WorldWideScience

Sample records for meitnerium 270

  1. A270 Demo Schokgolfdemping

    NARCIS (Netherlands)

    Netten, B.D.; Broek, T.H.A. van den; Blom, G.

    2010-01-01

    In februari 2010 zijn een aantal grootschalige experimenten uitgevoerd op de A270 tussen Helmond en Eindhoven. Het doel van deze experimenten is om de potentie van coöperatieve systemen te demonstreren voor het dempen van schokgolven en daarmee de mobiliteit op de Nederlandse snelwegen te kunnen

  2. 30 CFR 270.6 - Process.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Process. 270.6 Section 270.6 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.6 Process. Whenever a Regional Director determines on the basis of any information...

  3. 30 CFR 270.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Discrimination prohibited. 270.4 Section 270.4 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.4 Discrimination prohibited. No contract or subcontract to which...

  4. 8 CFR 270.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Definitions. 270.1 Section 270.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.1 Definitions. For the purpose of this part— Document means an instrument on which is recorded, by means of...

  5. 8 CFR 270.3 - Penalties.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Penalties. 270.3 Section 270.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.3 Penalties. (a) Criminal penalties. Nothing in section 274C of the Act shall be construed to diminish or...

  6. 12 CFR 270.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 270.1 Section 270.1 Banks and... RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.1 Authority. This part is issued by the Federal Open Market Committee (the “Committee”) pursuant to authority...

  7. 24 CFR 990.270 - Asset management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Asset management. 990.270 Section... THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.270 Asset management. As owners, PHAs have asset management responsibilities that are above and beyond property management activities. These...

  8. 18 CFR 270.506 - Confidentiality.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Confidentiality. 270.506 Section 270.506 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION...) through (9) of 5 U.S.C. 552(b). (b) Upon receipt of a request for disclosure of information treated as...

  9. 32 CFR 270.5 - Staff.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Staff. 270.5 Section 270.5 National Defense... Staff. (a) The Commission will have a support staff, which will include staff members sufficient to expeditiously and efficiently process the applications for payments under this part. All members of the staff...

  10. 12 CFR 270.3 - Governing principles.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Governing principles. 270.3 Section 270.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF... Governing principles. As required by section 12A of the Federal Reserve Act, the time, character, and volume...

  11. 18 CFR 284.270 - Reporting requirements.

    Science.gov (United States)

    2010-04-01

    ... AUTHORITIES Emergency Natural Gas Sale, Transportation, and Exchange Transactions § 284.270 Reporting... transportation (excluding exchanges). Within 48 hours after deliveries commence in an emergency natural gas... natural gas commences, the initial recipient of the exchange volumes must notify the Commission by...

  12. 8 CFR 270.2 - Enforcement procedures.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.2 Enforcement procedures. (a) Procedures for the filing of complaints. Any person or entity... charges for document fraud committed by refugees at the time of entry. The Service shall not issue a...

  13. 12 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF FEDERAL RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.2 Definitions... as to principal and interest by, any agency of the United States. (d) The term System Open Market...

  14. 7 CFR 2.70 - Deputy Chief Economist.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Economist. 2.70 Section 2.70 Agriculture... GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist § 2.70 Deputy Chief Economist. Pursuant to § 2.29, the following delegation of authority is made by the Chief Economist to the...

  15. 48 CFR 942.270-2 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 942.270-2 Section 942.270-2 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract Administration Services 942.270-2 Contract clause. The clause at 952...

  16. 48 CFR 1336.270 - Special requirements for ship construction

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Special requirements for ship construction 1336.270 Section 1336.270 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 1336.270 Special...

  17. 50 CFR 270.21 - Petition of objection.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Petition of objection. 270.21 Section 270... § 270.21 Petition of objection. (a) Filing a petition. Any person issued a notice of assessment under... promotion plan by filing a written petition of objection with NMFS. Petitions of objection may be filed: (1...

  18. 32 CFR 270.19 - Reports to Congress.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Reports to Congress. 270.19 Section 270.19... Reports to Congress § 270.19 Reports to Congress. Not later than September 23, 1998, the Commission will prepare and the Secretary will submit to Congress a report on the payment of claims under this part...

  19. 50 CFR 270.13 - Books, records and reports.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Books, records and reports. 270.13 Section 270.13 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... § 270.13 Books, records and reports. (a) The Council must submit to NMFS the following documents...

  20. 15 CFR 270.105 - Duties of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Duties of a Team. 270.105 Section 270... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.105 Duties of a Team. (a) A Team's Lead...

  1. 31 CFR 270.4 - Fees for services.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fees for services. 270.4 Section 270.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE AVAILABILITY OF RECORDS § 270.4 Fees for services...

  2. 40 CFR 52.270 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.270 Section 52.270 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) With the exception of the areas listed in paragraph (b) of this section: (1... plan does not include approvable procedures for preventing the significant deterioration of air quality...

  3. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

  4. 15 CFR 270.2 - Definitions used in this part.

    Science.gov (United States)

    2010-01-01

    ... members, other NIST employees participating in the investigation, private sector experts, university... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions used in this part. 270.2... CONSTRUCTION SAFETY TEAMS General § 270.2 Definitions used in this part. The following definitions are...

  5. 48 CFR 552.270-27 - Integrated Agreement.

    Science.gov (United States)

    2010-10-01

    ... agreement, express or implied, shall be admissible to contradict the provisions of the Lease. (End of clause) ... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-27...

  6. 20 CFR 404.270 - Cost-of-living increases.

    Science.gov (United States)

    2010-04-01

    ... INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.270 Cost-of-living... rises in the cost of living. These automatic increases also apply to other benefit amounts, as described...

  7. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)

    2012-05-15

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  8. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    International Nuclear Information System (INIS)

    Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.

    2012-01-01

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  9. 48 CFR 536.270 - Exercise of options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Exercise of options. 536... Construction 536.270 Exercise of options. (a) If exercising an option, notify the contractor, in writing, within the time period specified in the contract. (b) Exercise options only after determining that all...

  10. 50 CFR 270.11 - Responsibilities of NMFS.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... part 270 and other applicable law, and approve or disapprove, marketing and promotion plans and budgets... disapproval of a marketing and promotion plan or budget, together with reasons for such disapproval; (3) Issue...

  11. 40 CFR 270.62 - Hazardous waste incinerator permits.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM Special Forms of Permits § 270.62 Hazardous waste incinerator permits. When an owner or operator of a hazardous waste... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Hazardous waste incinerator permits...

  12. 17 CFR 270.3a-2 - Transient investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Transient investment companies... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-2 Transient investment companies... which an issuer owns or proposes to acquire investment securities (as defined in section 3(a) of the Act...

  13. Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

  14. 17 CFR 270.0-11 - Customer identification programs.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer identification... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.0-11 Customer identification programs... implementing regulation at 31 CFR 103.131, which requires a customer identification program to be implemented...

  15. The Road Side Unit for the A270 Test Site

    NARCIS (Netherlands)

    Passchier, I.; Driessen, B.J.F.; Heijligers, B.M.R.; Netten, B.D.; Schackmann, P.P.M.

    2011-01-01

    The design and implementation of the Road Side Unit for the A270 Test Site is presented. It consists of a sensor platform and V2I communication platform with full coverage of the test site. A service platform enables applications to make use of these facilities. The RSU will be used both for the

  16. 48 CFR 719.270 - Small business policies.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business policies... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.270 Small business policies. (a) In keeping with... United States small business to participate equitably in the furnishing of supplies and services for...

  17. 48 CFR 552.270-26 - No Waiver.

    Science.gov (United States)

    2010-10-01

    ... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-26 No Waiver... remedy consequent upon a breach thereof, and no acceptance of full or partial rent or other performance by either party during the continuance of any such breach shall constitute a waiver of any such...

  18. 48 CFR 2852.102-270 - Incorporation in full text.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... 2852.102-270 Incorporation in full text. JAR provisions or clauses shall be incorporated in solicitations and contracts in full text. ...

  19. 50 CFR 270.16 - Deposit of funds.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.16... approved marketing plan and budget, funds collected through assessments authorized by the Act must be deposited in any interest-bearing account or certificate of deposit of a bank that is a member of the...

  20. 40 CFR 270.65 - Research, development, and demonstration permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Research, development, and... Special Forms of Permits § 270.65 Research, development, and demonstration permits. (a) The Administrator may issue a research, development, and demonstration permit for any hazardous waste treatment facility...

  1. 40 CFR 270.3 - Considerations under Federal law.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Considerations under Federal law. 270... Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of... applicable law requires consideration or adoption of particular permit conditions or requires the denial of a...

  2. 48 CFR 352.270-2 - Indian preference.

    Science.gov (United States)

    2010-10-01

    ...-2 Section 352.270-2 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND... regulations), sex, religion, or Tribal affiliation. To the extent feasible and consistent with the efficient... to existing laws and regulations), sex, religion, or Tribal affiliation. The Contractor also agrees...

  3. 48 CFR 218.270 - Head of contracting activity determinations.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 218.270 Head of contracting activity determinations. For contract... contracting activity,” as defined in FAR 2.101, in the following locations: (a) FAR 2.101: (1) Definition of...

  4. Introduction and feasibility study of the HD-270 MLC

    International Nuclear Information System (INIS)

    Kim, Dae Young; Kim Won Taek; Lee, Hwa Jung; Lee, Kang Hyeok

    2003-01-01

    The multileaf collimator(MLC) has many advantages, but use of the MLC increased effective penumbra and isodose undulation in dose distribution compared with that of an alloy block. In this work, we introduced the HD-270 MLC, which can improve the above disadvantages of MLC, and reported its feasibility study. The HD-270 MLC is a technique which combines the use of the existing Siemens multileaf collimator(3D MLC) with patient translation perpendicular to the leaf plane. The technique produces a smoothed isodose distribution with the reduced isodose undulation and effective penumbra. To assess the efficacy of the HD-270 technique and determine the appropriate resolution, a polygonal shaped MLC field was made to produce field edge angles from 0 degree to 75 degree with a step of 15 degree. Each HD-270 group was generated according to the allowed resolution, i. e., 5, 3, and 2 mm. The experiment was carried out on Primus, a Siemens linear accelerator configured with HD-270 MLC. The total 60 MU of 6 MV photon beam was delivered to X-Omat film (Kodak, USA) at a SAD of 100 cm and 1.5 cm depth in solid water phantom. Exposed films were scanned by Lumiscan75(LUMISYS) and analyzed using RIT113 software (Radiological Imaging Technology Inc., USA). To test the mechanical accuracy of table movement, the transverse, longitudinal, and vertical positions were controlled by a consol with ±5 mm, ±4 mm, ±3 mm, and ±2 mm steps, and then measured using a dial gauge with an accuracy of 0.001 inch. During the experiments, the table loaded with about 50 Kg human phantom to simulate the real treatment situation. The effective penumbra and isodose undulation became larger with increase the resolution and field edge angle. The accuracy of the table movement on each direction is good within the ±1 mm. Clinical use of the MLC can be increased by using of the HD-270 MLC which complements to the disadvantages of the MLC.

  5. 48 CFR 809.270 - Qualified products for convenience/labor-saving foods.

    Science.gov (United States)

    2010-10-01

    ... convenience/labor-saving foods. 809.270 Section 809.270 Federal Acquisition Regulations System DEPARTMENT OF... 809.270 Qualified products for convenience/labor-saving foods. (a) Each VISN Nutrition and Food Service representative is authorized to establish a common VISN QPL for convenience and labor-saving foods...

  6. 17 CFR 270.3a-1 - Certain prima facie investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain prima facie investment companies. 270.3a-1 Section 270.3a-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-1 Certain prima facie investment...

  7. 17 CFR 270.3c-2 - Definition of beneficial ownership in small business investment companies.

    Science.gov (United States)

    2010-04-01

    ... 1940 § 270.3c-2 Definition of beneficial ownership in small business investment companies. For the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial ownership in small business investment companies. 270.3c-2 Section 270.3c-2 Commodity and Securities...

  8. 17 CFR 270.6b-1 - Exemption of employees' securities company pending determination of application.

    Science.gov (United States)

    2010-04-01

    ...' securities company pending determination of application. 270.6b-1 Section 270.6b-1 Commodity and Securities... 1940 § 270.6b-1 Exemption of employees' securities company pending determination of application. Any... Act (54 Stat. 801; 15 U.S.C. 80a-6) shall be exempt, pending final determination of such application...

  9. 17 CFR 270.22c-1 - Pricing of redeemable securities for distribution, redemption and repurchase.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redeemable securities for distribution, redemption and repurchase. 270.22c-1 Section 270.22c-1 Commodity and Securities... 1940 § 270.22c-1 Pricing of redeemable securities for distribution, redemption and repurchase. (a) No...

  10. 18 CFR 270.501 - Publication of notice from jurisdictional agency.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Publication of notice from jurisdictional agency. 270.501 Section 270.501 Conservation of Power and Water Resources FEDERAL... to the extent the material is treated as confidential under § 270.506, at the offices of the...

  11. 17 CFR 270.22e-3 - Exemption for liquidation of money market funds.

    Science.gov (United States)

    2010-04-01

    ... money market funds. 270.22e-3 Section 270.22e-3 Commodity and Securities Exchanges SECURITIES AND... for liquidation of money market funds. (a) Exemption. A registered open-end management investment company or series thereof (“fund”) that is regulated as a money market fund under § 270.2a-7 is exempt...

  12. 15 CFR 270.106 - Conflicts of interest related to service on a Team.

    Science.gov (United States)

    2010-01-01

    ... service on a Team. 270.106 Section 270.106 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.106 Conflicts of interest related to service on a Team. (a) Team members who are not Federal employees will be...

  13. 15 CFR 270.102 - Conditions for establishment and deployment of a Team.

    Science.gov (United States)

    2010-01-01

    ... deployment of a Team. 270.102 Section 270.102 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.102 Conditions for establishment and deployment of a Team. (a) The Director may establish a Team for deployment...

  14. 48 CFR 209.270 - Aviation and ship critical safety items.

    Science.gov (United States)

    2010-10-01

    ... Requirements 209.270 Aviation and ship critical safety items. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Aviation and ship critical safety items. 209.270 Section 209.270 Federal Acquisition Regulations System DEFENSE ACQUISITION...

  15. 38 CFR 3.270 - Applicability of various dependency, income and estate regulations.

    Science.gov (United States)

    2010-07-01

    ... dependency, income and estate regulations. 3.270 Section 3.270 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Dependency, Income and Estate § 3.270 Applicability of various dependency, income and estate regulations. (a...

  16. Dirac-Hartree-Fock studies of X-ray transitions in meitnerium

    International Nuclear Information System (INIS)

    Thierfelder, C.; Schwerdtfeger, P.; Hessberger, F.P.; Hofmann, S.

    2008-01-01

    The K -shell and L -shell ionizations potentials for 268 109 Mt were calculated at the Dirac-Hartree-Fock level taking into account quantum electrodynamic and finite nuclear-size effects. The K α1 transition energies for different ionization states are accurately predicted and compared with recent experiments in the α -decay of 272 111 Rg. (orig.)

  17. 200 and 270 GHz SIS receivers development for atmospheric observation

    International Nuclear Information System (INIS)

    Ochiai, S.; Masuko, H.

    1993-01-01

    Superconducting mixers have been developed for observations of atmospheric minor constituents such as ClO and ozone at Communications Research Laboratory. This paper describes the work at development of 200 and 270 GHz SIS mixers. Nb/AlOx/Nb junctions were fabricated at Nobeyama Radio Observatory. The base Nb layer 200 nm, the Al (AlOx) insulation layer, and the counter Nb electrode 150 nm are sputtered. The area outside of a junction defined by etching of the counter electrode is insulated by anodized Nb layer and sputtered SiO 2 . After sputtering thick SiO 2 layer on the whole wafer, a contact hole is made by etching. The thickness of the wiring Nb layer is 500 nm. The junctions are formed on the 250 μm thick fused quartz substrate. After the process of the junction fabrication, the quartz substrate is shaved from the back side until 150 μm thickness. Each junction for 270 GHz mixer has an area of about 1 μm 2 . The normal resistance of the six junctions series array is around 70 Ω. The mixer block has a reduced waveguide (1.2 x 0.1 mm for 200 GHz and 0.98 x 0. 1 mm for 270 GHz). The waveguide has two tuners in addition to a fixed backshort cavity. This configuration can allow to realize the lower embedding impedance, and less sensitive to the position of the tuners. The SIS mixers are cooled in a closed cycle He refrigerator. The LO is optically injected through a Fabry Perot interferometer. The 5--7 GHz IF is fed to a HEMT amplifier cooled at 15 K. The authors have started a preliminary measurement of the noise temperature of the SIS receivers, and comparing with calculated DSB receiver noise temperature assuming 3-port model. They continue to improve the performance of the SIS mixers now. They intend that the receivers shall be utilized for atmospheric monitor from next winter

  18. 17 CFR 270.19a-1 - Written statement to accompany dividend payments by management companies.

    Science.gov (United States)

    2010-04-01

    ... that an open-end company may treat as a separate source its net profits from such sales during its... specify the sources from which the remainder was paid. Every company which in any fiscal year elects to... dividend payments by management companies. 270.19a-1 Section 270.19a-1 Commodity and Securities Exchanges...

  19. Reflux and Belching After 270 Degree Versus 360 Degree Laparoscopic Posterior Fundoplication

    NARCIS (Netherlands)

    Broeders, Joris A.; Bredenoord, Albert J.; Hazebroek, Eric J.; Broeders, Ivo A.; Gooszen, Hein G.; Smout, André J.

    2012-01-01

    Objective: To investigate differences in effects of 270 degrees (270 degrees LPF) and 360 degrees laparoscopic posterior fundoplication (360 degrees LPF) on reflux characteristics and belching. Background: Three hundred sixty degrees LPF greatly reduces the ability of the stomach to vent ingested

  20. 17 CFR 270.17f-2 - Custody of investments by registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... registered management investment company. 270.17f-2 Section 270.17f-2 Commodity and Securities Exchanges....17f-2 Custody of investments by registered management investment company. (a) The securities and similar investments of a registered management investment company may be maintained in the custody of such...

  1. 48 CFR 514.270-7 - Guidelines for using the price list method.

    Science.gov (United States)

    2010-10-01

    ... on knowledge of the supplies or services and previous contract prices. (d) First time use for an item... price list method. 514.270-7 Section 514.270-7 Federal Acquisition Regulations System GENERAL SERVICES... for using the price list method. (a) General. The price list method helps avoid unbalanced bidding...

  2. 15 CFR 270.104 - Size and composition of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Size and composition of a Team. 270... NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.104 Size and composition of...

  3. 17 CFR 270.24b-2 - Filing copies of sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

  4. 18 CFR 270.302 - Occluded natural gas produced from coal seams.

    Science.gov (United States)

    2010-04-01

    ... produced from coal seams. 270.302 Section 270.302 Conservation of Power and Water Resources FEDERAL ENERGY... produced from coal seams. A person seeking a determination that natural gas is occluded natural gas produced from coal seams must file an application with the jurisdictional agency which contains the...

  5. 40 CFR 158.270 - Experimental use permit data requirements for residue chemistry.

    Science.gov (United States)

    2010-07-01

    ... requirements for residue chemistry. 158.270 Section 158.270 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for residue chemistry. All residue chemistry data, as described in... section 408(r) is sought. Residue chemistry data are not required for an experimental use permit issued on...

  6. 17 CFR 270.17g-1 - Bonding of officers and employees of registered management investment companies.

    Science.gov (United States)

    2010-04-01

    ... employees of registered management investment companies. 270.17g-1 Section 270.17g-1 Commodity and... ACT OF 1940 § 270.17g-1 Bonding of officers and employees of registered management investment companies. (a) Each registered management investment company shall provide and maintain a bond which shall...

  7. 17 CFR 270.12b-1 - Distribution of shares by registered open-end management investment company.

    Science.gov (United States)

    2010-04-01

    ... registered open-end management investment company. 270.12b-1 Section 270.12b-1 Commodity and Securities... 1940 § 270.12b-1 Distribution of shares by registered open-end management investment company. (a)(1... the printing and mailing of sales literature; (b) A registered, open-end management investment company...

  8. 40 CFR 270.21 - Specific part B information requirements for landfills.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... and post-closure plans submitted under § 270.14(b)(13). (f) If ignitable or reactive wastes will be...

  9. 48 CFR 538.270 - Evaluation of multiple award schedule (MAS) offers.

    Science.gov (United States)

    2010-10-01

    ... SERVICES ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING FEDERAL SUPPLY SCHEDULE CONTRACTING Establishing and Administering Federal Supply Schedules 538.270 Evaluation of multiple award schedule (MAS) offers... determining the Government's price negotiation objectives, consider the following factors: (1) Aggregate...

  10. 21 CFR 137.270 - Self-rising white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising white corn meal. 137.270 Section 137... Cereal Flours and Related Products § 137.270 Self-rising white corn meal. (a) Self-rising white corn meal is an intimate mixture of white corn meal, sodium bicarbonate, and one or both of the acid-reacting...

  11. Event-related potential N270 as an index of social information conflict in explicit processing.

    Science.gov (United States)

    Wang, Pei; Tan, Chen-Hao; Li, Yu; Zhang, Qin; Wang, Yi-Bo; Luo, Jun-Long

    2018-01-01

    As N270 has been widely shown to be sensitive to nonsocial information conflict, the present study investigated whether social information conflict can elicit increased N270 in either explicit or implicit processing conditions. Gender stereotype-related picture-word pairs and picture-word pairs in specific colors were used as social and nonsocial information, respectively. Participants performed an explicit task based on the S1-S2 paradigm in Study 1, and both social and nonsocial information conditions elicited larger N270 than the no-conflict condition. In Study 2, participants performed a word judgment task that was modified from the S1-S2 paradigm of Study 1. However, neither social information nor nonsocial information elicited larger N270 within the conflict condition. Social trials generally elicited a more negative ERP waveform than nonsocial trials overall. These findings suggest that N270 may reflect the processing of social information conflict only in explicit conditions and also that the cognitive basis of N270 is thus a general but explicit processing of working memory representation conflict. Copyright © 2017. Published by Elsevier B.V.

  12. Stigmastadiene and specific extitntion (270 nm) to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

    OpenAIRE

    Aued-Pimentel,Sabria; Silva,Simone Alves Da; Takemoto,Emy; Cano,Cristiane Bonaldi

    2013-01-01

    The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270) and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these paramete...

  13. 17 CFR 270.8b-16 - Amendments to registration statement.

    Science.gov (United States)

    2010-04-01

    ... company's investment objectives or policies (described in Item 8.2 of Form N-2) that have not been... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.8b-16 Amendments to registration statement. (a) Every registered management investment company which is required to file a semi-annual report...

  14. 17 CFR 270.6c-6 - Exemption for certain registered separate accounts and other persons.

    Science.gov (United States)

    2010-04-01

    ... portfolio company has the same: (i) Investment objectives, (ii) Fundamental policies, and (iii) Voting... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.6c... which is, or is a part of, a unit investment trust registered under the Act, engaged in a continuous...

  15. 43 CFR 30.270 - How will the hearing be conducted?

    Science.gov (United States)

    2010-10-01

    ... PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.270 How will the hearing be conducted? (a) At the hearing, each party challenging the tribe's claim to purchase the interests in question or the...) On conclusion of the hearing, the judge will issue a decision that determines all of the issues...

  16. 17 CFR 270.10b-1 - Definition of regular broker or dealer.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.10b-1 Definition of regular broker or dealer. The term regular broker or dealer of an investment company shall mean: (a) One... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of regular broker...

  17. 17 CFR 270.5b-1 - Definition of “total assets.”

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.5b-1 Definition of “total assets... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âtotal assets.â..., shall mean the gross assets of the company with respect to which the computation is made, taken as of...

  18. 17 CFR 270.3c-5 - Beneficial ownership by knowledgeable employees and certain other persons.

    Science.gov (United States)

    2010-04-01

    ... Company. For purposes of this definition, the term “investment company” as used in section 2(a)(3) of the Act includes a Covered Company. (2) The term Covered Company means a Section 3(c)(1) Company or a... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c...

  19. 38 CFR 21.270 - Payment of subsistence allowance during leave and between periods of instruction.

    Science.gov (United States)

    2010-07-01

    ... Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Monetary Assistance Services § 21.270... veteran jointly determine that such payment is not in the veteran's interest: (1) A period between...

  20. 32 CFR 270.13 - No right to judicial review or legal cause of action.

    Science.gov (United States)

    2010-07-01

    ... DEMOCRATIC REPUBLIC OF VIETNAM Payment § 270.13 No right to judicial review or legal cause of action. Subject... 32 National Defense 2 2010-07-01 2010-07-01 false No right to judicial review or legal cause of..., and such review is specifically precluded. This part does not create or acknowledge any legal right or...

  1. 17 CFR 270.17a-8 - Mergers of affiliated companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Mergers of affiliated... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.17a-8 Mergers of affiliated companies. (a) Exemption of affiliated mergers. A Merger of a registered investment company (or a series thereof...

  2. 41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...

  3. 17 CFR 270.12d1-1 - Exemptions for investments in money market funds.

    Science.gov (United States)

    2010-04-01

    ...)(3) and 270.17e-1(d)(2), the payment of a commission, fee, or other remuneration to a broker shall be...) of the Act if: (1) The commission, fee, or other remuneration is paid in connection with the sale of... directors, the company's investment adviser performs the duties of the board of directors. [71 FR 36655...

  4. 40 CFR 270.315 - What air emissions control information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What air emissions control information... Facility § 270.315 What air emissions control information must I keep at my facility? If you have air emission control equipment subject to 40 CFR part 264, subpart CC, you must keep the following information...

  5. Performance of Jatropha Oil Blends in RD270 Two Cylinders Four ...

    African Journals Online (AJOL)

    The performance characteristics of RD270 two cylinder, four stroke diesel engine fuelled with jatropha oil and its blend with diesel are presented in this paper. The jatropha biodiesel was obtained from National Research Institutes for Chemical Technology, Zaria, Nigeria. The produced biodiesel was blended with neat ...

  6. 26 CFR 1.270-1 - Limitation on deductions allowable to individuals in certain cases.

    Science.gov (United States)

    2010-04-01

    ... cultivates, operates, or manages a farm for gain or profit, either as owner or tenant. An individual who... provisions relating to activities not engaged in for profit applicable to taxable years beginning after... THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.270-1 Limitation...

  7. 18 CFR 270.303 - Natural gas produced from Devonian shale.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Natural gas produced... DETERMINATION PROCEDURES Requirements for Filings With Jurisdictional Agencies § 270.303 Natural gas produced from Devonian shale. A person seeking a determination that natural gas is produced from Devonian shale...

  8. 40 CFR 415.270 - Applicability; description of the borax production subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the borax... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Borax Production Subcategory § 415.270 Applicability; description of the borax production subcategory. The...

  9. Evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I270/I255 corridor in St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the transportation users. The technical system ...

  10. Appendices : evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I-270/I-255 corridor in : St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the : transportation users. The technical system ...

  11. The 270 MeV deuteron beam polarimeter at the Nuclotron Internal Target Station

    Energy Technology Data Exchange (ETDEWEB)

    Kurilkin, P.K. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Ladygin, V.P., E-mail: vladygin@jinr.ru [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Uesaka, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Suda, K. [RIKEN Nishina Center, Saitama (Japan); Gurchin, Yu.V.; Isupov, A.Yu. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Itoh, K. [Department of Physics, Saitama University, Saitama (Japan); Janek, M. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Physics Department, University of Zilina, 010 26 Zilina (Slovakia); Karachuk, J.-T. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Advanced Research Institute for Electrical Engineering, Bucharest (Romania); Kawabata, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Khrenov, A.N.; Kiselev, A.S.; Kizka, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Kliman, J. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia); Krasnov, V.A.; Livanov, A.N. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Nuclear Research, Moscow (Russian Federation); Maeda, Y. [Kyushi University, Hakozaki (Japan); Malakhov, A.I. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Matousek, V.; Morhach, M. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia)

    2011-06-21

    A deuteron beam polarimeter has been constructed at the Internal Target Station at the Nuclotron of JINR. The polarimeter is based on spin-asymmetry measurements in the d-p elastic scattering at large angles and the deuteron kinetic energy of 270 MeV. It allows to measure vector and tensor components of the deuteron beam polarization simultaneously.

  12. 17 CFR 270.30b1-7 - Monthly report for money market funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Monthly report for money... money market funds. (a) Report. Every registered open-end management investment company, or series thereof, that is regulated as a money market fund under § 270.2a-7 must file with the Commission a monthly...

  13. 17 CFR 270.24b-3 - Sales literature deemed filed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  14. 20 CFR 645.270 - What procedures are there to ensure that currently employed workers may file grievances regarding...

    Science.gov (United States)

    2010-04-01

    ... gender discrimination? 645.270 Section 645.270 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... regarding displacement, health and safety standards and gender discrimination? (a) The State shall establish...) Participants alleging gender discrimination by WtW programs that are not part of the One-Stop system may file a...

  15. 40 CFR 270.22 - Specific part B information requirements for boilers and industrial furnaces burning hazardous...

    Science.gov (United States)

    2010-07-01

    ... requirements for boilers and industrial furnaces burning hazardous waste. 270.22 Section 270.22 Protection of... requirements for boilers and industrial furnaces burning hazardous waste. When an owner or operator of a cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric acid...

  16. 17 CFR 270.30b1-1 - Semi-annual report for registered management investment companies.

    Science.gov (United States)

    2010-04-01

    ... registered management investment companies. 270.30b1-1 Section 270.30b1-1 Commodity and Securities Exchanges....30b1-1 Semi-annual report for registered management investment companies. Every registered management... management investment company that has filed a registration statement with the Commission registering its...

  17. 45 CFR 270.7 - What data will we use to measure performance on the work support and other measures?

    Science.gov (United States)

    2010-10-01

    ... measure performance on the work support and other measures? (a) We will use Census Bureau data to rank... 45 Public Welfare 2 2010-10-01 2010-10-01 false What data will we use to measure performance on the work support and other measures? 270.7 Section 270.7 Public Welfare Regulations Relating to Public...

  18. 17 CFR 270.22e-2 - Pricing of redemption requests in accordance with Rule 22c-1.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redemption requests in accordance with Rule 22c-1. 270.22e-2 Section 270.22e-2 Commodity and Securities Exchanges....22e-2 Pricing of redemption requests in accordance with Rule 22c-1. An investment company shall not be...

  19. Melitrast in coronary angiography; Roentgenkontrastmittel Melitrast-300 und Melitrast-270 in der kardiologischen Diagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Geisler, T.; Funke, B.; Wild, P.; Zotz, R. [Medizinische Klinik, Klinikum Schwalmstadt, Schwalmstadt (Germany); Dietz, G.; Petrov, R. [Dr. F. Koehler Chemie, Alsbach-Haehnlein (Germany); Stefenelli, U. [Fachinstitut fuer Statistik, Wuerzburg (Germany)

    2004-07-01

    The aim of this study was the evaluation of safety and cardiologic efficacy of the non-ionic contrast agent Iosarcol (Melitrast), a contrast agent with low protein affinity in two different iodine concentrations. One hundred patients were prospectively randomized to receive either Melitrast-270 or Melitrast-300 for left heart ventriculography and coronary angiography. Clinical evaluation, blood pressure and pulse measurement were performed and an electrocardiogram was recorded before and after contrast application and the diagnostic efficacy using a score was evaluated. In three patients side effects could be observed 2 hours after the application (vertigo, sickness, sweating). Melitrast in both concentrations led to a good contrast during ventriculography and coronary angiography which could not be differentiated by two experienced observers. Thus a lower iodine concentration and by this a lower viscosity seems to favour Melitrast-270 for invasive cardiologic diagnosis. (orig.)

  20. 17 CFR 270.6c-10 - Exemption for certain open-end management investment companies to impose deferred sales loads.

    Science.gov (United States)

    2010-04-01

    ... management investment companies to impose deferred sales loads. 270.6c-10 Section 270.6c-10 Commodity and... ACT OF 1940 § 270.6c-10 Exemption for certain open-end management investment companies to impose... purposes of this section: (1) Company means a registered open-end management investment company, other than...

  1. 17 CFR 270.18f-2 - Fair and equitable treatment for holders of each class or series of stock of series investment...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fair and equitable treatment for holders of each class or series of stock of series investment companies. 270.18f-2 Section 270.18f... or series of stock of series investment companies. (a) For purposes of this § 270.18f-2 a series...

  2. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  3. 17 CFR 270.3a-3 - Certain investment companies owned by companies which are not investment companies.

    Science.gov (United States)

    2010-04-01

    ... the definition of the term “investment company” by section 3(b)(1) or 3(b)(2) of the Act (15 U.S.C... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain investment companies owned by companies which are not investment companies. 270.3a-3 Section 270.3a-3 Commodity and...

  4. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    Energy Technology Data Exchange (ETDEWEB)

    W. S. Thompson

    2005-12-14

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  5. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    International Nuclear Information System (INIS)

    Thompson, W.S.

    2005-01-01

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  6. The electrical characteristics of copper slags in a 270 kVA DC arc furnace

    International Nuclear Information System (INIS)

    Derin, Bora; Sahin, Filiz Cinar; Yucel, Onuralp

    2003-01-01

    The electrical resistance of slags is the main criteria to determine the design and the operation conditions of slag resistance furnace (SRF) depending on temperature and composition. In this study, a 270 kVA DC electric arc furnace were used to determine the electrical characteristic of molten ancient copper slags. The specific conductivity of the slag was estimated by using furnace geometric factor given in the literature as an empirical formula and by using furnace resistance measured during smelting of the copper slag with or without different additives such as coke, CaO and Al 2 O 3 . (Original)

  7. Technological aspects at continuous casting of semi-finished products with ϕ270mm

    International Nuclear Information System (INIS)

    Ardelean, E; Ardelean, M; Hepuţ, T; Lăscuţoni, A

    2015-01-01

    Continuous casting installation especially appreciated because steel can be poured in a more varied assortment. The flexibility of the system is not sufficient if the casting parameters are not properly adopted and adapted to the specific brand of steel. This paper presents some technical aspects relative to continuous casting of semi-finished products with ϕ270mm section. Graphical dependencies obtained in Excel and analytical equations of this allows to specialists from industry to adopt values for the addicted parameters according to the independent ones, already known. (paper)

  8. Stigmastadiene and specific extitntion (270 nm to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

    Directory of Open Access Journals (Sweden)

    Sabria Aued-Pimentel

    2013-09-01

    Full Text Available The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270 and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these parameters, seven samples of extra virgin olive oil and three samples of olive oil (blend of virgin and refined were analyzed. Among the samples analyzed, four extra virgin samples had levels of stigmastadiene and E 270 higher than expected, among which two were adulterated with seed oil (rich in linoleic acid and the other two with olive pomace oil. The results demonstrate the higher sensitivity of stigmastadiene to determine the presence of the refined oil in virgin olive oil and good agreement with determining E 270. The latter technique is a simple, quick, and low cost method of determination that can be easily implemented in laboratories to assist in the screening and regulation of olive oils sold in Brazil.

  9. 17 CFR 270.12d2-1 - Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act.

    Science.gov (United States)

    2010-04-01

    ..., INVESTMENT COMPANY ACT OF 1940 § 270.12d2-1 Definition of insurance company for purposes of sections 12(d)(2... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act. 270.12d2-1 Section 270.12d2-1 Commodity...

  10. N270 sensitivity to conflict strength and working memory: A combined ERP and sLORETA study.

    Science.gov (United States)

    Scannella, Sébastien; Pariente, Jérémie; De Boissezon, Xavier; Castel-Lacanal, Evelyne; Chauveau, Nicolas; Causse, Mickaël; Dehais, Frédéric; Pastor, Josette

    2016-01-15

    The event-related potential N270 component is known to be an electrophysiological marker of the supramodal conflict processing. However little is know about the factors that may modulate its amplitude. In particular, among all studies that have investigated the N270, little or no control of the conflict strength and of the load in working memory have been done leaving a lack in the understanding of this component. We designed a spatial audiovisual conflict task with simultaneous target and cross-modal distractor to evaluate the N270 sensitivity to the conflict strength (i.e., visual target with auditory distractor or auditory target with visual distractor) and the load in working memory (goal task maintenance with frequent change in the target modality). In a first session, participants had to focus on one modality for the target position to be considered (left-hand or right-hand) while the distractor could be at the same side (compatible) or at opposite side (incompatible). In a second session, we used the same set of stimuli as in the first session with an additional distinct auditory signal that clued the participants to frequently switch between the auditory and the visual targets. We found that (1) reaction times and N270 amplitudes for conflicting situations were larger within the auditory target condition compared to the visual one, (2) the increase in target maintenance effort led to equivalent increase of both reaction times and N270 amplitudes within all conditions and (3) the right dorsolateral prefrontal cortex current density was higher for both conflicting and active maintenance of the target situations. These results provide new evidence that the N270 component is an electrophysiological marker of the supramodal conflict processing that is sensitive to the conflict strength and that conflict processing and active maintenance of the task goal are two functions of a common executive attention system. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Nature of the 153 and 270 keV transitions in /sup 119/Sb from sup(119m)Te

    Energy Technology Data Exchange (ETDEWEB)

    Sahota, H S [Punjabi Univ., Patiala (India). Dept. of Physics

    1982-08-01

    The 153 and 270 keV transitions in /sup 119/Sb have been investigated for the presence of any anomalous conversion through conversion electron intensity and conversion-electron gamma and gamma-gamma directional correlation measurements. The resulting subshell ratios and particle rarameters have been analysed for the accurate determination of mixing ratios for the transitions. The results are delta/sub 153/ = +-0.0025 and delta/sub 270/ = 0.10 sub(-0.20)sup(+0.03). The conversion process has been found to be normal in both cases.

  12. Spin Flipping and Polarization Lifetimes of a 270 MeV Deuteron Beam

    International Nuclear Information System (INIS)

    Morozov, V.S.; Crawford, M.Q.; Etienne, Z.B.; Kandes, M.C.; Krisch, A.D.; Leonova, M.A.; Sivers, D.W.; Wong, V.K.; Yonehara, K.; Anferov, V.A.; Meyer, H.O.; Schwandt, P.; Stephenson, E.J.; Przewoski, B. von

    2003-01-01

    We recently studied the spin flipping of a 270 MeV vertically polarized deuteron beam stored in the IUCF Cooler Ring. We swept an rf solenoid's frequency through an rf-induced spin resonance and observed the effect on the beam's vector and tensor polarizations. After optimizing the resonance crossing rate and setting the solenoid's voltage to its maximum value, we obtained a spin-flip efficiency of about 94 ± 1% for the vector polarization; we also observed a partial spin-flip of the tensor polarization. We then used the rf-induced resonance to measure the vector and tensor polarizations' lifetimes at different distances from the resonance; the polarization lifetime ratio τvector/τtensor was about 1.9 ± 0.4

  13. Measurement of turbulent flows in a square sectioned 270 .deg. bend

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sok Hyu; Lee, Gun Hyee [Wonkwang Univ., Iksan (Korea, Republic of); Chun, Kun Ho [Korea Univ., Seoul (Korea, Republic of)

    2000-07-01

    Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall.

  14. Measurement of turbulent flows in a square sectioned 270 .deg. bend

    International Nuclear Information System (INIS)

    Cho, Sok Hyu; Lee, Gun Hyee; Chun, Kun Ho

    2000-01-01

    Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall

  15. 17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...

  16. 40 CFR 270.235 - Options for incinerators, cement kilns, lightweight aggregate kilns, solid fuel boilers, liquid...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Options for incinerators, cement kilns... Technology (MACT) Standards § 270.235 Options for incinerators, cement kilns, lightweight aggregate kilns... incinerator, cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric...

  17. Effect of food on the pharmacokinetics of oral MMI270B (CGS 27023A), a novel matrix metalloproteinase inhibitor

    NARCIS (Netherlands)

    F.A.L.M. Eskens (Ferry); N.C. Levitt; A. Sparreboom (Alex); L. Choi; R. Mather; J. Verweij (Jaap); A.L. Harris

    2000-01-01

    textabstractMMI270B is a matrix metalloproteinase inhibitor (MMPI) with in vitro and in vivo activity. To exert optimal target inhibition, MMPI must be given chronically, and therefore, oral bioavailability is important. We analyzed the effect of food intake on AUC0-8

  18. MODELING SUPERSONIC-JET DEFLECTION IN THE HERBIG–HARO 110-270 SYSTEM WITH HIGH-POWER LASERS

    International Nuclear Information System (INIS)

    Yuan, Dawei; Li, Yutong; Lu, Xin; Yin, Chuanlei; Su, Luning; Liao, Guoqian; Zhang, Jie; Wu, Junfeng; Wang, Lifeng; He, Xiantu; Zhong, Jiayong; Wei, Huigang; Zhang, Kai; Han, Bo; Zhao, Gang; Jiang, Shaoen; Du, Kai; Ding, Yongkun; Zhu, Jianqiang

    2015-01-01

    Herbig–Haro (HH) objects associated with newly born stars are typically characterized by two high Mach number jets ejected in opposite directions. However, HH 110 appears to only have a single jet instead of two. Recently, Kajdi et al. measured the proper motions of knots in the whole system and noted that HH 110 is a continuation of the nearby HH 270. It has been proved that the HH 270 collides with the surrounding mediums and is deflected by 58°, reshaping itself as HH 110. Although the scales of the astrophysical objects are very different from the plasmas created in the laboratory, similarity criteria of physical processes allow us to simulate the jet deflection in the HH 110/270 system in the laboratory with high power lasers. A controllable and repeatable laboratory experiment could give us insight into the deflection behavior. Here we show a well downscaled experiment in which a laser-produced supersonic-jet is deflected by 55° when colliding with a nearby orthogonal side-flow. We also present a two-dimensional hydrodynamic simulation with the Euler program, LARED-S, to reproduce the deflection. Both are in good agreement. Our results show that the large deflection angle formed in the HH 110/270 system is probably due to the ram pressure from a flow–flow collision model

  19. Isolation and partial characterization of gypsy moth BTR-270, an anionic brush border membrane glycoconjugate that binds Bacillus thuringiensis Cry1A toxins with high affinity

    Science.gov (United States)

    Algimantas P. Valaitis; Jeremy L. Jenkins; Mi Kyong Lee; Donald H. Dean; Karen J. Garner

    2001-01-01

    BTR-270, a gypsy moth (Lymantria dispar) brush border membrane molecule that binds Bacillus thuringiensis (Bt) Cry1A toxins with high affinity, was purified by preparative gel electrophoresis. Rabbit antibodies specific for the Bt toxin-binding molecule were raised. Attempts to label BTR-270 by protein-directed techniques were...

  20. 17 CFR 270.32a-3 - Exemption from provision of section 32(a)(1) regarding the time period during which a registered...

    Science.gov (United States)

    2010-04-01

    ... select an independent public accountant. 270.32a-3 Section 270.32a-3 Commodity and Securities Exchanges... management investment company must select an independent public accountant. (a) A registered management... U.S.C. 80a-31(a)(1)) that the independent public accountant (“accountant”) be selected at a board of...

  1. 17 CFR 270.26a-2 - Exemptions from certain provisions of sections 26 and 27 for registered separate accounts and...

    Science.gov (United States)

    2010-04-01

    ... deduction of certain fees and charges from the assets of such accounts. 270.26a-2 Section 270.26a-2... registered separate accounts and others regarding custodianship of and deduction of certain fees and charges... by any State or other governmental entity and, if the separate account is registered under the Act as...

  2. 17 CFR 270.12d3-1 - Exemption of acquisitions of securities issued by persons engaged in securities related businesses.

    Science.gov (United States)

    2010-04-01

    ... securities issued by persons engaged in securities related businesses. 270.12d3-1 Section 270.12d3-1... in securities related businesses. (a) Notwithstanding section 12(d)(3) of the Act, a registered... securities related business, the determination required by paragraph (b) of this section shall be made as...

  3. 270GHz SiGe BiCMOS manufacturing process platform for mmWave applications

    Science.gov (United States)

    Kar-Roy, Arjun; Preisler, Edward J.; Talor, George; Yan, Zhixin; Booth, Roger; Zheng, Jie; Chaudhry, Samir; Howard, David; Racanelli, Marco

    2011-11-01

    TowerJazz has been offering the high volume commercial SiGe BiCMOS process technology platform, SBC18, for more than a decade. In this paper, we describe the TowerJazz SBC18H3 SiGe BiCMOS process which integrates a production ready 240GHz FT / 270 GHz FMAX SiGe HBT on a 1.8V/3.3V dual gate oxide CMOS process in the SBC18 technology platform. The high-speed NPNs in SBC18H3 process have demonstrated NFMIN of ~2dB at 40GHz, a BVceo of 1.6V and a dc current gain of 1200. This state-of-the-art process also comes with P-I-N diodes with high isolation and low insertion losses, Schottky diodes capable of exceeding cut-off frequencies of 1THz, high density stacked MIM capacitors, MOS and high performance junction varactors characterized up to 50GHz, thick upper metal layers for inductors, and various resistors such as low value and high value unsilicided poly resistors, metal and nwell resistors. Applications of the SBC18H3 platform for millimeter-wave products for automotive radars, phased array radars and Wband imaging are presented.

  4. Automatic whole core depletion and criticality calculations by MCNPX 2.7.0

    International Nuclear Information System (INIS)

    Kalcheva, S.; Koonen, E.

    2012-01-01

    Different approaches to perform automatic whole core criticality and depletion calculations in a research reactor using MCNPX 2.7.0 are presented. An approximate method is to use the existing symmetries of the burned fuel material distribution in the core, i.e., the axial, radial and azimuth symmetries around the core center, in order to significantly reduce the computation time. In this case it is not necessary to give a unique material number to each burn up cell. Cells having similar burn up and power, achieved during similar irradiation history at same initial fuel composition, will experience similar composition evolution and can therefore be given the same material number. To study the impact of the number of unique burn up materials on the computation time and utilized RAM memory, several MCNPX models have been developed. The paper discusses the accuracy of the model on comparison with measurements of BR2 operation cycles in function of the number of unique burn up materials and the impact of the used Q-value (MeV/fission) of the recoverable fission energy. (authors)

  5. Comparison of mouse, guinea pig and rabbit models for evaluation of plague subunit vaccine F1+rV270.

    Science.gov (United States)

    Qi, Zhizhen; Zhou, Lei; Zhang, Qingwen; Ren, Lingling; Dai, Ruixia; Wu, Benchuan; Wang, Tang; Zhu, Ziwen; Yang, Yonghai; Cui, Baizhong; Wang, Zuyun; Wang, Hu; Qiu, Yefeng; Guo, Zhaobiao; Yang, Ruifu; Wang, Xiaoyi

    2010-02-10

    In this study, a new subunit vaccine that comprised native F1 and recombinant rV270 was evaluated for protective efficacy using mouse, guinea pig and rabbit models in comparison with the live attenuated vaccine EV76. Complete protection against challenging with 10(6) colony-forming units (CFU) of virulent Yersinia pestis strain 141 was observed for mice immunized with the subunit vaccines and EV76 vaccine. In contrast, the subunit vaccine recipes VII (F1-20 microg+rV270-10 microg) and IX (F1-40 microg+rV270-20 microg) and EV76 vaccine provided 86%, 79% and 93% protection against the same level of challenge in guinea pigs and 100%, 83% and 100% protection in rabbits, respectively. The immunized mice with the vaccines had significantly higher IgG titres than the guinea pigs and rabbits, and the immunized guinea pigs developed significantly higher IgG titres than the rabbits, but the anti-F1 response in guinea pigs was more variable than in the mice and rabbits, indicating that guinea pig is not an ideal model for evaluating protective efficacy of plague subunit vaccine, instead the rabbits could be used as an alternative model. All the immunized animals with EV76 developed a negligible IgG titre to rV270 antigen. Furthermore, analysis of IgG subclasses in the immunized animals showed a strong response for IgG1, whereas those receiving EV76 immunization demonstrated predominant production of IgG1 and IgG2a isotypes. The subunit vaccine and EV76 vaccine are able to provide protection for animals against Y. pestis challenge, but the subunit vaccines have obvious advantages over EV76 in terms of safety of use. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

  6. Functional and genetic epidemiological characterisation of the FFAR4 (GPR120) p.R270H variant in the Danish population

    DEFF Research Database (Denmark)

    Vestmar, Marie Aare; Andersson, Ehm A; Christensen, Charlotte Riis

    2016-01-01

    . Association with quantitative metabolic traits comprised 8720 non-diabetic individuals. RESULTS: p.R270H showed reduced surface expression of FFAR4. Ligand-independent activity was eliminated and strongly impaired through the Gq and Gi signalling pathways, respectively. The ligand-induced maximal signalling...... reactive protein; hs-CRP) and liver function (alanine aminotransferase) in the Danish population (p>0.05). CONCLUSIONS: We demonstrate that p.R270H of FFAR4 impairs Gq and Gi signalling of FFAR4 in vitro; however, this impaired signalling for p.R270H does not translate into associations with human...

  7. Outcomes of Solo Smart valve in a single-center experience of 270 patients.

    Science.gov (United States)

    Liu, Hao; Khani-Hanjani, Abbas; Yang, Siyuan; Wang, Wei; Sidhu, Surita; Mullen, John; Modry, Dennis; Wang, Shaohua

    2018-04-03

    The Solo Smart pericardial aortic valve has been widely used in Europe as an option for aortic valve replacement (AVR). We are reporting early and midterm clinical outcomes of AVR with the Solo Smart valve in a single North America center. This is a retrospective study of 270 consecutive patients who had AVR at Mazankowski Alberta Heart Institute from February 2011 to March 2015. Follow-up and echocardiographic data were collected retrospectively from electronic and paper charts. Univariate and multivariate analysis were performed to evaluate the results. The mean age was 71.2±10.0 years, 67.4% were male, and 79.3% had combined procedures. Mean STS Score was 4.18±3.91. Early mortality was 3.7% for the entire group and 0% for isolated aortic valve replacement group. Mean cross-clamp time for isolated AVR and AVR with concomitant procedure was 70.8±12.7min and 117.0±45.0min, respectively. Permanent pacemaker implantation was necessary in 2.2% of patients. Echocardiography demonstrated a reduction in mean gradients from 40.8±17.4mmHg to 7.6±3.7 mmHg and peak gradient from 72.5 ± 48.8 mmHg to 15.5±7.5 mmHg. The 1-, 3-, and 5- year overall survival was 93.0%, 86.5% and 75.9%, respectively. At 5 years, freedom from valve-related death was 92.4%, freedom from structural valve deterioration and freedom from aortic valve reoperation were 96.4% and 98%, respectively. The Solo Smart valve is safe and has excellent hemodynamic performance. Aortic valve reoperation and rates of valve-related adverse events during midterm follow-up were low.

  8. SHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

    Directory of Open Access Journals (Sweden)

    Jefferson Olivatto da Silva

    2011-09-01

    Full Text Available Resenha do livroSHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

  9. Oral administration of type-II collagen peptide 250-270 suppresses specific cellular and humoral immune response in collagen-induced arthritis.

    Science.gov (United States)

    Zhu, Ping; Li, Xiao-Yan; Wang, Hong-Kun; Jia, Jun-Feng; Zheng, Zhao-Hui; Ding, Jin; Fan, Chun-Mei

    2007-01-01

    Oral antigen is an attractive approach for the treatment of autoimmune and inflammatory diseases. Establishment of immune markers and methods in evaluating the effects of antigen-specific cellular and humoral immune responses will help the application of oral tolerance in the treatment of human diseases. The present article observed the effects of chicken collagen II (CII), the recombinant polymerized human collagen II 250-270 (rhCII 250-270) peptide and synthesized human CII 250-270 (syCII 250-270) peptide on the induction of antigen-specific autoimmune response in rheumatoid arthritis (RA) peripheral blood mononuclear cells (PBMC) and on the specific cellular and humoral immune response in collagen-induced arthritis (CIA) and mice fed with CII (250-270) prior to immunization with CII. In the study, proliferation, activation and intracellular cytokine production of antigen-specific T lymphocytes were simultaneously analyzed by bromodeoxyuridine (BrdU) incorporation and flow cytometry at the single-cell level. The antigen-specific antibody and antibody-forming cells were detected by ELISA and ELISPOT, respectively. CII (250-270) was found to have stimulated the response of specific lymphocytes in PBMC from RA patients, including the increase expression of surface activation antigen marker CD69 and CD25, and DNA synthesis. Mice, fed with CII (250-270) before CII immunization, had significantly lower arthritic scores than the mice immunized with CII alone, and the body weight of the former increased during the study period. Furthermore, the specific T cell activity, proliferation and secretion of interferon (IFN)-gamma in spleen cells were actively suppressed in CII (250-270)-fed mice, and the serum anti-CII, anti-CII (250-270) antibody activities and the frequency of specific antibody-forming spleen cells were significantly lower in CII (250-270)-fed mice than in mice immunized with CII alone. These observations suggest that oral administration of CII (250-270) can

  10. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  11. MCSE Core Elective Exams in a Nutshell Covers exams 70-270, 70-297, and 70-298

    CERN Document Server

    Bhardwaj, Pawan

    2006-01-01

    For Windows XP and Windows Server 2003 administrators preparing forMicrosoft Certified Systems Engineer (MCSE) core exam 70-270, and core exams 70-297, and 70-298, this book is invaluable. Not only does it provide the resources you need to succeed on the exams, but to succeed in the real world as well. Think of this book as the notes you would have taken if you were to capture every essential nugget of information related to the skills measured in the core elective exams. To begin with, MCSE Core Elective Exams in a Nutshell allows you to see all of the topics expected for mastery in each

  12. [Treatment of mallet finger with dorsal nail glued splint: retrospective analysis of 270 cases].

    Science.gov (United States)

    Facca, S; Nonnenmacher, J; Liverneaux, P

    2007-11-01

    Management of mallet finger is both difficult and controversial. Sequelae are not uncommon, particularly after surgical treatment. Many authors advocate orthopedic treatment which is less invasive but requires greater patient participation to implement. Despite the large number of orthopedic methods proposed, none has proven superiority. We report here our experience with a dorsal adhesive splint which preserves digital pulp function and improves observance. This retrospective analysis included 270 mallet fingers presenting 153 tendon injuries and 117 bony injuries in 265 patients aged 42 years on average and treated from 2003 to 2005. Most of the tendon injuries involved the medius (38.7%) and most of the bony injuries involved the ring finger (35.4%). A splint was fashioned for the two distal phalanges and glued to the nail plate filed for this purpose. The splint was fashioned out of an L-shaped plastic sheet of thermo-malleable plastic dipped in hot water (60 degrees C). The L was molded to the dorsal aspect of the phalanges and rolled like a ring around the second phalanx, then glued to the nail. The splint was worn for eight weeks by patients with a tendon injury and six weeks for those with a bony injury. The splint was then worn at night for two weeks. Three criteria were used to analyze outcome: residual extension deficit, joint involvement, complications. Mean follow-up was 18 months. Mean time from trauma to definitive installation of the splint was six days. The complication rate for this orthopedic method was 14.3%, complications being observed in 6% of patients. All complications were transient except for one case of swan neck deformity and one case of painful osteoarthritis. Thirty splints (11%) became unglued but were all reinstalled using the same protocol. Thirty fingers (14%) presented residual deficit of active extension measuring less than 20 degrees. The quality of the result depended on the type of injury: tendon injuries led to extension

  13. Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.

    Directory of Open Access Journals (Sweden)

    Alexander Belyy

    Full Text Available Clostridium perfringens iota toxin is a binary toxin composed of the enzymatically active component Ia and receptor binding component Ib. Ia is an ADP-ribosyltransferase, which modifies Arg177 of actin. The previously determined crystal structure of the actin-Ia complex suggested involvement of Asp179 of actin in the ADP-ribosylation reaction. To gain more insights into the structural requirements of actin to serve as a substrate for toxin-catalyzed ADP-ribosylation, we engineered Saccharomyces cerevisiae strains, in which wild type actin was replaced by actin variants with substitutions in residues located on the Ia-actin interface. Expression of the actin mutant Arg177Lys resulted in complete resistance towards Ia. Actin mutation of Asp179 did not change Ia-induced ADP-ribosylation and growth inhibition of S. cerevisiae. By contrast, substitution of Glu270 of actin inhibited the toxic action of Ia and the ADP-ribosylation of actin. In vitro transcribed/translated human β-actin confirmed the crucial role of Glu270 in ADP-ribosylation of actin by Ia.

  14. Symptomatic type 1 protein C deficiency caused by a de novo Ser270Leu mutation in the catalytic domain

    DEFF Research Database (Denmark)

    Lind, B; Koefoed, P; Thorsen, S

    2001-01-01

    the intracellular content of mutant and wild-type protein was similar. Northern blot analysis of total mRNA from transfected cells showed no reduction of the mutant protein C mRNA compared with wild-type protein C mRNA. Collectively, these results indicate that the Ser270Leu mutation in the affected family caused......Heterozygosity for a C8524T transition in the protein C gene converting Ser270(TCG) to Leu(TTG) in the protease domain was identified in a family with venous thrombosis. The mutation was associated with parallel reduction in plasma levels of protein C anticoagulant activity and protein C antigen......, which is consistent with a type 1 deficiency. Transient expression of mutant protein C cDNA in human kidney 293 cells and analysis of protein C antigen in culture media and cell lysates showed that the secretion of mutant protein compared with wild-type protein was reduced by at least 97% while...

  15. THE COMPLETE, TEMPERATURE-RESOLVED EXPERIMENTAL SPECTRUM OF VINYL CYANIDE (H2CCHCN) BETWEEN 210 AND 270 GHz

    International Nuclear Information System (INIS)

    Fortman, Sarah M.; Neese, Christopher F.; De Lucia, Frank C.; Medvedev, Ivan R.

    2011-01-01

    The results of an experimental approach to the identification and characterization of the astrophysical weed vinyl cyanide in the 210-270 GHz region are reported. This approach is based on spectrally complete, intensity-calibrated spectra taken at more than 400 different temperatures in the 210-270 GHz region and is used to produce catalogs in the usual astrophysical format: line frequency, line strength, and lower state energy. As in our earlier study of ethyl cyanide, we also include the results of a frequency point-by-point analysis, which is especially well suited for characterizing weak lines and blended lines in crowded spectra. This study shows substantial incompleteness in the quantum-mechanical (QM) models used to calculate astrophysical catalogs, primarily due to their omission of many low-lying vibrational states of vinyl cyanide, but also due to the exclusion of perturbed rotational transitions. Unlike ethyl cyanide, the QM catalogs for vinyl cyanide include analyses of perturbed excited vibrational states, whose modeling is more challenging. Accordingly, we include an empirical study of the frequency accuracy of these QM models. We observe modest frequency differences for some vibrationally excited lines.

  16. Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

    International Nuclear Information System (INIS)

    Janek, M.; Saito, T.; Hatano, M.; Kato, H.; Sakoda, S.; Uchigashima, N.; Yako, K.; Ladygin, V.P.; Isupov, A. Yu.; Ladygina, N.B.; Malakhov, A.I.; Reznikov, S.G.; Vasiliev, T.A.; Uesaka, T.; Maeda, Y.; Suda, K.; Nishikawa, J.; Ohnishi, T.; Sakamoto, N.; Sekiguchi, K.; Okamura, H.; Sakai, H.

    2007-01-01

    The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd → 3 Hen obtained at T d =270 MeV in the angular range 0 -110 in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrate the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m. (orig.)

  17. Ressonância magnética na esclerose múltipla: análise de 270 casos

    Directory of Open Access Journals (Sweden)

    Minguetti Guilberto

    2001-01-01

    Full Text Available O autor apresenta 270 casos de pacientes com história clínica e imagens de ressonância magnética compatíveis com esclerose múltipla. São feitas considerações sobre a incidência quanto ao sexo, grupos etários e localização das lesões. Por se tratar de doença considerada rara nos países tropicais, o autor tece considerações didáticas sobre os critérios clínicos e de imagem úteis na prática radiológica e alerta os neurologistas para o significado desta doença na capital (Curitiba de um estado brasileiro (Paraná situado entre os paralelos 22º e 30º Sul.

  18. Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

    International Nuclear Information System (INIS)

    Janek, M.; Saito, T.; Ladygin, V.P.

    2007-01-01

    The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd→ 3 Hen reaction obtained at T d =270 MeV in the angular range 0-110 deg in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrates the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m

  19. 17 CFR 270.2a51-2 - Definitions of beneficial owner for certain purposes under sections 2(a)(51) and 3(c)(7) and...

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a51-2 Definitions of... exception set forth in this subparagraph, be excluded from the definition of investment company solely by... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions of beneficial...

  20. 20 CFR 662.270 - How are the costs of providing services through the One-Stop delivery system and the operating...

    Science.gov (United States)

    2010-04-01

    ... through the One-Stop delivery system and the operating costs of the system to be funded? 662.270 Section... and the operating costs of the system to be funded? The MOU must describe the particular funding arrangements for services and operating costs of the One-Stop delivery system. Each partner must contribute a...

  1. 17 CFR 270.3c-3 - Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt securities offered by small business... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-3 Definition of certain...

  2. 17 CFR 270.2a-4 - Definition of “current net asset value” for use in computing periodically the current price of...

    Science.gov (United States)

    2010-04-01

    ... value between calculations made as of the close of the New York Stock Exchange on the preceding business... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âcurrent net... Section 270.2a-4 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES...

  3. Beam Cherenkov counter conception for in line identification of 270 GeV/c Σ- Ξ- and Ω-

    International Nuclear Information System (INIS)

    Touillon, R.

    1991-06-01

    The purpose of this thesis is to design a beam Cerenkov counter. This counter will provide an on line identification of the Σ - , Ξ - and Ω - hyperons (270 GeV/c) in the experiment WA89 at CERN. The acceptance of the detector should allow tagging these hyperons in a large momentum range (± 25%) and for a beam divergence up to 250 microrad. The first part of this report is devoted to the physical goals such as the study of charmed baryons, the search of multiquark states, and the determination of hadronic and electromagnetic hyperon radii. The experimental WA89 setup is also presented. The major part deals with the design of the Cerenkov counter. The dimension of the detector, the Cerenkov angle value, the focal length of the spherical mirror, etc... are derived from a Monte-Carlo simulation. Various methods of simple photon detection (gaz detector: TEA, TMAE; solid detectors: PM and Image Intensifier) are investigated. The most performing solution uses two conical mirrors in order to reduce the size of the Cerenkov circles and an image intensifier (which detects the single photon) followed by an optical fiber matrix transmitting the luminous signal to 160 photomultipliers. The on line procedure for calculating the radius of each circle (identification of the particle) is studied in detail. Finally, the optimization of the optical system to achromatize the Cerenkov light is discussed [fr

  4. Randomized clinical trial of 270° posterior versus 180° anterior partial laparoscopic fundoplication for gastro-oesophageal reflux disease.

    Science.gov (United States)

    Roks, D J; Koetje, J H; Oor, J E; Broeders, J A; Nieuwenhuijs, V B; Hazebroek, E J

    2017-06-01

    Partial fundoplications provide similar reflux control with fewer post-fundoplication symptoms compared with Nissen fundoplication for gastro-oesophageal reflux disease (GORD). The best choice of procedure for partial fundoplication remains unclear. The aim of this study was to compare the outcome of two different types of partial fundoplication for GORD. A double-blind RCT was conducted between 2012 and 2015 in two hospitals specializing in antireflux surgery. Patients were randomized to undergo either a laparoscopic 270° posterior fundoplication (Toupet) or a laparoscopic 180° anterior fundoplication. The primary outcome was postoperative dysphagia at 12 months, measured by the Dakkak score. Subjective outcome was analysed at 1, 3, 6 and 12 months after surgery. Objective reflux control was assessed before and 6 months after surgery. Ninety-four patients were randomized to laparoscopic Toupet or laparoscopic 180° anterior fundoplication (47 in each group). At 12 months, 85 patients (90 per cent) were available for follow-up. Objective scores were available for 76 (81 per cent). Postoperative Dakkak dysphagia score at 12 months was similar in the two groups (mean 5·9 for Toupet versus 6·4 for anterior fundoplication; P = 0·773). Subjective outcome at 12 months demonstrated no significant differences in control of reflux or post-fundoplication symptoms. Overall satisfaction and willingness to undergo surgery did not differ between the groups. Postoperative endoscopy and 24-h pH monitoring showed no significant differences in mean oesophageal acid exposure time or recurrent pathological oesophageal acid exposure. Both types of partial fundoplication provided similar control of GORD at 12 months, with no difference in post-fundoplication symptoms. Registration number: NTR5702 (www.trialregister.nl). © 2017 BJS Society Ltd Published by John Wiley & Sons Ltd.

  5. Spin-isospin excitation in sd-shell nuclei studied by the (d,2He) reaction at Ed=270MeV

    International Nuclear Information System (INIS)

    Niizeki, T.; Ohnuma, H.; Yamamoto, T.; Katoh, K.; Yamashita, T.; Hara, Y.; Okamura, H.; Sakai, H.; Ishida, S.; Sakamoto, N.; Otsu, H.; Wakasa, T.; Uesaka, T.; Satou, Y.; Fujita, T.; Ichihara, T.; Orihara, H.; Toyokawa, H.; Hatanaka, K.; Kato, S.; Kubono, S.; Yosoi, M.

    1994-01-01

    The (d, 2 He) reactions on 24 Mg, 26 Mg and 28 Si were studied at E d =270MeV. The 0 cross sections obtained for the 1 + states from the 24 Mg, 28 Si(d, 2 He) reactions show a good correlation with those from the mirror (p,n) reactions. Four peaks were identified in the 26 Mg(d, 2 He) 26 Ne reaction as being due to the 1 + excitation. The B(GT + ) values for these transitions were estimated and compared with the shell model prediction. ((orig.))

  6. Prevalence of and risk factors associated with cesarean section in Lebanon - A retrospective study based on a sample of 29,270 women.

    Science.gov (United States)

    Zgheib, Sandy M; Kacim, Mohammad; Kostev, Karel

    2017-12-01

    During the last decades, there has been an alarming and dramatic increase in the number of cesarean births in both developed and undeveloped countries. This increase has not been clinically justified but, nevertheless, has raised an important number of issues. The aim of this study was to determine the risk factors associated with the high cesarean section rates in Lebanon. This study is based on a sample of 29,270 Lebanese women who were pregnant between 2000 and 2015. Among these, 14,327 gave birth by cesarean section and 14,943 gave birth vaginally. To identify the risk factors of cesarean section, logistic regression was applied as a statistical method using the SPSS statistical package. Of the 29,270 pregnant women included in the study, 49% had cesarean sections while 51% gave birth vaginally. Repeat cesarean section accounted for 23% while vaginal birth after cesarean accounted for only 0.2% of deliveries. In addition, weekdays were associated with a preference of providers to carry out more cesarean sections. According to an analysis of our data using logistic regression, the risk factors associated with the increase in cesarean section rates were advanced maternal age, elective cesarean section, malpresentation of fetus, multiple birth, prolonged pregnancy, prolonged labor, and fetal distress. Based on these results, it is recommended that a new health policy be implemented to reduce the number of unnecessary cesarean deliveries in Lebanon. Copyright © 2017 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  7. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

    Science.gov (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

    2014-05-02

    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  8. Fission of 209 Bi by 60-270 MeV tagged photons: cross section measurement and analysis of photo fissility

    International Nuclear Information System (INIS)

    Terranova, M.L.; Tavares, O.A.P.

    1996-07-01

    Tagged photons produced by the ROKK-2 facility have been used to measure the photofission cross section of 209 Bi in the energy range 60-270 MeV. Photofission events were detected by using a nuclear fragment detector designed for fission experiments, based on multiwire spark counters. Fissility values have been deduced and compared with available data obtained in other laboratories by using monochromatic photons. These data, together with early measurements obtained near photofission threshold, have been analysed in the framework of a two-step model which considers the primary photo interaction occurring via the quasi-deuteron and/or photo mesonic processes, followed by a mechanism of evaporation-fission competition for the excited residual nucleus. The model was found to reproduce the main experimental features of 209 Bi photo fissility up to 300 MeV. (author). 52 refs., 7 figs., 2 tabs

  9. Preconditioner and convergence study for the Quantum Computer Aided Design (QCAD) nonlinear poisson problem posed on the Ottawa Flat 270 design geometry.

    Energy Technology Data Exchange (ETDEWEB)

    Kalashnikova, Irina

    2012-05-01

    A numerical study aimed to evaluate different preconditioners within the Trilinos Ifpack and ML packages for the Quantum Computer Aided Design (QCAD) non-linear Poisson problem implemented within the Albany code base and posed on the Ottawa Flat 270 design geometry is performed. This study led to some new development of Albany that allows the user to select an ML preconditioner with Zoltan repartitioning based on nodal coordinates, which is summarized. Convergence of the numerical solutions computed within the QCAD computational suite with successive mesh refinement is examined in two metrics, the mean value of the solution (an L{sup 1} norm) and the field integral of the solution (L{sup 2} norm).

  10. Lessons from Iowa : development of a 270 megawatt compressed air energy storage project in midwest Independent System Operator : a study for the DOE Energy Storage Systems Program.

    Energy Technology Data Exchange (ETDEWEB)

    Holst, Kent (Iowa Stored Energy Plant Agency, Traer, IA); Huff, Georgianne; Schulte, Robert H. (Schulte Associates LLC, Northfield, MN); Critelli, Nicholas (Critelli Law Office PC, Des Moines, IA)

    2012-01-01

    The Iowa Stored Energy Park was an innovative, 270 Megawatt, $400 million compressed air energy storage (CAES) project proposed for in-service near Des Moines, Iowa, in 2015. After eight years in development the project was terminated because of site geological limitations. However, much was learned in the development process regarding what it takes to do a utility-scale, bulk energy storage facility and coordinate it with regional renewable wind energy resources in an Independent System Operator (ISO) marketplace. Lessons include the costs and long-term economics of a CAES facility compared to conventional natural gas-fired generation alternatives; market, legislative, and contract issues related to enabling energy storage in an ISO market; the importance of due diligence in project management; and community relations and marketing for siting of large energy projects. Although many of the lessons relate to CAES applications in particular, most of the lessons learned are independent of site location or geology, or even the particular energy storage technology involved.

  11. Silicon photomultiplier readout of a monolithic 270 x 5 x 5 cm{sup 3} plastic scintillator bar for time of flight applications

    Energy Technology Data Exchange (ETDEWEB)

    Roeder, Marko; Bemmerer, Daniel; Heidel, Klaus; Stach, Daniel; Wagner, Andreas; Weinberger, David [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); Cowan, Thomas E.; Gohl, Stefan; Reinicke, Stefan [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); TU Dresden (Germany); Reinhardt, Tobias P.; Zuber, Kai [TU Dresden (Germany); Collaboration: R3B-Collaboration

    2016-07-01

    The detection of 200-1000 MeV neutrons requires large amounts of detector material because of the long nuclear interaction length of these particles. In the example of the NeuLAND neutron time-of-flight detector at FAIR, this is accomplished by using 3000 scintillator bars of 270 x 5 x 5 cm{sup 3} size made of the fast plastic polyvinyltoluene. In the present work, we investigated whether silicon photomultiplier (SiPM) photosensors can replace fast timing photomultiplier tubes. The response of the system consisting of scintillator, SiPM, and preamplifier was studied using 30 MeV single electrons provided by the ELBE superconducting electron linac. The results were interpreted by a simple Monte Carlo simulation, and the time resolution was found to obey an inverse-square-root scaling law with the number of fired pixels. In the electron beam tests, a time resolution of σ{sub t}=136 ps was reached with a pure SiPM readout, well within the design parameters for NeuLAND.

  12. Excess mortality, causes of death and life expectancy in 270,770 patients with recent onset of mental disorders in Denmark, Finland and Sweden.

    Directory of Open Access Journals (Sweden)

    Merete Nordentoft

    Full Text Available BACKGROUND: Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations. OBJECTIVE: To investigate the excess mortality in different diagnostic categories due to suicide and other external causes of death, and due to specific causes in connection with diseases and medical conditions. METHODS: In longitudinal national psychiatric case registers from Denmark, Finland, and Sweden, a cohort of 270,770 recent-onset patients, who at least once during the period 2000 to 2006 were admitted due to a psychiatric disorder, were followed until death or the end of 2006. They were followed for 912,279 person years, and 28,088 deaths were analyzed. Life expectancy and standardized cause-specific mortality rates were estimated in each diagnostic group in all three countries. RESULTS: The life expectancy was generally approximately 15 years shorter for women and 20 years shorter for men, compared to the general population. Mortality due to diseases and medical conditions was increased two- to three-fold, while excess mortality from external causes ranged from three- to 77-fold. Mortality due to diseases and medical conditions was generally lowest in patients with affective disorders and highest in patients with substance abuse and personality disorders, while mortality due to suicide was highest in patients with affective disorders and personality disorders, and mortality due to other external causes was highest in patients with substance abuse. CONCLUSIONS: These alarming figures call for action in order to prevent the high mortality.

  13. Phase Change Material Selection for Thermal Energy Storage at High Temperature Range between 210 °C and 270 °C

    Directory of Open Access Journals (Sweden)

    José Miguel Maldonado

    2018-04-01

    Full Text Available The improvement of thermal energy storage systems implemented in solar technologies increases not only their performance but also their dispatchability and competitiveness in the energy market. Latent heat thermal energy storage systems are one of those storing methods. Therefore, the need of finding the best materials for each application becomes an appealing research subject. The main goal of this paper is to find suitable and economically viable materials able to work as phase change material (PCM within the temperature range of 210–270 °C and endure daily loading and unloading processes in a system with Fresnel collector and an organic Rankine cycle (ORC. Twenty-six materials have been tested and characterized in terms of their thermophysical conditions, thermal and cycling stability, and health hazard. Two materials out of the 26 candidates achieved the last stage of the selection process. However, one of the two finalists would require an inert working atmosphere, which would highly increase the cost for the real scale application. This leads to a unique suitable material, solar salt (40 wt % KNO3/60 wt % NaNO3.

  14. Comparison in myelography between iodixanol 270 and 320 mgI/ml and iotrolan 300 mgI/ml: a multicentre, randomised, parallel-group, double-blind, phase III trial

    International Nuclear Information System (INIS)

    Palmers, Yvan; Kuhn, Fritz-Peter; Petersen, Dirk; De Greef, Danielle

    2002-01-01

    The objective of the trial was to compare the safety and efficacy of the non-ionic, dimeric, isotonic contrast medium iodixanol (Visipaque 270 and 320 mgI/ml) with those of iotrolan (Isovist 300 mgI/ml) in myelography. After lumbar or cervical puncture, 315 patients were examined in a multicentre, double-blind, randomised, comparative myelography study. Image quality, changes in vital signs, immediate and delayed adverse events were registered. There was a tendency for better images with iodixanol 320 than with iodixanol 270 and iotrolan 300, but the overall quality was good or excellent with all products. The frequency of patients reporting adverse events and headache varied much across centres, but there was no statistically significant difference between the contrast media. The incidence of events was higher after lumbar puncture than after cervical puncture, in women rather than in men, and after puncture with a 22-gauge (G) bevel-tipped needle compared with a 24 G Sprotte needle. The frequency of headache did not correlate with the absence of pathology. The higher iodine concentration in iodixanol 320 could be an advantage for film quality. When compared with iotrolan 300, iodixanol 320 and 270 give similar incidences of adverse events, including headache. (orig.)

  15. Millennial-scale climatic variability between 340 000 and 270 000 years ago in SW Europe: evidence from a NW Iberian margin pollen sequence

    Directory of Open Access Journals (Sweden)

    S. Desprat

    2009-03-01

    Full Text Available We present a new high-resolution marine pollen record from NW Iberian margin sediments (core MD03-2697 covering the interval between 340 000 and 270 000 years ago, a time period centred on Marine Isotope Stage (MIS 9 and characterized by particular baseline climate states. This study enables the documentation of vegetation changes in the north-western Iberian Peninsula and therefore the terrestrial climatic variability at orbital and in particular at millennial scales during MIS 9, directly on a marine stratigraphy. Suborbital vegetation changes in NW Iberia in response to cool/cold events are detected throughout the studied interval even during MIS 9e ice volume minimum. However, they appear more frequent and of higher amplitude during the 30 000 years following the MIS 9e interglacial period and during the MIS 9a-8 transition, which correspond to intervals of an intermediate to high ice volume and mainly periods of ice growth. Each suborbital cold event detected in NW Iberia has a counterpart in the Southern Iberian margin SST record. High to moderate amplitude cold episodes detected on land and in the ocean appear to be related to changes in deep water circulation and probably to iceberg discharges at least during MIS 9d, the mid-MIS 9c cold event and MIS 9b. This work provides therefore additional evidence of pervasive millennial-scale climatic variability in the North Atlantic borderlands throughout past climatic cycles of the Late Pleistocene, regardless of glacial state. However, ice volume might have an indirect influence on the amplitude of the millennial climatic changes in Southern Europe.

  16. Prevalence of pain medication prescriptions in France, Germany, and the UK - a cross-sectional study including 4,270,142 patients.

    Science.gov (United States)

    Jacob, Louis; Kostev, Karel

    2018-01-01

    The goal of the present study was to analyze the prevalence of pain medication prescriptions in general practices in France, Germany, and the UK. This study included all patients aged ≥18 years followed in 2016 in general practitioner practices in France, Germany and the UK. The primary outcome was the prevalence of patients receiving prescriptions for pain medications in France, Germany, and the UK in 2016. The following drugs were included in the analysis: anti-inflammatory and antirheumatic products, non-steroids and analgesics including opioids, antimigraine preparations, and other analgesics and antipyretics. Demographic variables included age and gender. This study included 4,270,142 patients. The prevalences of pain medication prescriptions were 57.3% in France, 29.6% in Germany, and 21.7% in the UK. Although this prevalence generally remained consistent between age groups in France (54.3%-60.3%), it increased with age in Germany (18-30 years: 23.8%; >70 years: 35.8%) and in the UK (18-30 years: 9.3%; >70 years: 43.8%). Finally, the prevalence of pain medication prescriptions was higher in women than in men in all three countries. Paracetamol was prescribed to 82.3% and 60.1% of patients receiving pain medication in France and the UK, respectively, whereas ibuprofen was prescribed to 46.5% of individuals in Germany. The prevalence of pain medication prescriptions was higher in France than in Germany and the UK. Further research is needed to gain a better understanding of the differences in the prescription patterns between these three European countries.

  17. The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV and at zero degree

    International Nuclear Information System (INIS)

    Ladygin, V.P.; Uesaka, T.; Saito, T.

    2005-01-01

    The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero degree obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 He-n and 3 H-p channels are in agreement within experimental accuracy

  18. Tensor analyzing power T20 of the dd →3Hen and dd →3Hp reactions at zero angle for energies 140, 200, and 270 MeV

    International Nuclear Information System (INIS)

    Ladygin, V. P.; Uesaka, T.; Saito, T.; Hatano, M.; Isupov, A. Yu.; Kato, H.; Ladygina, N. B.; Maeda, Y.; Malakhov, A. I.; Nishikawa, J.; Ohnishi, T.; Okamura, H.; Reznikov, S. G.; Sakai, H.; Sakamoto, N.; Sakoda, S.; Satou, Y.; Sekiguchi, K.; Suda, K.; Tamii, A.

    2006-01-01

    RIKEN Accelerator Research Facility data on the tensor analyzing power T 20 of the dd → 3 Hen and dd → 3 Hp reactions at zero angle for deuteron kinetic energies of 140, 200, and 270 MeV are reported. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S-wave ratio in the 3 He and 3 H wave functions in the energy range of the experiment. Data on T 20 for the 3 Hen channel are in agreement with those for the 3 Hp channel within the experimental errors

  19. The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV at zero angle

    International Nuclear Information System (INIS)

    Ladygin, V.P.; ); Uesaka, T.; Saito, T.

    2006-01-01

    The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero angle obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 Hen and 3 Hp channels are in agreement within experimental accuracy [ru

  20. 18 CFR 270.401 - Jurisdictional agency.

    Science.gov (United States)

    2010-04-01

    ..., Springfield, VA 22153. (5) California, except Naval Petroleum Reserve No. 1 (Elk Hills) and No. 2 (Buena Vista..., Office of Conservation, PO Box 94275, Baton Rouge, LA 70804. (15) Maryland—Department of Natural...

  1. 50 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... restaurant trade, but whose primary business function is not the processing or packaging of fish or fish... harvesters. Research means any type of research designed to advance the image, desirability, usage...

  2. 18 CFR 270.101 - General definitions.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... gas produced from coal seams means naturally occurring natural gas released from entrapment from the fractures, pores and bedding planes of coal seams. (7) Natural gas produced from Devonian shale means...

  3. 18 CFR 270.201 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... jurisdictional agencies for tight formation gas, occluded natural gas produced from coal seams, and natural gas...

  4. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Giving Back — IDRC photo contest winner shares prize with Senegalese colleagues. Brendan Baker can be called many things: an engineer, an international volunteer, an award-winning photographer, and, evidently, a generous man. The winner of IDRC's “Expose Urban Solutions” photo contest, Baker shared his CA$2.

  5. Reference: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e development of the root system with nutritional cues. The putative high-affinity nitrate transporter NRT2....1 represses lateral root initiation in response to nutritional cues. 38 13693-8 1

  6. 21 CFR 1271.270 - Records.

    Science.gov (United States)

    2010-04-01

    ... particular HCT/P involved. (b) Records management system. You must establish and maintain a records management system relating to core CGTP requirements. Under this system, records pertaining to a particular... procedures, and equipment logs) must also be maintained and organized under the records management system. If...

  7. 40 CFR 1065.270 - Chemiluminescent detector.

    Science.gov (United States)

    2010-07-01

    ... Chemiluminescent detector. (a) Application. You may use a chemiluminescent detector (CLD) to measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept a CLD for NOX...) Component requirements. We recommend that you use a CLD that meets the specifications in Table 1 of § 1065...

  8. 40 CFR 82.270 - Prohibitions.

    Science.gov (United States)

    2010-07-01

    ... newly manufacture any halon blend. Halon blends manufactured solely for the purpose of aviation fire... capable of recycling the blend to the relevant industry standards for the chemical purity of each... April 6, 1998 the provision that the blend must be returned to it or its designee for recycling; and (3...

  9. 40 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... (formerly referred to as the Federal Water Pollution Control Act or Federal Water Pollution Control Act... constituent thereof may enter the environment or be emitted into the air or discharged into any waters... may consist of several treatment, storage, or disposal operational units (for example, one or more...

  10. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-04-20

    Seeking justice: Women's police stations in Latin America. On April 20, 2009, in the small town of Diriomo, Nicaragua, Luz Marina Lezama Suazo, aged 47, was shot dead, allegedly by her husband. According to her sister, “She'd been having problems with him for a while and we had told her to leave.

  11. 50 CFR 270.3 - Submission of application.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... Marketing Council for one or more species of fish and fish products of that species. One signed original and.... Applications should not be bound. (b) The application consists of four parts: (1) A document requesting NMFS to...

  12. Measuring temperatures with modified Kleiber 270B pyrometer

    International Nuclear Information System (INIS)

    Osch, E.V. van.

    1995-05-01

    At ECN a fast pyrometer is being used as a diagnostic tool for plasma disruption simulation experiments on candidate plasma facing materials for future thermonuclear fusion devices such as NET or ITER. The pyrometer is being used to measure the surface temperature response of the materials to short pulse high heat loads as induced by high power laser or electron beam, simulating the disrupting plasma's energy deposition. A procedure to measure surface temperatures without having to know surface emissivity in advance is described. The formulae needed in this procedure to obtain the correct temperature, starting from the initial incorrect temperature reading, are derived. Inversely, the formula to determine the emissivity of the surface when its temperature is known is equally derived. Finally, a small study on background level sensitivity is presented, showing the, in general, small effect of background on the temperature measurement. (orig.)

  13. 48 CFR 352.270-5 - Care of laboratory animals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Care of laboratory animals... of laboratory animals. (a) As prescribed in 370.403(a), the Contracting Officer shall insert the... on Humane Care and Use of Laboratory Animals (January 2006) The Public Health Service (PHS) Policy on...

  14. 50 CFR 270.10 - Responsibilities of a Council.

    Science.gov (United States)

    2010-10-01

    ... economic, market, social, demographic, and biological information as deemed necessary by NMFS; (8) Maintain books and records, prepare and submit to NMFS reports in accordance with respect to the receipt and... contain references to any private brand or trade name and will avoid the use of deceptive acts or...

  15. Literature review on induced exposure models, Task 2 HS-270

    Science.gov (United States)

    1982-02-01

    Sections 1, 2 and 3 of this report describe the development of : induced exposure models, together with d discussion of questions : of validity. These Sections focus on the most important and : relevant results from the literature, while Appendix A c...

  16. 17 CFR 270.2a-7 - Money market funds.

    Science.gov (United States)

    2010-04-01

    ... portfolio securities are valued at the fund's Acquisition cost as adjusted for amortization of premium or...-Rounding Method of pricing means the method of computing an investment company's price per share for... within the procedures adopted by the board of directors shall be the following: (A) Shadow Pricing...

  17. 24 CFR 234.270 - Condition of the multifamily structure.

    Science.gov (United States)

    2010-04-01

    .... (b) If the property has been damaged by fire and such property was not covered by fire insurance at... Commissioner without deduction from the insurance benefits for any loss occasioned by such fire if the following conditions are met: (1) The property shall have been covered by fire insurance at the time the...

  18. 48 CFR 352.270-8 - Prostitution and related activities.

    Science.gov (United States)

    2010-10-01

    .../AIDS, or endorse, utilize, or participate in a prevention method or treatment program to which it has a..., medical supplies, logistics support, data management, and freight forwarding. Notwithstanding the... Officer: (1) Organizational Integrity Certification: “I certify that (insert Contractor's name), which...

  19. 48 CFR 1816.402-270 - NASA technical performance incentives.

    Science.gov (United States)

    2010-10-01

    ... under procedures other than FAR part 12 at the discretion of the procurement officer upon consideration of the guidelines in 1816.402. Performance incentives, which are objective and measure hardware... negative, and its associated unit of measurement should reflect the value to the Government of that level...

  20. 32 CFR 270.8 - Authorization of payment.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS COMPENSATION OF CERTAIN FORMER OPERATIVES INCARCERATED BY THE DEMOCRATIC REPUBLIC OF VIETNAM... purpose. Any payment authorized to a person under a legal disability, may, in the discretion of the Commission, be paid for the use of the person, to the natural or legal guardian, committee, conservator, or...

  1. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  2. 21 CFR 172.270 - Sulfated butyl oleate.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION... edible vegetable oil using 1-butanol. Following sulfation, the reaction mixture is washed with water and...

  3. P270: Factors associated with fall rate in psychogeriatric residents

    NARCIS (Netherlands)

    Kosse, N.M.; de Groot, Maartje H; Hortobágyi, T.; Lamoth, C.J.C.

    2014-01-01

    Introduction: Falls in psychogeriatric residents represent a costly but unresolved safety issue. Identifying fall risk factors and their inter-relationship may help to individualize prevention programs and increase the effectiveness. Therefore, we aimed to examine the relationship between patient

  4. A Society Based on Work. Information Series No. 270.

    Science.gov (United States)

    Carnevale, Anthony Patrick

    American society is based on work. The industrial revolution exposed a growing proportion of the population to unemployment, underemployment, and dislocation. Early theoreticians believed that unemployment was a temporary labor market imbalance that would correct itself with downward wage adjustments. John Maynard Keynes, on the other hand, argued…

  5. 48 CFR 552.270-29 - Acceptance of Space.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Acceptance of Space. 552... Acceptance of Space. As prescribed in 570.603, insert the following clause: Acceptance of Space (SEP 1999) (a... designated representative shall promptly inspect the space. (b) The Government will accept the space and the...

  6. 48 CFR 352.270-4 - Protection of human subjects.

    Science.gov (United States)

    2010-10-01

    ... subjects as well as to graphic, written, or recorded information derived from individually identifiable... relation to both the potential benefits, if any, to the subjects and the importance of the knowledge to be... contract until the Contractor corrects the noncompliance. The Contracting Officer may communicate the...

  7. 10 CFR 205.270 - Off-the-record communications.

    Science.gov (United States)

    2010-01-01

    ... 18 CFR 1.30(f), against participation in the decision-making process by Department employees who... and any responses made to it. (4) With 48 hours of receiving, making or knowingly causing to be made a...

  8. All projects related to | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: PUBLISHING, INTELLECTUAL PROPERTY, COPYRIGHT, ACCESS TO INFORMATION, Internet, STUDENTS. Region: Brazil, South America, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, Far East Asia, South Asia. Program: Networked Economies. Total Funding: ...

  9. 46 CFR 28.270 - Instruction, drills, and safety orientation.

    Science.gov (United States)

    2010-10-01

    ... Lines or With More Than 16 Individuals On Board, or for Fish Tender Vessels Engaged in the Aleutian... outfit and a self-contained breathing apparatus, if the vessel is so equipped; (8) Making a voice radio...

  10. 7 CFR 205.270 - Organic handling requirements.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT..., heating, drying, mixing, grinding, churning, separating, distilling, extracting, slaughtering, cutting... packaging, canning, jarring, or otherwise enclosing food in a container may be used to process an...

  11. 48 CFR 247.270-2 - Technical provisions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...

  12. 32 CFR 270.11 - Limitation on disbursements.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS COMPENSATION OF CERTAIN FORMER OPERATIVES INCARCERATED BY THE DEMOCRATIC REPUBLIC OF VIETNAM... eligible for the payment, i.e., the commando, his surviving spouse, children, parents, or siblings. The...

  13. 1935 15' Quad #270 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  14. 32 CFR 270.7 - Verification of eligibility.

    Science.gov (United States)

    2010-07-01

    ...) Maintain a liaison with on-site personnel at the National Archives Center, College Park, Maryland, to organize and translate finance records for review. (3) Upon receipt of each Application for Compensation of...

  15. 12 CFR 270.4 - Transactions in obligations.

    Science.gov (United States)

    2010-01-01

    ... OPERATIONS OF FEDERAL RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks... engage in open market operations as directed by the Committee. (b) Transactions for the System Open... open market operations and the effectuation of open market policies. [38 FR 2753, Jan. 30, 1973, as...

  16. 40 CFR 98.270 - Definition of source category.

    Science.gov (United States)

    2010-07-01

    ... this section: (1) Chemical recovery furnaces at kraft and soda mills (including recovery furnaces that burn spent pulping liquor produced by both the kraft and semichemical process). (2) Chemical recovery... into paperboard products (e.g., containers), or operate coating and laminating processes. (b) The...

  17. 48 CFR 1339.270 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... COMMERCE SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information... to 1352.239-71, Electronic and Information Technology, in solicitations for Electronic and...

  18. 17 CFR 270.18f-3 - Multiple class companies.

    Science.gov (United States)

    2010-04-01

    ... appreciation and depreciation, and Fundwide Expenses shall be allocated based on one of the following methods... each day's income, realized gains and losses, unrealized appreciation and depreciation, and Fundwide... gains or losses, and unrealized appreciation or depreciation, based on the operating results of the...

  19. 48 CFR 552.270-2 - Historic Preference.

    Science.gov (United States)

    2010-10-01

    ... in the competition, the Government will give a 2.5 percent price preference to suitable non-historic... Government will give a 2.5 percent price preference to suitable non-historic developed or undeveloped sites... tradeoffs among price and non-price factors, the Government will give a price evaluation preference, based...

  20. 40 CFR 61.270 - Applicability and designation of sources.

    Science.gov (United States)

    2010-07-01

    ... specific gravity within the range of specific gravities specified in ASTM D836-84 for Industrial Grade... attached to motor vehicles such as trucks, rail cars, barges, or ships. (e) This subpart does not apply to...

  1. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... include, without limitation, controls and procedures designed to ensure that information required to be...

  2. 48 CFR 514.270-2 - Guidelines for use.

    Science.gov (United States)

    2010-10-01

    ... furnish the types and quantities of supplies or services in the aggregate. (2) How grouping delivery... cases it serves GSA's best interest to combine two or more line items for an aggregate award. Such cases... for similar articles or services is impractical. (b) Before deciding to combine items for aggregate...

  3. 17 CFR 270.8b-12 - Requirements as to paper, printing and language.

    Science.gov (United States)

    2010-04-01

    ... and font, bold-face type, italics and red ink, by presenting all required information in a format... and other tabular data included therein shall be in roman type at least as large as 10-point modern type. However, to the extent necessary for convenient presentation, financial statements and other...

  4. 46 CFR 170.270 - Door design, operation, installation, and testing.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Door design, operation, installation, and testing. 170..., operation, installation, and testing. (a) Each Class 1 door must have a quick action closing device... the welding process so that the door frame is not distorted. (e) For each watertight door which is in...

  5. CWAP Certified Wireless Analysis Professional Official Study Guide Exam PW0-270

    CERN Document Server

    Westcott, David A; Miller, Ben; Mackenzie, Peter

    2011-01-01

    The official study guide for the Certified Wireless Analysis Professional certification from CWNPFour leading wireless experts thoroughly prepare you for the vendor-neutral CWAP exam administered by CWNP, the industry leader for enterprise Wi-Fi training and certification.  This official study guide not only covers all exam objectives for the CWAP exam, it also prepares you to administer and troubleshoot complex enterprise WLAN environments.Covers all exam objectives for the Certified Wireless Analysis Professional (CWAP) examCovers 802.11 physical (PHY) and 802.11 MAC layer frame formats and

  6. 17 CFR 270.3a-4 - Status of investment advisory programs.

    Science.gov (United States)

    2010-04-01

    ... basis of the client's financial situation and investment objectives and in accordance with any... regarding the client's financial situation and investment objectives, and gives the client the opportunity... been any changes in the client's financial situation or investment objectives, and whether the client...

  7. 17 CFR 270.23c-3 - Repurchase offers by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... repurchase pricing date, either in whole or in part, without penalty or premium, as necessary to permit the... repurchase payment deadline shall occur seven days after the repurchase pricing date applicable to such tender. (5) Repurchase pricing date with respect to a tender of common stock shall mean the date on which...

  8. 40 CFR 270.20 - Specific part B information requirements for land treatment facilities.

    Science.gov (United States)

    2010-07-01

    ... interpreting results; (vii) The justification for any hazardous constituents recommended for selection as principal hazardous constituents, in accordance with the criteria for such selection in § 264.278(a); (4) A... of particulate matter, if applicable; (d) If food-chain crops are to be grown in or on the treatment...

  9. 41 CFR 102-117.270 - What are agency performance measures for transportation?

    Science.gov (United States)

    2010-07-01

    ...) Increase the use of electronic commerce; (2) Adopt industry best practices and services to meet your agency... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are agency... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION...

  10. 40 CFR 270.42 - Permit modification at the request of the permittee.

    Science.gov (United States)

    2010-07-01

    ... decontamination of facility equipment or structures, with prior approval of the Director 1 1 e. Changes in... 12. Changes in background values for hazardous constituents in soil and soil-pore liquid 2 13...

  11. 33 CFR 106.270 - Security measures for delivery of stores and industrial supplies.

    Science.gov (United States)

    2010-07-01

    ... stores and industrial supplies. (a) General. The OCS facility owner or operator must ensure that security...). These additional security measures may include: (1) Intensifying inspection of the stores or industrial... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Security measures for delivery of...

  12. 17 CFR 270.22c-2 - Redemption fees for redeemable securities.

    Science.gov (United States)

    2010-04-01

    ... holder of an interest in such a trust. (5) Shareholder information agreement means a written agreement... interested persons of the fund, must either: (i) Approve a redemption fee, in an amount (but no more than two... necessary or not appropriate. (2) Shareholder information. With respect to each financial intermediary that...

  13. 37 CFR 270.1 - Notice of use of sound recordings under statutory license.

    Science.gov (United States)

    2010-07-01

    ..., and the primary purpose of the service is not to sell, advertise, or promote particular products or services other than sound recordings, live concerts, or other music-related events. (iv) A new subscription...

  14. 17 CFR 270.17f-4 - Custody of investment company assets with a securities depository.

    Science.gov (United States)

    2010-04-01

    ... available concerning the internal accounting controls and financial strength of the custodian; and (3... controls and financial strength of the securities depository; and (2) The fund has implemented internal... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of investment company...

  15. 40 CFR 270.1 - Purpose and scope of these regulations.

    Science.gov (United States)

    2010-07-01

    ... Overview and definitions 40 CFR part 260 3001 Identification and listing of hazardous waste 40 CFR part 261... hazardous waste management units must have permits during the active life (including the closure period) of... of a permit for the active life of a hazardous waste management facility or unit does not affect the...

  16. 48 CFR 852.270-2 - Bread and bakery products-quantities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bread and bakery products... Bread and bakery products—quantities. As prescribed in 870.111-3, insert the following clause: Bread and Bakery Products—Quantities (JAN 2008) The bidder agrees to furnish up to 25 percent more or 25 percent...

  17. 17 CFR 270.0-1 - Definition of terms used in this part.

    Science.gov (United States)

    2010-04-01

    ... adviser, principal underwriter, administrator (“management organizations”), or any of their control... select and nominate any other disinterested director of the fund; (iii) Any person who acts as legal... advisers and experts necessary to carry out their duties. (b) Unless otherwise specifically provided, the...

  18. 40 CFR 270.26 - Special part B information requirements for drip pads.

    Science.gov (United States)

    2010-07-01

    ... residuals. (14) A description of how each drip pad, including appurtenances for control of run-on and run..., detailed plans and an engineering report describing how the requirements of § 264.90(b)(2) of this chapter will be met. (c) Detailed plans and an engineering report describing how the drip pad is or will be...

  19. 40 CFR 270.300 - What container information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... volume of containers to be stored. (4) Provisions for preventing or managing run-on. (5) How accumulated... construction. (2) How the design promotes drainage or how containers are kept from contact with standing... not contain free liquids. (2) A description of how the storage area is designed or operated to drain...

  20. 40 CFR 270.14 - Contents of part B: General requirements.

    Science.gov (United States)

    2010-07-01

    ..., and engineering studies shall be certified by a qualified Professional Engineer. For post-closure... § 264.1 provides otherwise: (1) A general description of the facility. (2) Chemical and physical... atmosphere. (9) A description of precautions to prevent accidental ignition or reaction of ignitable...

  1. Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

    Data.gov (United States)

    U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

  2. 40 CFR 270.17 - Specific part B information requirements for surface impoundments.

    Science.gov (United States)

    2010-07-01

    ... migration of any hazardous constituents into the ground water or surface water at any future time; (2) The....19 of this chapter; (5) Proposed action leakage rate, with rationale, if required under § 264.222 of..., including the double liner system, leak detection system, cover system, and appurtenances for control of...

  3. 48 CFR 514.270-4 - Grouping line items for aggregate award.

    Science.gov (United States)

    2010-10-01

    ... may have sufficient requirements so that individual shipments involve economic production runs and... franchises in certain territories, grouping different territories could tend to restrict competition. (3...

  4. An Interferometric 270--355 GHz Spectral Line Survey of the Red Supergiant VY CMa

    Science.gov (United States)

    Menten, K. M.; Young, K. H.; Patel, N. A.; Gottlieb, C. A.; Thaddeus, P.; McCarthy, M. C.; Gurwell, M. A.; Belloche, A.; Kaminski, T.; Verheyen, L.; Decin, L.; Brunken, S.; Holger, S. P. M.

    2011-05-01

    We have used the Submillimeter Array to image the molecular line emission in the circumstellar envelope of the peculiar red supergiant star VY Canis Majoris over the whole 870 μm atmospheric window. Employing adaptive calibration using the object's continuum emission we achieve high quality one arcsecond resolution imaging of the whole 280--355 GHz range within which we find 211 distinct spectral lines from 33 molecules (including isotopologues) plus 40 unidentified lines. From the distribution of molecules we are obtaining their abundances and isotopologic abundance ratios. Using data for multiple transitions in a number of molecules we are deriving the physical conditions in the circumstellar envelope to reach a picture of the star's chemistry that can be compared with models. Our legacy survey is accompanied by a strong laboratory effort that helps with the identification of possibly newly found molecules traced by unidentified lines. We shall create a publicly accessible database of spectral-line channel-maps of the emission from all the lines detected in the survey.

  5. 17 CFR 270.6e-2 - Exemptions for certain variable life insurance separate accounts.

    Science.gov (United States)

    2010-04-01

    ...) solely with respect to variable life insurance contracts, means the gross premium payment made less any portion of such gross premium charged for or attributable to the items specified in paragraphs (c)(4)(vi... that portion of its assets having a value equal to, or approximately equal to, the reserves and other...

  6. 17 CFR 270.23c-1 - Repurchase of securities by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... issuer. (5) Payment of the purchase price is accompanied or preceded by a written confirmation of the purchase. (6) The purchase is made at a price not above the market value, if any, or the asset value of..., within the preceding six months, informed stockholders of its intention to purchase stock of such class...

  7. 17 CFR 270.34b-1 - Sales literature deemed to be misleading.

    Science.gov (United States)

    2010-04-01

    ... includes the information specified in paragraphs (a) and (b) of this section. Note to introductory text of..., illustrations, and descriptions contained in investment company sales literature are misleading, see § 230.156... adjusted to reflect the effect of taxes (not including a quotation of tax equivalent yield or other similar...

  8. 17 CFR 270.17j-1 - Personal investment activities of investment company personnel.

    Science.gov (United States)

    2010-04-01

    ... the Fund; or (4) To engage in any manipulative practice with respect to the Fund. (c) Code of Ethics... regarding, the purchase or sale of Covered Securities by the Fund for which the principal underwriter acts... recommendation to the Fund regarding the purchase or sale of Covered Securities. (2) Advisory person of a Fund or...

  9. 17 CFR 270.17f-1 - Custody of securities with members of national securities exchanges.

    Science.gov (United States)

    2010-04-01

    ... upon physical inspection thereof and upon examination of the books of the custodian. The physical... a member of a national securities exchange of any obligation under existing law or under the rules...

  10. 17 CFR 270.19b-1 - Frequency of distribution of capital gains.

    Science.gov (United States)

    2010-04-01

    ... eligible trust security which adversely affects the ability of such issuer to continue payment of principal... which adversely affects the ability of such issuer to continue payment of principal or interest on its... request as not being necessary or appropriate in the public interest or for the protection of investors...

  11. 17 CFR 270.30d-1 - Filing of copies of reports to shareholders.

    Science.gov (United States)

    2010-04-01

    ... shareholders. A registered management investment company, other than a small business investment company... and procedures specified therefor, of reports on Form N-CSR (§§ 249.331 and 274.128 of this chapter...

  12. 24 CFR 213.270 - Supplementary loans; election of action; claims; debentures.

    Science.gov (United States)

    2010-04-01

    ... desires to pursue. (b) Maximum claim period. Notice of intention to file claim on a form prescribed by the... filed on submitting claim. Within 30 days after the filing of the notice of intention to file claim, or...) All records, ledger cards, documents, books, papers and accounts relating to the loan transaction; (10...

  13. 17 CFR 270.27d-2 - Insurance company undertaking in lieu of segregated trust account.

    Science.gov (United States)

    2010-04-01

    ... unassigned surplus, if a stock company, or (ii) unassigned surplus, if a mutual company, at least equal to... amendment thereto pursuant to the Securities Act of 1933 of the registered investment company issuing...

  14. 40 CFR 270.66 - Permits for boilers and industrial furnaces burning hazardous waste.

    Science.gov (United States)

    2010-07-01

    ....104(a) of this chapter; (3) When a trial burn for chlorinated dioxins and furans is required under... emission rate of the 2,3,7,8-chlorinated tetra-octa congeners of chlorinated dibenzo-p-dioxins and furans... chapter, a quantitative analysis of the scrubber water (if any), ash residues, other residues, and...

  15. 40 CFR 270.24 - Specific part B information requirements for process vents.

    Science.gov (United States)

    2010-07-01

    ... incinerator, flare, boiler, process heater, condenser, or carbon adsorption system to comply with the... each compliance test required by § 264.1033(k). (3) A design analysis, specifications, drawings... texts acceptable to the Regional Administrator that present basic control device information. The design...

  16. 40 CFR 270.25 - Specific part B information requirements for equipment.

    Science.gov (United States)

    2010-07-01

    ..., boiler, process heater, condenser, or carbon adsorption system and chooses to use test data to determine....1033(j). (3) A design analysis, specifications, drawings, schematics, and piping and instrumentation... Administrator that present basic control device information. The design analysis shall address the vent stream...

  17. 40 CFR 270.110 - What must I include in my application for a RAP?

    Science.gov (United States)

    2010-07-01

    ... parameters you will use to treat hazardous remediation wastes before disposing of them according to the LDR... estimate of the quantity of these wastes; and (3) A description of the processes you will use to treat...

  18. SU-E-T-270: Optimized Shielding Calculations for Medical Linear Accelerators (LINACs).

    Science.gov (United States)

    Muhammad, W; Lee, S; Hussain, A

    2012-06-01

    The purpose of radiation shielding is to reduce the effective equivalent dose from a medical linear accelerator (LINAC) to a point outside the room to a level determined by individual state/international regulations. The study was performed to design LINAC's room for newly planned radiotherapy centers. Optimized shielding calculations were performed for LINACs having maximum photon energy of 20 MV based on NCRP 151. The maximum permissible dose limits were kept 0.04 mSv/week and 0.002 mSv/week for controlled and uncontrolled areas respectively by following ALARA principle. The planned LINAC's room was compared to the already constructed (non-optimized) LINAC's room to evaluate the shielding costs and the other facilities those are directly related to the room design. In the evaluation process it was noted that the non-optimized room size (i.e., 610 × 610 cm 2 or 20 feet × 20 feet) is not suitable for total body irradiation (TBI) although the machine installed inside was having not only the facility of TBI but the license was acquired. By keeping this point in view, the optimized INAC's room size was kept 762 × 762 cm 2. Although, the area of the optimized rooms was greater than the non-planned room (i.e., 762 × 762 cm 2 instead of 610 × 610 cm 2), the shielding cost for the optimized LINAC's rooms was reduced by 15%. When optimized shielding calculations were re-performed for non-optimized shielding room (i.e., keeping room size, occupancy factors, workload etc. same), it was found that the shielding cost may be lower to 41 %. In conclusion, non- optimized LINAC's room can not only put extra financial burden on the hospital but also can cause of some serious issues related to providing health care facilities for patients. © 2012 American Association of Physicists in Medicine.

  19. : tous les projets | Page 270 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    $ 2,500,000.00. Adaptation aux effets qu'ont les changements climatiques sur les ressources en eau. Projet. Les connaissances sont encore très incomplètes en ce qui a trait aux les conséquences actuelles et possibles des risques liés au ...

  20. 48 CFR 352.270-9 - Non-discrimination for conscience.

    Science.gov (United States)

    2010-10-01

    ... acknowledges that an offeror has specific rights, as cited in paragraph (b) of this provision, to exclude... right to not make an award to an offeror whose proposal does not comply with the salient work requirements of the solicitation. Any exercise of that Government right will be made by the Head of the...

  1. 17 CFR 270.3a-8 - Certain research and development companies.

    Science.gov (United States)

    2010-04-01

    ...) Capital preservation investment means an investment that is made to conserve capital and liquidity until the funds are used in the issuer's primary business or businesses; (5) Controlled primarily means...

  2. The Keyword Method of Foreign Vocabulary Learning: An Investigation of Its Generalizability. Working Paper No. 270.

    Science.gov (United States)

    Pressley, Michael; And Others

    In five experiments, college-age students of differing foreign language-learning abilities were asked to learn Latin word translations to determine the effectiveness of the keyword method of foreign language vocabulary learning. The Latin words were the types for which it has been argued that the keyword method effects would be maximized (the…

  3. 40 CFR 270.290 - What general types of information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ..., dikes, trenches), (3) Prevent contamination of water supplies, (4) Mitigate effects of equipment failure... interval must show the pattern of surface water flow in the vicinity of and from each operational unit of... date. (2) 100-year flood plain area. (3) Surface waters including intermittent streams. (4) Surrounding...

  4. 17 CFR 270.17f-5 - Custody of investment company assets outside the United States.

    Science.gov (United States)

    2010-04-01

    ...-owned direct or indirect subsidiary of a U.S. Bank or bank-holding company. (2) Foreign Assets means any investments (including foreign currencies) for which the primary market is outside the United States, and any... investments. (3) Foreign Custody Manager means a Fund's or a Registered Canadian Fund's board of directors or...

  5. 40 CFR 270.310 - What equipment information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ...) Method of compliance with the standard (e.g., monthly leak detection and repair, or equipped with dual... (e.g., a pump or a pipeline valve). (4) Percent by weight of total organics in the hazardous waste...

  6. SU-E-J-270: Study of PET Response to HDR Brachytherapy of Rectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, R; Le, Y; Armour, E; Efron, J; Azad, N; Wahl, R; Gearhart, S; Herman, J [Johns Hopkins University, Baltimore, MD (United States)

    2014-06-01

    Purpose: Dose-response studies in radiation therapy are typically using single response values for tumors across ensembles of tumors. Using the high dose rate (HDR) treatment plan dose grid and pre- and post-therapy FDG-PET images, we look for correlations between voxelized dose and FDG uptake response in individual tumors. Methods: Fifteen patients were treated for localized rectal cancer using 192Ir HDR brachytherapy in conjunction with surgery. FDG-PET images were acquired before HDR therapy and 6–8 weeks after treatment (prior to surgery). Treatment planning was done on a commercial workstation and the dose grid was calculated. The two PETs and the treatment dose grid were registered to each other using non-rigid registration. The difference in PET SUV values before and after HDR was plotted versus absorbed radiation dose for each voxel. The voxels were then separated into bins for every 400 cGy of absorbed dose and the bin average values plotted similarly. Results: Individual voxel doses did not correlate with PET response; however, when group into tumor subregions corresponding to dose bins, eighty percent of the patients showed a significant positive correlation (R2 > 0) between PET uptake difference in the targeted region and the absorbed dose. Conclusion: By considering larger ensembles of voxels, such as organ average absorbed dose or the dose bins considered here, valuable information may be obtained. The dose-response correlations as measured by FDG-PET difference potentially underlines the importance of FDG-PET as a measure of response, as well as the value of voxelized information.

  7. 40 CFR 270.19 - Specific part B information requirements for incinerators.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM...) When seeking an exemption under § 264.340 (b) or (c) of this chapter (Ignitable, corrosive, or reactive... chapter, solely because it is reactive (Hazard Code R) for characteristics other than those listed in...

  8. 40 CFR 270.16 - Specific part B information requirements for tank systems.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... systems in which ignitable, reactive, or incompatible wastes are to be stored or treated, a description of...

  9. 40 CFR 270.18 - Specific part B information requirements for waste piles.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... quality of the residuals; (f) If ignitable or reactive wastes are to be placed in a waste pile, an...

  10. 40 CFR 270.15 - Specific part B information requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... ignitable or reactive wastes) and § 264.177(c) (location of incompatible wastes), where applicable. (d...

  11. 40 CFR 270.305 - What tank information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... 267.198. (j) For tank systems in which ignitable, reactive, or incompatible wastes are to be stored or...

  12. 32 CFR Appendix A to Part 270 - Application for Compensation of Vietnamese Commandos

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Application for Compensation of Vietnamese... Vietnamese Commandos All persons applying for payment shall submit a properly completed, signed and notarized Application for Compensation of Vietnamese Commandos, along with corroborating documents and information, to...

  13. 76 FR 270 - Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2011-01-04

    ...] Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program AGENCY: Environmental Protection... approved Municipal Solid Waste Landfill (MSWLF) permit program. The approved modification allows the State..., EPA issued a final rule (69 FR 13242) amending the Municipal Solid Waste Landfill (MSWLF) criteria in...

  14. 40 CFR 270.23 - Specific part B information requirements for miscellaneous units.

    Science.gov (United States)

    2010-07-01

    ... address and ensure compliance of the unit with each factor in the environmental performance standards of § 264.601. If the applicant can demonstrate that he does not violate the environmental performance... the Director to be necessary for evaluation of compliance of the unit with the environmental...

  15. Hyperthyroidism treatment by iodine 131: about a study on 270 patients

    International Nuclear Information System (INIS)

    Leroux, M.A.

    2005-01-01

    This study constitutes a starting point for a thought about the use of iodine 131 in the treatment of hyperthyroidism. The therapies are different depending on the teams, for the iodine 131 activities to deliver and their calculation modes; The use of synthesis anti-thyroid drugs before therapy is discussed. The radiation protection is an important factor in the decision of a metabolic radiotherapy. The indications of the treatment by radioactive iodine are different in Europe and in Usa. (N.C.)

  16. 48 CFR 352.270-1 - Accessibility of meetings, conferences, and seminars to persons with disabilities.

    Science.gov (United States)

    2010-10-01

    ...) The Contractor agrees as follows: (a) Planning. The Contractor shall develop a plan to assure that any... planning the meeting, conference, or seminar, shall include in all announcements and other materials... device for the deaf (TDD). (2) The Contractor shall provide, at no additional cost to the individual...

  17. TOTAL NUCLEAR-REACTION PROBABILITY OF 270 TO 390 N-14 IONS IN SI AND CSI

    NARCIS (Netherlands)

    WARNER, RE; CARPENTER, CL; FETTER, JM; WAITE, WF; WILSCHUT, HW; HOOGDUIN, JM

    A magnetic spectrograph and position-sensitive detectors were used to measure the total nuclear reaction probability eta(R) for alpha + CsI at 116 MeV, N-14 + CsI at 265 and 385 MeV, and N-14 + Si at 271 and 390 MeV. From these eta(R)'s, average reaction cross sections sigma(R) were deduced for

  18. 33 CFR 207.270 - Tallahatchie River, Miss., between Batesville and the mouth; logging.

    Science.gov (United States)

    2010-07-01

    ... Tallahatchie River, Miss., between Batesville and the mouth; logging. (a) The floating of “sack”, rafts, or of... sufficient capacity to properly manage the movement of the raft and to keep it from being an obstruction to...

  19. 48 CFR 213.270 - Use of the Governmentwide commercial purchase card.

    Science.gov (United States)

    2010-10-01

    ... exception for an electronic commerce/electronic data interchange system or operational requirement that... Medical Electronic Catalog Program are two examples where use of the purchase card may not be cost...

  20. Contribution of gammagraphy to the diagnosis of bone tumours. Study of 270 patients

    International Nuclear Information System (INIS)

    Caballero Carpena, O.; Esteban Velasco, J.

    1982-01-01

    In this study, two hundred seventy patients with bone tumours were evaluated by whole-body radionuclide studies: bone and vascular scan, using 99mTc MDP. In the group of primary bone tumour: 50 cases, the gammagraphy was positive in all cases except one myeloma. The morphology of the abnormal scan area of a primary bone tumour depend more of the site of the bone lesion than on its histopathology, and the size is significant by larger in sarcoma than others. The positivity of gammagraphy in the group of secondary bone tumours: 220 cases, was 93%, and the gammagraphic diagnosis being earlier than the radiologic one in 27%. Finally, we have studied the location of metastases, and the correlation between the positive scan and the request of exploration

  1. Hyperthyroidism treatment by iodine 131: about a study on 270 patients; Traitement de l'hyperthyroidie par l'iode 131: a propos d'une etude sur 270 patients

    Energy Technology Data Exchange (ETDEWEB)

    Leroux, M.A

    2005-07-01

    This study constitutes a starting point for a thought about the use of iodine 131 in the treatment of hyperthyroidism. The therapies are different depending on the teams, for the iodine 131 activities to deliver and their calculation modes; The use of synthesis anti-thyroid drugs before therapy is discussed. The radiation protection is an important factor in the decision of a metabolic radiotherapy. The indications of the treatment by radioactive iodine are different in Europe and in Usa. (N.C.)

  2. 17 CFR 270.3a-5 - Exemption for subsidiaries organized to finance the operations of domestic or foreign companies.

    Science.gov (United States)

    2010-04-01

    ... subordinated in right of payment to other debt of the parent company); (2) Any non-voting preferred stock of... stock issued by the finance subsidiary, the holders of those securities may institute legal proceedings... venture) or for debt securities or non-voting preferred stock issued by the finance subsidiary meeting the...

  3. Importance of All-in-one (MCNPX2.7.0+CINDER2008) Code for Rigorous Transmutation Study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Oyeon [Institute for Modeling and Simulation Convergence, Daegu (Korea, Republic of); Kim, Kwanghyun [RadTek Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    It can be utilized as a possible mechanism for reducing the volume and hazard of radioactive waste by transforming hazardous radioactive elements with long half-life into less hazardous elements with short halflife. Thus, the understanding of the transmutation mechanism and beneficial machinery design technologies are important and useful. Although the terminology transmutation was rooted back to alchemy which transforms the base metals into gold in the middle ages, Rutherford and Soddy were the first observers by discovering the natural transmutation as a part of radioactive decay of the alpha decay type in early 20th century. Along with the development of computing technology, analysis software, for example, CINDER was developed for rigorous atomic transmutation study. The code has a long history of development from the original work of T. England at Bettis Atomic Power Laboratory (BAPL) in the early 1960s. It has been used to calculate the inventory of nuclides in an irradiated material. CINDER'90 which is recently released involved an upgrade of the code to allow the spontaneous tracking of chains based upon the significant density or pass-by of a nuclide, where pass-by represents the density of a nuclide transforming to other nuclides. Nuclear transmutation process is governed by highly non-linear differential equation. Chaotic nature of the non-linear equation bespeaks the importance of the accurate input data (i.e. number of significant digits). Thus, reducing the human interrogation is very important for the rigorous transmutation study and 'allin- one' code structure is desired. Note that non-linear characteristic of the transmutation equation caused by the flux changes due to the number density change during a given time interval (intrinsic physical phenomena) is not considered in this study. In this study, we only emphasized the effects of human interrogation in the computing process solving nonlinear differential equations, as shown in the case of accidental discovery of chaos by Edward N. Lorenz.

  4. 17 CFR 270.11a-3 - Offers of exchange by open-end investment companies other than separate accounts.

    Science.gov (United States)

    2010-04-01

    ... advertising that mentions the existence of the exchange offer also discloses (i) The existence of any... than two years old, at all times the offer has been outstanding) that the terms of the offer were...

  5. 17 CFR 270.7d-1 - Specification of conditions and arrangements for Canadian management investment companies...

    Science.gov (United States)

    2010-04-01

    ... and arrangements for Canadian management investment companies requesting order permitting registration... arrangements for Canadian management investment companies requesting order permitting registration. (a) A management investment company organized under the laws of Canada or any province thereof may obtain an order...

  6. Certification of polycyclic aromatic compounds. Pt. 6. CRM Nos. 152, 265, 266, 267, 268, 269, 270, 271, 272

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, J; Belliardo, J J; Wagstaffe, P J

    1985-01-01

    The purity of samples of seven polycyclic aromatic hydrocarbons and two nitrogen-containing heterocyclics has been determined in an interlaboratory exercise, involving eleven laboratories of the EC member countries. The purity measurements were carried out using independent analytical methods (gas liquid chromatography, high performance liquid chromatography and mass spectrometry). This report describes the certification procedure and experimental details of the interlaboratory analyses of standard materials for environmental pollutants.

  7. Phase locked 270-440 GHz local oscillator based on flux flow in long Josephson tunnel junctions

    DEFF Research Database (Denmark)

    Koshelets, V.P.; Shitov, S.V.; Filippenko, L.V.

    2000-01-01

    The combination of narrow linewidth and wide band tunability makes the Josephson flux flow oscillator (FFO) a perfect on-chip local oscillator for integrated sub-mm wave receivers for, e.g., spectral radio astronomy. The feasibility of phase locking the FFO to an external reference oscillator......-running tunnel junction. The results of residual FFO phase noise measurements are also presented. Finally, we propose a single-chip fully superconductive receiver with two superconductor–insulator–superconductor mixers and an integrated phase-locked loop. ©2000 American Institute of Physics....

  8. 17 CFR 270.17a-7 - Exemption of certain purchase or sale transactions between an investment company and certain...

    Science.gov (United States)

    2010-04-01

    ... other remuneration is paid in connection with the transaction; (e) The board of directors of the investment company, including a majority of the directors who are not interested persons of such investment... investment adviser or investment advisers which are affiliated persons of each other, common directors, and...

  9. 37 CFR 270.5 - Designated collection and distribution organizations for records of use of sound recordings under...

    Science.gov (United States)

    2010-07-01

    ... unpublished television transmission programs 202.22 Addresses prescribed for communications with the Copyright... (visual), registration of (see Pictorial, graphic & sculptural works) 202.10, 202.20 Arts (visual... Commercial prints and labels, Deposit of 202.20(c)(2)(v) Communications with Copyright Office, Addresses...

  10. The experimental setup of a large field operational test for cooperative driving vehicles at the A270

    NARCIS (Netherlands)

    Broek, T.H.A. van den; Netten, B.D.; Hoedemaeker, M.; Ploeg, J.

    2010-01-01

    In this paper, a large field operational test (FOT) for cooperative driving systems, which take place on a public highway, is discussed. The experimental setup consist of a specific driver support system, which is closely related to cooperative adaptive cruise control (CACC) systems. Instead of

  11. 17 CFR 270.11a-1 - Definition of “exchange” for purposes of section 11 of the Act.

    Science.gov (United States)

    2010-04-01

    ... issued, and notice of intention to close the account was mailed to the security holder, and he had a... group eligible to purchase the security, the issuer required the surrender of the security and paid the redemption price thereof. (c) The provisions of paragraph (a) of this section shall not apply if, following...

  12. 17 CFR 270.30a-2 - Certification of Form N-CSR and Form N-Q.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certification of Form N-CSR... Form N-CSR and Form N-Q. (a) Each report filed on Form N-CSR (§§ 249.331 and 274.128 of this chapter) or Form N-Q (§§ 249.332 and 274.130 of this chapter) by a registered management investment company...

  13. 37 CFR 270.2 - Reports of use of sound recordings under statutory license for preexisting subscription services.

    Science.gov (United States)

    2010-07-01

    ... “Intended Playlists” for each channel and each day of the reported month. The “Intended Playlists” shall...; (2) The channel; (3) The sound recording title; (4) The featured recording artist, group, or... sound recording); (6) The marketing label of the commercially available album or other product on which...

  14. 37 CFR 270.3 - Reports of use of sound recordings under statutory license for nonsubscription transmission...

    Science.gov (United States)

    2010-07-01

    ...) of title 17 of the United States Code, or both. (b) Definitions. (1) Aggregate Tuning Hours are the... broadcast signal over a digital communications network such as the Internet, regardless of whether the... the ISRC, the (A) Album title; and (B) Marketing label; (vi) The actual total performances of the...

  15. 45 CFR 270.5 - What factors will we use to determine a State's score on the work measures?

    Science.gov (United States)

    2010-10-01

    ... Force Rate is composed of two equally weighted sub-measures defined as follows: (i) The Job Retention...-measures defined as follows: (i) The Increase in the Job Retention Rate means the percentage point difference between the job retention rate for the performance year and the job retention rate for the...

  16. 17 CFR 270.17d-1 - Applications regarding joint enterprises or arrangements and certain profit-sharing plans.

    Science.gov (United States)

    2010-04-01

    ... Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY... or stock purchase plan, but shall not include an investment advisory contract subject to section 15..., stock option or stock purchase plan provided by any controlled company which is not an investment...

  17. 48 CFR 552.270-1 - Instructions to Offerors-Acquisition of Leasehold Interests in Real Property.

    Science.gov (United States)

    2010-10-01

    .... However, if the last day falls on a Saturday, Sunday, or legal holiday, then the period shall include the... received at the activity designated for receipt of offers and was under the Government's control prior to... Contracting Officer determines that the lack of balance poses an unacceptable risk to the Government. (7) The...

  18. Offshore high - Boundaries: When 10 women jostle for personal space with 270 men, establishing limits is the key

    Energy Technology Data Exchange (ETDEWEB)

    Harvie, W.

    1998-06-01

    Male-female relationships on the Hibernia offshore site is discussed. Since women are outnumbered 27 to 1, some gender problems have been anticipated. Every employee on the platform, as well as every Hibernia and service company worker has taken gender sensitivity training and knows the rules. Although not every potential problem was anticipated, so far sexual harassment has not been a problem. The workers know what is acceptable and what is not, and the rules are generally observed. The ten women on the platform tend to work on administrative and support tasks, although by funding special scholarships the company is encouraging women to study engineering, computing and other petroleum-related fields, as well as pipefitting, welding and similar trades. The women aboard the platform live like the men, sharing a two-bunk berth with ensuite bathroom and shower. Off-duty time is spent congregating with the men in TV lounges, the smoking room or playing pool. Like the men, the women work 12-hour shifts for three weeks straight. It does get dull and repetitive, but in a province with chronic high unemployment, that is an acceptable irritation.

  19. 270 nm Pseudomorphic Ultraviolet Light-Emitting Diodes with Over 60 mW Continuous Wave Output Power

    Science.gov (United States)

    Grandusky, James R.; Chen, Jianfeng; Gibb, Shawn R.; Mendrick, Mark C.; Moe, Craig G.; Rodak, Lee; Garrett, Gregory A.; Wraback, Michael; Schowalter, Leo J.

    2013-03-01

    In this letter, the achievement of over 60 mW output power from pseudomorphic ultraviolet light-emitting diodes in continuous wave operation is reported. Die thinning and encapsulation improved the photon extraction efficiency to over 15%. Improved thermal management and a high characteristic temperature resulted in a low thermal rolloff up to 300 mA injection current with an output power of 67 mW, an external quantum efficiency (EQE) of 4.9%, and a wall plug efficiency (WPE) of 2.5% for a single-chip device emitting at 271 nm in continuous wave operation.

  20. 17 CFR 270.6e-3(T) - Temporary exemptions for flexible premium variable life insurance separate accounts.

    Science.gov (United States)

    2010-04-01

    ... for issuance, increases in or additions of insurance benefits, transfer and redemption of flexible... deducted from amounts transferred to a flexible contract from another plan of insurance; (iii) Sections 27... guaranteed death benefit risks assumed by the life insurer under the flexible contracts (collectively, a...

  1. 17 CFR 270.27d-1 - Reserve requirements for principal underwriters and depositors to carry out the obligations to...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Reserve requirements for....27d-1 Reserve requirements for principal underwriters and depositors to carry out the obligations to... reserve and as security for the purpose of assuring the refund of charges required by sections 27(d) and...

  2. Transdisciplinarity in the university: discourse and practice - DOI: 10.3395/reciis.v3i3.270en

    Directory of Open Access Journals (Sweden)

    Aleixina Maria Lopes Andalécio

    2009-09-01

    Full Text Available This article presents discussions and partial results of a piece of doctoral research centered on the questions raised by the new forms of production and organization of knowledge, guided by the discourse and practice of transdisciplinarity. The latter is understood in the context of the university, as an effort to overcome the fragmentation of knowledge into disciplines and excessive specialization, in face of the complex reality of the modern world, with its relational and interconnected character. To guide the questions, the research is based on the presuppositions that there is an epistemological, practical, social, and political distance between the discourse and the practice of transdisciplinarity. The empirical terrain is represented by the analysis of two large institutional transdisciplinary projects implemented at the Federal University of Minas Gerais in the late 1990s. In the methodology, thematic document analysis techniques, in-depth interviews, and direct observation are used. The results reached so far indicate that even researchers who have a strong discourse in favor of transdisciplinarity still work in a disciplinary manner in practice. However, even among researchers who are called “disciplinary”, there seems to be a consensus that current problems demand a different approach and transdisciplinarity presents itself as an appropriate alternative to deal with them.

  3. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  4. 17 CFR 270.27e-1 - Requirements for notice to be mailed to certain purchasers of periodic payment plan certificates...

    Science.gov (United States)

    2010-04-01

    ... your plan, you should consider that, while the average sales charge deducted from your payments has... payments under the plan, if you continue the plan, will be _ (11) ___and the average sales charge if you... terminate your plan, you should consider that, while the sales charge deducted from your payments has...

  5. 28 CFR 2.70 - Authority and functions of the U.S. Parole Commission with respect to District of Columbia Code...

    Science.gov (United States)

    2010-07-01

    ... offenders who are committed to prison for treatment and rehabilitation based on felony convictions under the... eligible for parole by statute, including offenders who have been returned to prison upon the revocation of... authority to return such offenders to prison upon an order of revocation. (D.C. Code 24-406.) [65 FR 45888...

  6. CRED Subsurface Temperature Recorder (STR); PRIA, JOH; Long: -169.55499, Lat: 16.71490 (WGS84); Sensor Depth: 2.70m; Data Range: 20040117-20060119.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  7. 17 CFR 270.22e-1 - Exemption from section 22(e) of the Act during annuity payment period of variable annuity...

    Science.gov (United States)

    2010-04-01

    ...) of the Act during annuity payment period of variable annuity contracts participating in certain... from section 22(e) of the Act during annuity payment period of variable annuity contracts participating... payment period of variable annuity contracts participating in such account, be exempt from the provisions...

  8. 17 CFR 270.7d-2 - Definition of “public offering” as used in section 7(d) of the Act with respect to certain...

    Science.gov (United States)

    2010-04-01

    ... Canada, the laws of any province or territory of Canada, and the rules or regulations of any federal, provincial, or territorial regulatory authority, or any self-regulatory authority, of Canada. (2) Canadian... Retirement Savings Plan” or “Registered Retirement Income Fund” administered under Canadian law, that is...

  9. 17 CFR 270.30b1-2 - Semi-annual report for totally-owned registered management investment company subsidiary of...

    Science.gov (United States)

    2010-04-01

    ...-owned registered management investment company subsidiary of registered management investment company...-owned registered management investment company subsidiary of registered management investment company... subsidiary of a registered management investment company need not file a semi-annual report on Form N-SAR if...

  10. 17 CFR 270.2a51-1 - Definition of investments for purposes of section 2(a)(51) (definition of “qualified purchaser...

    Science.gov (United States)

    2010-04-01

    ... futures contracts, and options on physical commodities traded on or subject to the rules of: (i) Any... Commodity means any physical commodity with respect to which a Commodity Interest is traded on a market... (including foreign currencies) held for investment purposes. For purposes of this section, cash and cash...

  11. Microstructure and property measurements on in situ TiB2/70Si–Al composite for electronic packaging applications

    International Nuclear Information System (INIS)

    Zhang, L.; Gan, G.S.; Yang, B.

    2012-01-01

    Highlights: ► 2.0 wt.%TiB 2 /70Si–Al composite is prepared by a novel reactive technique. ► In situ TiB 2 particles can refine effectively the primary Si phase. ► The composite exhibited attractive physical and mechanical properties. -- Abstract: A novel reactive technique has been employed in fabrication of 2.0 wt.%TiB 2 /70Si–Al composite for electronic packaging applications. The microstructure and properties of composite were studied using scanning electron microscopy, energy dispersive X-ray spectrometer, coefficient of thermal expansion and thermal conductivity measurements, and 3-point bending tests. The results indicate that the in situ TiB 2 particles can effectively refine the primary Si phase. The property measurements results indicate that the 2.0 wt.%TiB 2 /70Si–Al composite has advantageous physical and mechanical properties, including low density, low coefficient of thermal expansion, high thermal conductivity, high Flexural strength and Brinell hardness.

  12. Sex-stratified Genome-wide Association Studies Including 270,000 Individuals Show Sexual Dimorphism in Genetic Loci for Anthropometric Traits

    Science.gov (United States)

    Jackson, Anne U.; Monda, Keri L.; Kilpeläinen, Tuomas O.; Esko, Tõnu; Mägi, Reedik; Li, Shengxu; Workalemahu, Tsegaselassie; Feitosa, Mary F.; Croteau-Chonka, Damien C.; Day, Felix R.; Fall, Tove; Ferreira, Teresa; Gustafsson, Stefan; Locke, Adam E.; Mathieson, Iain; Scherag, Andre; Vedantam, Sailaja; Wood, Andrew R.; Liang, Liming; Steinthorsdottir, Valgerdur; Thorleifsson, Gudmar; Dermitzakis, Emmanouil T.; Dimas, Antigone S.; Karpe, Fredrik; Min, Josine L.; Nicholson, George; Clegg, Deborah J.; Person, Thomas; Krohn, Jon P.; Bauer, Sabrina; Buechler, Christa; Eisinger, Kristina; Bonnefond, Amélie; Froguel, Philippe; Hottenga, Jouke-Jan; Prokopenko, Inga; Waite, Lindsay L.; Harris, Tamara B.; Smith, Albert Vernon; Shuldiner, Alan R.; McArdle, Wendy L.; Caulfield, Mark J.; Munroe, Patricia B.; Grönberg, Henrik; Chen, Yii-Der Ida; Li, Guo; Beckmann, Jacques S.; Johnson, Toby; Thorsteinsdottir, Unnur; Teder-Laving, Maris; Khaw, Kay-Tee; Wareham, Nicholas J.; Zhao, Jing Hua; Amin, Najaf; Oostra, Ben A.; Kraja, Aldi T.; Province, Michael A.; Cupples, L. Adrienne; Heard-Costa, Nancy L.; Kaprio, Jaakko; Ripatti, Samuli; Surakka, Ida; Collins, Francis S.; Saramies, Jouko; Tuomilehto, Jaakko; Jula, Antti; Salomaa, Veikko; Erdmann, Jeanette; Hengstenberg, Christian; Loley, Christina; Schunkert, Heribert; Lamina, Claudia; Wichmann, H. Erich; Albrecht, Eva; Gieger, Christian; Hicks, Andrew A.; Johansson, Åsa; Pramstaller, Peter P.; Kathiresan, Sekar; Speliotes, Elizabeth K.; Penninx, Brenda; Hartikainen, Anna-Liisa; Jarvelin, Marjo-Riitta; Gyllensten, Ulf; Boomsma, Dorret I.; Campbell, Harry; Wilson, James F.; Chanock, Stephen J.; Farrall, Martin; Goel, Anuj; Medina-Gomez, Carolina; Rivadeneira, Fernando; Estrada, Karol; Uitterlinden, André G.; Hofman, Albert; Zillikens, M. Carola; den Heijer, Martin; Kiemeney, Lambertus A.; Maschio, Andrea; Hall, Per; Tyrer, Jonathan; Teumer, Alexander; Völzke, Henry; Kovacs, Peter; Tönjes, Anke; Mangino, Massimo; Spector, Tim D.; Hayward, Caroline; Rudan, Igor; Hall, Alistair S.; Samani, Nilesh J.; Attwood, Antony Paul; Sambrook, Jennifer G.; Hung, Joseph; Palmer, Lyle J.; Lokki, Marja-Liisa; Sinisalo, Juha; Boucher, Gabrielle; Huikuri, Heikki; Lorentzon, Mattias; Ohlsson, Claes; Eklund, Niina; Eriksson, Johan G.; Barlassina, Cristina; Rivolta, Carlo; Nolte, Ilja M.; Snieder, Harold; Van der Klauw, Melanie M.; Van Vliet-Ostaptchouk, Jana V.; Gejman, Pablo V.; Shi, Jianxin; Jacobs, Kevin B.; Wang, Zhaoming; Bakker, Stephan J. L.; Mateo Leach, Irene; Navis, Gerjan; van der Harst, Pim; Martin, Nicholas G.; Medland, Sarah E.; Montgomery, Grant W.; Yang, Jian; Chasman, Daniel I.; Ridker, Paul M.; Rose, Lynda M.; Lehtimäki, Terho; Raitakari, Olli; Absher, Devin; Iribarren, Carlos; Basart, Hanneke; Hovingh, Kees G.; Hyppönen, Elina; Power, Chris; Anderson, Denise; Beilby, John P.; Hui, Jennie; Jolley, Jennifer; Sager, Hendrik; Bornstein, Stefan R.; Schwarz, Peter E. H.; Kristiansson, Kati; Perola, Markus; Lindström, Jaana; Swift, Amy J.; Uusitupa, Matti; Atalay, Mustafa; Lakka, Timo A.; Rauramaa, Rainer; Bolton, Jennifer L.; Fowkes, Gerry; Fraser, Ross M.; Price, Jackie F.; Fischer, Krista; KrjutÅ¡kov, Kaarel; Metspalu, Andres; Mihailov, Evelin; Langenberg, Claudia; Luan, Jian'an; Ong, Ken K.; Chines, Peter S.; Keinanen-Kiukaanniemi, Sirkka M.; Saaristo, Timo E.; Edkins, Sarah; Franks, Paul W.; Hallmans, Göran; Shungin, Dmitry; Morris, Andrew David; Palmer, Colin N. A.; Erbel, Raimund; Moebus, Susanne; Nöthen, Markus M.; Pechlivanis, Sonali; Hveem, Kristian; Narisu, Narisu; Hamsten, Anders; Humphries, Steve E.; Strawbridge, Rona J.; Tremoli, Elena; Grallert, Harald; Thorand, Barbara; Illig, Thomas; Koenig, Wolfgang; Müller-Nurasyid, Martina; Peters, Annette; Boehm, Bernhard O.; Kleber, Marcus E.; März, Winfried; Winkelmann, Bernhard R.; Kuusisto, Johanna; Laakso, Markku; Arveiler, Dominique; Cesana, Giancarlo; Kuulasmaa, Kari; Virtamo, Jarmo; Yarnell, John W. G.; Kuh, Diana; Wong, Andrew; Lind, Lars; de Faire, Ulf; Gigante, Bruna; Magnusson, Patrik K. E.; Pedersen, Nancy L.; Dedoussis, George; Dimitriou, Maria; Kolovou, Genovefa; Kanoni, Stavroula; Stirrups, Kathleen; Bonnycastle, Lori L.; Njølstad, Inger; Wilsgaard, Tom; Ganna, Andrea; Rehnberg, Emil; Hingorani, Aroon; Kivimaki, Mika; Kumari, Meena; Assimes, Themistocles L.; Barroso, Inês; Boehnke, Michael; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Frayling, Timothy; Groop, Leif C.; Haritunians, Talin; Hunter, David; Ingelsson, Erik; Kaplan, Robert; Mohlke, Karen L.; O'Connell, Jeffrey R.; Schlessinger, David; Strachan, David P.; Stefansson, Kari; van Duijn, Cornelia M.; Abecasis, Gonçalo R.; McCarthy, Mark I.; Hirschhorn, Joel N.; Qi, Lu; Loos, Ruth J. F.; Lindgren, Cecilia M.; North, Kari E.; Heid, Iris M.

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723 individuals) and took forward 348 SNPs into follow-up (additional 137,052 individuals) in a total of 94 studies. Seven loci displayed significant sex-difference (FDR<5%), including four previously established (near GRB14/COBLL1, LYPLAL1/SLC30A10, VEGFA, ADAMTS9) and three novel anthropometric trait loci (near MAP3K1, HSD17B4, PPARG), all of which were genome-wide significant in women (P<5×10−8), but not in men. Sex-differences were apparent only for waist phenotypes, not for height, weight, BMI, or hip circumference. Moreover, we found no evidence for genetic effects with opposite directions in men versus women. The PPARG locus is of specific interest due to its role in diabetes genetics and therapy. Our results demonstrate the value of sex-specific GWAS to unravel the sexually dimorphic genetic underpinning of complex traits. PMID:23754948

  13. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.

    Directory of Open Access Journals (Sweden)

    Joshua C Randall

    2013-06-01

    Full Text Available Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723 individuals and took forward 348 SNPs into follow-up (additional 137,052 individuals in a total of 94 studies. Seven loci displayed significant sex-difference (FDR<5%, including four previously established (near GRB14/COBLL1, LYPLAL1/SLC30A10, VEGFA, ADAMTS9 and three novel anthropometric trait loci (near MAP3K1, HSD17B4, PPARG, all of which were genome-wide significant in women (P<5×10(-8, but not in men. Sex-differences were apparent only for waist phenotypes, not for height, weight, BMI, or hip circumference. Moreover, we found no evidence for genetic effects with opposite directions in men versus women. The PPARG locus is of specific interest due to its role in diabetes genetics and therapy. Our results demonstrate the value of sex-specific GWAS to unravel the sexually dimorphic genetic underpinning of complex traits.

  14. 17 CFR 270.32a-2 - Exemption for initial period from vote of security holders on independent public accountant for...

    Science.gov (United States)

    2010-04-01

    ... from vote of security holders on independent public accountant for certain registered separate accounts... from vote of security holders on independent public accountant for certain registered separate accounts... 32(a) of the Act that selection of an independent public accountant shall have been submitted for...

  15. SU-E-T-270: Quality Control of Source Strength and Indexer Length in HDR Brachytherapy Using Sun Nuclear Mapcheck2

    International Nuclear Information System (INIS)

    Morales, J

    2014-01-01

    Purpose: The goal of this work was to evaluate Sun Nuclear MapCheck2 capability for quantitative determination of both HDR source strength and position. Predictive power of Mapcheck2 dose matrix, originated by a microSelectron-v2 source from 22mm distance, was investigated. Methods: A Mick MultiDoc phantom with the 1400mm indexer length mark aligned over MapCheck2 central detector plus two additional 5cm plastic slabs were used as a composite phantom. Dose readings were transformed by applying published source anisotropy corrections and experimentally established radial dose and relative sensitivity factors. Angular dependence was not considered. Only readings from diodes located 2cm around the central detector were evaluated. The reproducibility of a fit between transformed dose readings and the ratio of virtual source strength and the square of source-detector distance was investigated. Four parameters were considered in the model: virtual source strength, lateral, longitudinal and vertical source positions. Final source strength calibration factor was calculated from the ratio of reference measurements and results from the fit. Results: Original lateral and longitudinal source position estimations had systematic errors of 0.39mm and 0.75mm. After subtracting these errors, both source positions were predicted with a standard deviation of 0.15mm. Results for vertical positions were reproducible with a standard deviation of 0.05mm. The difference between calculated and reference source strengths from 34 independent measurement setups had a standard deviation of 0.3%. The coefficient of determination for the linear regression between known indexer lengths and results from the fit in the range 1400mm ± 5mm was 0.985. Conclusions: ource strength can be estimated with MapCheck2 at appropriate accuracy levels for quality control. Verification of indexer length with present implementation is more accurate than visual alternatives. Results can be improved by designing a coupling catheter phantom and refining relative diode calibration. Diode angular dependence in MapCheck2 does not play significant role

  16. 40 CFR 270.140 - What else must the Director prepare in addition to the draft RAP or notice of intent to deny?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What else must the Director prepare in... the Director prepare in addition to the draft RAP or notice of intent to deny? Once the Director has... Regional office or published material that is generally available need not be physically included with the...

  17. Excess Mortality, Causes of Death and Life Expectancy in 270,770 Patients with Recent Onset of Mental Disorders in Denmark, Finland and Sweden

    DEFF Research Database (Denmark)

    Nordentoft, Merete; Wahlbeck, Kristian; Hällgren, Jonas

    2013-01-01

    Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations.......Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations....

  18. Final Environmental Assessment: For the M270 Multiple Launch Rocket System (MLRS) Expanded Training Use Areas at Avon Park Air Force Range, Florida

    Science.gov (United States)

    2005-11-10

    and the propagation and maintenance of a healthy, well-balanced population of fish and wildlife (Florida Administrative Code 62-302) by state...Pistia stratiotes Water lettuce Psidium cattleianum Strawberry guava Rhodomyrtus tomentosa Downy rose myrtle Ruellia brittoniana Mexican petunia

  19. Investigation of the accumulation kinetics of free radicals under irradiation of some polymethylmethacrylate co-polymers in the 270-400 K temperature range

    Energy Technology Data Exchange (ETDEWEB)

    Pivovarov, S P; Poljakov, A I; Rjabikin, Y A; Philippov, N L; Bitenbaev, M I [AN Kazakhskoj SSR, Alma-Ata. Inst. Yadernoj Fiziki

    1982-02-01

    In the present work, anomalous shapes of free radical (FR) accumulation curves found under PMMA copolymers irradiation in the T >= 300/sup 0/ K temperature range have been studied. With the irradiation dose increase the FR concentration in PMMA increases up to a definite maximal value and then starts falling. It is stated that appearance of slopes on the FR accumulation curves is not associated with possible changes of the FR relaxation characteristics. The second order of the FR decay reactions is estimated with the activation energy E = 8.3 kcal/mol. It is suggested that the FR decay processes in the irradiation temperature range T >= 300/sup 0/ K are due to the fast decay of macrochains according to the 'unzipping' mechanism.

  20. Investigation of the accumulation kinetics of free radicals under irradiation of some polymethylmethacrylate co-polymers in the 270-400 K temperature range

    International Nuclear Information System (INIS)

    Pivovarov, S.P.; Poljakov, A.I.; Rjabikin, Y.A.; Philippov, N.L.; Bitenbaev, M.I.

    1982-01-01

    In the present work, anomalous shapes of free radical (FR) accumulation curves found under PMMA copolymers irradiation in the T >= 300 0 K temperature range have been studied. With the irradiation dose increase the FR concentration in PMMA increases up to a definite maximal value and then starts falling. It is stated that appearance of slopes on the FR accumulation curves is not associated with possible changes of the FR relaxation characteristics. The second order of the FR decay reactions is estimated with the activation energy E = 8.3 kcal/mol. It is suggested that the FR decay processes in the irradiation temperature range T >= 300 0 K are due to the fast decay of macrochains according to the 'unzipping' mechanism. (author)

  1. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits

    NARCIS (Netherlands)

    Randall, Joshua C.; Winkler, Thomas W.; Kutalik, Zoltán; Berndt, Sonja I.; Jackson, Anne U.; Monda, Keri L.; Kilpeläinen, Tuomas O.; Esko, Tõnu; Mägi, Reedik; Li, Shengxu; Workalemahu, Tsegaselassie; Feitosa, Mary F.; Croteau-Chonka, Damien C.; Day, Felix R.; Fall, Tove; Ferreira, Teresa; Gustafsson, Stefan; Locke, Adam E.; Mathieson, Iain; Scherag, Andre; Vedantam, Sailaja; Wood, Andrew R.; Liang, Liming; Steinthorsdottir, Valgerdur; Thorleifsson, Gudmar; Dermitzakis, Emmanouil T.; Dimas, Antigone S.; Karpe, Fredrik; Min, Josine L.; Nicholson, George; Clegg, Deborah J.; Person, Thomas; Krohn, Jon P.; Bauer, Sabrina; Buechler, Christa; Eisinger, Kristina; Bonnefond, Amélie; Froguel, Philippe; Hottenga, Jouke-Jan; Prokopenko, Inga; Waite, Lindsay L.; Harris, Tamara B.; Smith, Albert Vernon; Shuldiner, Alan R.; McArdle, Wendy L.; Caulfield, Mark J.; Munroe, Patricia B.; Grönberg, Henrik; Chen, Yii-Der Ida; Li, Guo; Beckmann, Jacques S.; Johnson, Toby; Thorsteinsdottir, Unnur; Teder-Laving, Maris; Khaw, Kay-Tee; Wareham, Nicholas J.; Zhao, Jing Hua; Amin, Najaf; Oostra, Ben A.; Kraja, Aldi T.; Province, Michael A.; Cupples, L. Adrienne; Heard-Costa, Nancy L.; Kaprio, Jaakko; Ripatti, Samuli; Surakka, Ida; Collins, Francis S.; Saramies, Jouko; Tuomilehto, Jaakko; Jula, Antti; Salomaa, Veikko; Erdmann, Jeanette; Hengstenberg, Christian; Loley, Christina; Schunkert, Heribert; Lamina, Claudia; Wichmann, H. Erich; Albrecht, Eva; Gieger, Christian; Hicks, Andrew A.; Johansson, Asa; Pramstaller, Peter P.; Kathiresan, Sekar; Speliotes, Elizabeth K.; Penninx, Brenda; Hartikainen, Anna-Liisa; Jarvelin, Marjo-Riitta; Gyllensten, Ulf; Boomsma, Dorret I.; Campbell, Harry; Wilson, James F.; Chanock, Stephen J.; Farrall, Martin; Goel, Anuj; Medina-Gomez, Carolina; Rivadeneira, Fernando; Estrada, Karol; Uitterlinden, André G.; Hofman, Albert; Zillikens, M. Carola; den Heijer, Martin; Kiemeney, Lambertus A.; Maschio, Andrea; Hall, Per; Tyrer, Jonathan; Teumer, Alexander; Völzke, Henry; Kovacs, Peter; Tönjes, Anke; Mangino, Massimo; Spector, Tim D.; Hayward, Caroline; Rudan, Igor; Hall, Alistair S.; Samani, Nilesh J.; Attwood, Antony Paul; Sambrook, Jennifer G.; Hung, Joseph; Palmer, Lyle J.; Lokki, Marja-Liisa; Sinisalo, Juha; Boucher, Gabrielle; Huikuri, Heikki; Lorentzon, Mattias; Ohlsson, Claes; Eklund, Niina; Eriksson, Johan G.; Barlassina, Cristina; Rivolta, Carlo; Nolte, Ilja M.; Snieder, Harold; van der Klauw, Melanie M.; van Vliet-Ostaptchouk, Jana V.; Gejman, Pablo V.; Shi, Jianxin; Jacobs, Kevin B.; Wang, Zhaoming; Bakker, Stephan J. L.; Mateo Leach, Irene; Navis, Gerjan; van der Harst, Pim; Martin, Nicholas G.; Medland, Sarah E.; Montgomery, Grant W.; Yang, Jian; Chasman, Daniel I.; Ridker, Paul M.; Rose, Lynda M.; Lehtimäki, Terho; Raitakari, Olli; Absher, Devin; Iribarren, Carlos; Basart, Hanneke; Hovingh, Kees G.; Hyppönen, Elina; Power, Chris; Anderson, Denise; Beilby, John P.; Hui, Jennie; Jolley, Jennifer; Sager, Hendrik; Bornstein, Stefan R.; Schwarz, Peter E. H.; Kristiansson, Kati; Perola, Markus; Lindström, Jaana; Swift, Amy J.; Uusitupa, Matti; Atalay, Mustafa; Lakka, Timo A.; Rauramaa, Rainer; Bolton, Jennifer L.; Fowkes, Gerry; Fraser, Ross M.; Price, Jackie F.; Fischer, Krista; Krjutå Kov, Kaarel; Metspalu, Andres; Mihailov, Evelin; Langenberg, Claudia; Luan, Jian'an; Ong, Ken K.; Chines, Peter S.; Keinanen-Kiukaanniemi, Sirkka M.; Saaristo, Timo E.; Edkins, Sarah; Franks, Paul W.; Hallmans, Göran; Shungin, Dmitry; Morris, Andrew David; Palmer, Colin N. A.; Erbel, Raimund; Moebus, Susanne; Nöthen, Markus M.; Pechlivanis, Sonali; Hveem, Kristian; Narisu, Narisu; Hamsten, Anders; Humphries, Steve E.; Strawbridge, Rona J.; Tremoli, Elena; Grallert, Harald; Thorand, Barbara; Illig, Thomas; Koenig, Wolfgang; Müller-Nurasyid, Martina; Peters, Annette; Boehm, Bernhard O.; Kleber, Marcus E.; März, Winfried; Winkelmann, Bernhard R.; Kuusisto, Johanna; Laakso, Markku; Arveiler, Dominique; Cesana, Giancarlo; Kuulasmaa, Kari; Virtamo, Jarmo; Yarnell, John W. G.; Kuh, Diana; Wong, Andrew; Lind, Lars; de Faire, Ulf; Gigante, Bruna; Magnusson, Patrik K. E.; Pedersen, Nancy L.; Dedoussis, George; Dimitriou, Maria; Kolovou, Genovefa; Kanoni, Stavroula; Stirrups, Kathleen; Bonnycastle, Lori L.; Njølstad, Inger; Wilsgaard, Tom; Ganna, Andrea; Rehnberg, Emil; Hingorani, Aroon; Kivimaki, Mika; Kumari, Meena; Assimes, Themistocles L.; Barroso, Inês; Boehnke, Michael; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Frayling, Timothy; Groop, Leif C.; Haritunians, Talin; Hunter, David; Ingelsson, Erik; Kaplan, Robert; Mohlke, Karen L.; O'Connell, Jeffrey R.; Schlessinger, David; Strachan, David P.; Stefansson, Kari; van Duijn, Cornelia M.; Abecasis, Gonçalo R.; McCarthy, Mark I.; Hirschhorn, Joel N.; Qi, Lu; Loos, Ruth J. F.; Lindgren, Cecilia M.; North, Kari E.; Heid, Iris M.

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  2. Sex-stratified Genome-wide Association Studies Including 270,000 Individuals Show Sexual Dimorphism in Genetic Loci for Anthropometric Traits

    DEFF Research Database (Denmark)

    Randall, Joshua C; Winkler, Thomas W; Kutalik, Zoltán

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133...

  3. [Reseña: Comunicacion Intercultural] Rodrigo, Miquel. (2012. La Comunicación Intercultural (2ª Edición . Barcelona: Anthropos. 270 p.

    Directory of Open Access Journals (Sweden)

    Eduardo Enrique Sandoval Obando

    2014-05-01

    Full Text Available La presente obra se convierte en un interesante y valioso aporte para aquellos estudiosos de las ciencias sociales y humanas; pero particularmente de aquellos sujetos involucrados en la comprensión de las diversas interrelaciones y contactos entre diversas culturas en que el intercambio de visiones, formas de pensar, creencias, costumbres, valores y diversas identidades, nos obligan / invitan a co-construir nuevas categorías de sentido, para el adecuado conocimiento de otros, a partir de una comunicación efectiva, pertinente, diversa y significativa. El libro se presenta en 5 capítulos, cada uno de los cuales se encuentran conformados por diversos sub-apartados que profundizan y aclaran didáctica y socioculturalmente, los diversos estudios y modelos teórico – prácticos que han ido emergiendo en este campo de desarrollo.

  4. Sex-stratified Genome-wide Association Studies Including 270,000 Individuals Show Sexual Dimorphism in Genetic Loci for Anthropometric Traits

    NARCIS (Netherlands)

    Randall, J.C.; Winkler, T.W.; Kutalik, Z.; Berndt, S.I.; Jackson, A.U.; Monda, K.L.; Kilpelainen, T.O.; Esko, T.; Magi, R.; Li, S.; Workalemahu, T.; Feitosa, M.F.; Croteau-Chonka, D.C.; Day, F.R.; Fall, T.; Ferreira, T.; Gustafsson, S.; Locke, A.E.; Mathieson, I.; Scherag, A.; Vedantam, S.; Wood, A.R.; Liang, L.; Steinthorsdottir, V.; Thorleifsson, G.; Dermitzakis, E.T.; Dimas, A.S.; Karpe, F.; Min, J.L.; Nicholson, G.; Clegg, D.J.; Person, T.; Krohn, J.P.; Bauer, S.; Buechler, C.; Eisinger, K.; Bonnefond, A.; Froguel, P.; Hottenga, J.J.; Prokopenko, I.; Waite, L.L.; Harris, T.B.; Smith, A.V.; Shuldiner, A.R.; McArdle, W.L.; Caulfield, M.J.; Munroe, P.B.; Gronberg, H.; Chen, Y.D.; Li, G.; Beckmann, J.S.; Johnson, T.; Thorsteinsdottir, U.; Teder-Laving, M.; Khaw, K.T.; Wareham, N.J.; Zhao, J.H.; Amin, N.; Oostra, B.A.; Kraja, A.T.; Province, M.A.; Cupples, L.A.; Heard-Costa, N.L.; Kaprio, J.; Ripatti, S.; Surakka, I.; Collins, F.S.; Saramies, J.; Tuomilehto, J.; Jula, A.; Salomaa, V.; Erdmann, J.; Hengstenberg, C.; Loley, C.; Schunkert, H.; Lamina, C.; Wichmann, H.E.; Albrecht, E.; Gieger, C.; Hicks, A.A.; Johansson, A; Pramstaller, P.P.; Kathiresan, S.; Speliotes, E.K.; Penninx, B.; Hartikainen, A.L.; Jarvelin, M.R.; Gyllensten, U.; Boomsma, D.I.; Campbell, H.; Wilson, J.F.; Chanock, S.J.; Farrall, M.; Goel, A.; Medina-Gomez, C.; Rivadeneira, F.; Estrada, K.; Uitterlinden, A.G.; Heijer, M. den; Kiemeney, L.A.L.M.; et al.,

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  5. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits

    NARCIS (Netherlands)

    Randall, Joshua C; Winkler, Thomas W; Kutalik, Zoltán; Berndt, Sonja I; Jackson, Anne U; Monda, Keri L; Kilpeläinen, Tuomas O; Esko, Tõnu; Mägi, Reedik; Li, Shengxu; Workalemahu, Tsegaselassie; Feitosa, Mary F; Croteau-Chonka, Damien C; Day, Felix R; Fall, Tove; Ferreira, Teresa; Gustafsson, Stefan; Locke, Adam E; Mathieson, Iain; Scherag, Andre; Vedantam, Sailaja; Wood, Andrew R; Liang, Liming; Steinthorsdottir, Valgerdur; Thorleifsson, Gudmar; Dermitzakis, Emmanouil T; Dimas, Antigone S; Karpe, Fredrik; Min, Josine L; Nicholson, George; Clegg, Deborah J; Person, Thomas; Krohn, Jon P; Bauer, Sabrina; Buechler, Christa; Eisinger, Kristina; Bonnefond, Amélie; Froguel, Philippe; Smith, Albert Vernon; Zhao, Jing Hua; Penninx, Brenda; Nolte, Ilja M; Snieder, Harold; Van der Klauw, Melanie M; Van Vliet-Ostaptchouk, Jana V; Bakker, Stephan J L; Mateo Leach, Irene; Navis, Gerjan; van der Harst, Pim; Kumari, Meena

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  6. 17 CFR 270.10f-3 - Exemption for the acquisition of securities during the existence of an underwriting or selling...

    Science.gov (United States)

    2010-04-01

    ...) Are subject to no greater than moderate credit risk; or (ii) If the issuer of the municipal securities... securities are subject to a minimal or low amount of credit risk. (4) Eligible Rule 144A Offering means an... purchased are: (i) Part of an issue registered under the Securities Act of 1933 (15 U.S.C. 77a—aa) that is...

  7. Paul Laity, The British Peace Movement 1870-1914. Oxford,Clarendon Press; 2001. IX + 270 p. ISBN: 0 19 924835 4.

    OpenAIRE

    Porter, Bernard

    2005-01-01

     « L’idée selon laquelle on pouvait abolir la guerre », dit Paul Laity dans ce livre, « a été plus répandue en Grande-Bretagne au XIXe siècle qu’au sein d’aucune autre puissance européenne. » C’est en premier lieu à cause de la sécurité géographique du pays, en raison de son insularité ; ensuite, l’in­fluence de la doctrine libre-échangiste, qui a toujours eu une forte composante pacifiste : les idéalistes du libéralisme comme Richard Cobden pensaient que quand les gens échangeraient libremen...

  8. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  9. CRED Subsurface Temperature Recorder (STR); Rose Atoll, American Samoa; Long: -168.16020, Lat: -14.55127 (WGS84); Sensor Depth: 2.70m; Data Date Range: 20100304-20120418.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  10. A meta-analysis of long follow-up outcomes of laparoscopic Nissen (total) versus Toupet (270°) fundoplication for gastro-esophageal reflux disease based on randomized controlled trials in adults.

    Science.gov (United States)

    Du, Xing; Hu, Zhiwei; Yan, Chao; Zhang, Chao; Wang, Zhonggao; Wu, Jimin

    2016-08-02

    Laparoscopic Nissen fundoplication (LNF) is the most common surgical procedure for the surgical management of gastro-esophageal reflux disease (GERD). Laparoscopic Toupet fundoplication (LTF) has been reported to have a lower prevalence of postoperative complications yet still obtain a similar level of reflux control. We conducted a meta-analysis to confirm the value of LNF and LTF. PubMed, Medline, Embase, Cochrane Library and Springerlink were searched for randomized controlled trials (RCTs) comparing LNF and LTF. Data regarding the benefits and adverse results of two techniques were extracted and compared using a meta-analysis. Eight eligible RCTs comparing LNF (n = 625) and LTF (n = 567) were identified. There were no significant differences between LNF and LTF with regard to hospitalization duration, perioperative complications, patient satisfaction, postoperative heartburn, regurgitation, postoperative DeMeester scores, or esophagites. A shorter operative time and higher postoperative lower esophageal sphincter pressure were associated with LNF. Prevalence of postoperative dysphagia, gas-bloating, inability to belch, dilatation for dysphagia and reoperation were higher after LNF, but subgroup analyses showed that differences with respect to dysphagia between LNF and LTF disappeared over time. Subgroup analyses did not support "tailored therapy" according to preoperative esophageal motility. LNF and LTF have equivalently good control of GERD and result in a similar prevalence of patient satisfaction. Based on current evidence, it is not rational or advisable to abandon LNF when choosing a surgical procedure for GERD.

  11. 75 FR 47223 - Louisiana: Final Authorization of State-Initiated Changes and Incorporation by Reference of...

    Science.gov (United States)

    2010-08-05

    ..., unless the EPA receives adverse written comment on this regulation by the close of business September 7... personal information provided, unless the comment includes information claimed to be Confidential Business... 270.14(a) and (b) intro. 517.B.5 270.14(b)(19)(iv). 517.T.6.a 270.14(c) related. 517.V 270.14(b)(21...

  12. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AERVDGVREALKGSKWTEVAGSPTFCNDDPALAVQQMTDMRTAT 180 ... Query: 270 GQRPFEMGEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK 314 ... GQRPFEM...GEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK Sbjct: 241 GQRPFEMGEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK 285

  13. Decree no.2003-270 on the 24. of march 2003 relative to the protection of persons exposed to ionizing radiations in medical and medico-legal aims and modifying the health code of public health (second part: decrees in Council of State); Decret no. 2003-270 du 24 mars 2003 relatif a la protection des personnes exposees a des rayonnements ionisants a des fins medicales et medico-legales et modifiant le code de la sante publique (deuxieme partie: decrets en Conseil d'Etat)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    This decree concerns the protection of persons exposed to ionizing radiation in medical aims. Three principal points are debated, the justification, the optimization and the procedures to use in practice. The justification requires that it exists an indisputable advantage compared with the risk it can present and no other technique with a comparable efficiency and less risks is available. The optimization needs to use ionizing radiations at the lowest level as reasonably achievable, the third part is devoted to the procedures, the guides and the training of the person who practices the examinations. (N.C.)

  14. 48 CFR 870.111-3 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... officer shall include the clause at 852.270-2, Bread and bakery products—quantities, in solicitations and contracts for bread and bakery products. (b) The contracting officer shall include the clause at 852.270-3...

  15. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IDFMRLAINGTAEAHRACMKYCKPGMYEF Sbjct: 121 IRTKAVYKYNTNETELHDVLFEARTVKTKEEIDFMRLAINGTAEAHRACMKYCKPGMYEF 180 ... Query: 270 CHRYATDLTLTYPIN...GKFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG 329 ... CHRYATDLTLTYPING...KFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG Sbjct: 241 CHRYATDLTLTYPINGKFTEQQKTIYNIVLS

  16. [Escherichia coli heat-labile enterotoxin B subunit enhances the immune response against canine parvovirus VP2 in mice immunized by VP2 DNA vaccine].

    Science.gov (United States)

    Han, Dongmei; Zhong, Fei; Li, Xiujin; Wang, Wei; Wang, Xingxing; Pan, Sumin

    2011-01-01

    To investigate the effect of Escherichia coli heat-labile enterotoxin (LT) B subunit (LTB) gene on canine parvovirus (CPV) VP2 gene vaccine. The LTB gene was amplified by PCR from genomic DNA of E. coli 44815 strain. The VP2-70 fragment (210 bp) encoding major epitope of VP2 (70 amino acids) was amplified by PCR from a plasmid encoding VP2 gene. VP2-70 and LTB genes were inserted into the eukaryotic vector to construct VP2-70 gene,LTB gene and VP2-70-LTB fused gene vectors. The mice were immunized with VP2-70 vector, VP2-70-LTB fused vector, or VP2-70 vector plus LTB vector, respectively. The antibody titers at the different time were measured by using ELISA method. The spleen lymphocyte proliferation activity was analyzed by 3-(4, 5-Dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay. The sequence of VP2-70 and LTB genes was identified. The recombinant VP2-70 and LTB proteins could be expressed in HEK293T cells in a secretory manner. The mice immunized with VP2-70 vector, VP2-70-LTB vector or VP2-70 vector plus LTB vector could generate the specific antibody against VP2 protein. The antibody titer immunized with VP2-70-LTB vector reached 1:5120 at 35 d post immunization, significantly higher than that of other two groups (P vaccine in mice.

  17. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  18. 78 FR 4135 - Programmatic Environmental Impact Statement for the Training Mission and Mission Support...

    Science.gov (United States)

    2013-01-18

    ... INFORMATION CONTACT: Mr. Gene Zirkle at (270) 798-9854, during normal working business hours Monday through.... This includes the formalization of environmental stewardship best management practices (BMPs...

  19. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sensor ... histidine kinase [Tropheryma whipplei str. Twist] ... Length = 81 ... Query: 211 MLDSLEKALGERD...KTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE 270 ... MLDSLEKALGERD...KTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE Sbjct: 1 ... MLDSLEKALGERDKTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE 60 ...

  20. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADACRLLGDRAYRLCLTDMRLPDGDGIELVAHIQTQQPGLPVAVV 78 ... Query: 150 AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPV...NCGAISPEL 209 ... AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL Sbjct: 139 AALAQLR...VQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL 198 ... Query: 270 GAHAEESVDVR

  1. Genetic parameters estimate for milk and mozzarella cheese yield, fat and protein percentage in dairy buffaloes in Brazil

    Directory of Open Access Journals (Sweden)

    H. Tonhati

    2010-02-01

    Full Text Available The aim of this study was analyze the (covariance components and genetic and phenotypic relationships in the following traits: accumulated milk yield at 270 days (MY270, observed until 305 days of lactation; accumulated milk yield at 270 days (MY270/ A and at 305 days (MY305, observed until 335 days of lactation; mozzarella cheese yield (MCY and fat (FP and protein (PP percentage, observed until 335 days of lactation. The (covariance components were estimated by Restricted Maximum Likelihood methodology in analyses single, two and three-traits using animal models. Heritability estimated for MY270, MY270/A, MY305, MCY, FP and PP were 0.22; 0.24, 0.25, 0.14, 0.29 and 0.40 respectively. The genetic correlations between MCY and the variables MY270, MY270/A, MY305, PP and FP was: 0.85; 1.00; 0.89; 0.14 and 0.06, respectively. This way, the selection for the production of milk in long period should increase MCY. However, in the search of animals that produce milk with quality, the genetic parameters suggest that another index should be composed allying these studied traits.

  2. 78 FR 58309 - Proposed Information Collection Activity; Comment Request

    Science.gov (United States)

    2013-09-23

    ... initiative, funded by the Children's Bureau (CB) within ACF, will support planning grants to develop a model... for the process evaluation will be used to assess grantees' organizational capacity and readiness to... response burden hours Baseline Telephone Interview of 540 270 1 1.0 270 Organizational Readiness...

  3. 48 CFR 302.7000 - Common HHSAR acronyms and abbreviations.

    Science.gov (United States)

    2010-10-01

    ... acronyms and abbreviations. (a) The HHSAR cites numerous acquisition-related and organizational acronyms...-3(b)(3). CDC Centers for Disease Control and Prevention 301.270(b). CFR Code of Federal Regulations....1300(c). PSC Program Support Center (in OS) 301.270(b). R&D research and development 301.607-72(b). RFI...

  4. 77 FR 71344 - Texas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2012-11-30

    ... adverse written comment on the codification of the Texas authorized RCRA program by the close of business... Business Information (CBI) or other information whose disclosure is restricted by statute. Do not submit...) introductory paragraph 40 CFR 270.42(a)(1) intro. 30 TAC 305.69(b)(1)(A), except for 40 CFR 270.42(a)(1)(i...

  5. Detection of measles IgM antibodies in children at Kaduna ...

    African Journals Online (AJOL)

    Measles virus IgM antibodies virus was assayed for in 270 sera from children aged 5 months to 8 years attending Yusuf Dantsoho Memorial Hospital, Kaduna, Northern Nigeria, using ELISA. Out of the 270 sera, 192(71.1%) tested positive to measles IgM and 78(28.9%) negative. The sample distribution was 137 from males, ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 7, No 1 (2008), The Seasonal Cycle of Sea Level in Sri Lanka and ... in the Submerged Channels of Dar es Salaam Coastal Waters, Abstract PDF ... Vol 3, No 2 (2004), Trophic Ecology of Some Common Juvenile ...

  7. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  8. Prevalence of Coxsackievirus A6 and Enterovirus 71 in Hand, Foot and Mouth Disease in Nanjing, China in 2013.

    Science.gov (United States)

    Hu, Ya-Qian; Xie, Guang-Cheng; Li, Dan-Di; Pang, Li-Li; Xie, Jing; Wang, Peng; Chen, Ying; Yang, Jing; Cheng, Wei-Xia; Zhang, Qing; Jin, Yu; Duan, Zhao-Jun

    2015-09-01

    Although hand, foot and mouth disease (HFMD) has been strongly associated with enterovirus 71 (EV71), coxsackievirus A16 (CVA16) and other enteroviruses, studies regarding coxsackievirus A6 (CVA6) infection in HFMD are limited. The aim of this study was to identify the major etiological agents causing HFMD in Nanjing in 2013 and explore the clinical and genetic characteristics of the prevalent enterovirus (EV) types in HFMD. A total of 394 throat swabs were collected from hospitalized children diagnosed with HFMD from April to July 2013. EVs were detected by reverse transcription polymerase chain reaction of 5' UTR sequences. Genotyping and phylogenetic analysis were based on VP4 sequences. Demographic and clinical data were obtained. Of the specimens, 68.5% (270/394) were positive for EVs. The genotypes and detection rates were CVA6, 30.00% (81/270); EV71, 17.41% (47/270); HRV, 11.11% (30/270); CVA10, 3.33% (9/270); CVA2, 1.11% (3/270); CVA16, 0.74% (2/270); EV68, 0.37% (1/270); echovirus 6, 0.37% (1/270); echovirus 9, 0.37% (1/270), respectively. Patients infected with CVA6 displayed symptoms atypical of HFMD, including larger vesicles on their limbs and buttocks. Phylogenetic analysis revealed 2 genetically distinct CVA6 strains that circulated independently within the region. Patients infected with CVA6 were more likely to have abnormal periphery blood white blood cell and C-reactive protein levels, while EV71 was more likely to infect the central nervous system, as indicated by clinical manifestations and white blood cell analysis of cerebrospinal fluid. Multiple EV genotypes contributed to HFMD in Nanjing in 2013, and CVA6 was the dominant genotype. The clinical presentation of CVA6 infection differs from that of EV71 infection in HFMD.

  9. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  10. Hydrogen as an energy carrier. Final report; Wasserstoff als Energietraeger. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Rebholz, H. [ed.

    1998-12-01

    This final report of the Special Field of Research 270 (SFB 270) documents the work and results of the four promotion phases from 1989 to 1998, presented in reports on 15 part-projects. From its inception, SFB 270, which bears the title ''Hydrogen as an Energy Carrier'', has been dedicated to two fields of work: in Project Area A to the production of hydrogen (7 part-projects) and in Project Area B to the transport and storage of hydrogen (8 part-projects). The scientific results of the part-projects have also been presented in detail in the progress reports and interim reports of 1991, 1994 and 1997. Some of them have also been presented at the colloquiums of SFB 270. Twelve part-projects have been abstracted individually for the ENERGY database. [German] Der vorliegende Abschlussbericht des Sonderforschungsbereichs 270 dokumentiert die Arbeiten und Ergebnisse der vier Foerderungsphasen von 1989 bis 1998. Sie sind in den Berichten von 15 Teilprojekten wiedergegeben. Der Sonderforschungsbereich 270 'Wasserstoff als Energietraeger' hat sich von Anfang an zwei Aufgabengebieten gewidmet: Im Projektbereich A der Herstellung von Wasserstoff (7 Teilprojekte) und im Projektbereich B dem Transport und der Speicherung von Wasserstoff (8 Teilprojekte). Wissenschaftliche Ergebnisse der Teilprojekte sind ausfuehrlich auch in den Arbeits- und Ergebnisberichten 1991, 1994 und 1997 wiedergegeben. Sie wurden auch, in Teilen, in entsprechenden Kolloquien des SFB 270 praesentiert. Fuer die Datenbank ENERGY wurden 12 Teilprojekte separat aufgenommen. (orig.)

  11. Surface effects during exoelectron-emission of BeO ceramics

    International Nuclear Information System (INIS)

    Siegel, V.; Kirchner, H.H.

    1979-01-01

    Studying the behaviour of the two thermally stimulated exoelectron emission (TSEE) maxima of BeO ceramics at about 270 0 C und 325 0 C it can be shown that the TSEE maximum at 270 0 C is closely connected with adsorption and desorption processes occuring on the surface of the samples. In particular, this TSEE maximum is strongly influenced as well by donor-like behaviour of adsorbed hydrogen and lithium as by acceptor-like behaviour of alcohols and nitrides of the lithium. The detailed surface processes leading to the apperance or disapperance of the TSEE maximum at 270 0 C are discussed. (orig.) [de

  12. Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication, Environmental Protection Agency Number ID4890008952

    Energy Technology Data Exchange (ETDEWEB)

    Holzemer, Michael J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hart, Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-04-01

    Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication for the Idaho National Laboratory Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Partial Permit, PER-116. This Permit Reapplication is required by the PER-116 Permit Conditions I.G. and I.H., and must be submitted to the Idaho Department of Environmental Quality in accordance with IDAPA 58.01.05.012 [40 CFR §§ 270.10 and 270.13 through 270.29].

  13. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 657 ... Home · Project; South of Sahara .... Trauma, Development and Peacebuilding : Toward an ... the conceptualization of post-traumatic stress disorder (PTSD), ... Centre for Environmental Economics and Policy in Africa.

  14. TMX-U [Tandem Mirror Experiment-Upgrade]: Final report, Volume 2

    International Nuclear Information System (INIS)

    Porter, G.D.

    1988-01-01

    This paper discusses the plasma control and the physics accomplishments of the Tandem Mirror Experiment-Upgrade. This particular volume discusses fueling, ion heating, Fokker-Planck modeling, plasma stability and technical development. 270 refs

  15. Temperature and 8 MeV electron irradiation effects on GaAs solar cells

    Indian Academy of Sciences (India)

    1Department of Physics, Mangalore Institute of Technology and Engineering, ... strate were irradiated with 1 MeV electrons, they showed high radiation tolerance ... under both forward and reverse bias in the temperature range of 270–315 K ...

  16. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1368 ... ICT in the context of education system ... Statistical handbook on baseline survey : part 1; data tables; (Focus City ... Technologies (ICT) in international development assistance - issues, trends and opportunities.

  17. Drug Does Not Improve Set of Cardiovascular Outcomes for Diastolic Heart Failure

    Science.gov (United States)

    ... 270 sites spread across the United States, Canada, Argentina, Brazil, the Republic of Georgia, and Russia. Trial ... The other method required looked at a person's history of heart failure hospitalization within the last year. ...

  18. Prožitek architektury

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2008-01-01

    Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Correlates of Weapon Carrying in School among Adolescents in Three Countries

    Czech Academy of Sciences Publication Activity Database

    Stickley, A.; Koyanagi, A.; Koposov, R.; Blatný, Marek; Hrdlička, M.; Schwab-Stone, M.; Ruchkin, V.

    2015-01-01

    Roč. 39, č. 1 (2015), s. 99-108 ISSN 1945-7359 Institutional support: RVO:68081740 Keywords : adolescent * Czech Republic * Russia * United States * weapon carrying Subject RIV: AN - Psychology Impact factor: 1.270, year: 2015

  20. South African Journal of Education - Vol 22, No 4 (2002)

    African Journals Online (AJOL)

    Analysing the role of ICT in bridging the digital divide amongst learners · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marlien Herselman, K.G. Britton, 270-274 ...

  1. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8494 ... Financial inclusion is an enabler for women's economic empowerment. ... Agency and IDRC, will support 140 doctoral and 60 early career women scientists in ... Addressing the Barriers to Young Women's Economic ...

  2. Towards supported bolaamphiphile membranes for water filtration: Roles of lipid and substrate

    NARCIS (Netherlands)

    Kaufman, Y.; Grinberg, S.; Linder, C..; Heldman, E.; Gilron, J.; Shen, Yue-xiao; Kumar, M.; Lammertink, Rob G.H.; Freger, V.

    2014-01-01

    Supported biomimetic membranes hold potential for applications such as biosensors and water purification by filtration. The current paper reports on the preparation of a supported bolaamphiphile membrane on two polymeric nanofiltration membranes: NF-270 made of polyamide with carboxylic surface

  3. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1325 ... Filter by project status ... Urban Poverty and Environment Programme : Colombo; monitoring and evaluation component; monitoring findings ... Enough foreign direct investment quickens economic growth everywhere.

  4. Sounding Cratonic Fill in Small Buried Craters Using Ground Penetrating Radar: Analog Study to the Martian Case

    OpenAIRE

    Heggy , Essam; Paillou , Philippe

    2006-01-01

    We report results from a 270 MHz GPR survey performed on a recently discovered impact field in the southwestern Egyptian desert. The investigation suggests the ability of radar techniques to detect small-buried craters and probe their filling

  5. Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2013-01-01

    Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

  6. Post-brooding management of local guinea fowls ( Numida meleagris )

    African Journals Online (AJOL)

    Amposem, I Adam. Abstract. No abstract. Bulletin of Animal Health and Production in Africa Vol. 54 (4) 2006: pp. 270-276. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 270 ... ... A Ten-year Period of Daily Sea Surface Temperature at a Coastal ... anthropogenic habitat modification around an East African estuary, Abstract PDF ... Development of the Mangrove Crab Parasesarma catenata Ortman, ...

  8. Factors affecting vaccine handling and storage practices among ...

    African Journals Online (AJOL)

    Objective: Assessing the factors associated with vaccine handling and storage practices. Methods: This was a .... Others include insufficient/unavailable backup refrigerators (52%) .... Human Vaccines 2010; 6(3): 270-278. 5. Joao Carlos de ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 270 ... Journal of Pharmaceutical and Allied Sciences. ... Vol 14, No 4 (2017), Influence of ampicllin/cloxacilin combination on pharmacokinetics of metformin in type ... effect of polymer type and composition on drug release from ...

  10. Subsurface ammonium maxima in northern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Satyanarayana, D.; Sahu, S.D.; Panigrahy, P.K.; Sarma, V.V.; Suguna, C.

    environments: The eastern tropical North Pacific Ocean and the Cariaco Trench. PhD Thesis, University of California at Los Angeles, 270 pp. Codispoti, L. A. (1981). Temporal nutrient variability in three different upwelling regions. In Coastal Upwelling, ed...

  11. 78 FR 64200 - Caribbean Fishery Management Council; Public Meetings

    Science.gov (United States)

    2013-10-28

    ... Caribbean Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries Service (NMFS), National... held at the Caribbean Fishery Management Council Headquarters, located at 270 Mu[ntilde]oz Rivera...

  12. 76 FR 49802 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-08-11

    ... reject the selection of the fund's independent public accountant. Rule 32a-4 (17 CFR 270.32a-4) exempts... information unless it displays a currently valid control number. The public may view the background...

  13. Migrace v české etnologii: náměty k obohacení migrační teorie

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    2016-01-01

    Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. ORF Sequence: NC_003423 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available orphan; low similarity to glycoamylases and other cell surface proteins; contains ~250-270 copies of a 13 AA repeat, NSS...TNSISFANTTPENTSTQITSPTAVNSSTPITSSSVLNSSTPITSSSILNTSTPITSSSVLNSSTPITSSSILNSSTPITSSTVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSS...TPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSS

  15. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 369 ... High income inequality in developed countries is attributed to skill-biased ... Resources and Division of Labour along Gender Lines in Veracruz, Mexico ... ICTs for Microcredit Delivery : Correspondent Banking in Brazil.

  16. High capacity hydrogen storage nanocomposite materials

    Science.gov (United States)

    Zidan, Ragaiy; Wellons, Matthew S.

    2017-12-12

    A novel hydrogen absorption material is provided comprising a mixture of a lithium hydride with a fullerene. The subsequent reaction product provides for a hydrogen storage material which reversibly stores and releases hydrogen at temperatures of about 270.degree. C.

  17. Euroopa Liidu 7. Raamprogrammi projekt FLAVOURE / Marge Malbe

    Index Scriptorium Estoniae

    Malbe, Marge, 1968-

    2011-01-01

    2009. a sai Eesti Maaviljeluse Instituut 843,270.00 € suuruse Euroopa Liidu finantseeringu 3 aastat kestva projekti FLAVOURE (Food and Feed Laboratory of Varied and Outstanding Research in Estonia) läbiviimiseks ja koordineerimiseks

  18. Riccioli Revisited. A New Analysis of Giovanni Battista Riccioli’s New Almagest

    Directory of Open Access Journals (Sweden)

    Anna-Luna Post

    2016-09-01

    Full Text Available Review of: Christopher M. Graney, Setting Aside All Authority. Giovanni Battista Riccioli and the Science against Copernicus in the Age of Galileo, University of Notre Dame Press, 2015, 270 p., ill., ISBN: 9780268029883, $29.00.

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 270 ... Western Indian Ocean Journal of Marine Science. ... effective light trap for sampling tropical fish and crustacean larvae, Abstract PDF ... of Glutamate Dehydrogenase from the Marine Red Alga Gracilaria sordida (Harv.) ...

  20. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8531 ... GrOW briefs: From research to policy ... this research and offer actionable recommendations for decision-maker. ... Economic growth and gender equality ... Although women's labour force participation has increased ...

  1. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 282 ... Gender, International Law and Justice : Access to Gender Equality ... Culture and the Exercise of Decision Making by Women in West Africa ... in economic, political and social decision-making, and weak participation.

  2. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1804 ... IDRC's Democratic Governance, Women's Rights and Gender Equality ... from complex interactions between natural and human systems. ... years of potential life lost due to premature mortality or disability (DALYs).

  3. Original Research Article Phytochemical, Proximate and Metal

    African Journals Online (AJOL)

    Erah

    2.80%, fibre 2.70% and fat 1.80% but a relatively high content of ... tolerable upper intake established by the overseeing body. ... multiple organs, including the nervous, cardiovascular, gastro-intestinal, hepatic, renal, and hematologic systems.

  4. Publications | Page 27 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 7331 ... ... to build local capacity through funding, knowledge sharing, and training. ... Use of Mobile Phones by the Rural Poor: Gender perspectives from ... as a result of changes in diet, nutrition, and physical activity levels.

  5. 42 CFR 84.1147 - Silica mist test for dust, fume, and mist respirators; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... shall be ground to pass 99+ percent through a 270-mesh sieve. (e) Samples of the test suspension will be taken during each test period for analysis. (f) The total amount of silica mist unretained in the...

  6. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275 ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.761, year: 2015

  8. Knowledge and Perceptions of Date Rape among Female ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    to collect data. Knowledge .... The basic steps in the data gathering process ... Book. Newspaper. Radio. Lecture. Internet. Church/Mosque. Parents. 295. 270 .... Ladies/girls who love to demand material things from men and yet do not want.

  9. 40 CFR Appendix B to Part 97 - Final Section 126 Rule: Non-EGU Allocations, 2004-2007

    Science.gov (United States)

    2010-07-01

    ... MOBIL OIL CORPORATION 55006 027 0 NJ Gloucester MOBIL OIL CORPORATION 55006 270 14 NJ Monmouth NESTLE CO., INC., THE 20004 006 13 NJ Monmouth NESTLE CO., INC., THE 20004 007 13 NJ Middlesex NEW JERSEY STEEL...

  10. Peer Instruction in the Learning Laboratory: A Strategy To Decrease Student Anxiety.

    Science.gov (United States)

    Owens, Laura D.; Walden, Debra J.

    2001-01-01

    To decrease nursing students' anxiety during psychomotor skills testing in learning laboratories, paid peer instructors were trained to assist. Over 3 years, 270 students participated and reported positive outcomes. (SK)

  11. 45 CFR 1174.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  12. 13 CFR 143.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  13. 45 CFR 1157.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  14. 24 CFR 85.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  15. 45 CFR 1183.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  16. 21 CFR 1403.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  17. 49 CFR 18.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  18. 10 CFR 600.250 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  19. 15 CFR 24.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  20. 14 CFR 1273.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  1. 43 CFR 12.90 - Closeout.

    Science.gov (United States)

    2010-10-01

    ....) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  2. 20 CFR 437.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...) Final request for payment (SF-270) (if applicable). (iv) Invention disclosure (if applicable). (v... are not limited to: (i) Final performance or progress report. (ii) Financial Status Report (SF 269) or...

  3. 22 CFR 135.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  4. 28 CFR 66.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ....) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  5. ballistic performance of a quenched and tempered steel against

    African Journals Online (AJOL)

    eobe

    was investigated. Low alloy steel ... obliquity obliquity with a projectile velocity with a projectile velocity with a projectile .... quenching on low carbon and alloyed steel [5, 15]. Several studies .... Mars 190, Mars 240, Mars 270, Creusot-Loire,.

  6. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 875 ... In order to maximize learning from IDRC-organized events, ... Exploring the Emerging Impacts of Open Data in Developing Countries network ... data, and shares examples of potential social and economic benefits.

  7. Publications | Page 27 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 7331 ... Through the Global Entrepreneurship Monitor, Canadian and ... helps female entrepreneurs connect to global supply chains ... The report details activities and outputs of the groundwater management strategy with ...

  8. 76 FR 50216 - Ocean Transportation Intermediary License; Revocation

    Science.gov (United States)

    2011-08-12

    ... & Freight Forwarders. Address: 7094 Peachtree Industrial Boulevard, Suite 270-1, Norcross, GA 30071. Date...: 021616N. Name: Scrap-N-Ship Logistics Corp. Address: 810 SW. 173rd Avenue, Pembroke Pines, FL 33029. Date...

  9. Granulomatosis with polyangiitis

    Science.gov (United States)

    ... ncbi.nlm.nih.gov/pubmed/21372195 . Specks U, Merkel PA, Seo P, et al. Efficacy of remission- ... PA: Elsevier Saunders; 2016:chap 270. Stone JH, Merkel PA, Spiera R, et al. Rituximab versus cyclophosphamide ...

  10. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  11. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8491 ... Building emerging leaders in communications policy in Africa and Asia. In Africa and Asia, ... Perspectives ... Agricultural extension uses scientific research to educate farmers and improve agricultural practices.

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 270 ... ... Estimation of Folate (Vitamin B9) in fresh Lactuca sativa (Lettuce), Spinancia ... Evaluation of the microbiological quality and stability of folic acid ... Health status and pregnancy experience of pregnant women in a rural ...

  13. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  14. Heterogeneously Catalyzed Endothermic Fuel Cracking

    Science.gov (United States)

    2016-08-28

    reactor was circumferentially delivered from a 4.2 kW array consisting of 4 independently PID controlled fiber insulated heaters (Zircar ceramics, FIH...the H-ZSM- 5 lattice and Brønsted acid site characteristics” Micropor . Mesopor. Mater., 222 (2016) 256−270. DISTRIBUTION A: Distribution...distribution on the H-ZSM-5 lattice and Brønsted acid site characteristics" Micropor . Mesopor. Mater., 222 (2016) 256-270. S. M. Opalka, H. Huang

  15. 76 FR 12283 - Texas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2011-03-07

    ... written comment on the codification of the Texas authorized RCRA program by the close of business April 6.... 30 TAC 305.45(a)(8) intro.--(a)(8)(B).. 40 CFR 270.13(l) related. 30 TAC 305.50(a)(6) 40 CFR 270.17(b.... The Congressional Review Act, 5 U.S.C. 801 et seq., as added by the Small Business Regulatory...

  16. Novel Semiconducting Polymers for Highly Efficient Solar Energy Harvesting

    Science.gov (United States)

    2014-03-11

    we have developed an effective approach to enhance PCE and achieved an unprecedented high PCE value around 9.4%. S SS S X O O S SO OS S X S S X...Address: 128.135.225.61 Language: English (en-us,en;q=0.7,zh-cn;q=0.3) User Agent: Mozilla/5.0 (Windows NT 5.1; rv:27.0) Gecko/20100101 Firefox /27.0 Http

  17. Penentuan Bilangan Asam Dan Bilangan Penyabunan Pada Asam Laurat Hasil Hidrolisis Palm Kernel Oil (PKO) Di PT Socimas Medan

    OpenAIRE

    Tobing, Windy.T.

    2012-01-01

    Has been performed analysis in which the specified number of acid value and saponification value in lauric acid from hydrolysis process of palm kernel oil in PT.Socimas. Analysis of the results obtained acid value 269,9 and saponification value 270,8. Thus the acid value and saponification value correspond to the standart value 269-275 for acid value, and 270-276 for saponification value in PT. Socimas. 092401017

  18. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín

    2013-05-01

    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  19. Detailed Analysis of the Asteroid Pair (6070) Rheinland and (54827) 2001 NQ8

    Czech Academy of Sciences Publication Activity Database

    Vokrouhlický, D.; Pravec, Petr; Ďurech, J.; Hornoch, Kamil; Kušnirák, Peter; Galád, Adrián; Vraštil, J.; Kučáková, Hana; Pollock, J.; Ortiz, J.L.; Morales, N.; Gaftonyuk, N. M.; Pray, D. P.; Krugly, Yu. N.; Inasaridze, R.Ya.; Ayvazian, V.; Molotov, I.E.; Colazo, C.A.

    2017-01-01

    Roč. 153, č. 6 (2017), 270/1-270/17 ISSN 0004-637X R&D Projects: GA ČR(CZ) GA17-00774S Grant - others:GA ČR(CZ) GA13-01308S Institutional support: RVO:67985815 Keywords : minor planets * asteroids * general Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.533, year: 2016

  20. Class of backpropagation techniques for limited-angle reconstruction in microwave tomography

    International Nuclear Information System (INIS)

    Paladhi, P. Roy; Tayebi, A.; Udpa, L.; Udpa, S.; Sinha, A.

    2015-01-01

    Filtered backpropagation (FBPP) is a well-known technique used in Diffraction Tomography (DT). For accurate reconstruction using FBPP, full 360° angular coverage is necessary. However, it has been shown that using some inherent redundancies in the projection data in a tomographic setup, accurate reconstruction is still possible with 270° coverage which is called the minimal-scan angle range. This can be done by applying weighing functions (or filters) on projection data of the object to eliminate the redundancies and accurately reconstruct the image from 270° coverage. This paper demonstrates procedures to generate many general classes of these weighing filters. These are all equivalent at 270° coverage but vary in performance at lower angular coverages and in presence of noise. This paper does a comparative analysis of different filters when angular coverage is lower than minimal-scan angle of 270°. Simulation studies have been done to find optimum weight filters for sub-minimal angular coverage (<270°)

  1. Subjective and objective image differences in pediatric computed tomography cardiac angiography using lower iodine concentration

    International Nuclear Information System (INIS)

    Hwang, Jae-Yeon; Choo, Ki Seok; Choi, Yoon Young; Kim, Jin Hyeok; Ryu, Hwaseong; Kim, Yong-Woo; Jeon, Ung Bae; Nam, Kyung Jin; Han, Junhee

    2017-01-01

    Several recent studies showed the optimal contrast enhancement with a low-concentration and iso-osmolar contrast media in both adult and pediatric patients. However, low contrast media concentrations are not routinely used due to concerns of suboptimal enhancement of cardiac structures and small vessels. To evaluate the feasibility of using iso-osmolar contrast media containing a low iodine dose for CT cardiac angiography at 80 kilovolts (kVp) in neonates and infants. The iodixanol 270 group consisted of 79 CT scans and the iopromide 370 group of 62 CT scans in patients ≤1 year old. Objective measurement of the contrast enhancement was analyzed and contrast-to-noise ratios of the ascending aorta and left ventricle were calculated. Regarding subjective measurement, a four-point scale system was devised to evaluate degrees of contrast enhancement, image noise, motion artifact and overall image quality of each image set. Reader performance for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment was evaluated. Group objective and subjective measurements were nonsignificantly different. Overall sensitivity, specificity and diagnostic accuracy for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment were 42.8%, 59%, and 50%, respectively. The application of iodixanol 270 achieved optimal enhancement for performing pediatric cardiac CT angiography at 80 kVp in neonates and infants. Objective measurements of contrast enhancement and subjective image quality assessments were not statistically different in the iodixanol 270 and iopromide 370 groups. (orig.)

  2. Subjective and objective image differences in pediatric computed tomography cardiac angiography using lower iodine concentration

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Jae-Yeon [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Pusan National University Yangsan Hospital, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Choo, Ki Seok; Choi, Yoon Young; Kim, Jin Hyeok; Ryu, Hwaseong; Kim, Yong-Woo; Jeon, Ung Bae; Nam, Kyung Jin [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Han, Junhee [Pusan National University Yangsan Hospital, Division of Biostatistics, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of)

    2017-05-15

    Several recent studies showed the optimal contrast enhancement with a low-concentration and iso-osmolar contrast media in both adult and pediatric patients. However, low contrast media concentrations are not routinely used due to concerns of suboptimal enhancement of cardiac structures and small vessels. To evaluate the feasibility of using iso-osmolar contrast media containing a low iodine dose for CT cardiac angiography at 80 kilovolts (kVp) in neonates and infants. The iodixanol 270 group consisted of 79 CT scans and the iopromide 370 group of 62 CT scans in patients ≤1 year old. Objective measurement of the contrast enhancement was analyzed and contrast-to-noise ratios of the ascending aorta and left ventricle were calculated. Regarding subjective measurement, a four-point scale system was devised to evaluate degrees of contrast enhancement, image noise, motion artifact and overall image quality of each image set. Reader performance for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment was evaluated. Group objective and subjective measurements were nonsignificantly different. Overall sensitivity, specificity and diagnostic accuracy for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment were 42.8%, 59%, and 50%, respectively. The application of iodixanol 270 achieved optimal enhancement for performing pediatric cardiac CT angiography at 80 kVp in neonates and infants. Objective measurements of contrast enhancement and subjective image quality assessments were not statistically different in the iodixanol 270 and iopromide 370 groups. (orig.)

  3. NMR studies of 55Mn in amorphous CexMn100-x alloys

    International Nuclear Information System (INIS)

    Niki, H.; Okamura, K.; Yogi, M.; Amakai, Y.; Takano, H.; Murayama, S.; Obi, Y.

    2008-01-01

    In order to investigate the heavy-fermion like behavior of amorphous alloy Ce x Mn 100-x , the NMR measurements of 55 Mn (I=5/2 ) in Ce 65 Mn 35 have been carried out from 4.2 to 270 K using powdered sample. A broadened NMR spectrum containing five NQR lines split due to NQR interaction is observed. Quadrupole coupling constant 3e 2 Qq/2I(2I-1)h is gradually changed from about 1.8 MHz at 4.2 K to about 1.6 MHz at 270 K. Temperature dependence of the line width is expressed in the Curie-Weiss law with θ p =-10.5K. The value of Knight shift would be almost constant from 4.2 to 270 K

  4. Fragmentation of dimethyl ether in femtosecond intense field

    Science.gov (United States)

    Zhu, Jingyi; Guo, Wei; Wang, Yanqiu; Wang, Li

    2006-08-01

    The fragmentation of dimethyl ether (DME) in intense femtosecond laser field has been studied at 810, 405 and 270 nm with intensities up to 2.48 × 10 15, 3.86 × 10 15 and 1.62 × 10 14 W/cm 2, respectively. At 405 nm, DME is possibly firstly ionized by multiphoton absorption, and then parent ion DME + dissociates into fragments via filed-induced dissociation. For 810 and 270 nm laser fields, DME firstly dissociates into CH 3O and CH 3 fragments and then these neutral fragments are ionized by field tunneling. Another possible way for DME to dissociate at 810 and 270 nm is that DME is ionized by intense field ejection of inner valance electron and then the excited DME + dissociates into fragment ions. Ultrafast rearrangement of DME or DME + in intense field may be responsible to the unpredictable fragment ions, CHO+/C2H5+andH2+.

  5. Radiation effects on the species-specific cell sorting-out of the cellular slime molds

    International Nuclear Information System (INIS)

    Satow, Takashi

    1976-01-01

    The effects of gamma-rays irradiation on the development and the species-specific cell sorting-out of the cellular slime mold, Dictyostelium discoideum, were investigated. The interphase amoebae of the organism showed extremely resistant to 60 Co gamma-rays. The percentage of non-stained cells estimated by dye staining method was more than 90% at the dose of 270 kR. The amoebae irradiated at 270 kR performed the development similar in the most respects to that of the un-irradiated amoebae except that a little portion of the fruiting bodies were abnormal and that the appearance of aggregates and slugs delayed 3 hrs. The ability of the species-specific cell sorting-out was not affected by gamma-rays irradiation at 270 kR. (auth.)

  6. Mud Pit Risk-Based Closure Strategy Report, Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Brain Hoenes

    2004-08-01

    This report presents the findings of the human and ecological risk assessment for the NTS mud pits. The risk assessment utilizes data from 52 of the 270 NTS mud pits in conjunction with corroborative data from 87 other DOE mud pits associated with nuclear testing (at locations on the NTS, in the western United States, and Alaska) as well as relevant process knowledge. Based on the risk assessment findings, the report provides a strategy for further evaluation, characterization, and closure of all 270 NTS mud pit CASs using the Streamlined Approach for Environmental Restoration (SAFER).

  7. Molecular Signatures of Chronic Pain Subtypes

    Science.gov (United States)

    2015-03-01

    inflammatory cytokines in human articular chondrocytes. Arthritis Rheum 2009;60(11):3303–13. 100 Su RC, Becker AB, Kozyrskyj AL, Hayglass KT. Epi...Korzets A. Reflex sympathetic dystrophy of the stump in below-knee amputees. Clin J Pain 1992;8(3):270–5. 31. Sherman RA, Sherman CJ, Parker L. Chronic...sympathetic dystrophy of the stump in below-knee amputees. The Clinical journal of pain. Sep 1992;8(3):270-275. 4. Lindsay DR, Pyati S, Buchheit TE

  8. Low-energy electron transmission through high aspect ratio Al O nanocapillaries

    DEFF Research Database (Denmark)

    Milosavljević, A.R.; Jureta, J.; Víkor, G.

    2009-01-01

    Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined with resp......Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined...

  9. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    1993-01-01

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  10. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  11. The two domain hypothesis of limb prepattern and its relevance to congenital limb anomalies.

    Science.gov (United States)

    Tao, Hirotaka; Kawakami, Yasuhiko; Hui, Chi-Chung; Hopyan, Sevan

    2017-07-01

    Functional annotation of mutations that cause human limb anomalies is enabled by basic developmental studies. In this study, we focus on the prepatterning stage of limb development and discuss a recent model that proposes anterior and posterior domains of the early limb bud generate two halves of the future skeleton. By comparing phenotypes in humans with those in model organisms, we evaluate whether this prepatterning concept helps to annotate human disease alleles. WIREs Dev Biol 2017, 6:e270. doi: 10.1002/wdev.270 For further resources related to this article, please visit the WIREs website. © 2017 Wiley Periodicals, Inc.

  12. 12 MW

    DEFF Research Database (Denmark)

    Hasager, Charlotte Bay; Pena Diaz, Alfredo; Mikkelsen, Torben

    '12MW: final report' is for the project with the full title ‘12 MW wind turbines: the scientific basis for their operation at 70 to 270 m height offshore’ that had the goal to experimentally investigate the wind and turbulence characteristics between 70 and 270 m above sea level and thereby...... establish the scientific basis relevant for the next generation of huge 12 MW wind turbines operating offshore. The project started 1st October 2005 and ended 31st March 2009. Firstly was conducted a 6-month experiment at the Horns Rev offshore wind farm deploying a lidar and a sodar on the transformer...

  13. The influence of strain on annealing behaviour of heavily rolled aluminium AA1050

    DEFF Research Database (Denmark)

    Mishin, Oleg; Juul Jensen, Dorte; Hansen, Niels

    2012-01-01

    Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened microstru......Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened...

  14. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  15. Workplace Incivility and Conflict Management Styles: Predicting Job Performance, Organizational Commitment and Turnover Intent

    Science.gov (United States)

    Reio, Thomas G., Jr.; Trudel, Jeannie

    2013-01-01

    The purpose of this study was to examine the relations among conflict management styles and target and instigator incivility and job performance, organizational commitment, and turnover intent. Data from 270 employees suggested that experiencing and instigating uncivil behavior occurred frequently. Using an integrative conflict management style…

  16. 17 CFR 230.482 - Advertising by an investment company as satisfying requirements of section 10.

    Science.gov (United States)

    2010-04-01

    ... about the investment company; identifies a source from which an investor may obtain a prospectus and, if... non-money market funds. In the case of an open-end management investment company or a trust account... advertisement for an open-end management investment company (other than a company that is permitted under § 270...

  17. Installation Restoration Program. Phase 1: Records Search, Pope Air Force Base, North Carolina

    Science.gov (United States)

    1985-05-01

    Diazinon Calcium Cyanide A-Dust Pramitol 25E Mayforce Rodeo PZ 270 Dursban Fungicides Prograss PZ 250 Baygon Weed Hoe 108 Unicorn Fogging Solution Benlate...head; the direction in which ground water flows. I DPDO: Defense Property Disposal Office, previously included Redistri- bution and Marketing (R&M

  18. Combining Advanced Turbulent Mixing and Combustion Models with Advanced Multi-Phase CFD Code to Simulate Detonation and Post-Detonation Bio-Agent Mixing and Destruction

    Science.gov (United States)

    2017-10-01

    Prepared by: School of Aerospace Engineering, Georgia Institute of Technology 270 Ferst Dr Atlanta, GA 30332...METHOD- OLOGY 7 4.1 Modeling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 4.1.1 Eulerian Gas Phase...from [3] and our simu- lation : our work is able to capture a non linear behaviour . . . . . . . . . . 59 5.44 Pressure profile from the blast wave

  19. 76 FR 4348 - Labor-Management Cooperation Grant Program Information Collection Request

    Science.gov (United States)

    2011-01-25

    ...: Application for Federal Assistance (SF-424), Accounting System and Financial Capability Questionnaire (LM-3), Request for Advance or Reimbursement SF-270 (LM- 6), Financial Status Report SF-269a (LM-7), Project... the estimated time per response is 60 minutes. The Accounting System and Financial Capability...

  20. Remarks on the species of Matuta Fabr. in the collection of the Leyden Museum

    NARCIS (Netherlands)

    Man, de J.G.

    1881-01-01

    The carcinological collection of our Museum contains no less than 270 specimens of the genus Matuta Fabr., preserved in spirits, collected in the seas of the Indo-Pacific Region, from the shores of the Red Sea to those of the eastern islands of the Malayan Archipelago. They belong to six different

  1. 26 CFR 1.925(b)-1T - Temporary regulations; marginal costing rules.

    Science.gov (United States)

    2010-04-01

    ... these no-loss rules and of the overall profit percentage limitation of paragraph (c)(2) of this section... 120.00 Total (220.00) Combined taxable income (loss) 80.00 F's profit under the full costing combined... 100.00 F's expenses 170.00 Total (270.00) Combined taxable income (loss) 30.00 F's profit under the...

  2. 77 FR 46415 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-08-03

    .... Government or contractor representatives to travel to Finland for up to one week for equipment de-processing... missile system with a unitary warhead. ATACMS are fired from the M270A1 Multiple Launch Rocket System and the High Mobility Artillery Rocket System launchers. The highest classification level for release of...

  3. H2O synthesis, crystal structure, experimental and theoretical stu

    Indian Academy of Sciences (India)

    2018-03-22

    Mar 22, 2018 ... and diphosphopentamolybdates (abbreviated as {P2Mo5}), included in this .... Each Mo atom is surrounded by six oxygen atoms. The. Mo–O .... limit value of absorption (270 nm) the optical energy gap (Eg) was calculated ...

  4. 77 FR 66744 - Temporary Rule to Increase the Commercial Annual Catch Limit for South Atlantic Yellowtail Snapper

    Science.gov (United States)

    2012-11-07

    ... South Atlantic Comprehensive ACL Amendment and the Generic ACL Amendment to the Red Drum, Reef Fish Resources, Shrimp, and Coral and Coral Reefs FMPs for the Gulf of Mexico (Generic ACL Amendment) (76 FR... (518,270 kg), round weight. The AM implemented through that rule states that the commercial sector will...

  5. Atomic-Scale View on the H2O Formation Reaction from H2 on O-Rich RuO2(110)

    DEFF Research Database (Denmark)

    Wei, Yinying; Martinez, Umberto; Lammich, Lutz

    2014-01-01

    The H2O formation reaction from H-2 on O-rich RuO2(110) was studied by temperature-programmed desorption and reaction (TPD/TPR) and scanning tunneling microscopy (STM) measurements and density functional theory (DFT) calculations. On the one hand, following H-2 adsorption at 270 K, our TPD/TPR me...

  6. 40 CFR 79.61 - Vehicle emissions inhalation exposure guideline.

    Science.gov (United States)

    2010-07-01

    ...-body-exposure systems, water only may be provided. When the exposure generation system is not operating... system or by exposure system operating personnel. (i) The flow-metering device used for the exposure... System for Animal Studies. Fundamental and Applied Toxicology 4: 270-277. (14) Moore, W.; et al. (1978...

  7. Mining the Twentieth Century's History from the Time Magazine Corpus

    NARCIS (Netherlands)

    Kestemont, Mike; Karsdorp, F.B.; Düring, Marten

    2014-01-01

    In this paper we report on an explorative study of the history of the twentieth cen- tury from a lexical point of view. As data, we use a diachronic collection of 270,000+ English-language articles har- vested from the electronic archive of the well-known Time Magazine (1923–2006). We attempt to

  8. 76 FR 28825 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-05-18

    ...) (15 U.S.C. 80a-17(d)) of the Investment Company Act of 1940 (``Act'') authorizes the Commission to... profit-sharing plan. Rule 17d-1 under the Act (17 CFR 270.17d-1) prohibits funds and their affiliated... investment company (``SBIC'') and an affiliated bank, provided that reports about the investments are made on...

  9. 12 CFR 225.111 - Limit on investment by bank holding company system in stock of small business investment companies.

    Science.gov (United States)

    2010-01-01

    .... L. 90-104, 81 Stat. 268, 270), a national bank may invest in stock of small business investment... system in stock of small business investment companies. 225.111 Section 225.111 Banks and Banking FEDERAL... Limit on investment by bank holding company system in stock of small business investment companies. (a...

  10. Stretching DNA in polymer nanochannels fabricated by thermal imprint in PMMA

    DEFF Research Database (Denmark)

    Thamdrup, Lasse Højlund; Klukowska, A.; Kristensen, Anders

    2008-01-01

    . The stamp is compatible with molecular vapor deposition ( MVD), used for applying a durable chlorosilane based antistiction coating, and allows for imprint up to a temperature of 270 degrees C. The extension of YOYO-1 stained T4 GT7 bacteriophage DNA inside the PMMA nanochannels has been experimentally...

  11. Case Report

    African Journals Online (AJOL)

    aphasia. Am J Emerg Med. 1998 May;16(3):270-1. 11. Wasserstein A, Hill G, Goldfarb S, Goldberg M. Recurrent thrombotic thrombocytopenic purpura after viral infection. Clinical and histologic simulation of chronic glomerulonephritis. Arch Intern Med. 1981. Apr;141(5):685-7. 12. Riggs SA, Wray NP, Waddell CC, Rossen ...

  12. : tous les projets | Page 606 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: NATURAL DISASTERS, EARLY WARNING SYSTEMS, ACCESS TO INFORMATION, COASTS, LITTORAL ZONES, MANGROVES, REFORESTATION, SHELTERBELTS. Région: India, Sri Lanka, Central Asia, Far East Asia, South Asia. Programme: Économies en réseaux. Financement total : CA$ 3,485,270.00.

  13. Taxonomic revision of the genus Asellia (Chiroptera: Hipposideridae) with description of a new species from southern Arabia

    Czech Academy of Sciences Publication Activity Database

    Benda, P.; Vallo, Peter; Reiter, A.

    2011-01-01

    Roč. 13, č. 2 (2011), s. 245-270 ISSN 1508-1109 Institutional research plan: CEZ:AV0Z60930519 Keywords : Asellia * morphology * morphometry * mtDNA * taxonomy * phylogeny Subject RIV: EG - Zoology Impact factor: 1.116, year: 2011

  14. Rainfall Characteristics at Makurdi, North–Central Nigeria II | Agada ...

    African Journals Online (AJOL)

    -1h-1, 0.7 to 9.0MJha-1 and 270 to 4280 mm2h-1 respectively. Following Obi and Salako (1995) additional indices, namely, E(A), EkI30, EkIm ,E(A)I30 and EkAIm were evaluated. Mean monthly erosivity values ranges based on these indices ...

  15. Võstavka sprovotsirovala skandal

    Index Scriptorium Estoniae

    2008-01-01

    Prantsuse fotograafi Andre Zucca (1897-1973) fotonäitus "Les Parisiens sous lѫOccupation" näitab natsiokupatsiooni aegset Pariisi elu. 270 värvifotot on eksponeeritud Pariisi raekojas (Bibliotheque Historique de la Ville of Paris)

  16. Mercury Removal from MSW Incineration Flue Gas by Mineral-based Sorbents.

    Czech Academy of Sciences Publication Activity Database

    Rumayor, Marta; Svoboda, Karel; Švehla, Jaroslav; Pohořelý, Michael; Šyc, Michal

    2018-01-01

    Roč. 73, DEC 13 (2018), s. 265-270 ISSN 0956-053X R&D Projects: GA TA ČR TE02000236 Institutional support: RVO:67985858 Keywords : mercury * removal * mineral sorbents Subject RIV: DI - Air Pollution ; Quality OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.030, year: 2016

  17. "Praemium Imperiale" laureaadid / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Jaapani printsi Hitachi ja Japan Arts Associationi ühiselt väljaantavad preemiad (ca 270 000 Saksa marka) said prantsuse arhitekt Jean Nouvel, korea maalikunstnik Lee Ufan, ungari skulptor Martan Pan, USA helilooja Ornette Colema ja dramaturg Arthur Miller.

  18. Fabrication, structural and optical characterizations of thermally ...

    African Journals Online (AJOL)

    The bi-layer of metallic Cu-Sn precursors was thermally evaporated sequentially on microscopic glass substrates at the controlled thickness of 100nm, 500nm and 1000nm and at different substrate temperatures of 270C, 1000C and 2000C. The bi-layer was subsequently sulphurized in a custom-built reactor for 1hour at ...

  19. External Insect Morphology: A Negative Factor in Attitudes toward Insects and Likelihood of Incorporation in Future Science Education Settings

    Science.gov (United States)

    Wagler, Ron; Wagler, Amy

    2012-01-01

    This study investigated if the external morphology of an insect had a negative effect on United States (US) preservice elementary teacher's attitudes toward insects and beliefs concerning the likelihood of incorporating insects into future science education settings. 270 US kindergarten through sixth grade preservice elementary teachers…

  20. An Assessment of Hydrogen as a Means to Implement the United States Navy’s Renewable Energy Initiative

    Science.gov (United States)

    2014-09-01

    China Lake. The 270 megawatt geothermal power plant “provides on average 1.4 million megawatt-hours of electricity to the California power grid...22  3.  GEOTHERMAL POWER ......................................................... 23  4.  BIOMASS...4 Wind Power 5 - 22 Ocean Power (Tidal) 14 Solar (PV) 30 Geothermal 20 -50 Fossil-Based 150 Nuclear 4000 Table 1. Alternative Energy Sources

  1. The Survey of College Marketing Programs. Volume 2: Print Advertising and Marketing.

    Science.gov (United States)

    Primary Research Group, Inc., New York, NY.

    This report presents 213 tables detailing findings regarding types and costs of advertising within marketing programs at 68 colleges and universities. Highlights of this report include the following: these colleges print a mean number of 19,270 viewbooks and 16,380 catalogs; and advertise in newspapers (86.6 percent), in magazines (45.4 percent),…

  2. GENSIS: Generalized Model for Simulating Shoreline Change. Report 2. Workbook and System User’s Manual

    Science.gov (United States)

    1991-09-01

    if the user wishes to save this information, the file must be 0O 315 -- ’ 4 * 270*LN L:LN 1=.I ISO , Figure 13. Schematic representation of the...2146 11186 11191 11194 11189 11199 11207 11191 11195 11199 12207 12197 11206 11214 11204 10208 11205 11208 11222 12216 11204 2144 10279 10284 10291

  3. A new Friction and Lubrication Test for Cold Forging

    DEFF Research Database (Denmark)

    Bay, Niels; Wibom, Ole; Aalborg Nielsen, J

    1995-01-01

    This paper presents a new friction and lubrication test for cold forging. The test allows controlled variation of the surface expansion in the range 0-2000%, the tool temperature in the range 20-270°C and the sliding length between 0 and infinite. Friction is decreasing with increasing temperature...

  4. The late Aeronian graptolite sedgwickii Event. Associated positive carbon isotope excursion and facies changes in the Prague Synform (Barrandian area, Bohemia)

    Czech Academy of Sciences Publication Activity Database

    Štorch, Petr; Frýda, J.

    2012-01-01

    Roč. 149, č. 6 (2012), s. 1089-1106 ISSN 0016-7568 R&D Projects: GA ČR GA205/09/0619 Institutional research plan: CEZ:AV0Z30130516 Keywords : carbon isotope record * community evenness * extinction * graptolites * Silurian * species richness Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.270, year: 2012

  5. Young Persons' Education, Training and Employment Outcomes with Special Reference to Early School Leavers. A Report Prepared for the Business Council of Australia and Dusseldorp Skills Forum by Applied Economics.

    Science.gov (United States)

    2002

    Australian researchers investigated the education training outcomes of young people (age 15-19 years), focusing on early school leavers. Data came from the Australian Bureau of Statistics and the National Center for Vocational and Educational Research. About one-third of the 270,000 students who leave school each year leave before 12th grade. The…

  6. Ameliorative effects of ascorbic acid on rectal temperature ...

    African Journals Online (AJOL)

    Jane

    2011-08-29

    Aug 29, 2011 ... On day 1 post-transportation, the control rabbits lost 2.70% of the pre- transportation ... the adverse effects of stress due to road transportation. Key words: ... Besides, management strate-gies aimed at alleviating stress due to ...

  7. Effect of Herbal Immunodulator on Body weight gain in immunosuppressed broiler birds

    Directory of Open Access Journals (Sweden)

    S.G. Mode

    Full Text Available The herbal immunomodulator was evaluated in immunosupressed broiler birds in terms of body weight gain. The treatment with Ocimum sanctum and Emblica officinalis @ 3 gm /kg feed for 2 weeks were found to be effective immunomodulator in increasing body weight gain in broiler birds. [Vet World 2009; 2(7.000: 269-270

  8. determination of volume and direction of flow of kainji reservoir ...

    African Journals Online (AJOL)

    HOD

    by equations 1 and 2 as follows [2]. ⁄. In (1), D is the depth, V is the average velocity of sound ... Niger state on the 27th of August 1991, thereafter became the headquarter of Borgu Local Government. Area of ... cubic meters covering an area of 1,270 sq. kilometres. It has a power plant with initial six generating units and.

  9. Intramuscular adrenaline does not reduce the incidence of respiratory distress and hypoglycaemia in neonates delivered by elective caesarean section at term

    DEFF Research Database (Denmark)

    Pedersen, Pernille; Avlund, O L; Pedersen, B L

    2008-01-01

    AIM: To test whether intramuscular injection of 30 microg adrenaline decreased the incidence of respiratory distress and hypoglycaemia in term infants delivered by elective caesarean section before active labour. METHOD: The study was randomised and double-blinded. A total of 270 neonates were...

  10. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8491 ... What does it take to ensure agriculture is driving sustainable and inclusive rural economic growth ... Una Hakika: Scaling Digital Solutions for Conflict Management in ... Adaptation Finance: Linking Research, Policy, and Business. This project will train up to 36 emerging climate change leaders in ...

  11. ZnO/Bi2O3 nanowire composites as a new family of photocatalysts

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Slušná, Michaela; Tolasz, Jakub; Zetková, K.

    2015-01-01

    Roč. 270, Part A (2015), s. 83-91 ISSN 0032-5910 R&D Projects: GA TA ČR TA02010541 Institutional support: RVO:61388980 Keywords : Zinc oxide * Photocatalysis * Bi3+ doping Subject RIV: CA - Inorganic Chemistry Impact factor: 2.759, year: 2015

  12. In Vivo distribution of hydrocortisone over whole blood : A novel method for the extraction of erythrocytes

    NARCIS (Netherlands)

    Driessen, O.; Treuren, L.; Moolenaar, A.; Meijer, J.W.A.; Verheijen, P.

    1990-01-01

    Ten mg hydrocortisone (HC) was administered intravenously to a healthy volunteer after a dexamethasone suppresion test and HC concentrations were determined from 1-270 min in plasma, plasma water and on erythrocytes. HC was extracted front erythrocyte concentrates with high efficiency by HC-poor

  13. Investigations of the 1 KHZ Sound Absorption in Sea Water.

    Science.gov (United States)

    1983-01-15

    York, 465 pages. Seward, T. M. (1974) Determination of the first ionization constant of silicic acid from quartz solubility in borate buffer...attenuation coefficient. J. Acoust. Soc. Am. 42, 270-271. Uppstrom, L (1968) A modified method for the determination of boron with curcumin and a simplified

  14. 40 CFR 264.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 264.341 Section 264... Incinerators § 264.341 Waste analysis. (a) As a portion of the trial burn plan required by § 270.62 of this chapter, or with part B of the permit application, the owner or operator must have included an analysis of...

  15. Diastereoselective reduction of 1-(4-fluorophenyl)-3(R)-[3-oxo-3-(4-fluorophenyl) -propyl]-4 (S)-(4-hydroxyphenyl)azetidin-2-one to Ezetimibe by the whole cell catalyst Rhodococcus fascians MO22

    Czech Academy of Sciences Publication Activity Database

    Kyslíková, Eva; Babiak, P.; Marešová, Helena; Palyzová, Andrea; Hajíček, J.; Kyslík, Pavel

    2010-01-01

    Roč. 67, 3-4 (2010), s. 266-270 ISSN 1381-1177 R&D Projects: GA MŠk 2B08064 Institutional research plan: CEZ:AV0Z50200510 Keywords : Biotransformation * Rhodococcus fascians MO22 * Ezetimibe Subject RIV: CE - Biochemistry Impact factor: 2.330, year: 2010

  16. Description of .i.Paratylenchus (Gracilacus) straeleni./i. (De Coninck, 1931) Oostenbrink, 1960 (Nematoda: Criconematoidea, Tylenchulidae) from hazelnut in Turkey and its comparison with other world populations

    Czech Academy of Sciences Publication Activity Database

    Akyazi, F.; Felek, A.F.; Čermák, V.; Čudejková, M.; Foit, J.; Yildiz, S.; Háněl, Ladislav

    2015-01-01

    Roč. 52, č. 3 (2015), s. 270-279 ISSN 0440-6605 Grant - others:GA MŠk(CZ) EE2.3.20.0265 Program:EE Institutional support: RVO:60077344 Keywords : Corylus avellana * multivariate analyses * phylogeny * sequencing * species complex Subject RIV: EG - Zoology Impact factor: 0.602, year: 2015

  17. Nitrous oxide production and evasion from the Markland Pool of theOhio River

    Science.gov (United States)

    This figure shows how atmospheric N2O concentrations have increased from a background of about 270ppb up to 315 by the year 2000. This trend has continued and todays levels are at about 321 and are continuing to increase. This is a problem because N2O is a potent greenhouse gas...

  18. Some Empirical Dimensions of Countertrade

    OpenAIRE

    Jean-Francois Hennart

    1990-01-01

    This paper discusses some of the recent theories of why countries impose countertrade obligations and compares some of the implications of these theories with data obtained from a comprehensive database of countertrade transactions.© 1990 JIBS. Journal of International Business Studies (1990) 21, 243–270

  19. 17 CFR 274.303 - Form N-27I-2, notice of withdrawal right and statement of charges for variable life insurance...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-27I-2, notice of withdrawal right and statement of charges for variable life insurance contractholders required pursuant to... variable life insurance contractholders required pursuant to Rule 6e-2 (§ 270.6e-2 of this chapter). [41 FR...

  20. Effect of olive storage period at two different temperatures on oil ...

    African Journals Online (AJOL)

    ambient and 5°C) for different periods before oil extraction at 0, 7, 14, 21 and 28 days to investigate the effect of postharvest fruit storage on olive oil quality. Conventional analyses (acidity, peroxide value, specific extinction coefficient at 232 and 270 ...

  1. Literacy Coaches' Perspectives of Themselves as Literacy Leaders: Results from a National Study of K-12 Literacy Coaching and Leadership

    Science.gov (United States)

    Calo, Kristine M.; Sturtevant, Elizabeth G.; Kopfman, Kimberly M.

    2015-01-01

    As the face of education and the demands on teachers continues to change in the 21st century, so does the role of the literacy coach in schools across the country. This article explores the changing roles and responsibilities of literacy coaches by sharing the results of a study of 270 literacy coaches around the country. In this article, we share…

  2. Negative affect as a mediator of the relationship between vigorous-intensity exercise and smoking

    NARCIS (Netherlands)

    Tart, C.D.; Leyro, T.M.; Richter, A.; Zvolensky, M.J.; Smits, J.A.J.

    2010-01-01

    The present cross-sectional study evaluated whether people who engage in vigorous-intensity exercise are better able to regulate negative affective states, thereby changing core maintenance factors of smoking. Participants were a community sample of adults (n = 270) who completed self-report

  3. Post Waterflood CO2 Miscible Flood in Light Oil, Fluvial-Dominated Deltaic Reservoir (Pre-Work and Project Proposal), Class I

    Energy Technology Data Exchange (ETDEWEB)

    Bou-Mikael, Sami

    2002-02-05

    This project outlines a proposal to improve the recovery of light oil from waterflooded fluvial dominated deltaic (FDD) reservoir through a miscible carbon dioxide (CO2) flood. The site is the Port Neches Field in Orange County, Texas. The field is well explored and well exploited. The project area is 270 acres within the Port Neches Field.

  4. Babánekite, Cu.sub.3./sub.(AsO.sub.4./sub.).sub.2./sub.•8H.sub.2./sub.O, from Jáchymov, Czech Republic – a new member of the vivianite group

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Škácha, P.; Sejkora, J.; Škoda, R.; Novák, M.; Veselovský, F.; Hloušek, J.

    2017-01-01

    Roč. 62, č. 4 (2017), s. 261-270 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : Babánekite * new mineral * Vivianite group * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016

  5. Chemsearch Journal Volume 4 Number 1, June, 2013

    African Journals Online (AJOL)

    Magashi

    2013-06-01

    Jun 1, 2013 ... 0.188), TiO2 (0.00– 0.12), K2O (0.049 – 0.270), Li2O (0.047 ... and fish ponds), ceramics, glass, silica bricks, pharmaceutical, coal dust fire dampener, paint, poultry and ... attractive flow bandings and the colours found in.

  6. Start of Final Assembly of the CMS Barrel Yoke on schedule at P5 the 1st august, 2000. I

    CERN Multimedia

    Hubert Gerwig, CERN/ EP-CMI

    2000-01-01

    The Barrel Yoke and the vacuumtank weigh 6500 tonnes. The barrel Yoke consists of 5 rings eacu one weighing 1200 tonnes. The vacuum tank is a stainless steel structure weighing 270 tonnes (length = 13 m , outer diamter 7.6 m) The final assembly of these items will take approximately 1 year from now on.

  7. Effect of the relative time of emergence on the growth allometry of Galium aparine in competition with Triticum aestivum

    Czech Academy of Sciences Publication Activity Database

    Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Urban, Otmar; Marek, Michal V.

    2014-01-01

    Roč. 14, č. 4 (2014), s. 262-270 ISSN 1444-6162 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : cleaver * competition * growth allometry * relative time of emergence * wheat Subject RIV: GC - Agronomy Impact factor: 0.537, year: 2014

  8. Experiment list: SRX1090865 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available amming || cell type=intermediate stage of somatic cell reprogramming || chip antibo...,95.9,8.5,270 GSM1816302: pre-iPS rep.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogr

  9. 17 CFR 230.489 - Filing of form by foreign banks and insurance companies and certain of their holding companies...

    Science.gov (United States)

    2010-04-01

    ... that is a foreign bank or foreign insurance company excepted from the definition of investment company... is excepted from the definition of investment company by rule 3a-1 (17 CFR 270.3a-1) under the 1940... excepted from the definition of investment company by rule 3a-6 under the 1940 Act. (b) The requirements of...

  10. 78 FR 70973 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-11-27

    ... information to the Office of Management and Budget for extension and approval. Rule 18f-1 (17 CFR 270.18f-1) enables a registered open-end management investment company (``fund'') that may redeem its securities in-kind, by making a one-time election, to commit to make cash redemptions pursuant to certain...

  11. 17 CFR 240.15d-10 - Transition reports.

    Science.gov (United States)

    2010-04-01

    ... information or trends reflected, an assessment of the comparability of the data, and a representation as to... the fiscal year. (h) The provisions of this rule shall not apply to investment companies required to file reports pursuant to Rule 30b1-1 (§ 270.30b1-1 of this chapter) under the Investment Company Act of...

  12. Sequelae of Aggression in Acutely Suicidal Adolescents

    Science.gov (United States)

    Kerr, David C. R.; Washburn, Jason J.; Feingold, Alan; Kramer, Anne C.; Ivey, Asha Z.; King, Cheryl A.

    2007-01-01

    The consequences of aggression on problem course and suicide risk were examined in 270 acutely suicidal adolescents (ages 12-17 years; 184 girls). Participants were assessed during psychiatric hospitalization (T1), 6-months post-hospitalization (T2), and 15 or more months post-hospitalization (T3). Study variables included self- and…

  13. Warburg effect—damping of electromagnetic oscillations

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Jiří; Pokorný, Jan; Borodavka, Fedir

    2017-01-01

    Roč. 36, č. 3 (2017), s. 270-278 ISSN 1536-8378 R&D Projects: GA ČR GA16-12757S Institutional support: RVO:68378271 Keywords : Warburg effect * mitochondrial dysfunction * water ordering * mitochondrial membrane potential * biological electromagnetic activity * cancer Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 1.272, year: 2016

  14. Meče 11.-13. století z území Moravy

    Czech Academy of Sciences Publication Activity Database

    Žákovský, P.; Hošek, Jiří; Sedláčková, L.

    2013-01-01

    Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Reviews | Murugan | Lexikos

    African Journals Online (AJOL)

    P.R. Subramanian (Chief Editor). Kriyavill Tarkalat Tamil Akarati (TamilTamil- ArJkilam) (Dictionary of Contemporary Tamil (Tamil-Tamil-English)), 1992, reprint 1997, xxxvi + 980 pp. ISBN 81-85602-57-3. Chennai: Cre-A Publishers. E-mail: crea@vsnl.com.Price Rs. 270,00.

  16. Effects of microelements on soil nematode assemblages seven years after contaminating an agricultural field

    NARCIS (Netherlands)

    Nagy, P.; Bakonyi, G.; Bongers, A.M.T.; Kádár, I.; Fábián, M.; Kiss, I.

    2004-01-01

    Long-term effects of Cd, Cr, Cu, Se and Zn were studied 7 years after artificially contaminating plots of an agricultural field on a calcareous chernozem soil. Effects of three to four different contamination levels (originally 10, 30, 90 and 270 mg kg(-1)) were studied. Nematode density was

  17. Habitat requirements of the long-tailed ground squirrel (Spermophilus undulatus) in the southern Altai

    Czech Academy of Sciences Publication Activity Database

    Řičánková, V.; Fric, Zdeněk; Chlachula, J.; Šťastná, P.; Faltýnková, A.; Zemek, František

    2006-01-01

    Roč. 270, - (2006), s. 1-8 ISSN 0952-8369 Institutional research plan: CEZ:AV0Z60870520 Keywords : Spermophilus undulatus * Altai mountains * habitat selection * predation risk * grazing Subject RIV: EH - Ecology, Behaviour Impact factor: 1.413, year: 2006

  18. Bulletin of Animal Health and Production in Africa - Vol 54, No 4 (2006)

    African Journals Online (AJOL)

    Post-brooding management of local guinea fowls (Numida meleagris) · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Dei, P Dari, EO Otchere, KT Djang-Fordjour, A Donkoh, F Nelson, K Boa-Amposem, I Adam, 270-276. http://dx.doi.org/10.4314/bahpa.v54i4.32777 ...

  19. Solubilities of hydrogen and methane in coal liquids

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Ho-mu; Sebastian, H M; Simnick, J J; Chao, Kwang Chu

    1981-04-01

    The solubilities of hydrogen and methane in Exxon Donor Solvent (EDS) and Solvent Refined Coal II (SRC-II) coal liquids are determined at 190 and 270 C and pressures to 250 atm. Two narrow boiling distillate cuts from EDS and three from SRC-II are studied.

  20. Review of Physical and Chemical Methods for Characterization of Fuels

    Science.gov (United States)

    1981-12-01

    Reversed-phase chromatography REF Refractometry CAL Calorimetry POT Potentiometry CC Coordination chromatography MSB Mossbauer spectroscopy FS Flame...petroleum distillates ......... .... ........................ . .... A-2-63 Determination of the nitrogen content of shale oil furnace oil by refractometry ... refractometry ............................................ A-2-70 SAPONIFICATION NUMBER Saponification number of petroleum products.......................A-2

  1. Drag reduction of dense fine-grained slurries

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Pavel; Chára, Zdeněk; Štern, Petr

    2010-01-01

    Roč. 58, č. 4 (2010), s. 261-270 ISSN 0042-790X R&D Projects: GA ČR(CZ) GAP105/10/1574 Institutional research plan: CEZ:AV0Z20600510 Keywords : kaolin slurry * drag reduction * experimental investigation * peptization * slurry rheology Subject RIV: BK - Fluid Dynamics Impact factor: 0.553, year: 2010

  2. Some chemical components of garden egg as affected by stage of ...

    African Journals Online (AJOL)

    Fresh fruits of garden egg were sorted into green, yellow bottom and yellow all over stages of fruit ripeness. Each set of fruits was stored at 40Cand 270C for up to 16 days, respectively. The effects of stage of fruit ripeness, storage temperature and duration of storage on some chemical components of garden egg were ...

  3. File list: NoD.Neu.10.AllAg.Brain [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.Neu.10.AllAg.Brain mm9 No description Neural Brain ERX161927,ERX161921,SRX29803...270,ERX402277,ERX402286,ERX402292,ERX402281 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Neu.10.AllAg.Brain.bed ...

  4. 40 CFR 761.125 - Requirements for PCB spill cleanup.

    Science.gov (United States)

    2010-07-01

    ... greater which are subject to decontamination requirements under TSCA, including those spills listed under... required. (2) Disposal of cleanup debris and materials. All concentrated soils, solvents, rags, and other... than 1 pound of PCBs by weight (less than 270 gallons of untested mineral oil)—(1) Decontamination...

  5. Protecting Colleges and Students: Community College Strategies to Prevent Default

    Science.gov (United States)

    McKibben, Bryce; La Rocque, Matthew; Cochrane, Debbie

    2014-01-01

    Student loan default, defined as federal loan borrowers' failure to make any payments for at least 270 days, is an issue of increasing importance to community colleges and their students. This report takes a unique look at student loan default at nine community colleges across the nation, and how those colleges are working to help students avoid…

  6. New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.

    2013-01-01

    Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  7. Tertiary Student Attitudes to Bicycle Commuting in a Regional Australian University

    Science.gov (United States)

    Whannell, Patricia; Whannell, Robert; White, Richard

    2012-01-01

    Purpose: The purpose of this paper is to provide executive management at a regional university with empirical data to justify, or otherwise, a substantial outlay of funds to support bicycle commuting as a viable strategy for the reduction of traffic congestion. Design/methodology/approach: A custom designed questionnaire was completed by 270

  8. Evolutionary algorithm-based multi-criteria optimization of triboelectrostatic separator

    Czech Academy of Sciences Publication Activity Database

    Mach, F.; Adam, L.; Kacerovský, J.; Karban, P.; Doležel, Ivo

    2014-01-01

    Roč. 270, November (2014), s. 134-142 ISSN 0377-0427 R&D Projects: GA ČR(CZ) GAP102/11/0498 Institutional support: RVO:61388998 Keywords : separation processes * triboelectricity * particle separators Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.266, year: 2014

  9. Designing a Master's Program in Corporate Communication at an Urban University: A Case Study.

    Science.gov (United States)

    Patterson, Margaret Jones

    To assess how an urban university can take advantage of its setting to design a master's program in corporate communication, a 1987 study of the master's program in corporate communication at Duquesne University of Pittsburgh was conducted. Data were obtained through a survey of 590 local communication professionals, of whom 270 responded (a…

  10. China’s Gender Imbalance and Its Implications on China-Japan and China-Taiwan Security Relations

    Science.gov (United States)

    2011-12-01

    ties. Both sides agreed to allow 270 direct flights per week across the strait to enhance tourism and commerce by eliminating intermediate points...inaction against Japan or Taiwan would doom China to widespread social unrest and possible regime collapse. On the other hand, choosing military

  11. Relantionship between vestibular lamina, dental lamina, and the developing oral vestibule in the upper jaw of the field vole (Microtus agrestis, Rodentia)

    Czech Academy of Sciences Publication Activity Database

    Witter, K.; Pavlíková, H.; Matulová, Petra; Míšek, Ivan

    2005-01-01

    Roč. 265, - (2005), s. 264-270 ISSN 0362-2525 R&D Projects: GA ČR GA304/02/0448; GA MŠk OC B23.001 Institutional research plan: CEZ:AV0Z50450515 Keywords : mouth * dentition * tooth Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.421, year: 2005

  12. Determination of mercury and selenium in consumed food items in Libya using instrumental and radiochemikal NAA

    Czech Academy of Sciences Publication Activity Database

    Alamin, M. B.; Bejey, A.M.; Kučera, Jan; Mizera, Jiří

    2006-01-01

    Roč. 270, č. 1 (2006), s. 143-146 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : mercury * selenium * food items Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  13. Tvarohomakový koláč

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Ivana

    2006-01-01

    Roč. 89, č. 5 (2006), s. 270-272 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610518 Keywords : adjectives * word formation * orthography Subject RIV: AI - Linguistics

  14. 77 FR 31408 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-05-25

    ..., Washington, DC 20549-0213. Extension: Rules 17h-1T and 17h-2T, SEC File No. 270-359, OMB Control No. 3235... are approximately twenty-five new respondents per year that must draft an organizational chart... estimates that drafting the required organizational chart requires one hour and establishing a system for...

  15. 77 FR 44699 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-07-30

    ..., Washington, DC 20549-0213. Extension: Rules 17h-1T and 17h-2T, SEC File No. 270-359, OMB Control No. 3235... that must draft an organizational chart required under Rule 17h-1T and establish a system for complying with the risk assessment rules. The staff estimates that drafting the required organizational chart...

  16. Velocity structure and the role of fluids in the West Bohemia Seismic Zone

    Czech Academy of Sciences Publication Activity Database

    Alexandrakis, C.; Calò, M.; Bouchaala, F.; Vavryčuk, Václav

    2014-01-01

    Roč. 5, č. 2 (2014), s. 863-872 ISSN 1869-9510 R&D Projects: GA ČR(CZ) GAP210/12/1491 EU Projects: European Commission(XE) 230669 - AIM Institutional support: RVO:67985530 Keywords : seismic tomography * Bohemia/Vogtland seismoactive region * WEBNET Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.270, year: 2014

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 270 ... Vol 2, No 2 (2004), Chemistry and bacteriostatic activity of the essential oil and major isolates from the fruit rind of Citrus paradisi Macfad, Abstract .... Vol 9, No 3 (2012), Development and Optimization of controlled drug release formulation of Diclofenac Sodium based on Osmotic Technology, Abstract.

  18. 48 CFR 1352.239-71 - Electronic and information technology.

    Science.gov (United States)

    2010-10-01

    ... Electronic and information technology. As prescribed in 48 CFR 1339.270(a), insert the following provision: Electronic and Information Technology (APR 2010) (a) To be considered eligible for award, offerors must propose electronic and information technology (EIT) that meet the applicable Access Board accessibility...

  19. Computational issues in a stochastic finite horizon one product recovery inventory model

    NARCIS (Netherlands)

    Kiesmüller, G.P.; Scherer, C.W.

    2003-01-01

    Inderfurth [OR Spektrum 19 (1997) 111] and Simpson [Operations Research 26 (1978) 270] have shown how the optimal decision rules in a stochastic one product recovery system with equal leadtimes can be characterized. Using these results we provide in this paper a method for the exact computation of

  20. Has the ultimate state of turbulent thermal convection been observed?

    Czech Academy of Sciences Publication Activity Database

    Skrbek, L.; Urban, Pavel

    2015-01-01

    Roč. 785, DEC (2015), s. 270-282 ISSN 0022-1120 R&D Projects: GA ČR GA14-02005S Institutional support: RVO:68081731 Keywords : turbulent convection * turbulent flows Subject RIV: BK - Fluid Dynamics Impact factor: 2.514, year: 2015