1). (United States)

    Martinez, Emiliano; And Others

    This workbook, designed to be used with the textbook of the same title (FL 004 271), contains exercises, riddles, puzzles, coloring activities, and reinforcement of various word-perception skills and sentences. Included is a step-by-step procedure of phonetic analysis. The intention of the workbook is to enable students to increase their ability…

  6. Evaluation of Short-Term Bioassays to Predict Functional Impairment. Selected Short-Term Cardiovascular Toxicity Tests. (United States)


    Cardiology 43(3):533-540. Lundy, P.M., 1978. "Mechanism of the Cardiovascular Activity of Dibenzoxazepine in Cats ." European Journal of Pharmacology 48(3):271...1963. "Inhibitory Effect of Acetylcho- line on Glycogenolysis in the Isolated Guinea-Pig Heart." Journal of Pharmacology and Experimental

  7. Invaze netýkavky žláznaté v České republice

    Czech Academy of Sciences Publication Activity Database

    Skálová, Hana; Čuda, Jan


    Roč. 62, č. 2 (2014), s. 271-273 ISSN 0044-4812 R&D Projects: GA ČR GA206/07/0668 Institutional support: RVO:67985939 Keywords : plant species biology * reproduction * growth Subject RIV: EF - Botanics

  8. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results from an O3-Gradient and a FACE Experiment (United States)

    D. F. Karnosky; B. Mankovska; K. Percy; R. E. Dickson; G. K. Podila; J. Sober; A. Noormets; G. Hendrey; M. D. Coleman; M. Kubiske; K. S. Pregitzer; J. G. Isebrands


    Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3 sensitivity by growth and biomass...

  9. Critical Casimir forces and anomalous wetting

    Indian Academy of Sciences (India)

    the origin of artefacts in the profiles found by Ueno et al, whose fringe patterns were severely bent, due to inhomogeneous stresses on the two cell windows. In our new experiment, we have found zero contact angle in the whole temperature range. Two examples of profiles are shown in figure 8. At low temperature (271 mK).

  10. An evaluation of creep behavior in ultrafine-grained aluminum alloys processed by ECAP

    Czech Academy of Sciences Publication Activity Database

    Kawasaki, M.; Sklenička, Václav; Langdon, T. G.


    Roč. 45, č. 1 (2010), s. 271-274 ISSN 0022-2461 Institutional research plan: CEZ:AV0Z20410507 Keywords : creep * ultrafine-grained material * severe plastic deformation * equal-channel angular pressing Subject RIV: JG - Metallurgy Impact factor: 1.855, year: 2010

  11. 76 FR 44597 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

  12. 77 FR 26770 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis....271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272, Alcohol...

  13. 77 FR 39716 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting Pursuant to section 10(d) of the Federal... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Alcohol Abuse... Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93...

  14. 75 FR 36660 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272...

  15. 76 FR 22717 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists...

  16. 76 FR 22715 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists...

  17. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Denny P Alappattu. Articles written in Journal of Earth System Science. Volume 117 Issue S1 July 2008 pp 263-271. Aircraft measurements of aerosol black carbon from a coastal location in the north-east part of peninsular India during ICARB · S Suresh Babu S K Satheesh ...

  18. Mothers' knowledge about birth asphyxia: The need to do more!

    African Journals Online (AJOL)

    Jul-2012. Address for correspondence: .... 55 (15.5). Breech delivery. 96 (27.1). Cerebral palsy. 66 (18.6). Deliveries outside orthodox facilities. 125 (35.3). Deafness. 62 (17.5). Big baby. 108 (30.5). Speech impairment. 86 (24.3). Prematurity.

  19. Application of a chlorophyll index derived from satellite data to ...

    African Journals Online (AJOL)

    Application of a chlorophyll index derived from satellite data to investigate the variability of phytoplankton in the Benguela ecosystem. H Demarcq, R Barlow, L Hutchings. Abstract. No Abstract. African Journal of Marine Science Vol.29(2) 2007: pp. 271-282. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD ...

  20. Linking Emotion Regulation Strategies to Affective Events and Negative Emotions at Work (United States)

    Diefendorff, James M.; Richard, Erin M.; Yang, Jixia


    This study examined the use of specific forms of emotion regulation at work, utilizing Gross's [Gross, J. J. (1998). "The emerging field of emotion regulation: An integrative review." "Review of General Psychology" 2, 271-299] process-based framework of emotion regulation as a guiding structure. In addition to examining employee self-reported…

  1. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.


    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquitoes * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  2. The Lyman Alpha Reference Sample: Extended Lyman Alpha Halos Produced at Low Dust Content

    Czech Academy of Sciences Publication Activity Database

    Hayes, M.; Oestlin, G.; Schaerer, D.; Verhamme, A.; Mas-Hesse, J. M.; Adamo, A.; Atek, H.; Cannon, J.M.; Duval, F.; Guaita, L.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Melinder, J.; Orlitová, Ivana; Oti-Floranes, H.; Sandberg, A.


    Roč. 765, č. 2 (2013), L27/1-L27/6 ISSN 2041-8205 Institutional support: RVO:67985815 Keywords : cosmology observations * galaxies * evolution Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.602, year: 2013

  3. Annals of Medical and Health Sciences Research - Vol 4, No 2 (2014)

    African Journals Online (AJOL)

    Reservoir Complete Denture in a Patient with Xerostomia Secondary to Radiotherapy for Oral Carcinoma: A Case Report and Review of Literature · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Ladda, VO Kasat, SA Gangadhar, S Baheti, AJ Bhandari, 271-275.

  4. Measurement of the cosmic background radiation temperature at 6. 3 cm

    Energy Technology Data Exchange (ETDEWEB)

    Mandolesi, N.; Calzolari, P.; Cortiglioni, S.; Morigi, G.


    We present results of a measurement of the cosmic background radiation temperature at a wavelength of 6.3 cm. We obtained the value T/sub CBR/ = 2.71 +- 0.20 K. This is in good agreement with, and has a smaller error than, any previous measurement at equal or longer wavelengths.

  5. Speech Quality Measurement (United States)


    2.271 Sound Patterns of English, N. Chomsky and H. Halle, Haper zi Row, New York, 1968. 12.281 "Speech Synthesis by Rule," J. N. Holmes, I. G...L. H. Nakatani, B. J. McDermott, "Effect of Pitch and Formant Manipulations on Speech Quality," Bell Telephone Laboratories, Technical Memorandum, 72

  6. Resource allocation in food crop production and farming household ...

    African Journals Online (AJOL)

    Given the average household land size, labour and capital of 2.236 hectares, 271.57 man-day and N15,677.30 respectively, optimal resources allocation will yield the highest annual farm income of N110,473.50. To improve the food security status of farming households in the study area, farmers should allocate their ...

  7. China’s Pacific Policy at the Turn of the Millennium (United States)


    Current History 611 (September 1997): 282-286. Prime, Penelope P. “The Economy in Overdrive : Will It Crash?” Current History 575 (September 1993...September 1999): 286-290. . “Taiwan’s Lee Teng-hui Complex.” Current History 602 (September 1996): 266-271. Ross , Robert S. “Enter the Dragon

  8. Clean Hands Count

    Medline Plus

    Full Text Available ... 620,296 views 7:25 Vacation Nightmare: Sun, Sand, Prostitutes? | ABC World News Tonight | ABC News - Duration: 7:11. ABC News 3,271,501 views 7:11 Hand Hygiene Saves Lives - Duration: 5:12. Centers for Disease Control and Prevention (CDC) 95,256 views 5:12 ...

  9. Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk


    Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP-MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

  10. Serotonin and dopamine in the parabrachial nucleus of rats during conditioned taste aversion learning

    Czech Academy of Sciences Publication Activity Database

    Zach, P.; Křivánek, Jiří; Valeš, Karel


    Roč. 170, č. 2 (2006), s. 271-276 ISSN 0166-4328 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z5011922 Keywords : taste aversion * microdialysis * parabrachial nucleus Subject RIV: FH - Neurology Impact factor: 2.591, year: 2006

  11. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M


    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  12. Neural Expert Systems

    Czech Academy of Sciences Publication Activity Database

    Šíma, Jiří


    Roč. 8, č. 2 (1995), s. 261-271 ISSN 0893-6080 R&D Projects: GA ČR GA201/95/0976 Keywords : expert system * knowledge representation * multilayered neural network * back propagation * interval neuron function * incomplete information * explanation Impact factor: 1.262, year: 1995

  13. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8487 ... Canada-South Africa trilateral research chair in nanomaterials for clean water. This project aims to use nanomaterials (a nanometer is one billionth of a meter) to provide new, inexpensive techniques to purify water that also address the increasingly important issue of antimicrobial resistance.

  14. 48 CFR 1371.114 - Government review, comment, acceptance, and approval. (United States)


    ... Provisions and Clauses 1371.114 Government review, comment, acceptance, and approval. Insert clause 1352.271-83, Government Review, Comment, Acceptance and Approval, in all solicitations and contracts for ship..., acceptance, and approval. 1371.114 Section 1371.114 Federal Acquisition Regulations System DEPARTMENT OF...

  15. Measurement of the cosmic background radiation temperature at 6.3 cm

    International Nuclear Information System (INIS)

    Mandolesi, N.; Calzolari, P.; Cortiglioni, S.; Morigi, G.


    We present results of a measurement of the cosmic background radiation temperature at a wavelength of 6.3 cm. We obtained the value T/sub CBR/ = 2.71 +- 0.20 K. This is in good agreement with, and has a smaller error than, any previous measurement at equal or longer wavelengths

  16. Negative Affect as a Moderator of the Relationship between Hookup Motives and Hookup Consequences (United States)

    Montes, Kevin S.; Napper, Lucy E.; Froidevaux, Nicole M.; Kenney, Shannon; LaBrie, Joseph W.


    Objective: The current study examined the extent to which negative affect moderates the relationships between distinct hookup motives and hookup consequences. Participants: Data were collected from 271 heavy-drinking undergraduate college students. Methods: Students from 3 US universities completed online surveys assessing hooking up--related…

  17. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab


    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  18. Utilization status of Electronic Information Sources (EIS) for HIV ...

    African Journals Online (AJOL)

    Furthermore, there was statistically significant association between use of EIS and perceived electronic information retrieval skills AOR = 3.271, CI (1.942, 4.051), perceived quality of electronic information content retrieved AOR= 2.069, CI (1.051, 3.925) and limited access to computer and internet connection AOR = 5.072, ...

  19. Stages and Discharges of the Mississippi River and Tributaries and Other Watersheds in the New Orleans District for 1991 (United States)


    234 GULF OF MEXICO . . . . ..................... 263 PART II. OBSERVED DISCHARGES MISSISSIPPI RIVERANDPASSES ......... ............... 271 OLD...DISCHARGE IN THOUSAND DAY SECOND FEET DAY JAN FEB NAR APR NAY AtUN Jt. AUG SEP OCT NOV DEC 226215 125 83 33 32 90 64 37 m8 90 279 92 5 63 21 2m 224 127

  20. 77 FR 57541 - Airworthiness Directives; The Boeing Company Airplanes (United States)


    ...-0938; Directorate Identifier 2011-NM-271-AD] RIN 2120-AA64 Airworthiness Directives; The Boeing Company...). SUMMARY: We propose to adopt a new airworthiness directive (AD) for certain The Boeing Company Model 737... proposed AD, contact Boeing Commercial Airplanes, Attention: Data & Services Management, P.O. Box 3707, MC...

  1. 7-Amino-4,6-Dinitrobenzofuroxan, An Insensitive High Explosive (United States)


    decomposition exceeds endo- thermic rearrangement contribution causing the line to rise until at 271"C the endothermic process again prevails and the...separating immediately. Volatiles are removed on a rotary evaporator toleave 0.565 g of the amonium salt of 4. This is stirred for 10 min in 50 ml of IN

  2. On some singular limits in damped radiation hydrodynamics

    Czech Academy of Sciences Publication Activity Database

    Blanc, X.; Ducomet, B.; Nečasová, Šárka


    Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * dam ping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016

  3. Capillary electrochromatography of proteins and peptides (2006–2015)

    Czech Academy of Sciences Publication Activity Database

    Mikšík, Ivan


    Roč. 40, č. 1 (2017), s. 251-271 ISSN 1615-9306 R&D Projects: GA ČR(CZ) GA15-01948S Institutional support: RVO:67985823 Keywords : capillary electrochromatography * peptides * proteins Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 2.557, year: 2016

  4. A Short Note on t-filters, I-filters and Extended Filters on Residuated Lattices

    Czech Academy of Sciences Publication Activity Database

    Víta, Martin


    Roč. 271, 15 July (2015), s. 168-171 ISSN 0165-0114 R&D Projects: GA ČR GAP202/10/1826 Institutional support: RVO:67985807 Keywords : t-filters * I-filters * extended filters * residuated lattices Subject RIV: BA - General Mathematics Impact factor: 2.098, year: 2015

  5. Role of hydroxyl group and R/S configuration of isostere in binding properties of HIV-1 protease inhibitors

    Czech Academy of Sciences Publication Activity Database

    Petroková, Hana; Dušková, Jarmila; Dohnálek, Jan; Skálová, Tereza; Vondráčková-Buchtelová, Eva; Souček, Milan; Konvalinka, Jan; Brynda, Jiří; Fábry, Milan; Sedláček, Juraj; Hašek, Jindřich


    Roč. 271, č. 22 (2004), s. 4451-4461 ISSN 0014-2956 R&D Projects: GA AV ČR KJB4050312 Keywords : ethyleneamine inhibitor * HIV -1 protease * peptidomimetic inhibitor Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.260, year: 2004

  6. Využití brassinosteroidů k regulaci stresu během růstu a tvorby výnosu řepy cukrové

    Czech Academy of Sciences Publication Activity Database

    Hradecká, D.; Urban, J.; Kohout, Ladislav; Pulkrábek, J.; Hnilička, R.


    Roč. 125, 9/10 (2009), s. 271-273 ISSN 1210-3306 R&D Projects: GA AV ČR 1QS510680561 Institutional research plan: CEZ:AV0Z40550506 Keywords : sugar beet * yield * technological quality * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 0.645, year: 2009

  7. Conjugacy class sizes and solvability of finite groups

    Indian Academy of Sciences (India)

    Let be a finite group and * be the set of primary, biprimary and triprimary elements of . We prove that if the conjugacy class sizes of * are {1,,,} with positive coprime integers and ,then is solvable. This extends a recent result of Kong (Manatsh. Math. 168(2)(2012) 267–271).

  8. Mesophyll conductance to CO2 transport estimated by two independent methods: effect of variable CO2 concentration and abscisic acid

    Czech Academy of Sciences Publication Activity Database

    Vrábl, D.; Vašková, M.; Hronková, Marie; Flexas, J.; Šantrůček, Jiří


    Roč. 60, č. 8 (2009), s. 2315-2323 ISSN 0022-0957 R&D Projects: GA AV ČR(CZ) IAA601410505 Institutional research plan: CEZ:AV0Z50510513 Keywords : Carbon dioxide * mesophyll conductance * Helianthus annuus Subject RIV: ED - Physiology Impact factor: 4.271, year: 2009

  9. Waste water treatment of slaughterhouse through water treatment plants of stainless steel; Tratamiento de aguas residuales de mataderos mediante depuradoras compactas modulares de acero inoxidable

    Energy Technology Data Exchange (ETDEWEB)

    BaNales Sirvent, P.


    The object of this project was to develop an integral waste water treatment concept, based on compact module made of stainless steel, with a combination that allows to get performances according to given requirements stablished in the Community Directive 91/271/CEE (1991). The industrial pilot tests have been made in a slaughterhouse with a capacity of 20 tons per day. (Author)

  10. Detection of Biological False Positive Syphilis Serum Reactions ...

    African Journals Online (AJOL)

    A comparative evaluation of reagin tests (Wassermann, VDRL, RPR) and fluorescent treponema antibody absorption tests (FTA-ABS) performed on blood specimens from 5 271 persons (2 493 pregnant women, 1 130 apparently healthy prospective employees, 1 345 newborn babies and 303 leprosy patients) showed that ...

  11. Biophysical properties and cellular toxicity of covalent crosslinked oligomers of α-synuclein formed by photoinduced side-chain tyrosyl radicals

    Czech Academy of Sciences Publication Activity Database

    Borsarelli, C.D.; Falomir-Lockhart, L.J.; Ostatná, Veronika; Fauerbach, J.A.; Hsiao, H.-H.; Urlaub, H.; Paleček, Emil; Jares-Erijman, E.A.; Jovin, T.M.


    Roč. 53, č. 4 (2012), s. 1004-1015 ISSN 0891-5849 R&D Projects: GA AV ČR(CZ) KJB100040901 Institutional research plan: CEZ:AV0Z50040702 Keywords : Parkinson's disease * neurodegeneration * oxidative stress Subject RIV: BO - Biophysics Impact factor: 5.271, year: 2012

  12. Searching a dark photon with HADES

    Czech Academy of Sciences Publication Activity Database

    Agakishiev, G.; Balanda, A.; Belver, D.; Belyaev, A.; Berger-Chen, J. C.; Blanco, A.; Böhmer, M.; Boyard, J. L.; Cabanelas, P.; Chernenko, S.; Dybczak, A.; Epple, E.; Fabbietti, L.; Fateev, O.; Krása, Antonín; Křížek, Filip; Kugler, Andrej; Sobolev, Yuri, G.; Tlustý, Pavel; Wagner, Vladimír


    Roč. 731, APR (2014), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-06759S; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : HADES * dark photon * hidden sector * dark matter * rare eta decays Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.131, year: 2014

  13. SIndex 1..24

    Indian Academy of Sciences (India)

    interaction with glycine and GABA. 203. A1 resonance in water. Dynamics of the dissociative electron attachment in. H2O and D2O: The A1 resonance and axial recoil approximation. 271. Ab initio. Bhageerath—Targeting the near impossible: Pushing the frontiers of atomic models for protein tertiary structure prediction. 83.

  14. Risk factors Schistosoma hematobium in Ajelanwa area of Oyo state ...

    African Journals Online (AJOL)

    A large proportion of respondents were either dirty 271 (51.0%) or unkempt - uncut nails, unkempt hair and tattered clothes 105 (19.8%) with 11 (2.1 %) having scabies. Clinically detectable anaemia was present in 153 (28.8%) of the subjects. The prevalence rate of S haematobium was 14% in the study population with ...

  15. Learning the optimal buffer-stock consumption rule of Carroll

    NARCIS (Netherlands)

    Yıldızoğlu, M.; Sénégas, M.A.; Salle, I.; Zumpe, M.


    This article questions the rather pessimistic conclusions of Allen and Carroll [Macroeconomic Dynamics 5 (2001), 255-271] about the ability of consumers to learn the optimal buffer-stock-based consumption rule. To this end, we develop an agent-based model in which alternative learning schemes can be

  16. The 7B-1 mutation in tomato (Solanum lycopersicum L.) confers a blue light-specific lower sensitivity to coronatine, a toxin produced by Pseudomonas syringae pv. tomato

    Czech Academy of Sciences Publication Activity Database

    Bergougnoux, V.; Hlaváčková, V.; Plotzová, R.; Novák, Ondřej; Fellner, Martin


    Roč. 60, č. 4 (2009), s. 1219-1230 ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blue light-specific response * COI1 * cor onatine Subject RIV: EF - Botanics Impact factor: 4.271, year: 2009

  17. Fulltext PDF

    Indian Academy of Sciences (India)


    AAO template. Nanowires: properties, applications and synthesis via porous anodic aluminium oxide template. 271. Absorption coefficient. Optical properties of CeO2 thin films. 315. Acid chloride bath. Effect of condensation product on electrodeposition of zinc on mild steel. 463. Acrylamide. Selective absorption of water ...

  18. DNA modifications by platinum antitumor drugs and its recognition by DNA-binding proteins

    Czech Academy of Sciences Publication Activity Database

    Brabec, Viktor


    Roč. 271, Suppl. 1 (2004), s. 90 ISSN 0014-2956. [Meeting of the Federation of the European Biochemical Societies /29./. 26.06.2004-01.07.2004, Warsaw] R&D Projects: GA ČR GA305/02/1552 Keywords : platinum drugs * DNA-protein interaction * NF-kappaB Subject RIV: BO - Biophysics

  19. Succinobucol induces apoptosis in vascular smooth muscle cells

    Czech Academy of Sciences Publication Activity Database

    Midwinter, R.G.; Maghzal, G.; Dennis, J.M.; Wu, B.J.; Cai, H.; Kapralov, A.A.; Belikova, N.A.; Tyurina, Y.Y.; Dong, L. F.; Khachigian, L.; Neužil, Jiří; Kagan, V.E.; Stocker, R.


    Roč. 52, č. 5 (2012), s. 871-879 ISSN 0891-5849 R&D Projects: GA ČR(CZ) GAP301/10/1937 Institutional research plan: CEZ:AV0Z50520701 Keywords : reactive oxygen species * free radicals * apoptosis Subject RIV: EA - Cell Biology Impact factor: 5.271, year: 2012

  20. Marie Kovářová a výzkum tradičních svateb na Podblanicku

    Czech Academy of Sciences Publication Activity Database

    Petráňová, Lydia


    Roč. 50, č. 2 (2010), s. 271-284, 457 ISSN 0487-5648 Institutional research plan: CEZ:AV0Z90580513 Keywords : Podblanicko region * Benešov district * wedding rituals * wedding officers * wedding pastry Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. 48 CFR 1852.223-76 - Federal Automotive Statistical Tool Reporting. (United States)


    ... Statistical Tool Reporting. 1852.223-76 Section 1852.223-76 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.223-76 Federal Automotive Statistical Tool Reporting. As prescribed at 1823.271 and 1851.205, insert the following clause: Federal Automotive Statistical Tool Reporting (JUL 2003) If...

  2. Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

    Czech Academy of Sciences Publication Activity Database

    Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.


    Roč. 63, č. 2 (2014), s. 271-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant - others:Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

  3. MK-886 enhances tumour necrosis factor-alpha-induced differentiation and apoptosis

    Czech Academy of Sciences Publication Activity Database

    Štika, Jiří; Vondráček, Jan; Hofmanová, Jiřina; Šimek, V.; Kozubík, Alois


    Roč. 237, č. 2 (2006), s. 263-271 ISSN 0304-3835 R&D Projects: GA ČR(CZ) GA524/03/0766 Institutional research plan: CEZ:AV0Z50040507 Keywords : cell differentiation * leukaemia * HL-60 cells Subject RIV: BO - Biophysics Impact factor: 3.277, year: 2006

  4. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6389 ... Reducing poverty in Atlas Mountains. Wood is a scarce resource across North Africa, yet it is commonly used in rural areas as fuel for baking bread in traditional ovens. Rural households can burn through more than one tonne of firewood a year, threatening to deplete forests.

  5. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 282 ... Building Capacity for Feminist Research in Africa : Gender, Sexuality and Politics. Over the past decade, there has been increasing interest in African scholarship on the importance of understanding sexualities and on connecting this understanding to more relevant policy prescriptions so that African ...

  6. Agronomical use of sewage sludge from urban waste water treatment plant

    International Nuclear Information System (INIS)

    Motta, S.


    The Urban Waste Water Treatment Directive (91/271/EEC) aims to encourage the use of sludge whenever appropriate; the sewage sludge is a product of wastewater treatment which could find a reutilisation in the agricultural field. The necessity to find a solution to the sewage and biomass disposal has lead to the development of techniques based on natural reuse of agricultural soils. (Author)

  7. A new genus and species of proteocephalidean tapeworm (Cestoda), first parasite found in the driftwood catfish Tocantinsia piresi (Siluriformes: Auchenipteridae) from Brazil

    Czech Academy of Sciences Publication Activity Database

    Alves, P.V.; de Chambrier, A.; Scholz, Tomáš; Luque, J.L.


    Roč. 62, January 2015 (2015), 006 ISSN 0015-5683 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : taxonomy * morphology * Proteocephalidea * metascolex * Amazon River basin * Xingú River * Neotropical Region Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.271, year: 2015

  8. Crystal structure, spectroscopic and theoretical studies on two Schiff base compounds of 2,6-dichlorobenzylidene-2,4-dichloroaniline and 2,4-dichlorobenzylidene-2,4-dichloroaniline

    Czech Academy of Sciences Publication Activity Database

    Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.


    Roč. 139, Mar (2015), s. 271-278 ISSN 1386-1425 Grant - others:AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.653, year: 2015

  9. Within-field refugiums of Russian wheat aphid, Diuraphis noxia (Kurdj.) in cereals (Hom., Aphididae)

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr


    Roč. 74, - (2001), s. 124-126 ISSN 1436-5693 R&D Projects: GA AV ČR IBS5007102; GA AV ČR IAA6007105 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.271, year: 2001

  10. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.


    Roč. 18, č. 2 (2011), s. 267-271 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 logistic +operations+in+discarded+munitions+processing

  11. Residential and Nonresidential Parents; Perspectives on Visitation Problems. (United States)

    Wolchik, Sharlene A.; And Others


    Examined visitation problems from the perspectives of residential and nonresidential parents through interviews. Subjects were 341 fathers and 271 mothers from 378 divorcing families. Residential parents perceptions of visitation problems were correlated with concerns about their ex-spouse's parenting abilities. Anger and hurt about the divorce…

  12. Adoption of Integrated Pest Management among Cocoa Farmers in ...

    African Journals Online (AJOL)

    The determinants of adoption of IPM among cocoa farmers were investigated in Cross Rivers State, 271 trained cocoa farmers were systematically selected out of 2704 while in Osun State 107 were selected out of 1070. Structured questionnaire was used to obtain data on respondents' socio-economic characteristics, ...

  13. Modification of polysulfone with pendant carboxylic acid functionality ...

    Indian Academy of Sciences (India)

    271–276. c Indian Academy of Sciences. Modification of polysulfone with pendant carboxylic acid functionality for ultrafiltration membrane applications. ANNADANAM V SESHA SAINATH†,∗ and A V R REDDY. ∗. Reverse Osmosis Division, CSIR-Central Salt and Marine Chemicals Research Institute, Bhavnagar 364 002, ...

  14. Automated Demand Response for Energy Sustainability (United States)


    electric loads for use in DR programs include HVAC equipment, lighting, water pumping, and other miscellaneous motor loads. Figure 5 shows a high...100 Appendix L: Comparative Analysis: Bldg 254/271 HVAC Controls Project ............................ 102 Appendix M: Comparative...Security Technology Certification Program FEMP Federal Energy Management Program FERC Federal Energy Regulatory Commission HVAC Heating, ventilation

  15. From genes to genomes: concepts and applications of DNA technology

    National Research Council Canada - National Science Library

    Dale, Jeremy, Professor; Schantz, Malcolm von; Plant, Nick


    ... gel electrophoresis 25 25 26 29 29 31 31 32 33 33 36vi CONTENTS 2.6 2.7 2.8 2.9 2.10 2.11 2.12 2.13 Restriction endonucleases 2.6.1 Specificity 2.6.2 Sticky and blunt ends Ligation 2.7.1 2.7.2 Opt...

  16. Late Gothic/early Renaissance gilding technology and the traditional poliment material "Armenian bole": Truly red clay, or rather bauxite?

    Czech Academy of Sciences Publication Activity Database

    Hradil, David; Hradilová, J.; Bezdička, Petr


    Roč. 135, JAN (2017), s. 271-281 ISSN 0169-1317 R&D Projects: GA ČR(CZ) GA14-22984S Institutional support: RVO:61388980 Keywords : Historical gilding technology * Poliment * Armenian bole * X-ray powder micro-diffraction * Bauxite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 3.101, year: 2016

  17. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6341 ... IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Researchers at Uganda's National Agricultural Research Organisation and the Kenya Agricultural and Livestock Research Institute have partnered with ...

  18. Efimov effect in 2-neutron halo nuclei

    Indian Academy of Sciences (India)

    . B33, 563 (1970). [3] V Efimov, Comm. Nucl. Part. Phys. 19, 271 (1990). [4] Th Cornelius and W Glöckle, J. Chem. Phys. 85, 3906 (1986). B D Esry, C D Lin and C H Greene, Phys. Rev. A54, 394 (1996). J P D'Incao, H Suno and B D Esry, Phys.

  19. Restoration of hay meadows on ex-arable land: commercial seed mixtures vs. spontaneous succession

    Czech Academy of Sciences Publication Activity Database

    Lencová, K.; Prach, Karel


    Roč. 66, č. 2 (2011), s. 265-271 ISSN 0142-5242 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60050516 Keywords : grassland * rate of succession * species pool Subject RIV: EF - Botanics Impact factor: 1.099, year: 2011

  20. Bulletin of the Chemical Society of Ethiopia - Vol 28, No 2 (2014)

    African Journals Online (AJOL)

    SOCl2 catalyzed cyclization of chalcones: Synthesis and spectral studies of some bio-potentH pyrazoles · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K. Ranganathan, R. Suresh, G. Vanangamudi, K. Thirumurthy, P. Mayavel, G. Thirunarayanan, 271-288.

  1. Cocos sahnii Kaul: A Cocos nucifera L.-like fruit from the Early ...

    Indian Academy of Sciences (India)


    Jul 20, 2012 ... Cook OF 1910 History of the coconut palm in America. Contributios US Nat. Herb. 14 271–342. Corner EJH 1966 The natural history of palms (London, UK: Weidenfeld and Nicholson). Couper RA 1952 The spore and pollen flora of the Cocos-bearing beds, Mangonui, North Auckland. Trans. Roy. Soc. New.

  2. Autonomic Mechanisms Associated with Heart Rate and Vasoconstrictor Reserves (United States)


    J Physiol 271:R837 R847 25. Faris IB, Jamieson GG, Ludbrook J (1983) Effects of acute changes in blood volume on the carotid sinus baroreceptor...Ludbrook J, Faris IB, Jamieson GG (1981) Blood volume and the carotid baroreceptor reflex in conscious rabbits. Clin Sci (Lond) 61(Suppl 7):173s 175s 33

  3. Upconversion Effects in Resonantly Pumped Er3+ and Pr3+ Doped Low Phonon-Energy Crystals for Eye-Safe Laser Applications (United States)


    271-278 (2007). [15] Ferrier, A., Velazquez ,M., Doualan,J. L. and Moncorge, R., “Energy level and excited state absorption properties of Er3...Jian-hui, and Yang Gaobo, Optoelectronics Letters 8 (2012) 0273. [33] A. Ferrier, M. Velazquez , J. L. Doualan, and R. Moncorge, J. of AppL. Phys

  4. Proceedings (Mathematical Sciences) SUBJECT INDEX

    Indian Academy of Sciences (India)

    parameter family of Cauchy problems 97. Characteristic function. On CNC commuting contractive tuples. 299. Chern class. On the classification of complex vector bundles of stable rank. 271. Clarke subdifferential. Multiplicity of nontrivial solutions for elliptic equations with nonsmooth poten- tial and resonance at higher ...

  5. 48 CFR 1371.117 - Lay days. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1371.117 Section... REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.117 Lay days. Insert clause 1352.271-86, Lay Days, in all solicitations and contracts for ship repair. ...

  6. Verification and Validation Data for Computational Unsteady Aerodynamics (Donnees de verification et de valadation pour l’aerodynamique instationnaire numerique) (United States)


    by R.M. Bennett 10. Supersonic 2D Wing with Control Surfaces 257 by P. Naudin v 11E. RAE Tests on AGARD Tailplane 271 by I.W. Kaynes 12. NAL SST...Quai Marcel Dassault Glasgow, G12 8QQ, Scotland Cedex 300 M.J. de C. Henshaw92214 Saint Cloud British Aerospace (Operations) Ltd. P. Naudin Military

  7. Thermophysical Properties of Matter-The TPRC Data Series. Volume 10. Thermal Diffusivity (United States)


    thallium -thorium-thuliu-tti- titanium--titanium alloys--titanium compounds -tunget en-uranium-uranium compounds--vanadium--vater--ytterbiLum--yttriua--yttriR...178 66* Tellurium Te. .. .... ... .... ..... 181 67* Terbium Tb. .. ....... ... ...... 182 68* Thallium TI.. ....... .... ...... 183...t Cabbage ....... ................... 630 2691 Carrot ....... ................... 631 270t Castor Oil ....... ................... 632 271 t Egg

  8. Khimicheskoe osazhdenie na aerozol'nykh chastitsakh

    Czech Academy of Sciences Publication Activity Database

    Levdansky, V.V.; Smolík, Jiří; Moravec, Pavel; Ždímal, Vladimír


    Roč. 75, č. 3 (2002), s. 118-121 ISSN 0021-0285 R&D Projects: GA AV ČR IAA4072205 Grant - others:BRFFI(BY) T99-271 Keywords : chemical deposition * aerosol particles Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  9. Effect of condensation product on electrodeposition of zinc on mild ...

    Indian Academy of Sciences (India)


    AAO template. Nanowires: properties, applications and synthesis via porous anodic aluminium oxide template. 271. Absorption coefficient. Optical properties of CeO2 thin films. 315. Acid chloride bath. Effect of condensation product on electrodeposition of zinc on mild steel. 463. Acrylamide. Selective absorption of water ...

  10. 5 CFR 1315.17 - Formulas. (United States)


    ... interest owed is calculated as follows: $1,500 (.065/360*10) = $2.71 (c) Monthly compounding interest...) Daily simple interest formula. (1) To calculate daily simple interest the following formula may be used... interest rate; and d equals the numbers of days for which interest is being calculated. (2) For example, if...

  11. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Chhstl J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad

    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N = 271) rated the

  12. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Bröcker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad


    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

  13. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships.

    NARCIS (Netherlands)

    Oostrom, I.I.H. van; Meijers-Heijboer, H.; Duivenvoorden, H.J.; Brocker-Vriends, A.H.; Asperen, C.J. van; Sijmons, R.H.; Seynaeve, C.; Gool, A.R. van; Klijn, J.G.M.; Riedijk, S.R.; Dooren, S. van; Tibben, A.


    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

  14. Domain Decomposition for Generalized Unilateral Semi-Coercive Contact Problem with Given Friction in Elasticity

    Czech Academy of Sciences Publication Activity Database

    Daněk, Josef; Hlaváček, Ivan; Nedoma, Jiří


    Roč. 68, č. 3 (2005), s. 271-300 ISSN 0378-4754 R&D Projects: GA MPO FT-TA/087 Keywords : domain decomposition * unilateral contact * Tresca's friction model * formulation in displacements * linear finite elements Subject RIV: BA - General Mathematics Impact factor: 0.554, year: 2005

  15. Attention-Like Modulation of Hippocampus Place Cell Discharge

    Czech Academy of Sciences Publication Activity Database

    Fenton, André Antonio; Lytton, W.W.; Barry, J.M.; Lenck-Santini, P. P.; Zinyuk, Larissa; Kubík, Štěpán; Bureš, Jan; Poucet, B.; Muller, R. U.; Olypher, Andrej Vadimovich


    Roč. 30, č. 13 (2010), s. 4613-4625 ISSN 0270-6474 R&D Projects: GA ČR(CZ) GA309/09/0286 Institutional research plan: CEZ:AV0Z50110509 Keywords : attention * overdispersion * place cells Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

  16. The phosphatase activity of the isolated H4-H5 loop of Na+/K+ ATPase resides outside its ATP binding site

    Czech Academy of Sciences Publication Activity Database

    Ettrich, Rüdiger


    Roč. 271, č. 19 (2004), s. 3923-3939 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5011922; MSM113100003 Keywords : phosphatase Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.260, year: 2004

  17. Comparison of individuals opting for BRCA1/2 or HNPCC genetic susceptibility testing with regard to coping, illness perceptions, illness experiences, family system characteristics and hereditary cancer distress

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Bröcker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; van Gool, Arthur R.; Klijn, Jan G. M.; Tibben, Aad


    To study differences between individuals opting for genetic cancer susceptibility testing of a known familial BRCA1/2 and HNPCC related germline mutation. Coping, illness perceptions, experiences with cancer in relatives and family system characteristics were assessed in 271 applicants for genetic

  18. Comparison of individuals opting for BRCA1/2 or HNPCC genetic susceptibility testing with regard to coping, illness perceptions, illness experiences, family system characteristics and hereditary cancer distress

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Tibben, Aad

    Objective: To study differences between individuals opting for genetic cancer susceptibility testing of a known familial BRCA1/2 and HNPCC related germline mutation. Methods: Coping, illness perceptions, experiences with cancer in relatives and family system characteristics were assessed in 271

  19. O modálních predikativech slovesného původu typu To přende, (se) patří... zbórat

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena


    Roč. 100, č. 4 (2017), s. 265-271 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA16-04648S Keywords : dialect * verbal modal predicatives * modal verbs * modalization * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  20. Lipothymia and Syncope—Aetiology and Outcome in a Prehospital Setting: A Retrospective Study

    DEFF Research Database (Denmark)

    Zwisler, Stine Thorhauge; Mikkelsen, Søren


    MECU runs registered, 678 were assignments in which the patients were diagnosed with lipothymia or syncope (3.8%). 578 patients (85%) were admitted to hospital. 278 of the patients were discharged directly from the emergency department, while 271 were admitted to a ward. 112 patients refused treatment...

  1. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status

    NARCIS (Netherlands)

    Wolters, N.; Knoors, H.E.T.; Cillessen, A.H.N.; Verhoeven, L.T.W.


    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of

  2. Tangible and Intangible Rewards and Employee Creativity: The Mediating Role of Situational Extrinsic Motivation (United States)

    Yoon, Hye Jung; Sung, Sun Young; Choi, Jin Nam; Lee, Kyungmook; Kim, Seongsu


    This study examined the effects of tangible and intangible forms of creativity-contingent rewards on employee creativity. Situation-specific intrinsic and extrinsic motivations were proposed as mediators of the reward-creativity link. Based on data collected from 271 employees and their supervisors, results revealed the following: (a) intangible…

  3. Comparative Ultrastructure of Langerhans-Like Cells in Spleens of Ray-Finned Fishes (Actinopterygii)

    Czech Academy of Sciences Publication Activity Database

    Lovy, J.; Wright, G. M.; Speare, D. J.; Tyml, Tomáš; Dyková, Iva


    Roč. 271, č. 10 (2010), s. 1229-1239 ISSN 0362-2525 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * cyprinidae * halibut * dendritic cells * Langerhans cell * Birbeck granules * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.773, year: 2010

  4. Research Article Genome-wide association study for economic traits ...

    Indian Academy of Sciences (India)

    Aiqiang Lin

    The PCR procedure was. 101. 95 °C for ..... Ethics statement. 270. The sample collection and experiments in the study was approved by the Animal Care and. 271. Use Committee of Fisheries College of Jimei University (Animal Ethics no. 1067). 272 .... Transport of fatty acids across the human placenta: a review. Prog Lipid ...

  5. Journal of Agriculture and Social Research (JASR) Vol. 12, No. 2 ...

    African Journals Online (AJOL)


    ABSTRACT. The study focused on effect of capacity building programme of development agencies on well being of beneficiaries in Niger Delta Nigeria. Data was collected with the aid of structured questionnaire from 271 randomly selected participants involved in capacity building programmes in Niger Delta area of Nigeria ...

  6. Students' Achievement Goal Orientations and Their Behavioral and Emotional Engagement: Co-Examining the Role of Perceived School Goal Structures and Parent Goals during Adolescence (United States)

    Gonida, Eleftheria N.; Voulala, Katerina; Kiosseoglou, Grigoris


    The role of perceived school goal structures and parent goals in predicting adolescents' goal orientations and their behavioral and emotional engagement in the classroom was examined in the present study. Surveys were given to a sample of 271 seventh- and ninth-grade students. Path analyses showed that (a) perceived school mastery goal structures…

  7. 43 CFR 418.20 - Diversions from the Truckee River to Lahontan Reservoir, January through June. (United States)


    ... during this period. (6) Values for TSM/J will vary with the Carson Division water demand as shown in... defined in the following table along with an example of TSM/J for Carson River water demand of 271,000... upon water availability and Project demand as expressed in the following relationship: TRD=TDD+ TCL+CDD...

  8. Changing compositon of human capital: the Czech Republic, Hungary and Poland

    Czech Academy of Sciences Publication Activity Database

    Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav


    Roč. 16, č. 2 (2008), s. 247-271 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * occupation * education Subject RIV: AH - Economics Impact factor: 0.614, year: 2008

  9. Intervención cognitivo conductual en adultos mayores : retos y dificultades en la adaptación de una terapia de grupo manualizada /


    Vergara-Lope Tristán, Samana sustentante.


     tesis que para obtener el grado de Doctor en Psicología, presenta Samana Vergara-Lope Tristán ; asesor Ana Luisa González-Celis Rangel. 271 páginas. Doctorado en Psicología UNAM, Facultad de Psicología, 2009

  10. Morpho (?) phono (?) logical fuzzy edges

    African Journals Online (AJOL)

    Open Access DOWNLOAD FULL TEXT Subscription or Fee Access. Morpho (?) phono (?) logical fuzzy edges: The case of {-/}/{-/U/} semantic (?) contrast in Shona. K. G. Mkangwanwi. Abstract. (ZAMBEZIA: Journal of Humanities of the Univ of Zimbabwe, 2000 27(1): 47-54). Full Text: EMAIL FULL TEXT EMAIL FULL TEXT

  11. Contemporary cognitive load theory research: The good, the bad and the ugly

    NARCIS (Netherlands)

    Kirschner, Paul A.; Ayres, Paul; Chandler, Paul


    Kirschner, P. A., Ayres, P., & Chandler, P. (2011). Contemporary cognitive load theory research: The good, the bad and the ugly. Computers in Human Behavior, 27(1), 99-105. doi:10.1016/j.chb.2010.06.025

  12. Pollution of agricultural crops with lanthanides, thorium and uranium studied

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Mizera, Jiří; Řanda, Zdeněk; Vávrová, M.


    Roč. 271, č. 3 (2007), s. 581-587 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : thorium, uranium * agricultural crops * neutron activation analysis Subject RIV: BE - Theoretical Physics Impact factor: 0.499, year: 2007

  13. Dicty_cDB: Contig-U06058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 27_1( EU420127 |pid:none) Clavicipitaceae sp. CV-2008a trans... 350 6e-95 EF468764_1( EF468764 |pid:none) Ophiocordyceps...fac... 348 3e-94 EF468756_1( EF468756 |pid:none) Metacordyceps liangshanensis strai... 348 3e-94 DQ028594_1(

  14. Bergman kernels, TYZ expansions and Hankel operators on the Kepler manifold

    Czech Academy of Sciences Publication Activity Database

    Bommier-Hato, H.; Engliš, Miroslav; Youssfi, E.-H.


    Roč. 271, č. 2 (2016), s. 264-288 ISSN 0022-1236 Institutional support: RVO:67985840 Keywords : Kepler manifold * Bergman kernel * Tian-Yau-Zelditch expansion Subject RIV: BA - General Mathematics Impact factor: 1.254, year: 2016

  15. Daphnia diversity in water bodies of the Po River Basin

    Czech Academy of Sciences Publication Activity Database

    Marková, Silvia; Maurone, C.; Racchetti, E.; Bartoli, M.; Rossi, V.


    Roč. 76, č. 2 (2017), s. 261-271 ISSN 1129-5767 Institutional support: RVO:67985904 Keywords : genetic diagnostic markers * invasive species * genetic differentiation Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.451, year: 2016

  16. Oral Toxicity Studies of Hydroalcohol Leaf Extract of Ageratum

    African Journals Online (AJOL)


    Powis G. Model systems for detecting the hepatic toxicity of pyrrolizidine alkaloïdes and pyrrolizidine alkaloid N-oxides. Toxicol. Appl. Pharmacol. 1989; 101: 271-284. 9. Quijano L, Calderson JS, Gomez GF, Soria IE, Rios. T. Highly oxygenated flavonoides from. Ageratum conyzoides. Phytochemistry 1980;. 19: 2439-2442.

  17. Characterization of Transverse Tubule Vesicles Isolated from Skeletal Muscle (United States)


    L.. and D~e Mclfo. MI.(. (11973) J. Biot. (Chem. 248. 271 272 3 691-3 701 11 Di )amond, F.. N orion. Kit.. Mc In tosh . 1). a nd Hlermoni. MI. 33 Froeh...obtained from E-Y Laboratories sucrose gradient (6 ml 10% sucrose, 6 ml 27% (San Mateo, CA). Pierce Chemical Corp. ( Rock - sucrose made in KCI

  18. Brief Report: Incidence of and Risk Factors for Autistic Disorder in Neonatal Intensive Care Unit Survivors. (United States)

    Matsuishi, Toyojiro; Yamashita, Yushiro; Ohtani, Yasuyo; Ornitz, Edward; Kuriya, Norikazu; Murakami, Yoshihiko; Fukuda, Seiichi; Hashimoto, Takeo; Yamashita, Fumio


    Analysis of the incidence of autistic disorder (AD) among 5,271 children in a neonatal intensive care unit in Japan found that 18 children were later diagnosed with AD, an incidence more than twice as high as previously reported. Children with AD had a significantly higher history of the meconium aspiration syndrome than the controls. (Author/DB)

  19. Studies on ascaridid, oxyurid and enoplid nematodes (Nematoda) from fishes of the Okavango River, Botswana

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Van As, L. L.


    Roč. 62, JUL 22 2015 (2015), s. 039 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : helminth parasites, * taxonomy * new species, * Cucullanus * Cithariniella * Synodontisia * Galeiceps * freshwater fish * Africa Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  20. 41 CFR 101-27.102 - Economic order quantity principle. (United States)


    ... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order quantity (EOQ) principle is a means for achieving economical inventory management. Application of the EOQ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity...