WorldWideScience

Sample records for meitnerium 270

  1. A270 Demo Schokgolfdemping

    NARCIS (Netherlands)

    Netten, B.D.; Broek, T.H.A. van den; Blom, G.

    2010-01-01

    In februari 2010 zijn een aantal grootschalige experimenten uitgevoerd op de A270 tussen Helmond en Eindhoven. Het doel van deze experimenten is om de potentie van coöperatieve systemen te demonstreren voor het dempen van schokgolven en daarmee de mobiliteit op de Nederlandse snelwegen te kunnen

  2. 40 CFR 270.6 - References.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false References. 270.6 Section 270.6... ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM General Information § 270.6 References. (a) When used in part 270 of this chapter, the following publications are incorporated by reference. These...

  3. 30 CFR 270.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Discrimination prohibited. 270.4 Section 270.4 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.4 Discrimination prohibited. No contract or subcontract to which...

  4. 30 CFR 270.6 - Process.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Process. 270.6 Section 270.6 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.6 Process. Whenever a Regional Director determines on the basis of any information...

  5. 48 CFR 2115.270 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Applicability. 2115.270 Section 2115.270 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT, FEDERAL EMPLOYEES... BY NEGOTIATION Solicitation and Receipt of Proposals and Quotations 2115.270 Applicability. (a) FAR...

  6. 48 CFR 3002.270 - Abbreviations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Abbreviations. 3002.270 Section 3002.270 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) GENERAL DEFINITIONS OF WORDS AND TERMS Abbreviations 3002.270 Abbreviations...

  7. 12 CFR 270.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 270.1 Section 270.1 Banks and... RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.1 Authority. This part is issued by the Federal Open Market Committee (the “Committee”) pursuant to authority...

  8. 12 CFR 270.3 - Governing principles.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Governing principles. 270.3 Section 270.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF... Governing principles. As required by section 12A of the Federal Reserve Act, the time, character, and volume...

  9. 24 CFR 990.270 - Asset management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Asset management. 990.270 Section... THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.270 Asset management. As owners, PHAs have asset management responsibilities that are above and beyond property management activities. These...

  10. 48 CFR 1615.270 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Applicability. 1615.270 Section 1615.270 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION...

  11. 8 CFR 270.2 - Enforcement procedures.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Enforcement procedures. 270.2 Section 270.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT... charges for document fraud committed by refugees at the time of entry. The Service shall not issue a...

  12. 21 CFR 173.270 - Hexane.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Hexane. 173.270 Section 173.270 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) SECONDARY DIRECT FOOD ADDITIVES PERMITTED IN FOOD FOR HUMAN CONSUMPTION Solvents, Lubricants, Release Agents and Related Substances ...

  13. 32 CFR 270.5 - Staff.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Staff. 270.5 Section 270.5 National Defense... Staff. (a) The Commission will have a support staff, which will include staff members sufficient to expeditiously and efficiently process the applications for payments under this part. All members of the staff...

  14. 15 CFR 270.301 - Policy.

    Science.gov (United States)

    2010-01-01

    ... SAFETY TEAMS Collection and Preservation of Evidence; Information Created Pursuant to an Investigation; and Protection of Information § 270.301 Policy. Evidence collected and information created by Team...

  15. 15 CFR 270.300 - Scope.

    Science.gov (United States)

    2010-01-01

    ... SAFETY TEAMS Collection and Preservation of Evidence; Information Created Pursuant to an Investigation; and Protection of Information § 270.300 Scope. During the course of an investigation conducted..., preservation, and protection of evidence obtained and information created pursuant to an investigation. ...

  16. 50 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.2... products in preparation for sale. Marketing and promotion means any activity aimed at encouraging the... Seafood Promotion Act of 1986: Act means the Fish and Seafood Promotion Act of 1986 (Public Law 99-659...

  17. 15 CFR 270.205 - Reports.

    Science.gov (United States)

    2010-01-01

    ... SAFETY TEAMS Investigations § 270.205 Reports. (a) Not later than 90 days after completing an investigation, a Team shall issue a public report which includes: (1) An analysis of the likely technical cause... its public report immediately after conducting a preliminary reconnaissance will issue a public report...

  18. 50 CFR 270.22 - Refunds.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.22... the Council during the remainder of the assessment rate period. Future assessments will only be sent... a future assessment rate period and no refund is requested, that sector participant may again...

  19. 40 CFR 270.40 - Transfer of permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Transfer of permits. 270.40 Section 270.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM Changes to Permit § 270.40...

  20. 15 CFR 270.351 - Protection of voluntarily submitted information.

    Science.gov (United States)

    2010-01-01

    ... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Collection and Preservation of Evidence; Information Created Pursuant to an Investigation; and Protection of Information Protection of Information § 270.351... information. 270.351 Section 270.351 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign...

  1. 15 CFR 270.105 - Duties of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Duties of a Team. 270.105 Section 270... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.105 Duties of a Team. (a) A Team's Lead...

  2. 48 CFR 942.270-2 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 942.270-2 Section 942.270-2 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract Administration Services 942.270-2 Contract clause. The clause at 952...

  3. 50 CFR 270.5 - Conduct of referendum.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Conduct of referendum. 270.5 Section 270.5..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.5 Conduct... the date of the last affirmative determination, will conduct a referendum on the adoption of the...

  4. 40 CFR 52.270 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.270 Section 52.270 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) With the exception of the areas listed in paragraph (b) of this section: (1... plan does not include approvable procedures for preventing the significant deterioration of air quality...

  5. 17 CFR 270.35d-1 - Investment company names.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment company names. 270... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.35d-1 Investment company names. (a... adopted a policy to invest, under normal circumstances, at least 80% of the value of its Assets in the...

  6. 18 CFR 270.306 - Devonian shale wells in Michigan.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Devonian shale wells in Michigan. 270.306 Section 270.306 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY...) Attesting the applicant has no knowledge of any information not described in the application which is...

  7. 18 CFR 270.304 - Tight formation gas.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Tight formation gas. 270.304 Section 270.304 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... before January 1, 1980; and (2) The applicant has no knowledge of any information not described in the...

  8. 48 CFR 204.270 - Electronic Document Access.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Electronic Document Access..., DEPARTMENT OF DEFENSE GENERAL ADMINISTRATIVE MATTERS Contract Distribution 204.270 Electronic Document Access. Follow the procedures at PGI 204.270 relating to obtaining an account in the Electronic Document Access...

  9. 15 CFR 270.352 - Public safety information.

    Science.gov (United States)

    2010-01-01

    ... CONSTRUCTION SAFETY TEAMS Collection and Preservation of Evidence; Information Created Pursuant to an Investigation; and Protection of Information Protection of Information § 270.352 Public safety information. A... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Public safety information. 270.352...

  10. 15 CFR 270.350 - Freedom of Information Act.

    Science.gov (United States)

    2010-01-01

    ... CONSTRUCTION SAFETY TEAMS Collection and Preservation of Evidence; Information Created Pursuant to an Investigation; and Protection of Information Protection of Information § 270.350 Freedom of Information Act. As... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Freedom of Information Act. 270.350...

  11. 48 CFR 642.270 - Contracting Officer's Representative (COR).

    Science.gov (United States)

    2010-10-01

    ... Representative (COR). 642.270 Section 642.270 Federal Acquisition Regulations System DEPARTMENT OF STATE CONTRACT... Officer's Representative (COR). (a) Scope. Contracting officers may designate technically qualified... training and have the necessary experience and judgment shall be appointed as CORs. This policy shall be...

  12. 48 CFR 552.270-27 - Integrated Agreement.

    Science.gov (United States)

    2010-10-01

    ... agreement, express or implied, shall be admissible to contradict the provisions of the Lease. (End of clause) ... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-27...

  13. 20 CFR 404.270 - Cost-of-living increases.

    Science.gov (United States)

    2010-04-01

    ... INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.270 Cost-of-living... rises in the cost of living. These automatic increases also apply to other benefit amounts, as described...

  14. 21 CFR 172.270 - Sulfated butyl oleate.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.270 Sulfated butyl oleate. Sulfate butyl oleate may be safely...

  15. 48 CFR 719.270 - Small business policies.

    Science.gov (United States)

    2010-10-01

    ... contract file. (h) SDB shall be the Small Business Advisor and Minority Business Procurement Policy Manager... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business policies... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.270 Small business policies. (a) In keeping with...

  16. 27 CFR 24.270 - Determination of tax.

    Science.gov (United States)

    2010-04-01

    ... nearest 10th gallon; or (c) In the case of pipeline removals, on the volume of bulk wine removed recorded..., DEPARTMENT OF THE TREASURY LIQUORS WINE Removal, Return and Receipt of Wine Taxpaid Removals § 24.270 Determination of tax. The tax on wine is determined at the time of removal from a bonded wine premises for...

  17. 48 CFR 2852.102-270 - Incorporation in full text.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... 2852.102-270 Incorporation in full text. JAR provisions or clauses shall be incorporated in solicitations and contracts in full text. ...

  18. 17 CFR 270.3a-2 - Transient investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Transient investment companies... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-2 Transient investment companies... which an issuer owns or proposes to acquire investment securities (as defined in section 3(a) of the Act...

  19. 50 CFR 270.11 - Responsibilities of NMFS.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... part 270 and other applicable law, and approve or disapprove, marketing and promotion plans and budgets... disapproval of a marketing and promotion plan or budget, together with reasons for such disapproval; (3) Issue...

  20. 48 CFR 753.270 - Prescription of USAID forms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prescription of USAID... DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 753.270 Prescription of USAID forms. The requirements for use of USAID forms are contained in parts 701 through 752 where the subject matter applicable...

  1. The Road Side Unit for the A270 Test Site

    NARCIS (Netherlands)

    Passchier, I.; Driessen, B.J.F.; Heijligers, B.M.R.; Netten, B.D.; Schackmann, P.P.M.

    2011-01-01

    The design and implementation of the Road Side Unit for the A270 Test Site is presented. It consists of a sensor platform and V2I communication platform with full coverage of the test site. A service platform enables applications to make use of these facilities. The RSU will be used both for the

  2. Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

  3. 17 CFR 270.0-11 - Customer identification programs.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer identification... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.0-11 Customer identification programs... implementing regulation at 31 CFR 103.131, which requires a customer identification program to be implemented...

  4. 40 CFR 270.3 - Considerations under Federal law.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Considerations under Federal law. 270... Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of... applicable law requires consideration or adoption of particular permit conditions or requires the denial of a...

  5. 17 CFR 270.2a-7 - Money market funds.

    Science.gov (United States)

    2010-04-01

    ... Entity”), and the securities that it issues (other than securities issued to a company that controls, or... the securities. (7) Portfolio Lending Agreements. A portfolio lending agreement shall be treated as... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Money market funds. 270.2a-7...

  6. 48 CFR 514.270-2 - Guidelines for use.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Guidelines for use. 514... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 514.270-2 Guidelines for use. (a... furniture). (2) The articles will be assembled and used as a unit, and different manufacturers' components...

  7. 17 CFR 270.32a-4 - Independent audit committees.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Independent audit committees... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.32a-4 Independent audit committees. A... the fund's accounting and auditing processes (“audit committee”); (b) The company's board of directors...

  8. Introduction and feasibility study of the HD-270 MLC

    International Nuclear Information System (INIS)

    Kim, Dae Young; Kim Won Taek; Lee, Hwa Jung; Lee, Kang Hyeok

    2003-01-01

    The multileaf collimator(MLC) has many advantages, but use of the MLC increased effective penumbra and isodose undulation in dose distribution compared with that of an alloy block. In this work, we introduced the HD-270 MLC, which can improve the above disadvantages of MLC, and reported its feasibility study. The HD-270 MLC is a technique which combines the use of the existing Siemens multileaf collimator(3D MLC) with patient translation perpendicular to the leaf plane. The technique produces a smoothed isodose distribution with the reduced isodose undulation and effective penumbra. To assess the efficacy of the HD-270 technique and determine the appropriate resolution, a polygonal shaped MLC field was made to produce field edge angles from 0 degree to 75 degree with a step of 15 degree. Each HD-270 group was generated according to the allowed resolution, i. e., 5, 3, and 2 mm. The experiment was carried out on Primus, a Siemens linear accelerator configured with HD-270 MLC. The total 60 MU of 6 MV photon beam was delivered to X-Omat film (Kodak, USA) at a SAD of 100 cm and 1.5 cm depth in solid water phantom. Exposed films were scanned by Lumiscan75(LUMISYS) and analyzed using RIT113 software (Radiological Imaging Technology Inc., USA). To test the mechanical accuracy of table movement, the transverse, longitudinal, and vertical positions were controlled by a consol with ±5 mm, ±4 mm, ±3 mm, and ±2 mm steps, and then measured using a dial gauge with an accuracy of 0.001 inch. During the experiments, the table loaded with about 50 Kg human phantom to simulate the real treatment situation. The effective penumbra and isodose undulation became larger with increase the resolution and field edge angle. The accuracy of the table movement on each direction is good within the ±1 mm. Clinical use of the MLC can be increased by using of the HD-270 MLC which complements to the disadvantages of the MLC.

  9. 17 CFR 270.22e-3 - Exemption for liquidation of money market funds.

    Science.gov (United States)

    2010-04-01

    ... money market funds. 270.22e-3 Section 270.22e-3 Commodity and Securities Exchanges SECURITIES AND... for liquidation of money market funds. (a) Exemption. A registered open-end management investment company or series thereof (“fund”) that is regulated as a money market fund under § 270.2a-7 is exempt...

  10. 48 CFR 352.270-6 - Restriction on use of human subjects.

    Science.gov (United States)

    2010-10-01

    ... human subjects. 352.270-6 Section 352.270-6 Federal Acquisition Regulations System HEALTH AND HUMAN....270-6 Restriction on use of human subjects. As prescribed in 370-304(b), the Contracting Officer shall insert the following clause: Restriction on Use of Human Subjects (January 2006) Pursuant to 45 CFR part...

  11. 17 CFR 270.6c-3 - Exemptions for certain registered variable life insurance separate accounts.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemptions for certain registered variable life insurance separate accounts. 270.6c-3 Section 270.6c-3 Commodity and Securities... 1940 § 270.6c-3 Exemptions for certain registered variable life insurance separate accounts. A separate...

  12. 17 CFR 270.3c-2 - Definition of beneficial ownership in small business investment companies.

    Science.gov (United States)

    2010-04-01

    ... 1940 § 270.3c-2 Definition of beneficial ownership in small business investment companies. For the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial ownership in small business investment companies. 270.3c-2 Section 270.3c-2 Commodity and Securities...

  13. 15 CFR 270.204 - Provision of additional resources and services needed by a Team.

    Science.gov (United States)

    2010-01-01

    ... services needed by a Team. 270.204 Section 270.204 Commerce and Foreign Trade Regulations Relating to... CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Investigations § 270.204 Provision of additional resources and services needed by a Team. The Director will determine the appropriate resources that a Team...

  14. 15 CFR 270.106 - Conflicts of interest related to service on a Team.

    Science.gov (United States)

    2010-01-01

    ... service on a Team. 270.106 Section 270.106 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.106 Conflicts of interest related to service on a Team. (a) Team members who are not Federal employees will be...

  15. 17 CFR 270.17j-1 - Personal investment activities of investment company personnel.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Personal investment activities of investment company personnel. 270.17j-1 Section 270.17j-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270...

  16. 48 CFR 809.270 - Qualified products for convenience/labor-saving foods.

    Science.gov (United States)

    2010-10-01

    ... convenience/labor-saving foods. 809.270 Section 809.270 Federal Acquisition Regulations System DEPARTMENT OF... 809.270 Qualified products for convenience/labor-saving foods. (a) Each VISN Nutrition and Food Service representative is authorized to establish a common VISN QPL for convenience and labor-saving foods...

  17. 200 and 270 GHz SIS receivers development for atmospheric observation

    International Nuclear Information System (INIS)

    Ochiai, S.; Masuko, H.

    1993-01-01

    Superconducting mixers have been developed for observations of atmospheric minor constituents such as ClO and ozone at Communications Research Laboratory. This paper describes the work at development of 200 and 270 GHz SIS mixers. Nb/AlOx/Nb junctions were fabricated at Nobeyama Radio Observatory. The base Nb layer 200 nm, the Al (AlOx) insulation layer, and the counter Nb electrode 150 nm are sputtered. The area outside of a junction defined by etching of the counter electrode is insulated by anodized Nb layer and sputtered SiO 2 . After sputtering thick SiO 2 layer on the whole wafer, a contact hole is made by etching. The thickness of the wiring Nb layer is 500 nm. The junctions are formed on the 250 μm thick fused quartz substrate. After the process of the junction fabrication, the quartz substrate is shaved from the back side until 150 μm thickness. Each junction for 270 GHz mixer has an area of about 1 μm 2 . The normal resistance of the six junctions series array is around 70 Ω. The mixer block has a reduced waveguide (1.2 x 0.1 mm for 200 GHz and 0.98 x 0. 1 mm for 270 GHz). The waveguide has two tuners in addition to a fixed backshort cavity. This configuration can allow to realize the lower embedding impedance, and less sensitive to the position of the tuners. The SIS mixers are cooled in a closed cycle He refrigerator. The LO is optically injected through a Fabry Perot interferometer. The 5--7 GHz IF is fed to a HEMT amplifier cooled at 15 K. The authors have started a preliminary measurement of the noise temperature of the SIS receivers, and comparing with calculated DSB receiver noise temperature assuming 3-port model. They continue to improve the performance of the SIS mixers now. They intend that the receivers shall be utilized for atmospheric monitor from next winter

  18. 17 CFR 270.12d1-1 - Exemptions for investments in money market funds.

    Science.gov (United States)

    2010-04-01

    ... money market funds. 270.12d1-1 Section 270.12d1-1 Commodity and Securities Exchanges SECURITIES AND... Exemptions for investments in money market funds. (a) Exemptions for acquisition of money market fund shares... issued by a money market fund; and (2) A money market fund, any principal underwriter thereof, and a...

  19. 17 CFR 270.24b-2 - Filing copies of sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

  20. 17 CFR 270.18c-1 - Exemption of privately held indebtedness.

    Science.gov (United States)

    2010-04-01

    ... indebtedness. 270.18c-1 Section 270.18c-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... indebtedness. The issuance or sale of more than one class of senior securities representing indebtedness by a... outstanding any publicly held indebtedness, and all securities of any such class are (a) privately held by the...

  1. 48 CFR 852.270-2 - Bread and bakery products-quantities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bread and bakery products-quantities. 852.270-2 Section 852.270-2 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... Bread and bakery products—quantities. As prescribed in 870.111-3, insert the following clause: Bread and...

  2. 17 CFR 270.17a-6 - Exemption for transactions with portfolio affiliates.

    Science.gov (United States)

    2010-04-01

    ... a wholly-owned subsidiary of a fund; (C) Usual and ordinary fees for services as a director; (D) An... with portfolio affiliates. 270.17a-6 Section 270.17a-6 Commodity and Securities Exchanges SECURITIES... Exemption for transactions with portfolio affiliates. (a) Exemption for transactions with portfolio...

  3. 17 CFR 270.8b-12 - Requirements as to paper, printing and language.

    Science.gov (United States)

    2010-04-01

    ..., printing and language. 270.8b-12 Section 270.8b-12 Commodity and Securities Exchanges SECURITIES AND... Requirements as to paper, printing and language. (a) Registration statements and reports shall be filed on good... and reports shall be in the English language. If any exhibit or other paper or document filed with a...

  4. 17 CFR 270.17f-4 - Custody of investment company assets with a securities depository.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of investment company assets with a securities depository. 270.17f-4 Section 270.17f-4 Commodity and Securities Exchanges....17f-4 Custody of investment company assets with a securities depository. (a) Custody arrangement with...

  5. 18 CFR 270.303 - Natural gas produced from Devonian shale.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Natural gas produced from Devonian shale. 270.303 Section 270.303 Conservation of Power and Water Resources FEDERAL ENERGY...; and (4) Attesting that the applicant has no knowledge of any information not described in the...

  6. 48 CFR 514.270-7 - Guidelines for using the price list method.

    Science.gov (United States)

    2010-10-01

    ... on knowledge of the supplies or services and previous contract prices. (d) First time use for an item... price list method. 514.270-7 Section 514.270-7 Federal Acquisition Regulations System GENERAL SERVICES... for using the price list method. (a) General. The price list method helps avoid unbalanced bidding...

  7. 15 CFR 270.104 - Size and composition of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Size and composition of a Team. 270... NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.104 Size and composition of...

  8. 17 CFR 270.2a-46 - Certain issuers as eligible portfolio companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain issuers as eligible portfolio companies. 270.2a-46 Section 270.2a-46 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... eligible portfolio companies. The term eligible portfolio company shall include any issuer that meets the...

  9. 34 CFR 270.3 - What definitions apply to these programs?

    Science.gov (United States)

    2010-07-01

    ... regulations for the Bilingual Education Program. (Authority: 20 U.S.C. 3223(a)(1)) National origin... 34 Education 1 2010-07-01 2010-07-01 false What definitions apply to these programs? 270.3 Section 270.3 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND...

  10. 37 CFR 270.1 - Notice of use of sound recordings under statutory license.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Notice of use of sound recordings under statutory license. 270.1 Section 270.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE... website or from the Licensing Division, and shall include the following information: (1) The full legal...

  11. 40 CFR 158.270 - Experimental use permit data requirements for residue chemistry.

    Science.gov (United States)

    2010-07-01

    ... requirements for residue chemistry. 158.270 Section 158.270 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for residue chemistry. All residue chemistry data, as described in... section 408(r) is sought. Residue chemistry data are not required for an experimental use permit issued on...

  12. 32 CFR Appendix A to Part 270 - Application for Compensation of Vietnamese Commandos

    Science.gov (United States)

    2010-07-01

    ... DEMOCRATIC REPUBLIC OF VIETNAM Pt. 270, App. A Appendix A to Part 270—Application for Compensation of..., parents, or siblings, who were captured and incarcerated by North Vietnam as a result of participating in... portions. Social Security Number: Providing a social security number is voluntary. If one is not provided...

  13. Hydra, a fruitful model system for 270 years.

    Science.gov (United States)

    Galliot, Brigitte

    2012-01-01

    The discovery of Hydra regeneration by Abraham Trembley in 1744 promoted much scientific curiosity thanks to his clever design of experimental strategies away from the natural environment. Since then, this little freshwater cnidarian polyp flourished as a potent and fruitful model system. Here, we review some general biological questions that benefitted from Hydra research, such as the nature of embryogenesis, neurogenesis, induction by organizers, sex reversal, symbiosis, aging, feeding behavior, light regulation, multipotency of somatic stem cells, temperature-induced cell death, neuronal transdifferentiation, to cite only a few. To understand how phenotypes arise, theoricists also chose Hydra to model patterning and morphogenetic events, providing helpful concepts such as reaction-diffusion, positional information, and autocatalysis combined with lateral inhibition. Indeed, throughout these past 270 years, scientists used transplantation and grafting experiments, together with tissue, cell and molecular labelings, as well as biochemical procedures, in order to establish the solid foundations of cell and developmental biology. Nowadays, thanks to transgenic, genomic and proteomic tools, Hydra remains a promising model for these fields, but also for addressing novel questions such as evolutionary mechanisms, maintenance of dynamic homeostasis, regulation of stemness, functions of autophagy, cell death, stress response, innate immunity, bioactive compounds in ecosystems, ecotoxicant sensing and science communication.

  14. BRM270, a Compound from Natural Plant Extracts, Inhibits Glioblastoma Stem Cell Properties and Glioblastoma Recurrence.

    Science.gov (United States)

    Jeon, Hee-Young; Park, Cheol Gyu; Ham, Seok Won; Choi, Sang-Hun; Lee, Seon Yong; Kim, Jung Yun; Seo, Sunyoung; Jin, Xiong; Kim, Jun-Kyum; Eun, Kiyoung; Kim, Eun-Jung; Kim, Hyunggee

    2017-09-01

    Glioblastoma multiforme (GBM) is one of the most aggressive and lethal human brain tumors, and the median survival of patients with GBM is only 14 months. Glioblastoma stem cells (GSCs) are regarded as a main cause of GBM recurrence, because of their self-renewal and drug resistance properties. Therefore, targeting GSCs is an important therapeutic strategy for GBM. In this study, we show the effects of BRM270, a compound from natural plant extracts, on GSCs in vitro and GBM recurrence in vivo. BRM270 induced apoptotic cell death and inhibited cell growth and "stemness" both in vitro and in vivo. Combining BRM270 treatment with concurrent chemoradiotherapy (CCRT) dramatically increased mice survival and tumor growth inhibition. Taken together, our results suggested that BRM270 synergizes with CCRT as a therapeutic agent to target GSCs.

  15. 21 CFR 137.270 - Self-rising white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising white corn meal. 137.270 Section 137... Cereal Flours and Related Products § 137.270 Self-rising white corn meal. (a) Self-rising white corn meal is an intimate mixture of white corn meal, sodium bicarbonate, and one or both of the acid-reacting...

  16. Event-related potential N270 as an index of social information conflict in explicit processing.

    Science.gov (United States)

    Wang, Pei; Tan, Chen-Hao; Li, Yu; Zhang, Qin; Wang, Yi-Bo; Luo, Jun-Long

    2018-01-01

    As N270 has been widely shown to be sensitive to nonsocial information conflict, the present study investigated whether social information conflict can elicit increased N270 in either explicit or implicit processing conditions. Gender stereotype-related picture-word pairs and picture-word pairs in specific colors were used as social and nonsocial information, respectively. Participants performed an explicit task based on the S1-S2 paradigm in Study 1, and both social and nonsocial information conditions elicited larger N270 than the no-conflict condition. In Study 2, participants performed a word judgment task that was modified from the S1-S2 paradigm of Study 1. However, neither social information nor nonsocial information elicited larger N270 within the conflict condition. Social trials generally elicited a more negative ERP waveform than nonsocial trials overall. These findings suggest that N270 may reflect the processing of social information conflict only in explicit conditions and also that the cognitive basis of N270 is thus a general but explicit processing of working memory representation conflict. Copyright © 2017. Published by Elsevier B.V.

  17. 17 CFR 270.30b1-7 - Monthly report for money market funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Monthly report for money... money market funds. (a) Report. Every registered open-end management investment company, or series thereof, that is regulated as a money market fund under § 270.2a-7 must file with the Commission a monthly...

  18. 17 CFR 270.30b1-4 - Report of proxy voting record.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Report of proxy voting record... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.30b1-4 Report of proxy voting record....129 of this chapter) not later than August 31 of each year, containing the registrant's proxy voting...

  19. 12 CFR 563b.270 - What must I include in my proxy statement?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false What must I include in my proxy statement? 563b... CONVERSIONS FROM MUTUAL TO STOCK FORM Standard Conversions Proxy Solicitation § 563b.270 What must I include in my proxy statement? (a) Content requirements. You must prepare your proxy statement in compliance...

  20. 17 CFR 270.2a51-3 - Certain companies as qualified purchasers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain companies as qualified... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a51-3 Certain companies as qualified purchasers. (a) For purposes of section 2(a)(51)(A) (ii) and (iv) of the Act , a company...

  1. 17 CFR 270.24b-3 - Sales literature deemed filed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  2. 17 CFR 270.34b-1 - Sales literature deemed to be misleading.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed to be... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.34b-1 Sales literature deemed to be misleading. Any advertisement, pamphlet, circular, form letter, or other sales literature addressed to or...

  3. 48 CFR 552.270-6 - Maintenance of Building and Premises-Right of Entry.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Maintenance of Building... Provisions and Clauses 552.270-6 Maintenance of Building and Premises—Right of Entry. As prescribed in 570.603, insert the following clause: Maintenance of Building and Premises—Right of Entry (SEP 1999...

  4. 41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...

  5. 17 CFR 270.17a-8 - Mergers of affiliated companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Mergers of affiliated... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.17a-8 Mergers of affiliated companies. (a) Exemption of affiliated mergers. A Merger of a registered investment company (or a series thereof...

  6. 40 CFR 270.17 - Specific part B information requirements for surface impoundments.

    Science.gov (United States)

    2010-07-01

    ... the leak detection system; (4) The construction quality assurance (CQA) plan if required under § 264... he will provide such a certification upon completion of construction in accordance with the plans and... under § 270.14(b)(7); (f) A description of how hazardous waste residues and contaminated materials will...

  7. 17 CFR 270.23c-3 - Repurchase offers by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... reasonably designed, taking into account current market conditions and the company's investment objectives... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.23c-3 Repurchase offers by... by an investment company to repurchase common stock of which it is the issuer. (3) Repurchase offer...

  8. 17 CFR 270.6c-6 - Exemption for certain registered separate accounts and other persons.

    Science.gov (United States)

    2010-04-01

    ... portfolio company has the same: (i) Investment objectives, (ii) Fundamental policies, and (iii) Voting... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.6c... which is, or is a part of, a unit investment trust registered under the Act, engaged in a continuous...

  9. 17 CFR 270.8b-16 - Amendments to registration statement.

    Science.gov (United States)

    2010-04-01

    ... company's investment objectives or policies (described in Item 8.2 of Form N-2) that have not been... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.8b-16 Amendments to registration statement. (a) Every registered management investment company which is required to file a semi-annual report...

  10. 17 CFR 270.2a-1 - Valuation of portfolio securities in special cases.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a-1 Valuation of portfolio securities in special cases. (a) Any investment company whose securities are qualified... which the securities owned by such company are required by applicable State law or regulations to be...

  11. 40 CFR 415.270 - Applicability; description of the borax production subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the borax... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Borax Production Subcategory § 415.270 Applicability; description of the borax production subcategory. The...

  12. Performance of Jatropha Oil Blends in RD270 Two Cylinders Four ...

    African Journals Online (AJOL)

    The performance characteristics of RD270 two cylinder, four stroke diesel engine fuelled with jatropha oil and its blend with diesel are presented in this paper. The jatropha biodiesel was obtained from National Research Institutes for Chemical Technology, Zaria, Nigeria. The produced biodiesel was blended with neat ...

  13. The 270 MeV deuteron beam polarimeter at the Nuclotron Internal Target Station

    Energy Technology Data Exchange (ETDEWEB)

    Kurilkin, P.K. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Ladygin, V.P., E-mail: vladygin@jinr.ru [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Uesaka, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Suda, K. [RIKEN Nishina Center, Saitama (Japan); Gurchin, Yu.V.; Isupov, A.Yu. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Itoh, K. [Department of Physics, Saitama University, Saitama (Japan); Janek, M. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Physics Department, University of Zilina, 010 26 Zilina (Slovakia); Karachuk, J.-T. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Advanced Research Institute for Electrical Engineering, Bucharest (Romania); Kawabata, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Khrenov, A.N.; Kiselev, A.S.; Kizka, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Kliman, J. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia); Krasnov, V.A.; Livanov, A.N. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Nuclear Research, Moscow (Russian Federation); Maeda, Y. [Kyushi University, Hakozaki (Japan); Malakhov, A.I. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Matousek, V.; Morhach, M. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia)

    2011-06-21

    A deuteron beam polarimeter has been constructed at the Internal Target Station at the Nuclotron of JINR. The polarimeter is based on spin-asymmetry measurements in the d-p elastic scattering at large angles and the deuteron kinetic energy of 270 MeV. It allows to measure vector and tensor components of the deuteron beam polarization simultaneously.

  14. Evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I270/I255 corridor in St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the transportation users. The technical system ...

  15. Appendices : evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I-270/I-255 corridor in : St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the : transportation users. The technical system ...

  16. 17 CFR 270.3a-7 - Issuers of asset-backed securities.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-7 Issuers of asset-backed... downgrading in the rating of the issuer's outstanding fixed-income securities; and (iii) The assets are not... parties in those eligible assets that principally generate the cash flow needed to pay the fixed-income...

  17. 17 CFR 270.17f-6 - Custody of investment company assets with Futures Commission Merchants and Commodity Clearing...

    Science.gov (United States)

    2010-04-01

    ... transactions in Exchange-Traded Futures Contracts and Commodity Options, Provided that: (1) The manner in which... Contracts and Commodity Options means commodity futures contracts, options on commodity futures contracts... assets with Futures Commission Merchants and Commodity Clearing Organizations. 270.17f-6 Section 270.17f...

  18. 17 CFR 270.11a-3 - Offers of exchange by open-end investment companies other than separate accounts.

    Science.gov (United States)

    2010-04-01

    ... because it is unable to invest amounts effectively in accordance with applicable investment objectives... investment companies other than separate accounts. 270.11a-3 Section 270.11a-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF...

  19. 17 CFR 270.17g-1 - Bonding of officers and employees of registered management investment companies.

    Science.gov (United States)

    2010-04-01

    ... nature of the securities in the company's portfolio: Provided, however, That (1) the amount of a single... company, a statement of the nature and amount of the claim, (3) File with the Commission, within five days... employees of registered management investment companies. 270.17g-1 Section 270.17g-1 Commodity and...

  20. 40 CFR 270.22 - Specific part B information requirements for boilers and industrial furnaces burning hazardous...

    Science.gov (United States)

    2010-07-01

    ... requirements for boilers and industrial furnaces burning hazardous waste. 270.22 Section 270.22 Protection of... requirements for boilers and industrial furnaces burning hazardous waste. When an owner or operator of a cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric acid...

  1. 20 CFR 645.270 - What procedures are there to ensure that currently employed workers may file grievances regarding...

    Science.gov (United States)

    2010-04-01

    ... gender discrimination? 645.270 Section 645.270 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... regarding displacement, health and safety standards and gender discrimination? (a) The State shall establish...) Participants alleging gender discrimination by WtW programs that are not part of the One-Stop system may file a...

  2. 45 CFR 270.5 - What factors will we use to determine a State's score on the work measures?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What factors will we use to determine a State's score on the work measures? 270.5 Section 270.5 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES HIGH PERFORMANCE...

  3. 17 CFR 270.3c-3 - Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt...

    Science.gov (United States)

    2010-04-01

    ... investment companies. 270.3c-3 Section 270.3c-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-3 Definition of certain... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of certain terms...

  4. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-05-12

    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  5. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  6. Phase Equilibria of the Fe-Ni-Sn Ternary System at 270°C

    Science.gov (United States)

    Huang, Tzu-Ting; Lin, Shih-Wei; Chen, Chih-Ming; Chen, Pei Yu; Yen, Yee-Wen

    2016-12-01

    The Fe-42 wt.% Ni alloy, also known as a 42 invar alloy (Alloy 42), is used as a lead-frame material because its thermal expansion coefficient is much closer to Si substrate than Cu or Ni substrates. In order to enhance the wettability between the substrate and solder, the Sn layer was commonly electroplated onto the Alloy 42 surface. A clear understanding of the phase equilibria of the Fe-Ni-Sn ternary system is necessary to ensure solder-joint reliability between Sn and Fe-Ni alloys. To determine the isothermal section of the Fe-Ni-Sn ternary system at 270°C, 26 Fe-Ni-Sn alloys with different compositions were prepared. The experimental results confirmed the presence of the Fe3Ni and FeNi phases at 270°C. Meanwhile, it observed that the isothermal section of the Fe-Ni-Sn ternary system was composed of 11 single-phase regions, 19 two-phase regions and nine tie-triangles. Moreover, no ternary compounds were found in the Fe-Ni-Sn system at 270°C.

  7. Glutamate 270 plays an essential role in K(+)-activation and domain closure of Thermus thermophilus isopropylmalate dehydrogenase.

    Science.gov (United States)

    Gráczer, Éva; Palló, Anna; Oláh, Julianna; Szimler, Tamás; Konarev, Petr V; Svergun, Dmitri I; Merli, Angelo; Závodszky, Péter; Weiss, Manfred S; Vas, Mária

    2015-01-16

    The mutant E270A of Thermus thermophilus 3-isopropylmalate dehydrogenase exhibits largely reduced (∼1%) catalytic activity and negligible activation by K(+) compared to the wild-type enzyme. A 3-4 kcal/mol increase in the activation energy of the catalysed reaction upon this mutation could also be predicted by QM/MM calculations. In the X-ray structure of the E270A mutant a water molecule was observed to take the place of K(+). SAXS and FRET experiments revealed the essential role of E270 in stabilisation of the active domain-closed conformation of the enzyme. In addition, E270 seems to position K(+) into close proximity of the nicotinamide ring of NAD(+) and the electron-withdrawing effect of K(+) may help to polarise the aromatic ring in order to aid the hydride-transfer. Copyright © 2014. Published by Elsevier B.V.

  8. 17 CFR 270.3a-3 - Certain investment companies owned by companies which are not investment companies.

    Science.gov (United States)

    2010-04-01

    ... the definition of the term “investment company” by section 3(b)(1) or 3(b)(2) of the Act (15 U.S.C... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain investment companies owned by companies which are not investment companies. 270.3a-3 Section 270.3a-3 Commodity and...

  9. 17 CFR 270.30a-2 - Certification of Form N-CSR and Form N-Q.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certification of Form N-CSR and Form N-Q. 270.30a-2 Section 270.30a-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Form N-CSR and Form N-Q. (a) Each report filed on Form N-CSR (§§ 249.331 and 274.128 of this chapter...

  10. Observational data on Galactic supernova remnants: II. The supernova remnants within l = 90°-270°

    Directory of Open Access Journals (Sweden)

    Guseinov O.H.

    2004-01-01

    Full Text Available We have collected all the available data on Galactic supernova remnants given in the literature. The data of Galactic supernova remnants located in the Galactic longitude interval l=90° - 270° in all spectral bands are represented in this work. We have adopted distance values for the SNRs by examining these data. The data of various types on neutron stars connected to these supernova remnants are also represented. Remarks of some authors and by ourselves regarding the data and some properties of both the supernova remnants and the point sources are given.

  11. The electrical characteristics of copper slags in a 270 kVA DC arc furnace

    International Nuclear Information System (INIS)

    Derin, Bora; Sahin, Filiz Cinar; Yucel, Onuralp

    2003-01-01

    The electrical resistance of slags is the main criteria to determine the design and the operation conditions of slag resistance furnace (SRF) depending on temperature and composition. In this study, a 270 kVA DC electric arc furnace were used to determine the electrical characteristic of molten ancient copper slags. The specific conductivity of the slag was estimated by using furnace geometric factor given in the literature as an empirical formula and by using furnace resistance measured during smelting of the copper slag with or without different additives such as coke, CaO and Al 2 O 3 . (Original)

  12. Glycogen storage disease type 1a in three siblings with the G270V mutation.

    Science.gov (United States)

    Parvari, R; Isam, J; Moses, S W

    1999-04-01

    Glycogen storage disease type 1a (von Gierke disease, GSD1a) is caused by the deficiency of microsomal glucose-6-phosphatase (G6Pase) activity. The cloning of G6Pase cDNA and characterization of the human G6Pase gene enabled the identification of the mutations causing GSD1a. Here we report on the clinical and biochemical features of three GSD1a siblings of a Muslin Arab family with a G270V mutation. Two older patients presented with an unusually mild clinical and biochemical course.

  13. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    International Nuclear Information System (INIS)

    Thompson, W.S.

    2005-01-01

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  14. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    Energy Technology Data Exchange (ETDEWEB)

    W. S. Thompson

    2005-12-14

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  15. BRM270 inhibits cancer stem cell maintenance via microRNA regulation in chemoresistant A549 lung adenocarcinoma cells.

    Science.gov (United States)

    Kwon, Taeho; Chandimali, Nisansala; Huynh, Do Luong; Zhang, Jiao Jiao; Kim, Nameun; Bak, Yesol; Yoon, Do-Young; Yu, Dae-Yeul; Lee, Jae Cheol; Gera, Meeta; Ghosh, Mrinmoy; Park, Yang Ho; Jeong, Dong Kee

    2018-02-14

    Chemotherapy is a standard treatment for non-small-cell lung cancer (NSCLC). However, the dose-limiting toxicity of drugs and the development of chemoresistance are major clinical challenges to successful management of NSCLC. Asian traditional medicine is gaining global attention as a non-toxic alternative to chemotherapy. BRM270 is an extract formulated from seven Asian medicinal plants that has been shown to inhibit tumor cell proliferation in diverse cancer types. We previously demonstrated that BRM270 suppresses tumorigenesis by negatively regulating nuclear factor-κB signaling in multidrug-resistant cancer stem cells (CSCs). In this study we report that the growth, migration, and invasion of normal human lung adenocarcinoma cells and their chemoresistant derivatives was inhibited by BRM270 treatment. Notably, BRM270 was found to modulate CSC self-renewal and tumor-initiating capacity via positive regulation of the miRNA-128. Thus, combination therapy with miRNA-128 and BRM270 may be an effective treatment strategy for chemoresistant NSCLC.

  16. Stigmastadiene and specific extitntion (270 nm to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

    Directory of Open Access Journals (Sweden)

    Sabria Aued-Pimentel

    2013-09-01

    Full Text Available The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270 and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these parameters, seven samples of extra virgin olive oil and three samples of olive oil (blend of virgin and refined were analyzed. Among the samples analyzed, four extra virgin samples had levels of stigmastadiene and E 270 higher than expected, among which two were adulterated with seed oil (rich in linoleic acid and the other two with olive pomace oil. The results demonstrate the higher sensitivity of stigmastadiene to determine the presence of the refined oil in virgin olive oil and good agreement with determining E 270. The latter technique is a simple, quick, and low cost method of determination that can be easily implemented in laboratories to assist in the screening and regulation of olive oils sold in Brazil.

  17. N270 sensitivity to conflict strength and working memory: A combined ERP and sLORETA study.

    Science.gov (United States)

    Scannella, Sébastien; Pariente, Jérémie; De Boissezon, Xavier; Castel-Lacanal, Evelyne; Chauveau, Nicolas; Causse, Mickaël; Dehais, Frédéric; Pastor, Josette

    2016-01-15

    The event-related potential N270 component is known to be an electrophysiological marker of the supramodal conflict processing. However little is know about the factors that may modulate its amplitude. In particular, among all studies that have investigated the N270, little or no control of the conflict strength and of the load in working memory have been done leaving a lack in the understanding of this component. We designed a spatial audiovisual conflict task with simultaneous target and cross-modal distractor to evaluate the N270 sensitivity to the conflict strength (i.e., visual target with auditory distractor or auditory target with visual distractor) and the load in working memory (goal task maintenance with frequent change in the target modality). In a first session, participants had to focus on one modality for the target position to be considered (left-hand or right-hand) while the distractor could be at the same side (compatible) or at opposite side (incompatible). In a second session, we used the same set of stimuli as in the first session with an additional distinct auditory signal that clued the participants to frequently switch between the auditory and the visual targets. We found that (1) reaction times and N270 amplitudes for conflicting situations were larger within the auditory target condition compared to the visual one, (2) the increase in target maintenance effort led to equivalent increase of both reaction times and N270 amplitudes within all conditions and (3) the right dorsolateral prefrontal cortex current density was higher for both conflicting and active maintenance of the target situations. These results provide new evidence that the N270 component is an electrophysiological marker of the supramodal conflict processing that is sensitive to the conflict strength and that conflict processing and active maintenance of the task goal are two functions of a common executive attention system. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Effect of food on the pharmacokinetics of oral MMI270B (CGS 27023A), a novel matrix metalloproteinase inhibitor

    NARCIS (Netherlands)

    F.A.L.M. Eskens (Ferry); N.C. Levitt; A. Sparreboom (Alex); L. Choi; R. Mather; J. Verweij (Jaap); A.L. Harris

    2000-01-01

    textabstractMMI270B is a matrix metalloproteinase inhibitor (MMPI) with in vitro and in vivo activity. To exert optimal target inhibition, MMPI must be given chronically, and therefore, oral bioavailability is important. We analyzed the effect of food intake on AUC0-8

  19. 17 CFR 270.17f-7 - Custody of investment company assets with a foreign securities depository.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of investment company... 1940 § 270.17f-7 Custody of investment company assets with a foreign securities depository. (a) Custody...-limiting safeguards. The custody arrangement provides reasonable safeguards against the custody risks...

  20. 45 CFR 270.7 - What data will we use to measure performance on the work support and other measures?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What data will we use to measure performance on..., DEPARTMENT OF HEALTH AND HUMAN SERVICES HIGH PERFORMANCE BONUS AWARDS § 270.7 What data will we use to measure performance on the work support and other measures? (a) We will use Census Bureau data to rank...

  1. 48 CFR 733.270-2 - Special procedures regarding contract disputes appeals promulgated pursuant to paragraph 2 of the...

    Science.gov (United States)

    2010-10-01

    ... regarding contract disputes appeals promulgated pursuant to paragraph 2 of the Administrator's designation... Appeals 733.270-2 Special procedures regarding contract disputes appeals promulgated pursuant to paragraph... paragraphs (d) (1) through (5) of this section and will promptly, and in any event within 65 days after the...

  2. 17 CFR 270.17a-5 - Pro rata distribution neither “sale” nor “purchase.”

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pro rata distribution neither... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.17a-5 Pro rata distribution neither “sale” nor “purchase.” When a company makes a pro rata distribution in cash or in kind...

  3. 17 CFR 270.2a19-2 - Investment company general partners not deemed interested persons.

    Science.gov (United States)

    2010-04-01

    ... or a business development company that is organized as a limited partnership under state law. (3... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment company general... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270...

  4. Isolation and partial characterization of gypsy moth BTR-270, an anionic brush border membrane glycoconjugate that binds Bacillus thuringiensis Cry1A toxins with high affinity

    Science.gov (United States)

    Algimantas P. Valaitis; Jeremy L. Jenkins; Mi Kyong Lee; Donald H. Dean; Karen J. Garner

    2001-01-01

    BTR-270, a gypsy moth (Lymantria dispar) brush border membrane molecule that binds Bacillus thuringiensis (Bt) Cry1A toxins with high affinity, was purified by preparative gel electrophoresis. Rabbit antibodies specific for the Bt toxin-binding molecule were raised. Attempts to label BTR-270 by protein-directed techniques were...

  5. Direct and social genetic effects on body weight at 270 days and carcass and ham quality traits in heavy pigs.

    Science.gov (United States)

    Rostellato, R; Sartori, C; Bonfatti, V; Chiarot, G; Carnier, P

    2015-01-01

    The aims of this study were to estimate covariance components for BW at 270 d (BW270) and carcass and ham quality traits in heavy pigs using models accounting for social effects and to compare the ability of such models to fit the data relative to models ignoring social interactions. Phenotypic records were from 9,871 pigs sired by 293 purebred boars mated to 456 crossbred sows. Piglets were born and reared at the same farm and randomly assigned at 60 d of age to groups (6.1 pigs per group on average) housed in finishing pens, each having an area of 6 m(2). The average additive genetic relationship among group mates was 0.11. Pigs were slaughtered at 277 ± 3 d of age and 169.7 ± 13.9 kg BW in groups of nearly 70 animals each. Four univariate animal models were compared: a basic model (M1) including only direct additive genetic effects, a model (M2) with nonheritable social group (pen) effects in addition to effects in M1, a model (M3) accounting for litter effects in addition to M2, and a model (M4) accounting for social genetic effects in addition to effects in M3. Restricted maximum likelihood estimates of covariance components were obtained for BW270; carcass backfat depth; carcass lean meat content (CLM); iodine number (IOD); and linoleic acid content (LIA) of raw ham subcutaneous fat; subcutaneous fat depth in the proximity of semimembranosus muscle (SFD1) and quadriceps femoris muscle (SFD2); and linear scores for ham round shape (RS), subcutaneous fat (SF), and marbling. Likelihood ratio tests indicated that, for all traits, M2 fit the data better than M1 and that M3 was superior to M2 except for SFD1 and SFD2. Model M4 was significantly better than M3 for BW270 (P quality traits ranged from 6.8 (RS) to 11.2% (SF). Direct and social genetic effects on BW270 were uncorrelated, whereas there was a negative genetic covariance between direct and social effects on CLM, IOD, RS, and SF, which reduced the total heritable variance. This variance, measured relative

  6. Initiation of prostate cancer in mice by Tp53R270H: evidence for an alternative molecular progression

    Directory of Open Access Journals (Sweden)

    Ruth L. Vinall

    2012-11-01

    Tp53 mutations are common in human prostate cancer (CaP, occurring with a frequency of ∼30% and ∼70% in localized and metastatic disease, respectively. In vitro studies have determined several common mutations of Tp53 that have specific gain-of-function properties in addition to loss of function, including the ability to promote castration-resistant (CR growth of CaP cells in some contexts. To date, a lack of suitable mouse models has prohibited investigation of the role played by Tp53 mutations in mediating CaP progression in vivo. Here, we describe the effects of conditional expression of a mutant Tp53 (Tp53R270H; equivalent to the human hotspot mutant R273H in the prostate epithelium of mice. Heterozygous “Tp53LSL-R270H/+” [129S4(Trp53tm3Tyj] and “Nkx3.1-Cre” [129S(Nkx3-1tm3(creMms] mice with prostate-specific expression of the Tp53R270H mutation (p53R270H/+ Nkx3.1-Cre mice were bred onto an FVB/N background via speed congenesis to produce strain FVB.129S4(Trp53tm3Tyj/wt; FVB.129S(Nkx3-1tm3(creMms/wt and littermate genotype negative control mice. These mutant mice had significantly increased incidences of prostatic intraepithelial neoplasia (PIN lesions, and these appeared earlier, compared with the Nkx3.1 haploinsufficient (Nkx3.1-Cre het littermate mice, which did not express the Tp53 mutation. PIN lesions in these mice showed consistent progression and some developed into invasive adenocarcinoma with a high grade, sarcomatoid or epithelial-mesenchymal transition (EMT phenotype. PIN lesions were similar to those seen in PTEN conditional knockout mice, with evidence of AKT activation concomitant with neoplastic proliferation. However, the invasive tumor phenotype is rarely seen in previously described mouse models of prostatic neoplasia. These data indicate that the Tp53R270H mutation plays a role in CaP initiation. This finding has not previously been reported. Further characterization of this model, particularly in a setting of androgen

  7. SHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

    Directory of Open Access Journals (Sweden)

    Jefferson Olivatto da Silva

    2011-09-01

    Full Text Available Resenha do livroSHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

  8. Oral administration of type-II collagen peptide 250-270 suppresses specific cellular and humoral immune response in collagen-induced arthritis.

    Science.gov (United States)

    Zhu, Ping; Li, Xiao-Yan; Wang, Hong-Kun; Jia, Jun-Feng; Zheng, Zhao-Hui; Ding, Jin; Fan, Chun-Mei

    2007-01-01

    Oral antigen is an attractive approach for the treatment of autoimmune and inflammatory diseases. Establishment of immune markers and methods in evaluating the effects of antigen-specific cellular and humoral immune responses will help the application of oral tolerance in the treatment of human diseases. The present article observed the effects of chicken collagen II (CII), the recombinant polymerized human collagen II 250-270 (rhCII 250-270) peptide and synthesized human CII 250-270 (syCII 250-270) peptide on the induction of antigen-specific autoimmune response in rheumatoid arthritis (RA) peripheral blood mononuclear cells (PBMC) and on the specific cellular and humoral immune response in collagen-induced arthritis (CIA) and mice fed with CII (250-270) prior to immunization with CII. In the study, proliferation, activation and intracellular cytokine production of antigen-specific T lymphocytes were simultaneously analyzed by bromodeoxyuridine (BrdU) incorporation and flow cytometry at the single-cell level. The antigen-specific antibody and antibody-forming cells were detected by ELISA and ELISPOT, respectively. CII (250-270) was found to have stimulated the response of specific lymphocytes in PBMC from RA patients, including the increase expression of surface activation antigen marker CD69 and CD25, and DNA synthesis. Mice, fed with CII (250-270) before CII immunization, had significantly lower arthritic scores than the mice immunized with CII alone, and the body weight of the former increased during the study period. Furthermore, the specific T cell activity, proliferation and secretion of interferon (IFN)-gamma in spleen cells were actively suppressed in CII (250-270)-fed mice, and the serum anti-CII, anti-CII (250-270) antibody activities and the frequency of specific antibody-forming spleen cells were significantly lower in CII (250-270)-fed mice than in mice immunized with CII alone. These observations suggest that oral administration of CII (250-270) can

  9. Novel phyto-derivative BRM270 inhibits hepatocellular carcinoma cells proliferation by inducing G2/M phase cell cycle arrest and apoptosis in xenograft mice model.

    Science.gov (United States)

    Kumar Mongre, Raj; Sharma, Neelesh; Singh Sodhi, Simrinder; Ghosh, Mrinmoy; Kumar Singh, Amit; Kim, Nameun; Park, Yang Ho; Shin, Young Gyu; Kim, Sung Jin; Jiao Jiao, Zhang; Huynh, Do Luong; Jeong, Dong Kee

    2017-03-01

    Hepatocellular carcinoma (HCC) is a major threat to human health worldwide and development of novel antineoplastic drug is demanding task. BRM270 is a proprietary combination of traditional medicinal herbs, has been shown to be effective against a wide range of stem-like cancer initiating cells (SLCICs). However, the underlying mechanism and antitumor efficacy of BRM270 in human hepatocellular carcinoma (HCC) cells have not been well elucidated till date. Here we studied the tumoricidal effect of BRM270 on human-CD133 + expressing stem-like HepG-2 and SNU-398 cells. Gene expression profiling by qPCR and specific cellular protein expressions was measured using immunocytochemistry/western blot analysis. In vivo efficacy of BRM270 has been elucidated in the SLCICs induced xenograft model. In addition, 2DG-(2-Deoxy-d-Glucose) optical-probe guided tumor monitoring was performed to delineate the size and extent of metastasized tumor. Significant (PBRM270 significantly (PBRM270 can effectively inhibit proliferation and induce apoptosis in hepatoma cells by down-regulating CyclinD1/Bcl2 mediated c-Jun apoptotic pathway. Copyright © 2017. Published by Elsevier Masson SAS.

  10. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  11. MCSE Core Elective Exams in a Nutshell Covers exams 70-270, 70-297, and 70-298

    CERN Document Server

    Bhardwaj, Pawan

    2006-01-01

    For Windows XP and Windows Server 2003 administrators preparing forMicrosoft Certified Systems Engineer (MCSE) core exam 70-270, and core exams 70-297, and 70-298, this book is invaluable. Not only does it provide the resources you need to succeed on the exams, but to succeed in the real world as well. Think of this book as the notes you would have taken if you were to capture every essential nugget of information related to the skills measured in the core elective exams. To begin with, MCSE Core Elective Exams in a Nutshell allows you to see all of the topics expected for mastery in each

  12. [Treatment of mallet finger with dorsal nail glued splint: retrospective analysis of 270 cases].

    Science.gov (United States)

    Facca, S; Nonnenmacher, J; Liverneaux, P

    2007-11-01

    Management of mallet finger is both difficult and controversial. Sequelae are not uncommon, particularly after surgical treatment. Many authors advocate orthopedic treatment which is less invasive but requires greater patient participation to implement. Despite the large number of orthopedic methods proposed, none has proven superiority. We report here our experience with a dorsal adhesive splint which preserves digital pulp function and improves observance. This retrospective analysis included 270 mallet fingers presenting 153 tendon injuries and 117 bony injuries in 265 patients aged 42 years on average and treated from 2003 to 2005. Most of the tendon injuries involved the medius (38.7%) and most of the bony injuries involved the ring finger (35.4%). A splint was fashioned for the two distal phalanges and glued to the nail plate filed for this purpose. The splint was fashioned out of an L-shaped plastic sheet of thermo-malleable plastic dipped in hot water (60 degrees C). The L was molded to the dorsal aspect of the phalanges and rolled like a ring around the second phalanx, then glued to the nail. The splint was worn for eight weeks by patients with a tendon injury and six weeks for those with a bony injury. The splint was then worn at night for two weeks. Three criteria were used to analyze outcome: residual extension deficit, joint involvement, complications. Mean follow-up was 18 months. Mean time from trauma to definitive installation of the splint was six days. The complication rate for this orthopedic method was 14.3%, complications being observed in 6% of patients. All complications were transient except for one case of swan neck deformity and one case of painful osteoarthritis. Thirty splints (11%) became unglued but were all reinstalled using the same protocol. Thirty fingers (14%) presented residual deficit of active extension measuring less than 20 degrees. The quality of the result depended on the type of injury: tendon injuries led to extension

  13. Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.

    Directory of Open Access Journals (Sweden)

    Alexander Belyy

    Full Text Available Clostridium perfringens iota toxin is a binary toxin composed of the enzymatically active component Ia and receptor binding component Ib. Ia is an ADP-ribosyltransferase, which modifies Arg177 of actin. The previously determined crystal structure of the actin-Ia complex suggested involvement of Asp179 of actin in the ADP-ribosylation reaction. To gain more insights into the structural requirements of actin to serve as a substrate for toxin-catalyzed ADP-ribosylation, we engineered Saccharomyces cerevisiae strains, in which wild type actin was replaced by actin variants with substitutions in residues located on the Ia-actin interface. Expression of the actin mutant Arg177Lys resulted in complete resistance towards Ia. Actin mutation of Asp179 did not change Ia-induced ADP-ribosylation and growth inhibition of S. cerevisiae. By contrast, substitution of Glu270 of actin inhibited the toxic action of Ia and the ADP-ribosylation of actin. In vitro transcribed/translated human β-actin confirmed the crucial role of Glu270 in ADP-ribosylation of actin by Ia.

  14. [The new gene encoding TrfA-type replication initiator has been found on caprolactam/salicylate degradation plasmid pBS270].

    Science.gov (United States)

    Volkova, O V; Panov, A V; Kosheleva, I A; Esikova, T Z; Boronin, A M

    2013-01-01

    The mini-replicon of pseudomonads' caprolactam/salicylate degradation plasmid pBS270 (105 kb, contains incompatibility determinants of P-7 group) has been obtained and its nucleotide sequence has been determined. The new gene encoding TrfA-like replication initiator has been found on this replicon. Poor homology of this replication initiator with known proteins of TrfA-family allows us to classify obtained replicon as IncP-1-like. The pBS270mini reveals chimeric nature.

  15. Event-related potential N270 delayed and enhanced by the conjunction of relevant and irrelevant perceptual mismatch.

    Science.gov (United States)

    Bennett, Matthew A; Duke, Philip A; Fuggetta, Giorgio

    2014-05-01

    Event-related potential studies using delayed match-to-sample tasks have demonstrated the presence of two components, N270 and N400, possibly reflecting the sequential processing of multiple sources of endogenous mismatch. To date, studies have only investigated mismatch between a single cue and target. In this study, we used distractor stimuli to investigate the effect of a secondary source of mismatch distinct from the task-relevant stimulus. Subjects performed two paradigms in which the cue and target could match or mismatch. In one paradigm, task-irrelevant distractors were added--producing a source of task-irrelevant perceptual mismatch. A mismatch-triggered negativity was elicited in both paradigms, but was delayed and enhanced in magnitude in the distractors present paradigm. It is suggested that the distractors may differentially affect mismatch responses through the generation of a task-irrelevant mismatch response. Copyright © 2014 Society for Psychophysiological Research.

  16. Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

    International Nuclear Information System (INIS)

    Janek, M.; Saito, T.; Hatano, M.; Kato, H.; Sakoda, S.; Uchigashima, N.; Yako, K.; Ladygin, V.P.; Isupov, A. Yu.; Ladygina, N.B.; Malakhov, A.I.; Reznikov, S.G.; Vasiliev, T.A.; Uesaka, T.; Maeda, Y.; Suda, K.; Nishikawa, J.; Ohnishi, T.; Sakamoto, N.; Sekiguchi, K.; Okamura, H.; Sakai, H.

    2007-01-01

    The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd → 3 Hen obtained at T d =270 MeV in the angular range 0 -110 in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrate the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m. (orig.)

  17. Deep neck space infection – A retrospective study of 270 cases at tertiary care center

    Directory of Open Access Journals (Sweden)

    Atishkumar B. Gujrathi

    2016-12-01

    Full Text Available Objective: To review the clinical findings in deep neck infections and identification predisposing factors of these complications. Methods: In this study, 270 patients with deep neck infections were studied retrospectively, study conducted in the Department of Ear, Nose and Throat, Dr. Shankarrao Chavan Government Medical College, Nanded, Maharashtra, India, from March 2013 to March 2016. Results: Analysis showed that males are most likely to have deep neck space infections (DNSI. Odontogenic and tonsillar causes were the more frequent ones. Staphylococcus aureus and Streptococcus species were the microorganisms more commonly isolated. Conclusion: DNSI remains a common and challenging disease for otorhinolaryngologists, and should be treated on emergency basis. In developing countries, lack of adequate nutrition, poor oral hygiene, tobacco chewing, smoking and beetle nut chewing has led to an increased prevalence of dental and periodontal diseases. In present study, Odontogenic infections were the most common etiological factor for DNSI. Keywords: Deep neck space infection, Incision and drainage, Odontogenic infections, Tracheotomy

  18. 17 CFR 270.6c-8 - Exemptions for registered separate accounts to impose a deferred sales load and to deduct certain...

    Science.gov (United States)

    2010-04-01

    ... AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.6c-8 Exemptions for registered separate accounts... such sales load imposed, when added to any sales load previously paid on such contract, shall not... the value of any variable annuity contract participating in such account, upon total redemption of the...

  19. 17 CFR 270.2a51-1 - Definition of investments for purposes of section 2(a)(51) (definition of “qualified purchaser...

    Science.gov (United States)

    2010-04-01

    ... AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a51-1 Definition of investments for purposes of... the rules under the Commodity Exchange Act . (2) The term Family Company means a company described in... company, a company that would be an investment company but for the exclusions provided by sections 3(c)(1...

  20. 17 CFR 270.12d3-1 - Exemption of acquisitions of securities issued by persons engaged in securities related businesses.

    Science.gov (United States)

    2010-04-01

    ..., the acquiring company has invested not more than five percent of the value of its total assets in the..., INVESTMENT COMPANY ACT OF 1940 § 270.12d3-1 Exemption of acquisitions of securities issued by persons engaged... investment company, or any company or companies controlled by such registered investment company (“acquiring...

  1. 17 CFR 270.2a19-3 - Certain investment company directors not considered interested persons because of ownership of...

    Science.gov (United States)

    2010-04-01

    ... directors not considered interested persons because of ownership of index fund securities. 270.2a19-3... considered interested persons because of ownership of index fund securities. If a director of a registered... investment objective to replicate the performance of one or more broad-based securities indices (“Index Fund...

  2. 20 CFR 662.270 - How are the costs of providing services through the One-Stop delivery system and the operating...

    Science.gov (United States)

    2010-04-01

    ... through the One-Stop delivery system and the operating costs of the system to be funded? 662.270 Section... and the operating costs of the system to be funded? The MOU must describe the particular funding arrangements for services and operating costs of the One-Stop delivery system. Each partner must contribute a...

  3. Beam Cherenkov counter conception for in line identification of 270 GeV/c Σ- Ξ- and Ω-

    International Nuclear Information System (INIS)

    Touillon, R.

    1991-06-01

    The purpose of this thesis is to design a beam Cerenkov counter. This counter will provide an on line identification of the Σ - , Ξ - and Ω - hyperons (270 GeV/c) in the experiment WA89 at CERN. The acceptance of the detector should allow tagging these hyperons in a large momentum range (± 25%) and for a beam divergence up to 250 microrad. The first part of this report is devoted to the physical goals such as the study of charmed baryons, the search of multiquark states, and the determination of hadronic and electromagnetic hyperon radii. The experimental WA89 setup is also presented. The major part deals with the design of the Cerenkov counter. The dimension of the detector, the Cerenkov angle value, the focal length of the spherical mirror, etc... are derived from a Monte-Carlo simulation. Various methods of simple photon detection (gaz detector: TEA, TMAE; solid detectors: PM and Image Intensifier) are investigated. The most performing solution uses two conical mirrors in order to reduce the size of the Cerenkov circles and an image intensifier (which detects the single photon) followed by an optical fiber matrix transmitting the luminous signal to 160 photomultipliers. The on line procedure for calculating the radius of each circle (identification of the particle) is studied in detail. Finally, the optimization of the optical system to achromatize the Cerenkov light is discussed [fr

  4. VBFNLO: A parton level Monte Carlo for processes with electroweak bosons -- Manual for Version 2.7.0

    CERN Document Server

    Baglio, J.; Bozzi, G.; Brieg, M.; Campanario, F.; Englert, C.; Feigl, B.; Frank, J.; Figy, T.; Geyer, F.; Hackstein, C.; Hankele, V.; Jager, B.; Kerner, M.; Kubocz, M.; Ninh, L.D.; Oleari, C.; Palmer, S.; Platzer, S.; Rauch, M.; Roth, R.; Rzehak, H.; Schissler, F.; Schlimpert, O.; Spannowsky, M.; Worek, M.; Zeppenfeld, D.

    2011-01-01

    VBFNLO is a flexible parton level Monte Carlo program for the simulation of vector boson fusion (VBF), QCD induced single and double vector boson production plus two jets, and double and triple vector boson production (plus jet) in hadronic collisions at next-to-leading order (NLO) in the strong coupling constant, as well as Higgs boson plus two jet production via gluon fusion at the one-loop level. For the new version -- Version 2.7.0 -- several major enhancements have been included into VBFNLO. The following new production processes have been added: $W\\gamma jj$ in VBF, $HHjj$ in VBF, $W$, $Wj$, $WH$, $WHj$, $pp\\to \\text{Spin-2}jj$ in VBF (with $\\text{Spin-2}\\to WW/ZZ\\to\\text{leptons}$) and the QCD induced processes $WZjj$, $W\\gamma jj$, $W^\\pm W^\\pm jj$ and $Wjj$ production. The implementation of anomalous gauge boson couplings has been extended to all triboson and VBF $VVjj$ processes, with an enlarged set of operators yielding anomalous couplings. Finally, semileptonic decay modes of the vector bosons ar...

  5. The novel inhibitor BRM270 downregulates tumorigenesis by suppression of NF-κB signaling cascade in MDR-induced stem like cancer-initiating cells.

    Science.gov (United States)

    Mongre, Raj Kumar; Sodhi, Simrinder Singh; Ghosh, Mrinmoy; Kim, Jeong Hyun; Kim, Nameun; Park, Yang Ho; Kim, Sung Jin; Heo, Yoo Jeong; Sharma, Neelesh; Jeong, Dong Kee

    2015-01-01

    The nuclear factor κB (NF-κB) and interleukin-6 (IL-6) contribute to multidrug resistance (MDR) in tumor chemotherapy. The essential phenomenon of oncogenic activation of NF-κB in cancer-initiating cells showing MDR resulting from increased IL-6 expression is still unclear. Cancer stem cells (CSCs) have been the objective of intensive study. The aim of this study was to investigate the selective and potential efficacy of BRM270 against stem-like cancer-initiating cells (SLCICs) via the molecular mechanisms of its anticancer effects. Co-regulation of NF-κB and Cdk6 might be new arena to mitigate tumorigenesis. In the present study phyto-drug based approach provides a new avenue in understanding the amelioration and regulatory mechanisms in CSCs. In the present study, an in vivo tumor metastasis model of osteosarcoma was established by injecting Cal72 and SaOS-2 SLCICs into the right lower flank of nude mice. Later the development of tumor was analyzed by LICOR Biosciences (Pearl image analyzer). Significant suppression of activation of NF-κB and LPS-induced gene expression and apoptosis by BRM270 was confirmed by FACS, western blotting and qPCR. Further, both p65 and Cdk6 were significantly (PBRM270 non-treated Cal72 SLCICs compared to treated group. BRM270 directly dephosphorylated RelA and selectively inhibited NF-κB transcriptional activity, resulting in decreased expression of interleukin-6, a cytokine implicated in cancer metastasis. BRM270-mediated cell shrinkage, pyknosis, karyorrhexis and programmed cell death (PCD) were observed by Hoechst 33342 staining while flow cytometry analysis showed significant (P<0.05) decrease in cell population from G0-G1 phases. These findings suggest that activation of the oncogenic Cdk6-NF-κB pathway, resulting from increased IL-6 expression, plays a central role in CD133 expressing SLCICs augmented MDR and neoplasia. This study proposes targeting of NF-κB, and Cdk6 with IL-6 as potential targets for PCD and treatment

  6. Potential Interference to the Deep Space Network Stations in Spain from NPOESS in the 25.5- to 27.0-GHz Band

    Science.gov (United States)

    Tsou, H.

    2008-08-01

    A new Instituto Nacional de Tecnica Aeroespacial (INTA) station, located about 70 km east of the Deep Space Network (DSN) Madrid complex (Robledo), is planned to support National Polar-orbiting Operational Environmental Satellite System (NPOESS) satellites. The 26.7-GHz NPOESS Ka-band downlink to this proposed station can potentially interfere with the DSN Madrid station that may support the future lunar and Sun-Earth Lagrange point missions operating in the 25.5- to 27.0-GHz band. A preliminary compatibility analysis has been conducted to assess the potential impact to the DSN Madrid complex from the NPOESS Ka-band downlink to the planned INTA station.

  7. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

    Science.gov (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

    2014-05-02

    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  8. Prevalence of and risk factors associated with cesarean section in Lebanon - A retrospective study based on a sample of 29,270 women.

    Science.gov (United States)

    Zgheib, Sandy M; Kacim, Mohammad; Kostev, Karel

    2017-12-01

    During the last decades, there has been an alarming and dramatic increase in the number of cesarean births in both developed and undeveloped countries. This increase has not been clinically justified but, nevertheless, has raised an important number of issues. The aim of this study was to determine the risk factors associated with the high cesarean section rates in Lebanon. This study is based on a sample of 29,270 Lebanese women who were pregnant between 2000 and 2015. Among these, 14,327 gave birth by cesarean section and 14,943 gave birth vaginally. To identify the risk factors of cesarean section, logistic regression was applied as a statistical method using the SPSS statistical package. Of the 29,270 pregnant women included in the study, 49% had cesarean sections while 51% gave birth vaginally. Repeat cesarean section accounted for 23% while vaginal birth after cesarean accounted for only 0.2% of deliveries. In addition, weekdays were associated with a preference of providers to carry out more cesarean sections. According to an analysis of our data using logistic regression, the risk factors associated with the increase in cesarean section rates were advanced maternal age, elective cesarean section, malpresentation of fetus, multiple birth, prolonged pregnancy, prolonged labor, and fetal distress. Based on these results, it is recommended that a new health policy be implemented to reduce the number of unnecessary cesarean deliveries in Lebanon. Copyright © 2017 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  9. Interaction between GPR120 p.R270H loss-of-function variant and dietary fat intake on incident type 2 diabetes risk in the D.E.S.I.R. study.

    Science.gov (United States)

    Lamri, A; Bonnefond, A; Meyre, D; Balkau, B; Roussel, R; Marre, M; Froguel, P; Fumeron, F

    2016-10-01

    GPR120 (encoded by FFAR4) is a lipid sensor that plays an important role in the control of energy balance. GPR120 is activated by long chain fatty acids (FAs) including omega-3 FAs. In humans, the loss of function p.R270H variant of the gene FFAR4 has been associated with a lower protein activity, an increased risk of obesity and higher fasting plasma glucose levels. The aim of this study was to investigate whether p.R270H interacts with dietary fat intake to modulate the risk of type 2 diabetes (T2D, 198 incident; 368 prevalent cases) and overweight (787 incident and 2891 prevalent cases) in the prospective D.E.S.I.R. study (n = 5,212, 9 years follow-up). The association of p.R270H with dietary fat and total calories was assessed by linear mixed models. The interaction between p.R270H and dietary fat on T2D and overweight was assessed by logistic regression analysis. The p.R270H variant had a minor allele frequency of 1.45% and was not significantly associated with total calories intake, fat intake or the total calories derived from fat (%). However, there was a significant interaction between p.R270H and dietary fat modulating the incidence of T2D (Pinteraction = 0.02) where the H-carriers had a higher risk of T2D than RR homozygotes in the low fat intake category only. The interaction between p.R270H and fat intake modulating the incidence and prevalence of overweight was not significant. The p.R270H variant of GPR120 modulates the risk of T2D in interaction with dietary fat intake in the D.E.S.I.R. Copyright © 2016 The Italian Society of Diabetology, the Italian Society for the Study of Atherosclerosis, the Italian Society of Human Nutrition, and the Department of Clinical Medicine and Surgery, Federico II University. Published by Elsevier B.V. All rights reserved.

  10. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  11. Thermally activated proton hopping in lawsonite, the ferroelectric transition at 125 K, and the co-elastic phase transition at 270 K

    International Nuclear Information System (INIS)

    Salje, E K H; Carpenter, M A

    2011-01-01

    Lawsonite, CaAl 2 Si 2 O 7 (OH) 2 H 2 O, is a novel ferroelectric material which is dominated by ordering and disordering of protons. We report related elastic anomalies in lawsonite. A new approach to extracting acoustic data from resonant ultrasonic spectroscopy has been applied to investigate the ordering and disordering of protons. This approach is based on analysis of entire spectra, rather than the more conventional fitting of individual resonance peaks and captures three features of the transitions. Firstly, structural disorder of protons persists down to low temperatures. Secondly, the structural transition between two paraelectric phases near 270 K is mainly of the order/disorder type but is not directly coupled to the proton mobility. Thirdly, the ferroelectric transition at 125 K shows a direct link with the proton mobility with an activation energy of 0.03 eV. The latter transition occurs in the large class of ferroelectric crystals where the molecular groups are linked by hydrogen and its thermodynamic potential is almost identical to that of KDP (KH 2 PO 4 ), albeit with a smaller isotope effect. While some damping is seen in small temperature intervals below the transition points, these anomalies are much smaller than those that occur at ferroelastic phase transitions. (fast track communication)

  12. Genetic variation in the serotonin 2A receptor and suicidal ideation in a sample of 270 Irish high-density schizophrenia families.

    Science.gov (United States)

    Fanous, Ayman H; Chen, Xiangning; Wang, Xu; Amdur, Richard; O'Neill, F Anthony; Walsh, Dermot; Kendler, Kenneth S

    2009-04-05

    Genetic variation in the serotonin 2A receptor (HTR2A) has been associated with both schizophrenia and suicidal behavior. Our sample comprised 270 Irish high-density schizophrenia families (n = 1,408 subjects, including 755 with psychotic illness). Diagnoses were generated using a modified SCID. All patients who had at least one episode of psychosis were rated on the Operation Criteria Checklist for Psychotic Illness (OPCRIT). Lifetime history of suicidal ideation was determined from medical records and psychiatric interviews and was scored in the OPCRIT. Twelve SNPs were selected for study. Ten of these were tagSNPs derived from HapMap data, along with His452Tyr and T102C. We tested for association with psychotic illness as a whole, as well as stratified by the presence of suicidal ideation, using FBAT and PDTPHASE. Single-marker as well as haplotype-based tests using a "sliding window" approach were performed. We observed several 2, 3, and 4 marker haplotypes near the 3' end of the gene that were over-transmitted to psychotic subjects (0.02 suicidal ideation. Because of multiple testing, these results do not provide support for HTR2A as a susceptibility gene for psychotic illness, or for suicidal ideation within psychotic illness. (c) 2008 Wiley-Liss, Inc.

  13. Excess Mortality, Causes of Death and Life Expectancy in 270,770 Patients with Recent Onset of Mental Disorders in Denmark, Finland and Sweden

    Science.gov (United States)

    Nordentoft, Merete; Wahlbeck, Kristian; Hällgren, Jonas; Westman, Jeanette; Ösby, Urban; Alinaghizadeh, Hassan; Gissler, Mika; Laursen, Thomas Munk

    2013-01-01

    Background Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations. Objective To investigate the excess mortality in different diagnostic categories due to suicide and other external causes of death, and due to specific causes in connection with diseases and medical conditions. Methods In longitudinal national psychiatric case registers from Denmark, Finland, and Sweden, a cohort of 270,770 recent-onset patients, who at least once during the period 2000 to 2006 were admitted due to a psychiatric disorder, were followed until death or the end of 2006. They were followed for 912,279 person years, and 28,088 deaths were analyzed. Life expectancy and standardized cause-specific mortality rates were estimated in each diagnostic group in all three countries. Results The life expectancy was generally approximately 15 years shorter for women and 20 years shorter for men, compared to the general population. Mortality due to diseases and medical conditions was increased two- to three-fold, while excess mortality from external causes ranged from three- to 77-fold. Mortality due to diseases and medical conditions was generally lowest in patients with affective disorders and highest in patients with substance abuse and personality disorders, while mortality due to suicide was highest in patients with affective disorders and personality disorders, and mortality due to other external causes was highest in patients with substance abuse. Conclusions These alarming figures call for action in order to prevent the high mortality. PMID:23372832

  14. Lessons from Iowa : development of a 270 megawatt compressed air energy storage project in midwest Independent System Operator : a study for the DOE Energy Storage Systems Program.

    Energy Technology Data Exchange (ETDEWEB)

    Holst, Kent (Iowa Stored Energy Plant Agency, Traer, IA); Huff, Georgianne; Schulte, Robert H. (Schulte Associates LLC, Northfield, MN); Critelli, Nicholas (Critelli Law Office PC, Des Moines, IA)

    2012-01-01

    The Iowa Stored Energy Park was an innovative, 270 Megawatt, $400 million compressed air energy storage (CAES) project proposed for in-service near Des Moines, Iowa, in 2015. After eight years in development the project was terminated because of site geological limitations. However, much was learned in the development process regarding what it takes to do a utility-scale, bulk energy storage facility and coordinate it with regional renewable wind energy resources in an Independent System Operator (ISO) marketplace. Lessons include the costs and long-term economics of a CAES facility compared to conventional natural gas-fired generation alternatives; market, legislative, and contract issues related to enabling energy storage in an ISO market; the importance of due diligence in project management; and community relations and marketing for siting of large energy projects. Although many of the lessons relate to CAES applications in particular, most of the lessons learned are independent of site location or geology, or even the particular energy storage technology involved.

  15. Renal safety in pediatric imaging: randomized, double-blind phase IV clinical trial of iobitridol 300 versus iodixanol 270 in multidetector CT

    Energy Technology Data Exchange (ETDEWEB)

    Zo' o, Martin; Dosseur, Patrick Le [CHU Charles Nicolle, Radiology Department, Rouen (France); Hoermann, Marcus; Balassy, Csilla [AKH, Radiology Department, Vienna (Austria); Brunelle, Francis [Necker Hospital, Radiopediatry Department, Paris (France); Azoulay, Robin [Robert Debre Hospital, Radiopediatry Department, Paris (France); Pariente, Daniele [Kremlin-Bicetre Hospital, Radiopediatry Department, Kremlin-Bicetre (France); Panuel, Michel [Nord Hospital, Medical Imaging Department, Marseille (France)

    2011-11-15

    It is debated whether iso-osmolar and low-osmolar contrast media are associated with different incidences of contrast medium-induced nephropathy (CIN) in patients with renal insufficiency. To compare the incidence of CIN in children undergoing contrast-enhanced multidetector computer tomography (MDCT) with intravenous injection of low-osmolar (iobitridol, Xenetix {sup registered} 300) or an iso-osmolar (iodixanol, Visipaque {sup registered} 270) iodinated contrast medium. One hundred forty-six children with normal renal function were included in this multicenter trial and underwent contrast-enhanced MDCT. The primary endpoint was the relative change in creatinine clearance from 48 h pre- to 72 h postcontrast medium administration using a noninferiority analysis in the intent-to-treat (ITT, n = 128) and per protocol (n = 68) populations. Secondary endpoints were incidence of CIN, global image quality, diagnostic efficacy and clinical safety. In the ITT population, the noninferiority of iobitridol over iodixanol was demonstrated. CIN incidence was 4.8% (three cases) with iobitridol and 10.6% (seven cases) with iodixanol (not significant). No statistically significant differences were observed for the secondary endpoints. Comparable satisfactory safety profiles were confirmed for both contrast media, with no significant difference in the incidence of CIN in children with normal renal function. (orig.)

  16. Phase Change Material Selection for Thermal Energy Storage at High Temperature Range between 210 °C and 270 °C

    Directory of Open Access Journals (Sweden)

    José Miguel Maldonado

    2018-04-01

    Full Text Available The improvement of thermal energy storage systems implemented in solar technologies increases not only their performance but also their dispatchability and competitiveness in the energy market. Latent heat thermal energy storage systems are one of those storing methods. Therefore, the need of finding the best materials for each application becomes an appealing research subject. The main goal of this paper is to find suitable and economically viable materials able to work as phase change material (PCM within the temperature range of 210–270 °C and endure daily loading and unloading processes in a system with Fresnel collector and an organic Rankine cycle (ORC. Twenty-six materials have been tested and characterized in terms of their thermophysical conditions, thermal and cycling stability, and health hazard. Two materials out of the 26 candidates achieved the last stage of the selection process. However, one of the two finalists would require an inert working atmosphere, which would highly increase the cost for the real scale application. This leads to a unique suitable material, solar salt (40 wt % KNO3/60 wt % NaNO3.

  17. Comparison in myelography between iodixanol 270 and 320 mgI/ml and iotrolan 300 mgI/ml: a multicentre, randomised, parallel-group, double-blind, phase III trial

    International Nuclear Information System (INIS)

    Palmers, Yvan; Kuhn, Fritz-Peter; Petersen, Dirk; De Greef, Danielle

    2002-01-01

    The objective of the trial was to compare the safety and efficacy of the non-ionic, dimeric, isotonic contrast medium iodixanol (Visipaque 270 and 320 mgI/ml) with those of iotrolan (Isovist 300 mgI/ml) in myelography. After lumbar or cervical puncture, 315 patients were examined in a multicentre, double-blind, randomised, comparative myelography study. Image quality, changes in vital signs, immediate and delayed adverse events were registered. There was a tendency for better images with iodixanol 320 than with iodixanol 270 and iotrolan 300, but the overall quality was good or excellent with all products. The frequency of patients reporting adverse events and headache varied much across centres, but there was no statistically significant difference between the contrast media. The incidence of events was higher after lumbar puncture than after cervical puncture, in women rather than in men, and after puncture with a 22-gauge (G) bevel-tipped needle compared with a 24 G Sprotte needle. The frequency of headache did not correlate with the absence of pathology. The higher iodine concentration in iodixanol 320 could be an advantage for film quality. When compared with iotrolan 300, iodixanol 320 and 270 give similar incidences of adverse events, including headache. (orig.)

  18. International prognostic index (IPI)--a critical comparison with five multiple myeloma staging systems in the group of 270 patients treated by conventional chemotherapy.

    Science.gov (United States)

    Scudla, V; Zemanova, M; Minarik, J; Bacovsky, J; Ordeltova, M; Indrak, K; Budikova, M; Dusek, L; Farbiakova, V

    2006-01-01

    In the group of 270 patients with multiple myeloma (MM) treated during 1991-2004 by conventional chemotherapy, the prognostic value and practical utility of IPI (International Prognostic Index) was assessed and compared with five other actual staging systems. Prognostic significance was assessed using the curves of overall survival (OS) according to Kaplan-Meier and log rank test (pIPI (pIPI (median OS 77, 76 and 77 months). To select a cohort of "high risk" patients, i.e. stage 3, with very unfavourable disease prognosis, the most advantageous was the system OSS and San Miguel (median OS was 5 and 6 months) and/or SWOG system selecting patients of stage 4, i.e. "worst prognosis", with median OS 8 months. It was found that IPI did not meet expectations for effective identification of "high risk" patients (median OS of stage 3 was 20 months) nor for the distinction of different prognosis of patients during initial 25 months of MM course at stage 2 vs. 3. The study indicates that under conditions of common clinical practice and conventional chemotherapy, the staging system according to D-S is still useful, while practical application of SWOG and IPI as simpler alternative to the assessment of clinical stage should be verified by further comparative studies. In harmony with the progress in cytogenetics and molecular biology as well as a prospective requirement of individual target therapy, a future suitable stratification system should be based on parameters of internal biological properties of myeloma tissue and microenvironment of bone marrow, allowing in addition a continuous evaluation of the disease course and the effect of therapy.

  19. Prevalence of pain medication prescriptions in France, Germany, and the UK - a cross-sectional study including 4,270,142 patients.

    Science.gov (United States)

    Jacob, Louis; Kostev, Karel

    2018-01-01

    The goal of the present study was to analyze the prevalence of pain medication prescriptions in general practices in France, Germany, and the UK. This study included all patients aged ≥18 years followed in 2016 in general practitioner practices in France, Germany and the UK. The primary outcome was the prevalence of patients receiving prescriptions for pain medications in France, Germany, and the UK in 2016. The following drugs were included in the analysis: anti-inflammatory and antirheumatic products, non-steroids and analgesics including opioids, antimigraine preparations, and other analgesics and antipyretics. Demographic variables included age and gender. This study included 4,270,142 patients. The prevalences of pain medication prescriptions were 57.3% in France, 29.6% in Germany, and 21.7% in the UK. Although this prevalence generally remained consistent between age groups in France (54.3%-60.3%), it increased with age in Germany (18-30 years: 23.8%; >70 years: 35.8%) and in the UK (18-30 years: 9.3%; >70 years: 43.8%). Finally, the prevalence of pain medication prescriptions was higher in women than in men in all three countries. Paracetamol was prescribed to 82.3% and 60.1% of patients receiving pain medication in France and the UK, respectively, whereas ibuprofen was prescribed to 46.5% of individuals in Germany. The prevalence of pain medication prescriptions was higher in France than in Germany and the UK. Further research is needed to gain a better understanding of the differences in the prescription patterns between these three European countries.

  20. Epigenetic induction of epithelial to mesenchymal transition by LCN2 mediates metastasis and tumorigenesis, which is abrogated by NF-κB inhibitor BRM270 in a xenograft model of lung adenocarcinoma.

    Science.gov (United States)

    Mongre, Raj Kumar; Sodhi, Simrinder Singh; Sharma, Neelesh; Ghosh, Mrinmoy; Kim, Jeong Hyun; Kim, Nameun; Park, Yang Ho; Shin, Young Gyu; Kim, Sung Jin; Jiao, Zhang Jiao; Huynh, Do Luong; Jeong, Dong Kee

    2016-01-01

    Tumor initiating cancer stem-like cells (TICSCs) have recently become the object of intensive study. Human-Lipocalin-2 (hLCN2) acts as a biomarker for cancers. The aim of the present study was to explore new insights regarding the potential role of LCN2 in inducing epithelial to mesenchymal transition (EMT) by transfecting LCN2 into CD133+-A549-TICSCs and its cross-talk with the NF-κB signaling pathway in adenocarcinoma of the lung. Furthermore, EMT was confirmed by transcriptomic analysis, immunoblotting and immunocyto/histochemical analyses. Tumorigenesis and metastasis were confirmed by molecular therapeutics tracer 2DG infrared optical probe in BALB/cSIc-nude mice. It was observed that the CD133+-expressing-LCN2-A549 TICSCs population increased in adenocarcinoma of the lung compared to the normal lung tissue. The expressions of genes involved in stemness, adhesion, motility and drug efflux was higher in these cells than in their non-LCN2 expressing counterparts. The present study revealed that elevated expression of LCN2 significantly induced metastasis via EMT. Overexpression of LCN2 significantly increased stemness and tumor metastasis by modulating NF-κB cellular signaling. BRM270, a novel inhibitor of NF-κB plays a significant role in the EMT reversal. BRM270, a naturaceutical induces cell shrinkage, karyorrhexis and programmed cell death (PCD) which were observed by Hoechst 33342 staining while flow cytometry analysis showed significant (PBRM270 as a novel cancer therapeutic drug to enhance the effect of doxorubicin (Dox)-resistant LCN2 induced metastasis of solid tumors in nude mice.

  1. Tensor analyzing power T20 of the dd →3Hen and dd →3Hp reactions at zero angle for energies 140, 200, and 270 MeV

    International Nuclear Information System (INIS)

    Ladygin, V. P.; Uesaka, T.; Saito, T.; Hatano, M.; Isupov, A. Yu.; Kato, H.; Ladygina, N. B.; Maeda, Y.; Malakhov, A. I.; Nishikawa, J.; Ohnishi, T.; Okamura, H.; Reznikov, S. G.; Sakai, H.; Sakamoto, N.; Sakoda, S.; Satou, Y.; Sekiguchi, K.; Suda, K.; Tamii, A.

    2006-01-01

    RIKEN Accelerator Research Facility data on the tensor analyzing power T 20 of the dd → 3 Hen and dd → 3 Hp reactions at zero angle for deuteron kinetic energies of 140, 200, and 270 MeV are reported. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S-wave ratio in the 3 He and 3 H wave functions in the energy range of the experiment. Data on T 20 for the 3 Hen channel are in agreement with those for the 3 Hp channel within the experimental errors

  2. The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV at zero angle

    International Nuclear Information System (INIS)

    Ladygin, V.P.; ); Uesaka, T.; Saito, T.

    2006-01-01

    The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero angle obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 Hen and 3 Hp channels are in agreement within experimental accuracy [ru

  3. Glueballs amass at the RHIC and LHC! The early quarkless first-order phase transition at T = 270 MeV—from pure Yang-Mills glue plasma to Hagedorn glueball states

    Science.gov (United States)

    Stoecker, Horst; Zhou, Kai; Schramm, Stefan; Senzel, Florian; Greiner, Carsten; Beitel, Maxim; Gallmeister, Kai; Gorenstein, Mark; Mishustin, Igor; Vasak, David; Steinheimer, Jan; Struckmeier, Juergen; Vovchenko, Volodymyr; Satarov, Leonid; Xu, Zhe; Zhuang, Pengfei; Csernai, Laszlo P.; Sinha, Bikash; Raha, Sibaji; Sándor Biró, Tamás; Panero, Marco

    2016-08-01

    The early stage of a high multiplicity pp, pA and AA collisions is represented by a nearly quarkless, hot, deconfined pure gluon plasma. According to pure Yang-Mills lattice gauge theory, this hot pure glue matter undergoes, at a high temperature, {T}c=270 {{MeV}}, a first-order phase transition into a confined Hagedorn glueball fluid. This new scenario should be characterized by a suppression of high p T photons and dileptons, baryon suppression and enhanced strange meson production. We propose to observe this newly predicted class of events at the Large Hadron Collider and the Relativistic Heavy-Ion Collider.

  4. LEGAL AID AS SEEN IN THE LIGHT OF THE LAW NO. 270/2010 REGARDING THE AMENDMENT AND THE COMPLETION OF THE LAW NO. 51/1995 FOR THE ORGANIZATION AND THE PRACTICE OF THE LAWYER’S PROFESSION

    Directory of Open Access Journals (Sweden)

    STEFAN NAUBAUER

    2011-04-01

    Full Text Available According to the explanatory memorandum of the Government as well as to the favorable opinion of the Legislative Council, the Law no. 270/2010 relate mainly to the correlation the OUG no. 51/2008 on legal aid in civil matters, by covering in detail the circumstances and the conditions for granting legal aid as well as the organization of the activity of granting such assistance. From the perspective of European law, the Legislative Council appreciated that the new law is placed within the sphere of the legislation as regulated at the European Union level, that are circumscribed to the European Area of freedom, security and justice, within the European legislation reserved to the judicial cooperation in civil matters.In this material we will analyze the following issues: granting legal aid in criminal matters, in which defense is mandatory according to the dispositions in the Criminal Procedural Code; granting legal aid in any other causes except criminal ones, as modality to grant public legal aid, according to the law; legal aid throughout a lawyer, granted at the request of the organs of the local public administration; appointing the lawyer for legal aid; extra-judiciary legal aid; competences of the bars regarding legal aid; the department for the coordination of legal aid; services of legal aid; legal aid registry; payment for the activity of legal aid and extra-judiciary legal aid.

  5. Accurate and precise lattice parameters of H2O and D2O ice Ih between 1.6 and 270 K from high-resolution time-of-flight neutron powder diffraction data.

    Science.gov (United States)

    Fortes, A Dominic

    2018-04-01

    Accurate and precise lattice parameters for D 2 O and H 2 O varieties of hexagonal ice (ice Ih, space group P6 3 /mmc) have been obtained in the range 1.6 to 270 K. Precision of the lattice parameters (∼0.0002% in a and 0.0004% in c for D 2 O, 0.0008% in a and 0.0015% in c for H 2 O) is ensured by use of the time-of-flight method on one of the longest primary neutron flight-path instruments in the world, the High-Resolution Powder Diffractometer at the ISIS neutron source. These data provide a more precise description of the negative thermal expansion of the material at low temperatures than the previous synchrotron `gold standard' [Röttger et al. (1994). Acta Cryst. B50, 644-648], including the region below 10 K where the lattice parameters saturate. The volume expansivity of both isotopologues turns negative below 59-60 K, in excellent agreement with a recent dilatometry study. The axial expansivities are highly isotropic (differing by < 1% in D 2 O ice Ih). Furthermore, the c/a ratio of different D 2 O ice samples exhibit a statistically significant dispersion of ∼0.015% below 150 K that appears to depend on the thermal history of the sample, which disappears on warming above 150 K. Similarly, H 2 O ice exhibits a `kink' in the c/a ratio at ∼115 K. The most plausible explanation is a freezing-in of the molecular reorientation process on cooling and subsequent relaxation on warming.

  6. Characterization of some coals and coal intercalations by high-resolution /sup 1/H (BR-24/MAS at 270 MHz) and /sup 13/ (CP/MAS) n. m. r. in solids

    Energy Technology Data Exchange (ETDEWEB)

    Rosenberger, H.; Scheler, G.; Kuenstner, E.

    1988-04-01

    High resolution /sup 1/H n.m.r. studies combining the BR-24 multiple-pulse method after BURUM and RHIM with fast magic-angle sample spinning (MAS), and high resolution solid-state /sup 13/C n.m.r. measurements with cross polarization (CP) and MAS have been used for investigating: a number of coals of different ranks; GDR soft brown coals characterized by textural differences; and typical intercalations to be found in such soft brown coals. The resolution level of /sup 1/H n.m.r. spectra achieved so far at a resonance frequency of 270 MHz permits determination of essential functional groups. The coalification series ranging from soft brown coal to anthracite shows an increase of the aromaticity values f/sub a//sup C/ and also an increase of the f..cap alpha../sup H/ values, which is analogous to the increases in reflectance and carbon content. There are marked differences between the functional groups to be found in detrital and xylite-containing soft brown coals. Tertiary (Miocene) brown coals from the 2nd Lower Lusatian seam (GDR) (i.e. unbedded, poorly bedded, bedded, xylite-containing unbedded, and gelified bedded coals) differ significantly due to variations in micropetrographical composition. Varying amounts of cellulose and lignin are contained in the xylites of the 2nd Lower Lusatian seam. /sup 13/C and /sup 1/H n.m.r. measurements are employed to determine the main constituents of substances such as pyropissite, retinite, fusite and 'monkey hairs' (fossilized rubber). 48 refs., 5 figs., 3 tabs

  7. 18 CFR 270.401 - Jurisdictional agency.

    Science.gov (United States)

    2010-04-01

    ...—Deputy State Director Resources and Science, Bureau of Land Management, Idaho State Office (931), 1387.... (15)(i) New Mexico, Northern New Mexico—Field Office Manager, Bureau of Land Management, Albuquerque Field Office (NGPA), 435 Montano Road, NE., Albuquerque, NM 87107. (ii) New Mexico, Southern New Mexico...

  8. 270-IJBCS-Article-Dr Campell Akujobi

    African Journals Online (AJOL)

    User

    2348035426409. ... It therefore, showed that poultry waste is the best organic waste to be applied .... waste (600 g). The highest count was. 8.21x107 cfu/g of soil while the lowest was. 1.02x104 cfu/g, which was obtained in the 1st week in the soil sample ...

  9. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reality check: Will cellphones really solve Africa's problems? In less than a generation, information and communication technologies (ICTs) have revolutionized the planet. Innovations like personal computers, the Internet, electronic mail, personal digital assistants (PDAs), and mobile.

  10. 18 CFR 270.101 - General definitions.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... gas produced from coal seams means naturally occurring natural gas released from entrapment from the fractures, pores and bedding planes of coal seams. (7) Natural gas produced from Devonian shale means...

  11. 18 CFR 270.201 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... jurisdictional agencies for tight formation gas, occluded natural gas produced from coal seams, and natural gas...

  12. Kas 270 rahvaraamatukogust piisab? / Ene Riet

    Index Scriptorium Estoniae

    Riet, Ene, 1954-

    2016-01-01

    Haldusreformi mõjust rahvaraamatukogude võrgule. Uuringust "Era- ja avalike teenuste ruumilise paiknemise ja kättesaadavuse tagamisest ja teenuste käsitlemisest maakonnaplaneeringute käigus" (2015)

  13. Reference: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e development of the root system with nutritional cues. The putative high-affinity nitrate transporter NRT2....1 represses lateral root initiation in response to nutritional cues. 38 13693-8 1

  14. 40 CFR 82.270 - Prohibitions.

    Science.gov (United States)

    2010-07-01

    ...: (1) Liquid injection incineration; (2) Reactor cracking; (3) Gaseous/fume oxidation; (4) Rotary kiln incineration; (5) Cement kiln; (6) Radiofrequency plasma destruction; or (7) An EPA-approved destruction...

  15. 50 CFR 270.15 - Quality standards.

    Science.gov (United States)

    2010-10-01

    ...) Quality standards must not be developed for the purpose of creating non-tariff barriers. Such standards must be compatible with U.S. obligations under the General Agreement on Tariffs and Trade, or under...

  16. 270-IJBCS-Article-Dr Campell Akujobi

    African Journals Online (AJOL)

    User

    University of Port Harcourt, 37. Seklemora E, Pavlora A, Koracheva K. 2001. Biostimulation-based bioremediation of diesel fuel field demonstration. Biodegrad., 12: 311- 316. Zhou BX, Treves DS, Wu LY, Marsh TC,. O'Neil RV, Pollumbo AV, Tiedje JM. 2002. Spatial and resource factors influencing high microbial diversity in.

  17. 21 CFR 1271.270 - Records.

    Science.gov (United States)

    2010-04-01

    ... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) REGULATIONS UNDER... electronic systems must be backed up. (d) Length of retention. You must retain all records for 10 years after... name and address and a list of the responsibilities of any establishment that performs a manufacturing...

  18. 40 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... authorized by EPA under part 271. Aquifer means a geological formation, group of formations, or part of a formation that is capable of yielding a significant amount of water to a well or spring. Closure means the..., partnership, corporation, municipality, State or Federal agency, or an agent or employee thereof. Physical...

  19. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A profile of Michael Clarke, director of IDRC's Information and Communication Technologies for Development (ICT4D) program area. As a professor in the Faculty of Medicine at the University of Western Ontario, Michael Clarke spent years promoting the use of advanced... Evolving approaches to sustainable development.

  20. 48 CFR 247.270-2 - Technical provisions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...

  1. Shockwave damping : field tests on the A270 in 2011

    NARCIS (Netherlands)

    Netten, B.D.; Broek, T.H.A. van den; Koenders, E.

    2011-01-01

    A novel approach is developed and tested for damping and resolving shockwaves. The approach is based on close cooperation between road side units and equipped vehicles. Road side units detect the shockwave within a few seconds, and then broadcast a dynamic speed limit to reduce inflow and increase

  2. Literature review on induced exposure models, Task 2 HS-270

    Science.gov (United States)

    1982-02-01

    Sections 1, 2 and 3 of this report describe the development of : induced exposure models, together with d discussion of questions : of validity. These Sections focus on the most important and : relevant results from the literature, while Appendix A c...

  3. 21 CFR 175.270 - Poly(vinyl fluoride) resins.

    Science.gov (United States)

    2010-04-01

    ... Dilute Solution Viscosity of Vinyl Chloride Polymers,” which is incorporated by reference. Copies may be obtained from the American Society for Testing Materials, 100 Barr Harbor Dr., West Conshohocken... information on the availability of this material at NARA, call 202-741-6030, or go to: http://www.archives.gov...

  4. 46 CFR 28.270 - Instruction, drills, and safety orientation.

    Science.gov (United States)

    2010-10-01

    ... outfit and a self-contained breathing apparatus, if the vessel is so equipped; (8) Making a voice radio... on board, breaking out and using emergency equipment, testing of all alarm and detection systems...

  5. 40 CFR 270.62 - Hazardous waste incinerator permits.

    Science.gov (United States)

    2010-07-01

    ... construction, the Director must establish permit conditions, including but not limited to allowable waste feeds...) Stack gas monitoring and pollution control equipment. (H) Nozzle and burner design. (I) Construction... water (if any), ash residues, and other residues, for the purpose of estimating the fate of the trial...

  6. 17 CFR 270.18f-3 - Multiple class companies.

    Science.gov (United States)

    2010-04-01

    ... result of the application of the same performance fee provisions in the advisory contract of the company... management of the company's assets, if these expenses are actually incurred in a different amount by that... each other class. (b) Expenses may be waived or reimbursed by the company's adviser, underwriter, or...

  7. 48 CFR 352.270-4 - Protection of human subjects.

    Science.gov (United States)

    2010-10-01

    ... subjects as well as to graphic, written, or recorded information derived from individually identifiable... relation to both the potential benefits, if any, to the subjects and the importance of the knowledge to be... contract until the Contractor corrects the noncompliance. The Contracting Officer may communicate the...

  8. Dicty_cDB: SSC270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 24 |BQ513824.1 EST621239 Generation of a set of potato cDNA clones for microarray analyses mixed potato tiss...7 |BQ514537.1 EST621952 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissu...ration of a set of potato cDNA clones for microarray analyses mixed potato tissues ...55811 |AL355811.4 Human DNA sequence *** SEQUENCING CANCELLED *** from clone RP11-562A11. 40 13 1 BQ514538 |BQ514538.1 EST621953 Gene...12514.1 EST560050 potato roots Solanum tuberosum cDNA clone cPRO14F15 5' end, mRNA sequence. 40 13 1 BQ51453

  9. Measuring temperatures with modified Kleiber 270B pyrometer

    International Nuclear Information System (INIS)

    Osch, E.V. van.

    1995-05-01

    At ECN a fast pyrometer is being used as a diagnostic tool for plasma disruption simulation experiments on candidate plasma facing materials for future thermonuclear fusion devices such as NET or ITER. The pyrometer is being used to measure the surface temperature response of the materials to short pulse high heat loads as induced by high power laser or electron beam, simulating the disrupting plasma's energy deposition. A procedure to measure surface temperatures without having to know surface emissivity in advance is described. The formulae needed in this procedure to obtain the correct temperature, starting from the initial incorrect temperature reading, are derived. Inversely, the formula to determine the emissivity of the surface when its temperature is known is equally derived. Finally, a small study on background level sensitivity is presented, showing the, in general, small effect of background on the temperature measurement. (orig.)

  10. 1935 15' Quad #270 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  11. 7 CFR 205.270 - Organic handling requirements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT..., heating, drying, mixing, grinding, churning, separating, distilling, extracting, slaughtering, cutting...

  12. 17 CFR 270.0-4 - Incorporation by reference.

    Science.gov (United States)

    2010-04-01

    ... limitations of § 201.24 of this chapter, incorporate by reference, in any registration statement, application or report filed with the Commission any financial statement or part thereof previously or... required to accompany a financial statement in any registration statement, application or report, the...

  13. Organizational Design Considerations for the New Coast Guard WMEC-270.

    Science.gov (United States)

    1981-06-01

    Addison-Wesley, 1969. Beckhard , R. and Harris, R.T., Organizational Transitions: Managing Complex Change, Addison-Wesley, 1977. Cherns, A., "The...531-52, 1979. 101 ,!4 Scott, W.G. and Mitchell, T.R., Organization Theory: A Struc- tural and Behavioral Analysis, 3rd ed., Richard D. Irwin, Inc...1976. Webber, R.A., Management: Basic Elements of Managing Organi- zations, 2d ed., Richard D. Irwin, Inc., 1979. Wilensky, H.L., Organizational

  14. 40 CFR 270.30 - Conditions applicable to all permits.

    Science.gov (United States)

    2010-07-01

    ... permit. Proper operation and maintenance includes effective performance, adequate funding, adequate operator staffing and training, and adequate laboratory and process controls, including appropriate quality... intervals specified elsewhere in this permit. (5) Compliance schedules. Reports of compliance or...

  15. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... procedures (as defined in paragraph (c) of this section) and internal control over financial reporting (as... management must evaluate, with the participation of the company's principal executive and principal financial... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249...

  16. 48 CFR 352.270-8 - Prostitution and related activities.

    Science.gov (United States)

    2010-10-01

    ... shall include, as express terms and conditions, the applicable provisions of this clause in all... prostitution or sex trafficking. (Note: The term “contract” includes “order” wherever it appears in this clause...

  17. 48 CFR 352.270-2 - Indian preference.

    Science.gov (United States)

    2010-10-01

    ... contract to Indians who can perform required work, regardless of age (subject to existing laws and... this contract involving utilization of small businesses; HUBZone small businesses; service-disabled... may terminate the contract in whole or in part or may impose any other sanctions authorized by law or...

  18. All projects related to | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: PUBLISHING, INTELLECTUAL PROPERTY, COPYRIGHT, ACCESS TO INFORMATION, Internet, STUDENTS. Region: Brazil, South America, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, Far East Asia, South Asia. Program: Networked Economies. Total Funding: ...

  19. 50 CFR 270.10 - Responsibilities of a Council.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS..., research, and other marketing and promotion activities of the Council; (3) Implement and administer an approved marketing and promotion plan and amendments to the plan; (4) Determine the assessment to be made...

  20. 50 CFR 270.3 - Submission of application.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... implement marketing and promotion plans under the Act. (The American Fisheries Society's “List of Common and... Marketing Council for one or more species of fish and fish products of that species. One signed original and...

  1. 48 CFR 552.270-23 - Subordination, Nondisturbance and Attornment.

    Science.gov (United States)

    2010-10-01

    ... clause, that this lease is subject and subordinate to any and all recorded mortgages, deeds of trust and... Officer's receipt of a written demand, to execute such instruments as Lessor may reasonably request to evidence further the subordination of this lease to any existing or future mortgage, deed of trust or other...

  2. 40 CFR 98.270 - Definition of source category.

    Science.gov (United States)

    2010-07-01

    ... this section: (1) Chemical recovery furnaces at kraft and soda mills (including recovery furnaces that burn spent pulping liquor produced by both the kraft and semichemical process). (2) Chemical recovery... into paperboard products (e.g., containers), or operate coating and laminating processes. (b) The...

  3. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  4. 48 CFR 552.270-2 - Historic Preference.

    Science.gov (United States)

    2010-10-01

    ..., architecture, archeology, engineering and culture that the Secretary of the Interior is authorized to expand... the Interior that a district, site, building, structure or object meets the National Register criteria... Secretary of the Interior (36 CFR 800.16(l)). (4) National Register of Historic Places means the National...

  5. P270: Factors associated with fall rate in psychogeriatric residents

    NARCIS (Netherlands)

    Kosse, N.M.; de Groot, Maartje H; Hortobágyi, T.; Lamoth, C.J.C.

    2014-01-01

    Introduction: Falls in psychogeriatric residents represent a costly but unresolved safety issue. Identifying fall risk factors and their inter-relationship may help to individualize prevention programs and increase the effectiveness. Therefore, we aimed to examine the relationship between patient

  6. Dicty_cDB: SFB270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA sequence. 64 4e-08 2 CF446374 |CF446374.1 EST682719 normalized cDNA library of onion Allium cepa cDNA clo...CETASE. [1] ;, mRNA sequence. 64 3e-06 1 CF440839 |CF440839.1 EST677184 normalized cDNA library of onion All

  7. 48 CFR 352.270-5 - Care of laboratory animals.

    Science.gov (United States)

    2010-10-01

    ... on Humane Care and Use of Laboratory Animals (January 2006) The Public Health Service (PHS) Policy on Humane Care and Use of Laboratory Animals (PHS Policy) establishes a number of requirements for research... of the PHS Policy, the Animal Welfare Act, and the Guide for the Care and Use of Laboratory Animals...

  8. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... securities or other properties. (g) Material. The term “material”, when used to qualify a requirement for the... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... percent of the value of the assets of the parent or, if a consolidated balance sheet is filed, the value...

  9. 48 CFR 552.270-29 - Acceptance of Space.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Acceptance of Space. 552... Acceptance of Space. As prescribed in 570.603, insert the following clause: Acceptance of Space (SEP 1999) (a... designated representative shall promptly inspect the space. (b) The Government will accept the space and the...

  10. 50 CFR 270.16 - Deposit of funds.

    Science.gov (United States)

    2010-10-01

    ... States Government. (b) The Council may, however, pending disbursement of these funds, invest in risk-free, short-term, interest-bearing instruments. (1) Risk-free. All investments must be insured or fully collateralized with Federal Government securities. In the absence of collateral, accounts established at...

  11. 50 CFR 270.21 - Petition of objection.

    Science.gov (United States)

    2010-10-01

    ... incorporation, and the names, addresses, and respective positions of its officers; if a partnership, the date and place of formation and the name and address of each partner; (2) The grounds upon which the...

  12. 48 CFR 1339.270 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... COMMERCE SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information... to 1352.239-71, Electronic and Information Technology, in solicitations for Electronic and...

  13. 50 CFR 270.13 - Books, records and reports.

    Science.gov (United States)

    2010-10-01

    ... evaluate the Council's performance and verify the results of the market assessment and promotion plan.. (b... according to the schedule approved in the Council's charter: (1) A marketing assessment and promotion plan; (2) A financial report with respect to the receipt and disbursement of funds; (3) An audit report...

  14. Construction of an adiabatic calorimeter. Thermodynamic properties of standard n-heptane from 155 to 270 K and of 2,2-dichloropropane from 135 to 270 K

    NARCIS (Netherlands)

    Miltenburg, J.C. van

    The construction of an adiabatic calorimeter is described. Measurements have been made of the heat capacity of a standard sample of n-heptane and of 2,2-dichloropropane. The estimated errors are generally within 0.5 per cent.

  15. 40 CFR 270.20 - Specific part B information requirements for land treatment facilities.

    Science.gov (United States)

    2010-07-01

    ... field test that will be conducted, including: (i) The type of test (e.g., column leaching, degradation... to volatilize or escape into the atmosphere; (2) The attenuative properties of underlying and surrounding soils or other materials; (3) The mobilizing properties of other materials co-disposed with these...

  16. 41 CFR 102-117.270 - What are agency performance measures for transportation?

    Science.gov (United States)

    2010-07-01

    ... customers and doing your job. By tracking performance measures you can report specific accomplishments and your success in supporting the agency mission. The Government Performance and Results Act (GPRA) of... be responsive and adaptive to the customer needs and concerns. ...

  17. Yeast Interacting Proteins Database: YBR270C, YDR259C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available factor; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in re...ctor; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in regul

  18. 24 CFR 213.270 - Supplementary loans; election of action; claims; debentures.

    Science.gov (United States)

    2010-04-01

    ... desires to pursue. (b) Maximum claim period. Notice of intention to file claim on a form prescribed by the... filed on submitting claim. Within 30 days after the filing of the notice of intention to file claim, or... Commissioner may include with the notice of redemption an offer to purchase the debentures at par plus accrued...

  19. : tous les projets | Page 270 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    $ 2,500,000.00. Adaptation aux effets qu'ont les changements climatiques sur les ressources en eau. Projet. Les connaissances sont encore très incomplètes en ce qui a trait aux les conséquences actuelles et possibles des risques liés au ...

  20. 17 CFR 270.22c-2 - Redemption fees for redeemable securities.

    Science.gov (United States)

    2010-04-01

    ... necessary or not appropriate. (2) Shareholder information. With respect to each financial intermediary that... information agreement with the financial intermediary (or its agent); or (ii) Prohibit the financial...) Financial intermediary does not include any person that the fund treats as an individual investor with...

  1. 40 CFR 270.290 - What general types of information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... and power outages, (5) Prevent undue exposure of personnel to hazardous waste (for example, requiring.... (j) Traffic pattern, estimated volume (number, types of vehicles) and control (for example, show... land uses (residential, commercial, agricultural, recreational). (5) A wind rose (i.e., prevailing wind...

  2. 40 CFR 270.14 - Contents of part B: General requirements.

    Science.gov (United States)

    2010-07-01

    ... water supplies; (iv) Mitigate effects of equipment failure and power outages; (v) Prevent undue exposure... of vehicles) and control (for example, show turns across traffic lanes, and stacking lanes (if..., recreational). (v) A wind rose (i.e., prevailing wind-speed and direction). (vi) Orientation of the map (north...

  3. 17 CFR 270.6e-2 - Exemptions for certain variable life insurance separate accounts.

    Science.gov (United States)

    2010-04-01

    ... territory of the United States or the District of Columbia an annual statement of its financial condition in... United States or of the District of Columbia an annual statement of its financial condition in the form... an amount not less than the sum of the present value of his contract which is the cash surrender...

  4. 40 CFR 270.18 - Specific part B information requirements for waste piles.

    Science.gov (United States)

    2010-07-01

    ... in relation to the leak detection system; (iv) The construction quality assurance (CQA) plan if... complied with; (h) A description of how hazardous waste residues and contaminated materials will be removed...

  5. 17 CFR 270.20a-1 - Solicitation of proxies, consents and authorizations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Solicitation of proxies... Solicitation of proxies, consents and authorizations. (a) No person shall solicit or permit the use of his or her name to solicit any proxy, consent, or authorization with respect to any security issued by a...

  6. 17 CFR 270.3a-4 - Status of investment advisory programs.

    Science.gov (United States)

    2010-04-01

    ... basis of the client's financial situation and investment objectives and in accordance with any... regarding the client's financial situation and investment objectives, and gives the client the opportunity... been any changes in the client's financial situation or investment objectives, and whether the client...

  7. 40 CFR 270.42 - Permit modification at the request of the permittee.

    Science.gov (United States)

    2010-07-01

    ... MACT performance testing where permit limits may only be waived during actual test events and... food chain crops, or to modify operating plans for distribution of animal feeds resulting from such... alternative type of nonhazardous waste fuel that is not specified in the permit 1 9. Technology changes needed...

  8. SU-E-J-270: Study of PET Response to HDR Brachytherapy of Rectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, R; Le, Y; Armour, E; Efron, J; Azad, N; Wahl, R; Gearhart, S; Herman, J [Johns Hopkins University, Baltimore, MD (United States)

    2014-06-01

    Purpose: Dose-response studies in radiation therapy are typically using single response values for tumors across ensembles of tumors. Using the high dose rate (HDR) treatment plan dose grid and pre- and post-therapy FDG-PET images, we look for correlations between voxelized dose and FDG uptake response in individual tumors. Methods: Fifteen patients were treated for localized rectal cancer using 192Ir HDR brachytherapy in conjunction with surgery. FDG-PET images were acquired before HDR therapy and 6–8 weeks after treatment (prior to surgery). Treatment planning was done on a commercial workstation and the dose grid was calculated. The two PETs and the treatment dose grid were registered to each other using non-rigid registration. The difference in PET SUV values before and after HDR was plotted versus absorbed radiation dose for each voxel. The voxels were then separated into bins for every 400 cGy of absorbed dose and the bin average values plotted similarly. Results: Individual voxel doses did not correlate with PET response; however, when group into tumor subregions corresponding to dose bins, eighty percent of the patients showed a significant positive correlation (R2 > 0) between PET uptake difference in the targeted region and the absorbed dose. Conclusion: By considering larger ensembles of voxels, such as organ average absorbed dose or the dose bins considered here, valuable information may be obtained. The dose-response correlations as measured by FDG-PET difference potentially underlines the importance of FDG-PET as a measure of response, as well as the value of voxelized information.

  9. 45 CFR 270.4 - On what measures will we base the bonus awards?

    Science.gov (United States)

    2010-10-01

    ... affordability of CCDF services based on a comparison of the reported assessed family co-payment to reported... section, we will compare family income to the assessed State family co-payment as reported on the ACF-801... of family co-payment to family income for each family served; and (ii) We will calculate a ratio of...

  10. 17 CFR 270.15a-4 - Temporary exemption for certain investment advisers.

    Science.gov (United States)

    2010-04-01

    ... an interest-bearing escrow account with the fund's custodian or a bank; (B) If a majority of the fund...-day period, the amount in the escrow account (including interest earned) will be paid to the... contract with the investment adviser, the investment adviser will be paid, out of the escrow account, the...

  11. 17 CFR 270.17f-1 - Custody of securities with members of national securities exchanges.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of securities with....17f-1 Custody of securities with members of national securities exchanges. (a) No registered... custody of a company which is a member of a national securities exchange as defined in the Securities...

  12. 17 CFR 270.17f-2 - Custody of investments by registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of investments by....17f-2 Custody of investments by registered management investment company. (a) The securities and similar investments of a registered management investment company may be maintained in the custody of such...

  13. 18 CFR 270.302 - Occluded natural gas produced from coal seams.

    Science.gov (United States)

    2010-04-01

    ... produced from coal seams. A person seeking a determination that natural gas is occluded natural gas... other log which will define the coal seams. (d) Evidence to establish that the natural gas was produced from a coal seam; (e) A statement by the applicant, under oath, that gas is produced from a coal seam...

  14. 40 CFR 270.25 - Specific part B information requirements for equipment.

    Science.gov (United States)

    2010-07-01

    ..., boiler, process heater, condenser, or carbon adsorption system and chooses to use test data to determine... diagrams based on the appropriate sections of “APTI Course 415: Control of Gaseous Emissions” (incorporated... characteristics and control device operation parameters as specified in § 264.1035(b)(4)(iii). (4) A statement...

  15. 40 CFR 270.66 - Permits for boilers and industrial furnaces burning hazardous waste.

    Science.gov (United States)

    2010-07-01

    ... Pretrial Burn Period of the permit conditions, including but not limited to, allowable hazardous waste feed... purposes of this paragraph: (1) An analysis of each feed stream, including hazardous waste, other fuels... feed system for the hazardous waste, and, as appropriate, other fuels and industrial furnace feedstocks...

  16. 17 CFR 270.30b2-1 - Filing of reports to stockholders.

    Science.gov (United States)

    2010-04-01

    ... to stockholders. (a) Every registered management investment company shall file a report on Form N-CSR... communication containing financial statements that is transmitted by or on behalf of such registered investment...

  17. Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

    Data.gov (United States)

    U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

  18. 48 CFR 213.270 - Use of the Governmentwide commercial purchase card.

    Science.gov (United States)

    2010-10-01

    ... exception for an electronic commerce/electronic data interchange system or operational requirement that... Medical Electronic Catalog Program are two examples where use of the purchase card may not be cost...

  19. 76 FR 270 - Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program

    Science.gov (United States)

    2011-01-04

    ... AGENCY 40 CFR Parts 239 and 258 Alaska: Adequacy of Alaska Municipal Solid Waste Landfill Permit Program... modification to Alaska's approved Municipal Solid Waste Landfill (MSWLF) permit program. The approved... 40 CFR 258.4. III. Statutory and Executive Order Reviews This action approves State solid waste...

  20. 45 CFR 270.2 - What definitions apply to this part?

    Science.gov (United States)

    2010-10-01

    ... performance year and the comparison year, except for the calculation and ranking of States on the increase in... operated in accordance with a State plan under title XIX of the Act. MSIS is the Medicaid Statistical...

  1. 40 CFR 270.1 - Purpose and scope of these regulations.

    Science.gov (United States)

    2010-07-01

    ...) Universal waste handlers and universal waste transporters (as defined in 40 CFR 260.10) managing the wastes... threat to human health, public safety, property, or the environment from the known or suspected presence... organizational unit must retain records for three years identifying the dates of the response, the responsible...

  2. 17 CFR 270.23c-1 - Repurchase of securities by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... dividends. (4) The seller of the security is not to the knowledge of the issuer an affiliated person of the issuer. (5) Payment of the purchase price is accompanied or preceded by a written confirmation of the purchase. (6) The purchase is made at a price not above the market value, if any, or the asset value of...

  3. 17 CFR 270.22c-1 - Pricing of redeemable securities for distribution, redemption and repurchase.

    Science.gov (United States)

    2010-04-01

    ... on the current net asset value of such security which is next computed after receipt of a tender of... paragraph shall not prevent a sponsor of a unit investment trust (hereinafter referred to as the “Trust”) engaged exclusively in the business of investing in eligible trust securities (as defined in Rule 14a-3(b...

  4. 17 CFR 270.19b-1 - Frequency of distribution of capital gains.

    Science.gov (United States)

    2010-04-01

    ... trust may distribute capital gain dividends received from a “regulated investment company” within a reasonable time after receipt. (c) The provisions of this rule shall not apply to a unit investment trust (hereinafter referred to as the “Trust”) engaged exclusively in the business of investing in eligible trust...

  5. 40 CFR 270.26 - Special part B information requirements for drip pads.

    Science.gov (United States)

    2010-07-01

    ... residuals. (14) A description of how each drip pad, including appurtenances for control of run-on and run..., detailed plans and an engineering report describing how the requirements of § 264.90(b)(2) of this chapter will be met. (c) Detailed plans and an engineering report describing how the drip pad is or will be...

  6. 40 CFR 270.300 - What container information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... volume of containers to be stored. (4) Provisions for preventing or managing run-on. (5) How accumulated... construction. (2) How the design promotes drainage or how containers are kept from contact with standing... not contain free liquids. (2) A description of how the storage area is designed or operated to drain...

  7. 40 CFR 270.21 - Specific part B information requirements for landfills.

    Science.gov (United States)

    2010-07-01

    ... each landfill or landfill cell; (b) Detailed plans and an engineering report describing how the... chapter; (2) Control of run-on; (3) Control of run-off; (4) Management of collection and holding facilities associated with run-on and run-off control systems; and (5) Control of wind dispersal of...

  8. 40 CFR 270.15 - Specific part B information requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... and volume of containers to be stored. (4) Provisions for preventing or managing run-on. (5) How... materials of construction. (2) How the design promotes drainage or how containers are kept from contact with... not contain free liquids; and (2) A description of how the storage area is designed or operated to...

  9. 17 CFR 270.3a-8 - Certain research and development companies.

    Science.gov (United States)

    2010-04-01

    ... wholly-owned subsidiaries; (3) Board of directors means the issuer's board of directors or an appropriate... company; (6) It is primarily engaged, directly, through majority-owned subsidiaries, or through companies... majority-owned subsidiaries and companies controlled primarily by the issuer that conduct similar types of...

  10. 17 CFR 270.3a-1 - Certain prima facie investment companies.

    Science.gov (United States)

    2010-04-01

    ... statements with the financial statements of any wholly-owned subsidiaries. [46 FR 6881, Jan. 22, 1981, as... securities; (2) Securities issued by employees' securities companies; (3) Securities issued by majority-owned subsidiaries of the issuer (other than subsidiaries relying on the exclusion from the definition of investment...

  11. 17 CFR 270.0-1 - Definition of terms used in this part.

    Science.gov (United States)

    2010-04-01

    ... liabilities with respect to such account, and at all other times, shall have a value approximately equal to or in excess of such reserves and liabilities; and that portion of such assets having a value equal to... present; and (vii) The disinterested directors have been authorized to hire employees and to retain...

  12. 40 CFR 270.16 - Specific part B information requirements for tank systems.

    Science.gov (United States)

    2010-07-01

    ... and certified by a qualified Professional Engineer as to the structural integrity and suitability for... design and operating practices that will, in conjunction with location aspects, prevent the migration of...

  13. CWAP Certified Wireless Analysis Professional Official Study Guide Exam PW0-270

    CERN Document Server

    Westcott, David A; Miller, Ben; Mackenzie, Peter

    2011-01-01

    The official study guide for the Certified Wireless Analysis Professional certification from CWNPFour leading wireless experts thoroughly prepare you for the vendor-neutral CWAP exam administered by CWNP, the industry leader for enterprise Wi-Fi training and certification.  This official study guide not only covers all exam objectives for the CWAP exam, it also prepares you to administer and troubleshoot complex enterprise WLAN environments.Covers all exam objectives for the Certified Wireless Analysis Professional (CWAP) examCovers 802.11 physical (PHY) and 802.11 MAC layer frame formats and

  14. 33 CFR 106.270 - Security measures for delivery of stores and industrial supplies.

    Science.gov (United States)

    2010-07-01

    ... stores and industrial supplies. (a) General. The OCS facility owner or operator must ensure that security...). These additional security measures may include: (1) Intensifying inspection of the stores or industrial... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Security measures for delivery of...

  15. 33 CFR 207.270 - Tallahatchie River, Miss., between Batesville and the mouth; logging.

    Science.gov (United States)

    2010-07-01

    ... Tallahatchie River, Miss., between Batesville and the mouth; logging. (a) The floating of “sack”, rafts, or of... sufficient capacity to properly manage the movement of the raft and to keep it from being an obstruction to...

  16. 48 CFR 552.270-9 - Inspection-Right of Entry.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Inspection-Right of Entry... Inspection—Right of Entry. As prescribed in 570.603, insert the following clause: Inspection—Right of Entry... the purposes of entry, to determine the potential or actual compliance by the Offeror or Lessor with...

  17. 15 CFR 270.102 - Conditions for establishment and deployment of a Team.

    Science.gov (United States)

    2010-01-01

    ... more buildings or types of buildings due to an extreme natural event (earthquake, hurricane, tornado... investigation of the building performance and emergency response and evacuation procedures will likely result in...

  18. 17 CFR 270.17f-5 - Custody of investment company assets outside the United States.

    Science.gov (United States)

    2010-04-01

    ... combination) that will adequately protect the Fund against the risk of loss of Foreign Assets held in... interest, lien or claim of any kind in favor of the Eligible Foreign Custodian or its creditors, except a... rights in favor of creditors of the custodian arising under bankruptcy, insolvency, or similar laws; (C...

  19. Contribution of gammagraphy to the diagnosis of bone tumours. Study of 270 patients

    International Nuclear Information System (INIS)

    Caballero Carpena, O.; Esteban Velasco, J.

    1982-01-01

    In this study, two hundred seventy patients with bone tumours were evaluated by whole-body radionuclide studies: bone and vascular scan, using 99mTc MDP. In the group of primary bone tumour: 50 cases, the gammagraphy was positive in all cases except one myeloma. The morphology of the abnormal scan area of a primary bone tumour depend more of the site of the bone lesion than on its histopathology, and the size is significant by larger in sarcoma than others. The positivity of gammagraphy in the group of secondary bone tumours: 220 cases, was 93%, and the gammagraphic diagnosis being earlier than the radiologic one in 27%. Finally, we have studied the location of metastases, and the correlation between the positive scan and the request of exploration

  20. Offshore high - Boundaries: When 10 women jostle for personal space with 270 men, establishing limits is the key

    Energy Technology Data Exchange (ETDEWEB)

    Harvie, W.

    1998-06-01

    Male-female relationships on the Hibernia offshore site is discussed. Since women are outnumbered 27 to 1, some gender problems have been anticipated. Every employee on the platform, as well as every Hibernia and service company worker has taken gender sensitivity training and knows the rules. Although not every potential problem was anticipated, so far sexual harassment has not been a problem. The workers know what is acceptable and what is not, and the rules are generally observed. The ten women on the platform tend to work on administrative and support tasks, although by funding special scholarships the company is encouraging women to study engineering, computing and other petroleum-related fields, as well as pipefitting, welding and similar trades. The women aboard the platform live like the men, sharing a two-bunk berth with ensuite bathroom and shower. Off-duty time is spent congregating with the men in TV lounges, the smoking room or playing pool. Like the men, the women work 12-hour shifts for three weeks straight. It does get dull and repetitive, but in a province with chronic high unemployment, that is an acceptable irritation.

  1. Importance of All-in-one (MCNPX2.7.0+CINDER2008) Code for Rigorous Transmutation Study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Oyeon [Institute for Modeling and Simulation Convergence, Daegu (Korea, Republic of); Kim, Kwanghyun [RadTek Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    It can be utilized as a possible mechanism for reducing the volume and hazard of radioactive waste by transforming hazardous radioactive elements with long half-life into less hazardous elements with short halflife. Thus, the understanding of the transmutation mechanism and beneficial machinery design technologies are important and useful. Although the terminology transmutation was rooted back to alchemy which transforms the base metals into gold in the middle ages, Rutherford and Soddy were the first observers by discovering the natural transmutation as a part of radioactive decay of the alpha decay type in early 20th century. Along with the development of computing technology, analysis software, for example, CINDER was developed for rigorous atomic transmutation study. The code has a long history of development from the original work of T. England at Bettis Atomic Power Laboratory (BAPL) in the early 1960s. It has been used to calculate the inventory of nuclides in an irradiated material. CINDER'90 which is recently released involved an upgrade of the code to allow the spontaneous tracking of chains based upon the significant density or pass-by of a nuclide, where pass-by represents the density of a nuclide transforming to other nuclides. Nuclear transmutation process is governed by highly non-linear differential equation. Chaotic nature of the non-linear equation bespeaks the importance of the accurate input data (i.e. number of significant digits). Thus, reducing the human interrogation is very important for the rigorous transmutation study and 'allin- one' code structure is desired. Note that non-linear characteristic of the transmutation equation caused by the flux changes due to the number density change during a given time interval (intrinsic physical phenomena) is not considered in this study. In this study, we only emphasized the effects of human interrogation in the computing process solving nonlinear differential equations, as shown in the case of accidental discovery of chaos by Edward N. Lorenz.

  2. 48 CFR 552.270-1 - Instructions to Offerors-Acquisition of Leasehold Interests in Real Property.

    Science.gov (United States)

    2010-10-01

    ... withdrawal of proposals. (1) Unless other methods (e.g., electronic commerce or facsimile) are permitted in... transmitted through an electronic commerce method authorized by the solicitation and was received at the...

  3. 37 CFR 270.5 - Designated collection and distribution organizations for records of use of sound recordings under...

    Science.gov (United States)

    2010-07-01

    ... Edition) Index INDEX TO CHAPTER II—COPYRIGHT OFFICE, LIBRARY OF CONGRESS Editorial Note: This listing is... 254.1 to 254.3 Collective works, Deposit of contributions to 202.20(c)(2)(xv) Colleges and... for making/distributing phonorecords of nondramatic musical works, Notice of intention to obtain 201...

  4. The experimental setup of a large field operational test for cooperative driving vehicles at the A270

    NARCIS (Netherlands)

    Broek, T.H.A. van den; Netten, B.D.; Hoedemaeker, M.; Ploeg, J.

    2010-01-01

    In this paper, a large field operational test (FOT) for cooperative driving systems, which take place on a public highway, is discussed. The experimental setup consist of a specific driver support system, which is closely related to cooperative adaptive cruise control (CACC) systems. Instead of

  5. 17 CFR 270.6e-3(T) - Temporary exemptions for flexible premium variable life insurance separate accounts.

    Science.gov (United States)

    2010-04-01

    ... consistent with the investment objectives of the separate account or would result in the purchase of... company with similar investment objectives; (iii) Any action described in paragraph (b)(5)(i) or (ii) of... securities which would not be consistent with the investment objectives of the separate account, or which...

  6. 17 CFR 270.17d-1 - Applications regarding joint enterprises or arrangements and certain profit-sharing plans.

    Science.gov (United States)

    2010-04-01

    ... investment company; (2) Any interest of a wholly owned subsidiary of the registered investment company; (3...-sharing plans. (a) No affiliated person of or principal underwriter for any registered investment company... affiliated person of such a person or principal underwriter, acting as principal, shall participate in, or...

  7. 17 CFR 270.27d-1 - Reserve requirements for principal underwriters and depositors to carry out the obligations to...

    Science.gov (United States)

    2010-04-01

    ...) or (ii) negotiable certificates of deposit issued by a bank, as defined in section 2(a)(5) of the Act... load” on any payment is that portion of the sales load in excess of 15 percent of that payment. (2... sales load on each of the first six monthly payments or their equivalent. (d) For all periodic payment...

  8. Scaphoid non-unions, where do they come from? The epidemiology and initial presentation of 270 scaphoid non-unions.

    Science.gov (United States)

    Reigstad, Ole; Grimsgaard, Christian; Thorkildsen, Rasmus; Reigstad, Astor; Røkkum, Magne

    2012-01-01

    Scaphoid injury and subsequent non-union is a well documented and researched subject. This article gives an overview of the epidemiology and results of the patients we have treated for scaphoid non-union at a University Hospital. 283 scaphoid non-unions in 268 patients (83% men) were operated upon, 230 as a primary and 47 as a secondary. The median age at time of surgery was 27 years. One-third of the non-unions were located in the proximal part of the scaphoid and the remaining two-thirds in the middle part. Of the 146 patients (55%) who contacted a doctor at the time of injury, 53 fractures where diagnosed (20%). Fourteen (5%) were operated primarily while 39 (15%) (seven dislocated) were immobilized in plaster casts. Thirty-two (12%) were under the age of 16 at the time of injury. The average time from the injury to the initial non-union surgery was 1.5 years with 2.8 years to the second procedure. The risk of osteoarthritis increased time from injury to surgery (both primary and secondary procedures). The greatest potential for the reduction of scaphoid non-union is an increased awareness amongst younger men. There is also potential for improved accuracy in the diagnosis of scaphoid fractures (better clinical tests, the use of radiographs, CTs and MRIs) in order to identify the fracture and evaluate dislocation at the initial injury. Early diagnosis and treatment of fractures and non-unions will reduce the development of degenerative wrist changes.

  9. Transdisciplinarity in the university: discourse and practice - DOI: 10.3395/reciis.v3i3.270en

    Directory of Open Access Journals (Sweden)

    Aleixina Maria Lopes Andalécio

    2009-09-01

    Full Text Available This article presents discussions and partial results of a piece of doctoral research centered on the questions raised by the new forms of production and organization of knowledge, guided by the discourse and practice of transdisciplinarity. The latter is understood in the context of the university, as an effort to overcome the fragmentation of knowledge into disciplines and excessive specialization, in face of the complex reality of the modern world, with its relational and interconnected character. To guide the questions, the research is based on the presuppositions that there is an epistemological, practical, social, and political distance between the discourse and the practice of transdisciplinarity. The empirical terrain is represented by the analysis of two large institutional transdisciplinary projects implemented at the Federal University of Minas Gerais in the late 1990s. In the methodology, thematic document analysis techniques, in-depth interviews, and direct observation are used. The results reached so far indicate that even researchers who have a strong discourse in favor of transdisciplinarity still work in a disciplinary manner in practice. However, even among researchers who are called “disciplinary”, there seems to be a consensus that current problems demand a different approach and transdisciplinarity presents itself as an appropriate alternative to deal with them.

  10. Transmission and Distribution of Photosynthetically Active Radiation (PAR) for Biomass Production in Exploration Missions [7226-270], Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Physical Sciences Inc. (PSI) proposes to develop a plant lighting system which collects, transmits and distributes photosynthetically active radiation (PAR) for...

  11. 17 CFR 270.31a-2 - Records to be preserved by registered investment companies, certain majority-owned subsidiaries...

    Science.gov (United States)

    2010-04-01

    ..., correspondence, checkbooks, bank statements, cancelled checks, cash reconciliations, cancelled stock certificates..., including any digital storage medium or system that meets the terms of this section. (2) General...

  12. 37 CFR 270.2 - Reports of use of sound recordings under statutory license for preexisting subscription services.

    Science.gov (United States)

    2010-07-01

    ... license shall post and make available online its Reports of Use. Preexisting subscription services shall post their Reports of Use online on or before the forty-fifth day after the close of each month, and... sound recording); (6) The marketing label of the commercially available album or other product on which...

  13. 40 CFR 270.235 - Options for incinerators, cement kilns, lightweight aggregate kilns, solid fuel boilers, liquid...

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM Integration with Maximum Achievable Control... 63, subpart EEE, of this chapter. (i) RCRA option. Under this option, the owner or operator continues...

  14. 37 CFR 270.3 - Reports of use of sound recordings under statutory license for nonsubscription transmission...

    Science.gov (United States)

    2010-07-01

    ..., less the actual running time of any sound recordings for which the service has obtained direct licenses... transitions in and out of commercials or program segments, brief performances during news, talk and sports... classified as news, talk, sports or business programming; (C) For eligible nonsubscription transmissions of...

  15. 17 CFR 270.11a-1 - Definition of “exchange” for purposes of section 11 of the Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âexchangeâ for....11a-1 Definition of “exchange” for purposes of section 11 of the Act. (a) For the purposes of section... issued, and notice of intention to close the account was mailed to the security holder, and he had a...

  16. 270 nm Pseudomorphic Ultraviolet Light-Emitting Diodes with Over 60 mW Continuous Wave Output Power

    Science.gov (United States)

    Grandusky, James R.; Chen, Jianfeng; Gibb, Shawn R.; Mendrick, Mark C.; Moe, Craig G.; Rodak, Lee; Garrett, Gregory A.; Wraback, Michael; Schowalter, Leo J.

    2013-03-01

    In this letter, the achievement of over 60 mW output power from pseudomorphic ultraviolet light-emitting diodes in continuous wave operation is reported. Die thinning and encapsulation improved the photon extraction efficiency to over 15%. Improved thermal management and a high characteristic temperature resulted in a low thermal rolloff up to 300 mA injection current with an output power of 67 mW, an external quantum efficiency (EQE) of 4.9%, and a wall plug efficiency (WPE) of 2.5% for a single-chip device emitting at 271 nm in continuous wave operation.

  17. 2013 Review of Neutron and Non-Neutron Nuclear Data

    Science.gov (United States)

    Holden, N. E.

    2016-02-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  18. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  19. [Reseña: Comunicacion Intercultural] Rodrigo, Miquel. (2012. La Comunicación Intercultural (2ª Edición . Barcelona: Anthropos. 270 p.

    Directory of Open Access Journals (Sweden)

    Eduardo Enrique Sandoval Obando

    2014-05-01

    Full Text Available La presente obra se convierte en un interesante y valioso aporte para aquellos estudiosos de las ciencias sociales y humanas; pero particularmente de aquellos sujetos involucrados en la comprensión de las diversas interrelaciones y contactos entre diversas culturas en que el intercambio de visiones, formas de pensar, creencias, costumbres, valores y diversas identidades, nos obligan / invitan a co-construir nuevas categorías de sentido, para el adecuado conocimiento de otros, a partir de una comunicación efectiva, pertinente, diversa y significativa. El libro se presenta en 5 capítulos, cada uno de los cuales se encuentran conformados por diversos sub-apartados que profundizan y aclaran didáctica y socioculturalmente, los diversos estudios y modelos teórico – prácticos que han ido emergiendo en este campo de desarrollo.

  20. Multibeam collection for TN270: Multibeam data collected aboard Thomas G. Thompson from 2011-10-08 to 2011-10-20, Honolulu, HI to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. 17 CFR 270.6c-7 - Exemptions from certain provisions of sections 22(e) and 27 for registered separate accounts...

    Science.gov (United States)

    2010-04-01

    ... restrictions on redemption imposed by the Program in any sales literature used in connection with the offer of... representation that this section is being relied upon and that the provisions of paragraphs (a) through (d) of...

  2. 17 CFR 270.2a51-2 - Definitions of beneficial owner for certain purposes under sections 2(a)(51) and 3(c)(7) and...

    Science.gov (United States)

    2010-04-01

    ... company (without giving effect to section 3(c)(1)(A) of the Act [15 U.S.C. 80a-3(c)(1)(A)]) (“owning company”) shall be deemed to be beneficially owned by one person unless: (1) The owning company is an investment company or an excepted investment company; (2) The owning company, directly or indirectly...

  3. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits

    NARCIS (Netherlands)

    Randall, Joshua C.; Winkler, Thomas W.; Kutalik, Zoltán; Berndt, Sonja I.; Jackson, Anne U.; Monda, Keri L.; Kilpeläinen, Tuomas O.; Esko, Tõnu; Mägi, Reedik; Li, Shengxu; Workalemahu, Tsegaselassie; Feitosa, Mary F.; Croteau-Chonka, Damien C.; Day, Felix R.; Fall, Tove; Ferreira, Teresa; Gustafsson, Stefan; Locke, Adam E.; Mathieson, Iain; Scherag, Andre; Vedantam, Sailaja; Wood, Andrew R.; Liang, Liming; Steinthorsdottir, Valgerdur; Thorleifsson, Gudmar; Dermitzakis, Emmanouil T.; Dimas, Antigone S.; Karpe, Fredrik; Min, Josine L.; Nicholson, George; Clegg, Deborah J.; Person, Thomas; Krohn, Jon P.; Bauer, Sabrina; Buechler, Christa; Eisinger, Kristina; Bonnefond, Amélie; Froguel, Philippe; Hottenga, Jouke-Jan; Prokopenko, Inga; Waite, Lindsay L.; Harris, Tamara B.; Smith, Albert Vernon; Shuldiner, Alan R.; McArdle, Wendy L.; Caulfield, Mark J.; Munroe, Patricia B.; Grönberg, Henrik; Chen, Yii-Der Ida; Li, Guo; Beckmann, Jacques S.; Johnson, Toby; Thorsteinsdottir, Unnur; Teder-Laving, Maris; Khaw, Kay-Tee; Wareham, Nicholas J.; Zhao, Jing Hua; Amin, Najaf; Oostra, Ben A.; Kraja, Aldi T.; Province, Michael A.; Cupples, L. Adrienne; Heard-Costa, Nancy L.; Kaprio, Jaakko; Ripatti, Samuli; Surakka, Ida; Collins, Francis S.; Saramies, Jouko; Tuomilehto, Jaakko; Jula, Antti; Salomaa, Veikko; Erdmann, Jeanette; Hengstenberg, Christian; Loley, Christina; Schunkert, Heribert; Lamina, Claudia; Wichmann, H. Erich; Albrecht, Eva; Gieger, Christian; Hicks, Andrew A.; Johansson, Asa; Pramstaller, Peter P.; Kathiresan, Sekar; Speliotes, Elizabeth K.; Penninx, Brenda; Hartikainen, Anna-Liisa; Jarvelin, Marjo-Riitta; Gyllensten, Ulf; Boomsma, Dorret I.; Campbell, Harry; Wilson, James F.; Chanock, Stephen J.; Farrall, Martin; Goel, Anuj; Medina-Gomez, Carolina; Rivadeneira, Fernando; Estrada, Karol; Uitterlinden, André G.; Hofman, Albert; Zillikens, M. Carola; den Heijer, Martin; Kiemeney, Lambertus A.; Maschio, Andrea; Hall, Per; Tyrer, Jonathan; Teumer, Alexander; Völzke, Henry; Kovacs, Peter; Tönjes, Anke; Mangino, Massimo; Spector, Tim D.; Hayward, Caroline; Rudan, Igor; Hall, Alistair S.; Samani, Nilesh J.; Attwood, Antony Paul; Sambrook, Jennifer G.; Hung, Joseph; Palmer, Lyle J.; Lokki, Marja-Liisa; Sinisalo, Juha; Boucher, Gabrielle; Huikuri, Heikki; Lorentzon, Mattias; Ohlsson, Claes; Eklund, Niina; Eriksson, Johan G.; Barlassina, Cristina; Rivolta, Carlo; Nolte, Ilja M.; Snieder, Harold; van der Klauw, Melanie M.; van Vliet-Ostaptchouk, Jana V.; Gejman, Pablo V.; Shi, Jianxin; Jacobs, Kevin B.; Wang, Zhaoming; Bakker, Stephan J. L.; Mateo Leach, Irene; Navis, Gerjan; van der Harst, Pim; Martin, Nicholas G.; Medland, Sarah E.; Montgomery, Grant W.; Yang, Jian; Chasman, Daniel I.; Ridker, Paul M.; Rose, Lynda M.; Lehtimäki, Terho; Raitakari, Olli; Absher, Devin; Iribarren, Carlos; Basart, Hanneke; Hovingh, Kees G.; Hyppönen, Elina; Power, Chris; Anderson, Denise; Beilby, John P.; Hui, Jennie; Jolley, Jennifer; Sager, Hendrik; Bornstein, Stefan R.; Schwarz, Peter E. H.; Kristiansson, Kati; Perola, Markus; Lindström, Jaana; Swift, Amy J.; Uusitupa, Matti; Atalay, Mustafa; Lakka, Timo A.; Rauramaa, Rainer; Bolton, Jennifer L.; Fowkes, Gerry; Fraser, Ross M.; Price, Jackie F.; Fischer, Krista; Krjutå Kov, Kaarel; Metspalu, Andres; Mihailov, Evelin; Langenberg, Claudia; Luan, Jian'an; Ong, Ken K.; Chines, Peter S.; Keinanen-Kiukaanniemi, Sirkka M.; Saaristo, Timo E.; Edkins, Sarah; Franks, Paul W.; Hallmans, Göran; Shungin, Dmitry; Morris, Andrew David; Palmer, Colin N. A.; Erbel, Raimund; Moebus, Susanne; Nöthen, Markus M.; Pechlivanis, Sonali; Hveem, Kristian; Narisu, Narisu; Hamsten, Anders; Humphries, Steve E.; Strawbridge, Rona J.; Tremoli, Elena; Grallert, Harald; Thorand, Barbara; Illig, Thomas; Koenig, Wolfgang; Müller-Nurasyid, Martina; Peters, Annette; Boehm, Bernhard O.; Kleber, Marcus E.; März, Winfried; Winkelmann, Bernhard R.; Kuusisto, Johanna; Laakso, Markku; Arveiler, Dominique; Cesana, Giancarlo; Kuulasmaa, Kari; Virtamo, Jarmo; Yarnell, John W. G.; Kuh, Diana; Wong, Andrew; Lind, Lars; de Faire, Ulf; Gigante, Bruna; Magnusson, Patrik K. E.; Pedersen, Nancy L.; Dedoussis, George; Dimitriou, Maria; Kolovou, Genovefa; Kanoni, Stavroula; Stirrups, Kathleen; Bonnycastle, Lori L.; Njølstad, Inger; Wilsgaard, Tom; Ganna, Andrea; Rehnberg, Emil; Hingorani, Aroon; Kivimaki, Mika; Kumari, Meena; Assimes, Themistocles L.; Barroso, Inês; Boehnke, Michael; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Frayling, Timothy; Groop, Leif C.; Haritunians, Talin; Hunter, David; Ingelsson, Erik; Kaplan, Robert; Mohlke, Karen L.; O'Connell, Jeffrey R.; Schlessinger, David; Strachan, David P.; Stefansson, Kari; van Duijn, Cornelia M.; Abecasis, Gonçalo R.; McCarthy, Mark I.; Hirschhorn, Joel N.; Qi, Lu; Loos, Ruth J. F.; Lindgren, Cecilia M.; North, Kari E.; Heid, Iris M.

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  4. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits

    NARCIS (Netherlands)

    Randall, Joshua C; Winkler, Thomas W; Kutalik, Zoltán; Berndt, Sonja I; Jackson, Anne U; Monda, Keri L; Kilpeläinen, Tuomas O; Esko, Tõnu; Mägi, Reedik; Li, Shengxu; Workalemahu, Tsegaselassie; Feitosa, Mary F; Croteau-Chonka, Damien C; Day, Felix R; Fall, Tove; Ferreira, Teresa; Gustafsson, Stefan; Locke, Adam E; Mathieson, Iain; Scherag, Andre; Vedantam, Sailaja; Wood, Andrew R; Liang, Liming; Steinthorsdottir, Valgerdur; Thorleifsson, Gudmar; Dermitzakis, Emmanouil T; Dimas, Antigone S; Karpe, Fredrik; Min, Josine L; Nicholson, George; Clegg, Deborah J; Person, Thomas; Krohn, Jon P; Bauer, Sabrina; Buechler, Christa; Eisinger, Kristina; Bonnefond, Amélie; Froguel, Philippe; Hottenga, Jouke-Jan; Prokopenko, Inga; Waite, Lindsay L; Harris, Tamara B; Smith, Albert Vernon; Shuldiner, Alan R; McArdle, Wendy L; Caulfield, Mark J; Munroe, Patricia B; Grönberg, Henrik; Chen, Yii-Der Ida; Li, Guo; Beckmann, Jacques S; Johnson, Toby; Thorsteinsdottir, Unnur; Teder-Laving, Maris; Khaw, Kay-Tee; Wareham, Nicholas J; Zhao, Jing Hua; Amin, Najaf; Oostra, Ben A; Kraja, Aldi T; Province, Michael A; Cupples, L Adrienne; Heard-Costa, Nancy L; Kaprio, Jaakko; Ripatti, Samuli; Surakka, Ida; Collins, Francis S; Saramies, Jouko; Tuomilehto, Jaakko; Jula, Antti; Salomaa, Veikko; Erdmann, Jeanette; Hengstenberg, Christian; Loley, Christina; Schunkert, Heribert; Lamina, Claudia; Wichmann, H Erich; Albrecht, Eva; Gieger, Christian; Hicks, Andrew A; Johansson, Asa; Pramstaller, Peter P; Kathiresan, Sekar; Speliotes, Elizabeth K; Penninx, Brenda; Hartikainen, Anna-Liisa; Jarvelin, Marjo-Riitta; Gyllensten, Ulf; Boomsma, Dorret I; Campbell, Harry; Wilson, James F; Chanock, Stephen J; Farrall, Martin; Goel, Anuj; Medina-Gomez, Carolina; Rivadeneira, Fernando; Estrada, Karol; Uitterlinden, André G; Hofman, Albert; Zillikens, M Carola; den Heijer, Martin; Kiemeney, Lambertus A; Maschio, Andrea; Hall, Per; Tyrer, Jonathan; Teumer, Alexander; Völzke, Henry; Kovacs, Peter; Tönjes, Anke; Mangino, Massimo; Spector, Tim D; Hayward, Caroline; Rudan, Igor; Hall, Alistair S; Samani, Nilesh J; Attwood, Antony Paul; Sambrook, Jennifer G; Hung, Joseph; Palmer, Lyle J; Lokki, Marja-Liisa; Sinisalo, Juha; Boucher, Gabrielle; Huikuri, Heikki; Lorentzon, Mattias; Ohlsson, Claes; Eklund, Niina; Eriksson, Johan G; Barlassina, Cristina; Rivolta, Carlo; Nolte, Ilja M; Snieder, Harold; Van der Klauw, Melanie M; Van Vliet-Ostaptchouk, Jana V; Gejman, Pablo V; Shi, Jianxin; Jacobs, Kevin B; Wang, Zhaoming; Bakker, Stephan J L; Mateo Leach, Irene; Navis, Gerjan; van der Harst, Pim; Martin, Nicholas G; Medland, Sarah E; Montgomery, Grant W; Yang, Jian; Chasman, Daniel I; Ridker, Paul M; Rose, Lynda M; Lehtimäki, Terho; Raitakari, Olli; Absher, Devin; Iribarren, Carlos; Basart, Hanneke; Hovingh, Kees G; Hyppönen, Elina; Power, Chris; Anderson, Denise; Beilby, John P; Hui, Jennie; Jolley, Jennifer; Sager, Hendrik; Bornstein, Stefan R; Schwarz, Peter E H; Kristiansson, Kati; Perola, Markus; Lindström, Jaana; Swift, Amy J; Uusitupa, Matti; Atalay, Mustafa; Lakka, Timo A; Rauramaa, Rainer; Bolton, Jennifer L; Fowkes, Gerry; Fraser, Ross M; Price, Jackie F; Fischer, Krista; Krjutå Kov, Kaarel; Metspalu, Andres; Mihailov, Evelin; Langenberg, Claudia; Luan, Jian'an; Ong, Ken K; Chines, Peter S; Keinanen-Kiukaanniemi, Sirkka M; Saaristo, Timo E; Edkins, Sarah; Franks, Paul W; Hallmans, Göran; Shungin, Dmitry; Morris, Andrew David; Palmer, Colin N A; Erbel, Raimund; Moebus, Susanne; Nöthen, Markus M; Pechlivanis, Sonali; Hveem, Kristian; Narisu, Narisu; Hamsten, Anders; Humphries, Steve E; Strawbridge, Rona J; Tremoli, Elena; Grallert, Harald; Thorand, Barbara; Illig, Thomas; Koenig, Wolfgang; Müller-Nurasyid, Martina; Peters, Annette; Boehm, Bernhard O; Kleber, Marcus E; März, Winfried; Winkelmann, Bernhard R; Kuusisto, Johanna; Laakso, Markku; Arveiler, Dominique; Cesana, Giancarlo; Kuulasmaa, Kari; Virtamo, Jarmo; Yarnell, John W G; Kuh, Diana; Wong, Andrew; Lind, Lars; de Faire, Ulf; Gigante, Bruna; Magnusson, Patrik K E; Pedersen, Nancy L; Dedoussis, George; Dimitriou, Maria; Kolovou, Genovefa; Kanoni, Stavroula; Stirrups, Kathleen; Bonnycastle, Lori L; Njølstad, Inger; Wilsgaard, Tom; Ganna, Andrea; Rehnberg, Emil; Hingorani, Aroon; Kivimaki, Mika; Kumari, Meena; Assimes, Themistocles L; Barroso, Inês; Boehnke, Michael; Borecki, Ingrid B; Deloukas, Panos; Fox, Caroline S; Frayling, Timothy; Groop, Leif C; Haritunians, Talin; Hunter, David; Ingelsson, Erik; Kaplan, Robert; Mohlke, Karen L; O'Connell, Jeffrey R; Schlessinger, David; Strachan, David P; Stefansson, Kari; van Duijn, Cornelia M; Abecasis, Gonçalo R; McCarthy, Mark I; Hirschhorn, Joel N; Qi, Lu; Loos, Ruth J F; Lindgren, Cecilia M; North, Kari E; Heid, Iris M

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  5. Sex-stratified Genome-wide Association Studies Including 270,000 Individuals Show Sexual Dimorphism in Genetic Loci for Anthropometric Traits

    DEFF Research Database (Denmark)

    Randall, Joshua C; Winkler, Thomas W; Kutalik, Zoltán

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,72...

  6. 17 CFR 270.32a-2 - Exemption for initial period from vote of security holders on independent public accountant for...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption for initial period from vote of security holders on independent public accountant for certain registered separate accounts... from vote of security holders on independent public accountant for certain registered separate accounts...

  7. 17 CFR 270.27f-1 - Notice of right of withdrawal required to be mailed to periodic payment plan certificate holders...

    Science.gov (United States)

    2010-04-01

    ... the depositor of, the issuer or a recordkeeping agent for the issuer if the custodian bank has... custodian bank by Commission order. (c) Solely for purposes of section 27(f) of the Act, the postmark date... holders of plans upon which the amount of sales load deducted from any payment does not exceed 9 percent...

  8. Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.

    Directory of Open Access Journals (Sweden)

    Joshua C Randall

    2013-06-01

    Full Text Available Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723 individuals and took forward 348 SNPs into follow-up (additional 137,052 individuals in a total of 94 studies. Seven loci displayed significant sex-difference (FDR<5%, including four previously established (near GRB14/COBLL1, LYPLAL1/SLC30A10, VEGFA, ADAMTS9 and three novel anthropometric trait loci (near MAP3K1, HSD17B4, PPARG, all of which were genome-wide significant in women (P<5×10(-8, but not in men. Sex-differences were apparent only for waist phenotypes, not for height, weight, BMI, or hip circumference. Moreover, we found no evidence for genetic effects with opposite directions in men versus women. The PPARG locus is of specific interest due to its role in diabetes genetics and therapy. Our results demonstrate the value of sex-specific GWAS to unravel the sexually dimorphic genetic underpinning of complex traits.

  9. Final Environmental Assessment: For the M270 Multiple Launch Rocket System (MLRS) Expanded Training Use Areas at Avon Park Air Force Range, Florida

    Science.gov (United States)

    2005-11-10

    disposal of graywater (shower and sink wash water) during field operations and the use, disposal, and spill management of petroleum, oils, and lubricants...at APAFR and do not move off this site. Other vehicles would be washed down after an exercise and prior to leaving APAFR, to remove any soil and...Pistia stratiotes Water lettuce Psidium cattleianum Strawberry guava Rhodomyrtus tomentosa Downy rose myrtle Ruellia brittoniana Mexican petunia

  10. Sex-stratified Genome-wide Association Studies Including 270,000 Individuals Show Sexual Dimorphism in Genetic Loci for Anthropometric Traits

    NARCIS (Netherlands)

    Randall, J.C.; Winkler, T.W.; Kutalik, Z.; Berndt, S.I.; Jackson, A.U.; Monda, K.L.; Kilpelainen, T.O.; Esko, T.; Magi, R.; Li, S.; Workalemahu, T.; Feitosa, M.F.; Croteau-Chonka, D.C.; Day, F.R.; Fall, T.; Ferreira, T.; Gustafsson, S.; Locke, A.E.; Mathieson, I.; Scherag, A.; Vedantam, S.; Wood, A.R.; Liang, L.; Steinthorsdottir, V.; Thorleifsson, G.; Dermitzakis, E.T.; Dimas, A.S.; Karpe, F.; Min, J.L.; Nicholson, G.; Clegg, D.J.; Person, T.; Krohn, J.P.; Bauer, S.; Buechler, C.; Eisinger, K.; Bonnefond, A.; Froguel, P.; Hottenga, J.J.; Prokopenko, I.; Waite, L.L.; Harris, T.B.; Smith, A.V.; Shuldiner, A.R.; McArdle, W.L.; Caulfield, M.J.; Munroe, P.B.; Gronberg, H.; Chen, Y.D.; Li, G.; Beckmann, J.S.; Johnson, T.; Thorsteinsdottir, U.; Teder-Laving, M.; Khaw, K.T.; Wareham, N.J.; Zhao, J.H.; Amin, N.; Oostra, B.A.; Kraja, A.T.; Province, M.A.; Cupples, L.A.; Heard-Costa, N.L.; Kaprio, J.; Ripatti, S.; Surakka, I.; Collins, F.S.; Saramies, J.; Tuomilehto, J.; Jula, A.; Salomaa, V.; Erdmann, J.; Hengstenberg, C.; Loley, C.; Schunkert, H.; Lamina, C.; Wichmann, H.E.; Albrecht, E.; Gieger, C.; Hicks, A.A.; Johansson, A; Pramstaller, P.P.; Kathiresan, S.; Speliotes, E.K.; Penninx, B.; Hartikainen, A.L.; Jarvelin, M.R.; Gyllensten, U.; Boomsma, D.I.; Campbell, H.; Wilson, J.F.; Chanock, S.J.; Farrall, M.; Goel, A.; Medina-Gomez, C.; Rivadeneira, F.; Estrada, K.; Uitterlinden, A.G.; Heijer, M. den; Kiemeney, L.A.L.M.; et al.,

    2013-01-01

    Given the anthropometric differences between men and women and previous evidence of sex-difference in genetic effects, we conducted a genome-wide search for sexually dimorphic associations with height, weight, body mass index, waist circumference, hip circumference, and waist-to-hip-ratio (133,723

  11. Microstructure and property measurements on in situ TiB2/70Si–Al composite for electronic packaging applications

    International Nuclear Information System (INIS)

    Zhang, L.; Gan, G.S.; Yang, B.

    2012-01-01

    Highlights: ► 2.0 wt.%TiB 2 /70Si–Al composite is prepared by a novel reactive technique. ► In situ TiB 2 particles can refine effectively the primary Si phase. ► The composite exhibited attractive physical and mechanical properties. -- Abstract: A novel reactive technique has been employed in fabrication of 2.0 wt.%TiB 2 /70Si–Al composite for electronic packaging applications. The microstructure and properties of composite were studied using scanning electron microscopy, energy dispersive X-ray spectrometer, coefficient of thermal expansion and thermal conductivity measurements, and 3-point bending tests. The results indicate that the in situ TiB 2 particles can effectively refine the primary Si phase. The property measurements results indicate that the 2.0 wt.%TiB 2 /70Si–Al composite has advantageous physical and mechanical properties, including low density, low coefficient of thermal expansion, high thermal conductivity, high Flexural strength and Brinell hardness.

  12. Reference values of maximum isometric muscle force obtained in 270 children aged 4-16 years by hand-held dynamometry

    NARCIS (Netherlands)

    Beenakker, E A; van der Hoeven, J H; Fock, J M; Maurits, N M

    Since muscle force and functional ability are not related linearly; maximum force can be reduced while functional ability is still maintained. For diagnostic and therapeutic reasons loss of muscle force should be detected as early and accurately as possible. Because of growth factors, maximum muscle

  13. Erratum to "Combustion oscillation study in a kerosene fueled rocket-based combined-cycle engine combustor" [Acta Astronaut. 129 (2016) 260-270

    Science.gov (United States)

    Huang, Zhi-Wei; He, Guo-Qiang; Qin, Fei; Xue, Rui; Wei, Xiang-Geng; Shi, Lei

    2017-03-01

    The publisher regrets that in the above article we found that Table 1 is present online, in the html version in ScienceDirect, but has been omitted in error from the final version of the PDF online and in the print version. The table can be found below:

  14. 17 CFR 270.10f-3 - Exemption for the acquisition of securities during the existence of an underwriting or selling...

    Science.gov (United States)

    2010-04-01

    ...) Are subject to no greater than moderate credit risk; or (ii) If the issuer of the municipal securities... securities are subject to a minimal or low amount of credit risk. (4) Eligible Rule 144A Offering means an... purchased are: (i) Part of an issue registered under the Securities Act of 1933 (15 U.S.C. 77a—aa) that is...

  15. 17 CFR 270.22e-1 - Exemption from section 22(e) of the Act during annuity payment period of variable annuity...

    Science.gov (United States)

    2010-04-01

    ...) of the Act during annuity payment period of variable annuity contracts participating in certain... from section 22(e) of the Act during annuity payment period of variable annuity contracts participating... payment period of variable annuity contracts participating in such account, be exempt from the provisions...

  16. Yield of Radionuclides and Isomers Measured in Fragmentation of the ^{nat}W and ^{186}W (97%) Targets with Protons at 630, 420 and 270 MeV

    CERN Document Server

    Karamian, S A; Chaloun, P; Filossofov, D V; Henzl, V; Henzlova, D; Kalinnikov, V G; Korolev, N A; Lebedev, N A; Novgorodov, A F; Collins, C B; Popescu, I I; Ur, C A

    2004-01-01

    Yields and cross sections of the radioactive nuclide formation have been measured via induced activity gamma-spectra after irradiation of the natural composition W and enriched ^{186)W targets at Dubna synchrocyclotron. Spallation and fission products have been represented among the detected nuclides. The high-spin isomers of Hf and Lu were produced and the isomer-to-ground state ratios could be estimated. The nuclide yields have also been calculated using the LAHET code at 6 values of proton energy in the range from 100 to 800 MeV both for ^{nat)W and for enriched ^{186)W targets. Measured isotope yields are generally in agreement with the calculations, however, the code is incapable to predict the isomer-to-ground state ratios. In experiment, it has been shown that the ^{177m}Lu, ^{178m2}Hf and ^{179m2}Hf high-spin isomers are produced with 2.5 times higher yield in the 97% enriched ^{186)W target as compared to the ^{nat)W target at identical irradiations. This makes significance for the creation of high-a...

  17. 17 CFR 270.18f-2 - Fair and equitable treatment for holders of each class or series of stock of series investment...

    Science.gov (United States)

    2010-04-01

    ... law, or otherwise, to the holders of the outstanding voting securities of a series company shall not... such company, provided that if such a majority is required by State law or otherwise, such requirement... outstanding voting securities of a company required by applicable State law or other applicable requirement...

  18. Functional and genetic epidemiological characterisation of the FFAR4 (GPR120) p.R270H variant in the Danish population

    DEFF Research Database (Denmark)

    Vestmar, Marie Aare; Andersson, Ehm A; Christensen, Charlotte Riis

    2016-01-01

    in the European Network for Genetic and Genomic Epidemiology consortium data (N=34 901-71 175; p>0.70). It was also not associated with waist-hip ratio, glucose metabolism during an oral glucose tolerance test, lipid levels or with markers of adiposity (leptin, adiponectin), inflammation (high-sensitive C...

  19. 17 CFR 270.27e-1 - Requirements for notice to be mailed to certain purchasers of periodic payment plan certificates...

    Science.gov (United States)

    2010-04-01

    ... it may be more or less than it is today. In determining whether to exercise your right to terminate... month.” (4) The name of the plan. (5) The date of the first business day which is 18 months from the... before the expiration of the 18th month, the date of the first business day which is 15 days from the...

  20. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  1. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2011-05-27

    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  2. Rapid Fielding: Case Study Concerning the Fielding of the Multiple Launch Rocket System (MLRS) M270A1 to 2d Battalion 4th Field Artillery Fort Sill, Oklahoma

    National Research Council Canada - National Science Library

    Saiz, Evangeline M

    2006-01-01

    .... This case study investigates one aspect of Army Transformation, accelerated fielding, to determine whether the Army's materiel fielding program properly supports rapidly fielding of essential major...

  3. Epigenetic induction of epithelial to mesenchymal transition by LCN2 mediates metastasis and tumorigenesis, which is abrogated by NF-?B inhibitor BRM270 in a xenograft model of lung adenocarcinoma

    OpenAIRE

    MONGRE, RAJ KUMAR; SODHI, SIMRINDER SINGH; SHARMA, NEELESH; GHOSH, MRINMOY; KIM, JEONG HYUN; KIM, NAMEUN; PARK, YANG HO; SHIN, YOUNG GYU; KIM, SUNG JIN; JIAO, ZHANG JIAO; HUYNH, DO LUONG; JEONG, DONG KEE

    2015-01-01

    Tumor initiating cancer stem-like cells (TICSCs) have recently become the object of intensive study. Human-Lipocalin-2 (hLCN2) acts as a biomarker for cancers. The aim of the present study was to explore new insights regarding the potential role of LCN2 in inducing epithelial to mesenchymal transition (EMT) by transfecting LCN2 into CD133+-A549-TICSCs and its cross-talk with the NF-?B signaling pathway in adenocarcinoma of the lung. Furthermore, EMT was confirmed by transcriptomic analysis, i...

  4. Studi Eksperimental Produk Milling Machine Holkke F - 8 – V Pada Mild Steel 410 × 25 × 25 Mm Dan 270 × 25 × 25 Mm Dengan Menggunakan End Mild Cutter Diameter 12 Mm

    OpenAIRE

    Hariyanto, Hariyanto

    2012-01-01

    In Manufacture Indutry, the quality of workpiece is decided by degree of machine's correctness To produce   a  high  quality    workpiece,   need  a high  quqlity  of  production process. So the quality of product will be importance to fulfill its tolerance will be examined by Study Eksperimental Produk which have been used for 26460  hours ( 1989 - 2011 )..As an example, by  Milling  machine HOLKE  F.- 8 - V...

  5. In-vehicle evaluation of the Globe EV 2300 lead-acid, Delco Remy 150 nickel-zinc, and Eagle-Picher NIF 270 nickel-iron battery systems

    Science.gov (United States)

    Uchiyama, A. A.; Bryant, J. A.

    1984-08-01

    Developmental versions of the Delco-Remy nickel-zinc,the Globe lead-acid, and the Eagle-Picher nickel-iron battery systems designed for electric-vehicle application were evaluated. The systems were tested with the Jet Industries Jet 750 pickup truck and the General Electric/Chrysler ETV 1-2 vehicle on a a chassis dynamometer. Performance of the batteries were determined under: (1) constant-speed; (2) cyclic drive profiles; and (3) continuous and segmented driving conditions. Data are presented on capacity, specific energy, discharge, internal resistance, and temperature characteristics. Maintenance features, such as the single-point watering and venting subsystems, and charging schemes, are addressed and results are discussed.

  6. Decree no.2003-270 on the 24. of march 2003 relative to the protection of persons exposed to ionizing radiations in medical and medico-legal aims and modifying the health code of public health (second part: decrees in Council of State); Decret no. 2003-270 du 24 mars 2003 relatif a la protection des personnes exposees a des rayonnements ionisants a des fins medicales et medico-legales et modifiant le code de la sante publique (deuxieme partie: decrets en Conseil d'Etat)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    This decree concerns the protection of persons exposed to ionizing radiation in medical aims. Three principal points are debated, the justification, the optimization and the procedures to use in practice. The justification requires that it exists an indisputable advantage compared with the risk it can present and no other technique with a comparable efficiency and less risks is available. The optimization needs to use ionizing radiations at the lowest level as reasonably achievable, the third part is devoted to the procedures, the guides and the training of the person who practices the examinations. (N.C.)

  7. 76 FR 56708 - Ohio: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2011-09-14

    ...; 3745-51-30; 3745- From Production of Dyes, 51-32; 3745-270-20; 3745-270-40; Effective Pigments, and... February 16, 2009. From Production of Dyes, Pigments, and Food, Drug and Cosmetic Colorants; Mass Loadings...

  8. ORF Alignment: NC_004567 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... plantarum WCFS1] ... Length = 270 ... Query: 4 ... KDLAYFDELISQKNFSKVAKTFGVSQPTVTTAIKRLESEFGAPLVIRDRVKNT...LHVTASG 63 ... KDLAYFDELISQKNFSKVAKTFGVSQPTVTTAIKRLESEFGAPLVIRDRVKNTLHVTASG Sbjct: 1 ... KDLAYFDELIS

  9. A Segurança Ambiental e os Dilemas da Reconstrução nos países em desenvolvimento arrasados por catástrofes naturais e conflitos: cooperação internacional ou capitalismo de desastre? 10.5102/uri.v4i1.270

    Directory of Open Access Journals (Sweden)

    Cláudio Tadeu Cardoso Fernandes

    2007-08-01

    Full Text Available Many countries around the world have been stricken by large intensity natural phenomena whose consequences bring enormous human and material losses. Other countries have also started to suffer consequences of predatory environmental explorations and environmental transformations more intensely. Developing countries that have been through hard economic difficulties or situations of violent conflicts, apart from suffering with a large amount of deaths, poverty, and bad life conditions, have most of its infra-structure and production chains devastated. As a result, the need for reconstruction of these hard hit countries and the environmental issues have been important topics of discussion in international relations, with the rise of important concepts like sustainable development and global environmental security.

  10. PATTE, GENEVIÈVE. ¿Qué los hace leer así? Los niños, la lectura y las bibliotecas. Ciudad de México: Fondo de Cultura Económica, 2011, 270 págs. ISBN: 978-607-16-0792-8.

    Directory of Open Access Journals (Sweden)

    Fermín Ezpeleta Aguilar

    2012-10-01

    Full Text Available El presente trabajo es el último ensayo de Geneviève Patte (1936-, bibliotecaria francesa excepcional que cuenta entre otras distinciones la Orden Nacional de Mérito o la condecoración de Chevelier des Arts et Lettres por la consagración de toda una vida al fomento de la lectura infantil en todos los dominios geográficos. El libro, traducido al español por Lirio Garduño Buono, se estructura en doce capítulos, cada uno de los cuales puede leerse de forma autónoma, si bien tomados en su conjunto refuerzan el objetivo que se propone la autora, que es el de transmitir mediante argumentos de experiencia propia la clave humana en la que se asienta la labor del bibliotecario, y en particular la del bibliotecario infantil de hoy.

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC270 (Link to dictyBase) - - - Contig-U16504-1 VFC270P (Link... to Original site) VFC270F 199 VFC270Z 518 VFC270P 717 - - Show VFC270 Library VF (Link to library) Clone ID VFC270 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16504-1 Original site URL http://dict...gnments: (bits) Value N U48706 |U48706.1 Dictyostelium discoideum small aggregate formation (smlA) gene, com...on protein. 86 1e-31 4 M19469 |M19469.1 Dictyostelium discoideum 109 gene 3, comp

  12. Enhancing expression of the pseudorabies virus glycoprotein E in yeast and its application in an indirect sandwich ELISA.

    Science.gov (United States)

    Wu, C-Y; Wu, C-W; Liao, C-M; Chien, M-S; Huang, C

    2017-09-01

    The purpose of this study was to produce a recombinant pseudorabies virus (PRV) glycoprotein E (gE) protein with the correct antigenicity for use as a low-cost diagnostic antigen. The gene fragment encoding the amino-terminal immunodominant region of PRV gE (codons 31-270) (gEN31-270) was codon optimized and expressed constitutively and secreted using a Pichia pastoris expression system. Yeast-expressed gEN31-270 (ygEN31-270) was harvested from the culture supernatant, and ygEN31-270 was shown to exhibit N-linked glycosylation. An indirect sandwich enzyme-linked immunosorbent assay (ELISA) was developed using ygEN31-270 as a coating antigen, and the results showed that the assay had high sensitivity and specificity, as well as almost perfect concordance with a commercial gE ELISA kit. The immunodominant region (amino acids 31-270) of gE was expressed successfully in P. pastoris using a codon optimization strategy. ygEN31-270 was secreted and N-glycosylated. The ygEN31-270-based indirect sandwich ELISA showed high sensitivity and specificity to detect gE-specific antibodies in swine serum samples. The ygEN31-270-based indirect sandwich ELISA may provide an alternative method for developing a diagnostic kit with easy manipulation and low cost. © 2017 The Society for Applied Microbiology.

  13. Structure and Dynamics of the Metal Site of Cadmium-Substituted Carboxypeptidase A in Solution and Crystalline States and under Steady-State peptide Catalysis

    DEFF Research Database (Denmark)

    Bauer, R.; Danielsen, E.; Hemmingsen, L.

    1997-01-01

    forms of a hydrogen bond between the Glu-270 carboxyl group and the metal-bound water (Glu-270 COO-...(HOH)M reversible arrow Glu-270 COOH ...(OH-)M) being slow on the time scale of a PAC experiment, i.e., slower than 0.5 mu s. We finally suggest that NQI-1' observed at low pH reflects an enzyme species...

  14. 78 FR 4135 - Programmatic Environmental Impact Statement for the Training Mission and Mission Support...

    Science.gov (United States)

    2013-01-18

    ... INFORMATION CONTACT: Mr. Gene Zirkle at (270) 798-9854, during normal working business hours Monday through.... This includes the formalization of environmental stewardship best management practices (BMPs...

  15. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SGTPSSVDG 60 ... Query: 137 WEDEKLGHAGGPGNFPHFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD 196 ... WEDEKLG...HAGGPGNFPHFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD Sbjct: 121 WEDEKLGHAGGPGNFP...HFCNIRPNPGQMPTATIDEVKAHTGLLIDARDPDRYAGRRELLD 180 ... Query: 257 AMEHAGLPGAAHYVGGWSQWSANPKNPVER 286 ... AMEHAGLPGAAHYVGGWSQWSANPKNPVER Sbjct: 241 AMEHAGLPGAAHYVGGWSQWSANPKNPVER 270

  16. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  17. Disaster Relief and Emergency Medical Services (DREAMS): Texas A&M Digital EMS and the Detection and Remediation of Chemical Threat Agents

    Science.gov (United States)

    2004-10-01

    Proteolysis of Urea-Denatured .4 OPH by Thermolysin at 25 °C t Fragment 4 *Fragmen 2 72 -270 30 -270 Folded Fragment 30 - 364 Fragment 5 30 -71 2 71 7364...blue space-filled model of the inhibitor DE4MBP. The hydrolytic capability of the fragments remains to be determined. By carefully defining the unfolding

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 11, No 1 (2012), Using an ecosystem model to evaluate fisheries management options to mitigate climate change impacts in western Indian Ocean coral reefs, Abstract PDF. Carlos Ruiz Sebastián, Tim R. McClanahan. Vol 4, No 2 (2005), Using Otolity Weight to Estimate Total Mortality of Blackspot ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 9, No 1 (2012), Topical Delivery of Miconazole-Loaded Microemulsion: Formulation Design and Evaluation, Abstract. KC Ofokansi, FC Kenechukwu, L Charles, AA Attama. Vol 9, No 3 (2012), Total Phenol amd Flavonoid contents of Crude Extract and Fractions of Picralima Nitida root bark TH. and ...

  20. 40 CFR 264.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... the waste feed sufficient to provide all information required by § 270.62(b) or § 270.19 of this... the owner or operator must conduct sufficient waste analysis to verify that waste feed to the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 264.341 Section 264...

  1. 78 FR 61251 - Radio Broadcasting Services; Heber Springs, Arkansas.

    Science.gov (United States)

    2013-10-03

    ...] Radio Broadcasting Services; Heber Springs, Arkansas. AGENCY: Federal Communications Commission. ACTION... Allison Sugg, proposing the allotment of Channel 270C3 at Heber Springs, Arkansas, as the community's third local service. Channel 270C3 can be allotted to Heber Springs consistent with the minimum distance...

  2. 48 CFR 302.7000 - Common HHSAR acronyms and abbreviations.

    Science.gov (United States)

    2010-10-01

    ...) 304.803-70(b). AHRQ Agency for Healthcare Research and Quality 301.270(b). AP Acquisition Plan 301.606... Secretary for Preparedness and Response, Office of Acquisitions Management, Contracts and Grants 301.270(b... Assistant Secretary for Facilities Management and Policy 301.607-73(a). DAS/GAPA Deputy Assistant Secretary...

  3. Genetic parameters estimate for milk and mozzarella cheese yield, fat and protein percentage in dairy buffaloes in Brazil

    Directory of Open Access Journals (Sweden)

    H. Tonhati

    2010-02-01

    Full Text Available The aim of this study was analyze the (covariance components and genetic and phenotypic relationships in the following traits: accumulated milk yield at 270 days (MY270, observed until 305 days of lactation; accumulated milk yield at 270 days (MY270/ A and at 305 days (MY305, observed until 335 days of lactation; mozzarella cheese yield (MCY and fat (FP and protein (PP percentage, observed until 335 days of lactation. The (covariance components were estimated by Restricted Maximum Likelihood methodology in analyses single, two and three-traits using animal models. Heritability estimated for MY270, MY270/A, MY305, MCY, FP and PP were 0.22; 0.24, 0.25, 0.14, 0.29 and 0.40 respectively. The genetic correlations between MCY and the variables MY270, MY270/A, MY305, PP and FP was: 0.85; 1.00; 0.89; 0.14 and 0.06, respectively. This way, the selection for the production of milk in long period should increase MCY. However, in the search of animals that produce milk with quality, the genetic parameters suggest that another index should be composed allying these studied traits.

  4. 75 FR 43115 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ..., as amended, is an appendix of the National Oil and Hazardous Substances Pollution Contingency Plan... the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3-90, and... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Intent to Partially...

  5. Detection of measles IgM antibodies in children at Kaduna ...

    African Journals Online (AJOL)

    Measles virus IgM antibodies virus was assayed for in 270 sera from children aged 5 months to 8 years attending Yusuf Dantsoho Memorial Hospital, Kaduna, Northern Nigeria, using ELISA. Out of the 270 sera, 192(71.1%) tested positive to measles IgM and 78(28.9%) negative. The sample distribution was 137 from males, ...

  6. 77 FR 69447 - Inland Waterways Users Board

    Science.gov (United States)

    2012-11-19

    ... Carroll Convention Center at the Paducah McCracken County Convention and Expo Center, 414 Park Street, Paducah, Kentucky 42001 at 270-408-1346 or [email protected] , with accommodations at the Fairfield Inn and Suites Paducah, 3950 Coleman Crossing Circle, Paducah, Kentucky 42001 at 270-442-1700...

  7. Prevalence of Coxsackievirus A6 and Enterovirus 71 in Hand, Foot and Mouth Disease in Nanjing, China in 2013.

    Science.gov (United States)

    Hu, Ya-Qian; Xie, Guang-Cheng; Li, Dan-Di; Pang, Li-Li; Xie, Jing; Wang, Peng; Chen, Ying; Yang, Jing; Cheng, Wei-Xia; Zhang, Qing; Jin, Yu; Duan, Zhao-Jun

    2015-09-01

    Although hand, foot and mouth disease (HFMD) has been strongly associated with enterovirus 71 (EV71), coxsackievirus A16 (CVA16) and other enteroviruses, studies regarding coxsackievirus A6 (CVA6) infection in HFMD are limited. The aim of this study was to identify the major etiological agents causing HFMD in Nanjing in 2013 and explore the clinical and genetic characteristics of the prevalent enterovirus (EV) types in HFMD. A total of 394 throat swabs were collected from hospitalized children diagnosed with HFMD from April to July 2013. EVs were detected by reverse transcription polymerase chain reaction of 5' UTR sequences. Genotyping and phylogenetic analysis were based on VP4 sequences. Demographic and clinical data were obtained. Of the specimens, 68.5% (270/394) were positive for EVs. The genotypes and detection rates were CVA6, 30.00% (81/270); EV71, 17.41% (47/270); HRV, 11.11% (30/270); CVA10, 3.33% (9/270); CVA2, 1.11% (3/270); CVA16, 0.74% (2/270); EV68, 0.37% (1/270); echovirus 6, 0.37% (1/270); echovirus 9, 0.37% (1/270), respectively. Patients infected with CVA6 displayed symptoms atypical of HFMD, including larger vesicles on their limbs and buttocks. Phylogenetic analysis revealed 2 genetically distinct CVA6 strains that circulated independently within the region. Patients infected with CVA6 were more likely to have abnormal periphery blood white blood cell and C-reactive protein levels, while EV71 was more likely to infect the central nervous system, as indicated by clinical manifestations and white blood cell analysis of cerebrospinal fluid. Multiple EV genotypes contributed to HFMD in Nanjing in 2013, and CVA6 was the dominant genotype. The clinical presentation of CVA6 infection differs from that of EV71 infection in HFMD.

  8. Multiple arrhythmic syndromes in a newborn, owing to a novel mutation in SCN5A

    Science.gov (United States)

    Calloe, Kirstine; Schmitt, Nicole; Grubb, Soren; Pfeiffer, Ryan; David, Jens-Peter; Kanter, Ronald; Cordeiro, Jonathan M.; Antzelevitch, Charles

    2011-01-01

    Background Mutations in the SCN5A gene have been linked to Brugada syndrome (BrS), conduction disease, Long QT syndrome (LQT3), atrial fibrillation (AF), and to pre- and neonatal ventricular arrhythmias. Objective The objective of this study is to characterize a novel mutation in Nav1.5 found in a newborn with fetal chaotic atrial tachycardia, postpartum intraventricular conduction delay, and QT interval prolongation. Methods Genomic DNA was isolated and all exons and intron borders of 15 ion-channel genes were sequenced, revealing a novel missense mutation (Q270K) in SCN5A. Nav1.5 wild type (WT) and Q270K were expressed in CHO-K1 with and without the Navβ1 subunit. Results Patch-clamp analysis showed ~40% reduction in peak sodium channel current (INa) density for Q270K compared with WT. Fast and slow decay of INa were significantly slower in Q270K. Steady-state activation and inactivation of Q270K channels were shifted to positive potentials, and window current was increased. The tetrodotoxin-sensitive late INa was increased almost 3-fold compared with WT channels. Ranolazine reduced late INa in WT and Q270K channels, while exerting minimal effects on peak INa. Conclusion The Q270K mutation in SCN5A reduces peak INa while augmenting late INa, and may thus underlie the development of atrial tachycardia, intraventricular conduction delay, and QT interval prolongation in an infant. PMID:21895525

  9. Hydrogen as an energy carrier. Final report; Wasserstoff als Energietraeger. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Rebholz, H. [ed.

    1998-12-01

    This final report of the Special Field of Research 270 (SFB 270) documents the work and results of the four promotion phases from 1989 to 1998, presented in reports on 15 part-projects. From its inception, SFB 270, which bears the title ''Hydrogen as an Energy Carrier'', has been dedicated to two fields of work: in Project Area A to the production of hydrogen (7 part-projects) and in Project Area B to the transport and storage of hydrogen (8 part-projects). The scientific results of the part-projects have also been presented in detail in the progress reports and interim reports of 1991, 1994 and 1997. Some of them have also been presented at the colloquiums of SFB 270. Twelve part-projects have been abstracted individually for the ENERGY database. [German] Der vorliegende Abschlussbericht des Sonderforschungsbereichs 270 dokumentiert die Arbeiten und Ergebnisse der vier Foerderungsphasen von 1989 bis 1998. Sie sind in den Berichten von 15 Teilprojekten wiedergegeben. Der Sonderforschungsbereich 270 'Wasserstoff als Energietraeger' hat sich von Anfang an zwei Aufgabengebieten gewidmet: Im Projektbereich A der Herstellung von Wasserstoff (7 Teilprojekte) und im Projektbereich B dem Transport und der Speicherung von Wasserstoff (8 Teilprojekte). Wissenschaftliche Ergebnisse der Teilprojekte sind ausfuehrlich auch in den Arbeits- und Ergebnisberichten 1991, 1994 und 1997 wiedergegeben. Sie wurden auch, in Teilen, in entsprechenden Kolloquien des SFB 270 praesentiert. Fuer die Datenbank ENERGY wurden 12 Teilprojekte separat aufgenommen. (orig.)

  10. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  11. Control and optimization system

    Science.gov (United States)

    Xinsheng, Lou

    2013-02-12

    A system for optimizing a power plant includes a chemical loop having an input for receiving an input parameter (270) and an output for outputting an output parameter (280), a control system operably connected to the chemical loop and having a multiple controller part (230) comprising a model-free controller. The control system receives the output parameter (280), optimizes the input parameter (270) based on the received output parameter (280), and outputs an optimized input parameter (270) to the input of the chemical loop to control a process of the chemical loop in an optimized manner.

  12. Surface effects during exoelectron-emission of BeO ceramics

    International Nuclear Information System (INIS)

    Siegel, V.; Kirchner, H.H.

    1979-01-01

    Studying the behaviour of the two thermally stimulated exoelectron emission (TSEE) maxima of BeO ceramics at about 270 0 C und 325 0 C it can be shown that the TSEE maximum at 270 0 C is closely connected with adsorption and desorption processes occuring on the surface of the samples. In particular, this TSEE maximum is strongly influenced as well by donor-like behaviour of adsorbed hydrogen and lithium as by acceptor-like behaviour of alcohols and nitrides of the lithium. The detailed surface processes leading to the apperance or disapperance of the TSEE maximum at 270 0 C are discussed. (orig.) [de

  13. Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication, Environmental Protection Agency Number ID4890008952

    Energy Technology Data Exchange (ETDEWEB)

    Holzemer, Michael J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hart, Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-04-01

    Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication for the Idaho National Laboratory Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Partial Permit, PER-116. This Permit Reapplication is required by the PER-116 Permit Conditions I.G. and I.H., and must be submitted to the Idaho Department of Environmental Quality in accordance with IDAPA 58.01.05.012 [40 CFR §§ 270.10 and 270.13 through 270.29].

  14. Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2013-01-01

    Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Determination of Temperature/Moisture Sensitive Composite Properties

    National Research Council Canada - National Science Library

    Tomblin, John

    2001-01-01

    ...). A series of dynamic mechanical analysis (DMA) and static mechanical tests were performed using specimens conditioned at three relative humidity levels and tested at six different temperatures for two commonly used 270 deg F cure prepreg systems...

  16. Improvement in the outcome of invasive fusariosis in the last decade

    DEFF Research Database (Denmark)

    Nucci, M; Marr, K A; Vehreschild, M J G T

    2014-01-01

    .001), whereas voriconazole (32% vs. 2%, p voriconazole, 53...... at end of treatment (HR 2.70, 95% CI 1.57-4.65, p voriconazole and combination therapies. There has been a 21% increase in survival rate...

  17. Osmotic stress and recovery in field populations of Zygnema sp. (Zygnematophyceae, Streptophyta) on Svalbard (High Arctic) subjected to natural desiccation

    Czech Academy of Sciences Publication Activity Database

    Pichrtová, Martina; Hájek, Tomáš; Elster, Josef

    2014-01-01

    Roč. 89, č. 2 (2014), s. 270-280 ISSN 0168-6496 Institutional support: RVO:67985939 Keywords : ecophysiology * green algae * plasmolysis Subject RIV: EH - Ecology, Behaviour Impact factor: 3.568, year: 2014

  18. The origin and hydrothermal mobilization of carbonaceous matter associated with Paleoproterozoic orogenic-type gold deposits of West Africa

    Czech Academy of Sciences Publication Activity Database

    Kříbek, B.; Sýkorová, Ivana; Machovič, V.; Knésl, I.; Laufek, F.; Zachariáš, J.

    2015-01-01

    Roč. 270, November 01 (2015), s. 300-317 ISSN 0301-9268 Institutional support: RVO:67985891 Keywords : carbonaceous matter * gold deposits * graphite Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.037, year: 2015

  19. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  20. Prožitek architektury

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2008-01-01

    Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Correlates of Weapon Carrying in School among Adolescents in Three Countries

    Czech Academy of Sciences Publication Activity Database

    Stickley, A.; Koyanagi, A.; Koposov, R.; Blatný, Marek; Hrdlička, M.; Schwab-Stone, M.; Ruchkin, V.

    2015-01-01

    Roč. 39, č. 1 (2015), s. 99-108 ISSN 1945-7359 Institutional support: RVO:68081740 Keywords : adolescent * Czech Republic * Russia * United States * weapon carrying Subject RIV: AN - Psychology Impact factor: 1.270, year: 2015

  2. South African Journal of Education - Vol 22, No 4 (2002)

    African Journals Online (AJOL)

    Analysing the role of ICT in bridging the digital divide amongst learners · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marlien Herselman, K.G. Britton, 270-274 ...

  3. 78 FR 33441 - Importer of Controlled Substances; Notice of Registration; Caraco Pharmaceutical Laboratories, LTD

    Science.gov (United States)

    2013-06-04

    ... Enforcement Administration Importer of Controlled Substances; Notice of Registration; Caraco Pharmaceutical..., 78 FR 12101, Caraco Pharmaceutical Laboratories, Ltd., 270 Prospect Plains Road, Cranbury, New Jersey... registration of Caraco Pharmaceutical Laboratories, Ltd., to import the basic class of controlled substance is...

  4. 78 FR 12101 - Importer of Controlled Substances; Notice of Application; Caraco Pharmaceutical Laboratories, LTD.

    Science.gov (United States)

    2013-02-21

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Importer of Controlled Substances; Notice of Application; Caraco Pharmaceutical... November 22, 2012, Caraco Pharmaceutical Laboratories, Ltd., 270 Prospect Plains Road, Cranbury, New Jersey...

  5. Migrace v české etnologii: náměty k obohacení migrační teorie

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    2016-01-01

    Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Towards supported bolaamphiphile membranes for water filtration: Roles of lipid and substrate

    NARCIS (Netherlands)

    Kaufman, Y.; Grinberg, S.; Linder, C..; Heldman, E.; Gilron, J.; Shen, Yue-xiao; Kumar, M.; Lammertink, Rob G.H.; Freger, V.

    2014-01-01

    Supported biomimetic membranes hold potential for applications such as biosensors and water purification by filtration. The current paper reports on the preparation of a supported bolaamphiphile membrane on two polymeric nanofiltration membranes: NF-270 made of polyamide with carboxylic surface

  7. Sounding Cratonic Fill in Small Buried Craters Using Ground Penetrating Radar: Analog Study to the Martian Case

    OpenAIRE

    Heggy , Essam; Paillou , Philippe

    2006-01-01

    We report results from a 270 MHz GPR survey performed on a recently discovered impact field in the southwestern Egyptian desert. The investigation suggests the ability of radar techniques to detect small-buried craters and probe their filling

  8. Peer Instruction in the Learning Laboratory: A Strategy To Decrease Student Anxiety.

    Science.gov (United States)

    Owens, Laura D.; Walden, Debra J.

    2001-01-01

    To decrease nursing students' anxiety during psychomotor skills testing in learning laboratories, paid peer instructors were trained to assist. Over 3 years, 270 students participated and reported positive outcomes. (SK)

  9. Riccioli Revisited. A New Analysis of Giovanni Battista Riccioli’s New Almagest

    Directory of Open Access Journals (Sweden)

    Anna-Luna Post

    2016-09-01

    Full Text Available Review of: Christopher M. Graney, Setting Aside All Authority. Giovanni Battista Riccioli and the Science against Copernicus in the Age of Galileo, University of Notre Dame Press, 2015, 270 p., ill., ISBN: 9780268029883, $29.00.

  10. Tahseen, Prof. Qudsia

    Indian Academy of Sciences (India)

    Specialization: Nematology, Classical & Molecular Taxonomy, Developmental Biology & Ecology & Functional Diversity of Soil and Freshwater Nematodes Address: Professor, Department of Zoology, Aligarh Muslim University, Aligarh 202 002, U.P.. Contact: Office: (0571) 270 0921-23/3440. Residence: 74174 81607

  11. 77 FR 33009 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-06-04

    ... and Exchange Commission, Office of Investor Education and Advocacy, Washington, DC 20549-0213... the type and general character of the securities to be issued. Rule 8b-22 (17 CFR 270.8b-22) provides...

  12. 78 FR 14352 - Notice of Approved Class III Tribal Gaming Ordinances

    Science.gov (United States)

    2013-03-05

    .... Manchester Band of Pomo Indians of the Manchester-Point Arena Rancheria 128. Manzanita Band of Mission...-Nine Palms Band of Mission Indians 269. United Auburn Indian Community 270. Upper Sioux Community 271...

  13. Influence of group member familiarity on online collaborative learning

    NARCIS (Netherlands)

    Janssen, Jeroen; Erkens, Gijsbert; Kirschner, Paul A.; Kanselaar, Gellof

    2010-01-01

    Janssen, J. J. H. M., Erkens, G., Kirschner, P. A., & Kanselaar, G. (2009). Influence of group member familiarity on online collaborative learning computers in human behaviour. Computers in Human Behavior, 25, 261-270.

  14. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275 ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.761, year: 2015

  15. Condensed-matter physics: Magnetism in flatland

    Science.gov (United States)

    Samarth, Nitin

    2017-06-01

    A pair of two-dimensional materials have been shown to exhibit ferromagnetism -- the familiar type of magnetism found in iron bar magnets. Such materials could have applications from sensing to data storage. See Letters p.265 & p.270

  16. 7 CFR 3015.84 - Request for advance or reimbursement.

    Science.gov (United States)

    2010-01-01

    ... FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Financial Reporting... nonconstruction grants or cooperative agreements shall request Treasury check advance payments on Standard Form... cooperative agreements shall request reimbursement on Standard Form 270, Request for Advance or Reimbursement...

  17. Renal Fanconi syndrome with ultrastructural defects in lysinuric protein intolerance

    NARCIS (Netherlands)

    Benninga, M. A.; Lilien, M.; de Koning, T. J.; Duran, M.; Versteegh, F. G. A.; Goldschmeding, R.; Poll-The, B. T.

    2007-01-01

    Renal Fanconi syndrome developed rapidly in a 3-year-old Moroccan girl with established lysinuric protein intolerance. She was hospitalized because of lowered consciousness, uncoordinated movements and hepatosplenomegaly after a febrile period. Laboratory investigations revealed plasma ammonia 270

  18. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. STOOKE SMALL BODIES MAPS V3.0

    Data.gov (United States)

    National Aeronautics and Space Administration — These maps of small solar system bodies have been prepared by Philip Stooke of the University of Western Ontario. This data set includes 270 map sheets of six...

  20. Job Satisfaction and Performance: The Moderating Effects of Value Attainment and Affective Disposition.

    Science.gov (United States)

    Hochwarter, Wayne A.; Perrewe, Pamela L.; Ferris, Gerald R.; Brymer, Robert A.

    1999-01-01

    A study of 270 hotel managers found that the strongest positive relationship between job satisfaction and performance occurred when high attainment of values associated with work was coupled with high-positive or low-negative affective disposition. (SK)

  1. 78 FR 64200 - Caribbean Fishery Management Council; Public Meetings

    Science.gov (United States)

    2013-10-28

    ... Caribbean Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries Service (NMFS), National... held at the Caribbean Fishery Management Council Headquarters, located at 270 Mu[ntilde]oz Rivera...

  2. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1804 ... IDRC's Democratic Governance, Women's Rights and Gender Equality initiative is supporting a body of comparative research on whether and how democratic processes and institutions are responding to women's rights and gender equality. Project ...

  3. Euroopa Liidu 7. Raamprogrammi projekt FLAVOURE / Marge Malbe

    Index Scriptorium Estoniae

    Malbe, Marge, 1968-

    2011-01-01

    2009. a sai Eesti Maaviljeluse Instituut 843,270.00 € suuruse Euroopa Liidu finantseeringu 3 aastat kestva projekti FLAVOURE (Food and Feed Laboratory of Varied and Outstanding Research in Estonia) läbiviimiseks ja koordineerimiseks

  4. 75 FR 72773 - Empowering Consumers to Avoid Bill Shock; Consumer Information and Disclosure

    Science.gov (United States)

    2010-11-26

    ... services should be exempt from any usage alert requirements that might evolve from this proceeding to... charges can result in significant expenditures of time, effort, and money for more than 270 million...

  5. TMX-U [Tandem Mirror Experiment-Upgrade]: Final report, Volume 2

    International Nuclear Information System (INIS)

    Porter, G.D.

    1988-01-01

    This paper discusses the plasma control and the physics accomplishments of the Tandem Mirror Experiment-Upgrade. This particular volume discusses fueling, ion heating, Fokker-Planck modeling, plasma stability and technical development. 270 refs

  6. High capacity hydrogen storage nanocomposite materials

    Energy Technology Data Exchange (ETDEWEB)

    Zidan, Ragaiy; Wellons, Matthew S.

    2017-12-12

    A novel hydrogen absorption material is provided comprising a mixture of a lithium hydride with a fullerene. The subsequent reaction product provides for a hydrogen storage material which reversibly stores and releases hydrogen at temperatures of about 270.degree. C.

  7. Positive train control test bed interoperability upgrades.

    Science.gov (United States)

    2013-02-01

    Transportation Technology Center, Inc. (TTCI) upgraded the Positive Train Control (PTC) Test Bed to support additional PTC testing configurations under Federal Railroad Administration (FRA) Task Order 270. The scope of work provided additional PTC Co...

  8. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 439 ... Tobacco Control Research, Dissemination and Networking in Lebanon. The Tobacco Control Research Group (TCRG), University of Beirut (AUB), is a multidisciplinary team of professionals from the health sciences, medicine, chemistry and engineering departments.

  9. OPERATION SUNBEAM, SHOT SMALL BOY. Project Officer’s Report. Project 2.9. Fallout Collection and Gross Sample Analysis

    Science.gov (United States)

    1985-09-01

    irregular depression in the playa without the characteristic lip of a true surface burst. The lO-foot height-of-burst and the exca- vations in the...90E 0 8 W 270 ’ P1 I N 360 E 90 SIB E900 S Sol 00 00~m E 9 WE~ 270 S18 1AM I/ IAM /Z~ AVPM /41l 962 3PM E4 01 0 ________If___E 120 Figure 3.3 Wind

  10. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  11. Agro. no 2 december 233

    African Journals Online (AJOL)

    without proper soil fertility management practices hve been identified as one of the most important factor militating ..... Sig. 0.022. 0.001. 0.067. 0.046. 0.361. 0.270. 0.270. 0.388. 0.195. Exp. Model Chi-square 93.7***. Overall case correctly predicted = 84.3%. *** Significant at 1%, ** significant at 5%, * significant at 10%. 131.

  12. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín

    2013-05-01

    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  13. Detailed Analysis of the Asteroid Pair (6070) Rheinland and (54827) 2001 NQ8

    Czech Academy of Sciences Publication Activity Database

    Vokrouhlický, D.; Pravec, Petr; Ďurech, J.; Hornoch, Kamil; Kušnirák, Peter; Galád, Adrián; Vraštil, J.; Kučáková, Hana; Pollock, J.; Ortiz, J.L.; Morales, N.; Gaftonyuk, N. M.; Pray, D. P.; Krugly, Yu. N.; Inasaridze, R.Ya.; Ayvazian, V.; Molotov, I.E.; Colazo, C.A.

    2017-01-01

    Roč. 153, č. 6 (2017), 270/1-270/17 ISSN 0004-637X R&D Projects: GA ČR(CZ) GA17-00774S Grant - others:GA ČR(CZ) GA13-01308S Institutional support: RVO:67985815 Keywords : minor planets * asteroids * general Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.533, year: 2016

  14. Understanding Active Metal Reaction Kinetics with Cu–Mg ...

    Indian Academy of Sciences (India)

    The exchange rates of oxidation reactions. Mg(s)+. Solution. E(volt) Speed. CuSO4. 2.70 fast. CuCl2. 2.70 fast. PbCl2. 2.23 fast. Pb(NO3)2. 2.23 fast. NiSO4. 2.11 fast ... Low compre- hension levels (around 40%) were observed. Further, 12 students were divided into four groups of three each, and test sheets were provided.

  15. 75 FR 43082 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ... and Hazardous Substances Pollution Contingency Plan; National Priorities List: Partial Deletion of the... pertains to the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L, 2-70, 2-70L, 3-89, 3... Priorities List (NPL). This partial deletion pertains to the soil and groundwater of parcels 24, 27, 28, 2-53...

  16. 78 FR 14801 - Veterinary Oversight of Antimicrobial Use in Livestock: Impact on Stakeholders; Public Meetings...

    Science.gov (United States)

    2013-03-07

    .... 138), 2355 Nashville Rd., Bowling Green, KY 42101; 270-745-1908; FAX: 270-745-1911; http://www.wku.edu..., from 8:30 a.m. to 12:30 p.m., Best Western Ramkota Hotel & Conference Center (Amphitheater II), 920... meeting in Bowling Green, KY; April 23, 2013, from 9:45 a.m. to 11 a.m. on the day of the meeting in...

  17. Genetic and bibliographic information: CERKL [GenLibi

    Lifescience Database Archive (English)

    Full Text Available CERKL ceramide kinase-like human retinitis pigmentosa (MeSH) Eye Diseases (C11) > Eye Diseases..., Hereditary (C11.270) > Retinitis Pigmentosa (C11.270.684) Eye Diseases (C11) > Retinal Diseases... (C11.768) > Retinal Degeneration (C11.768.585) > Retinitis Pigmentosa (C11.768.585.731) Congenital, Hereditary, and Neonatal Disease...s and Abnormalities (C16) > Genetic Diseases, Inborn (C16.320) > Eye Diseases

  18. The features of anaphylactic shock in Yogyakarta, Indonesia

    OpenAIRE

    R.H.Yudono, R.H.Yudono

    2015-01-01

    An anaphylactic shock survey was carried out in Yogyakarta, Indonesia, during November December 1981. Physicians whith private practice were asked to complete the questionnaires given by the author. These questionnaires were collected without physician's identities.One hundred out of 135 respondents have had 270 patients suffering from anaphylactic shock accident. Two hundred and sixty one (96.7%) out of 270 patients had good recovery and 9 patients (3.3%) were dead. Preconditioning disturban...

  19. Subchronic organophosphorus ester-induced delayed neurotoxicity in mallards

    Science.gov (United States)

    Hoffman, D.J.; Sileo, L.; Murray, H.C.

    1984-01-01

    Eighteen-week-old mallard hens received 0, 10, 30, 90, or 270 ppm technical grade EPN (phenylphosphonothioic acid O-ethyl-O-4-nitrophenyl ester) in the diet for 90 days. Ataxia was first observed in the 270-ppm group after 16 days, in the 90-ppm group after 20 days, in the 30-ppm group after 38 days; 10 ppm failed to produce ataxia. By the end of 90 days all 6 birds in the 270-ppm group exhibited ataxia or paralysis whereas 5 of 6 birds in the 90-ppm group and 2 of 6 birds in the 30-ppm group were visibly affected. Treatment with 30 ppm or more resulted in a significant reduction in body weight. Brain neurotoxic esterase activity was inhibited by averages of 16, 69, 73, and 74% in the 10-, 30-, 90-, and 270-ppm groups, respectively. Brain acetylcholinesterase, plasma cholinesterase, and plasma alkaline phosphatase were significantly inhibited as well. Distinct histopathological effects were seen in the 30-, 90-, and 270-ppm groups which included demyelination and degeneration of axons of the spinal cord. Additional ducks were exposed in a similar manner to 60-, 270-, or 540-ppm leptophos (phosphonothioic acid O-4-bromo-2,5-dichlorophenyl-O-methylphenyl ester) which resulted in similar behavioral, biochemical, and histopathological alterations. These findings indicate that adult mallards are probably somewhat less sensitive than chickens to subchronic dietary exposure to organophosphorus insecticides that induce delayed neurotoxicity.

  20. Filamin isoforms in molluscan smooth muscle.

    Science.gov (United States)

    Méndez-López, Lucía; Hellman, Ulf; Ibarguren, Izaskun; Villamarín, J Antonio

    2012-12-01

    The role of filamin in molluscan catch muscles is unknown. In this work three proteins isolated from the posterior adductor muscle of the sea mussel Mytilus galloprovincialis were identified by MALDI-TOF/TOF MS as homologous to mammalian filamin. They were named FLN-270, FLN-230 and FLN-105, according to their apparent molecular weight determined by SDS-PAGE: 270kDa, 230kDa and 105kDa, respectively. Both FLN-270 and FLN-230 contain the C-terminal dimerization domain and the N-terminal actin-binding domain typical of filamins. These findings, together with the data from peptide mass fingerprints, indicate that FLN-270 and FLN-230 are different isoforms of mussel filamin, with FLN-230 being the predominant isoform in the mussel catch muscle. De novo sequencing data revealed structural differences between both filamin isoforms at the rod 2 segment, the one responsible for the interaction of filamin with the most of its binding partners. FLN270 but not FLN230 was phosphorylated in vitro by cAMP-dependent protein kinase. As for the FLN-105, it would be an N-terminal proteolytic fragment generated from the FLN-270 isoform or a C-terminally truncated variant of filamin. On the other hand, a 45-kDa protein that copurifies with mussel catch muscle filamins was identified as the mussel calponin-like protein. The fact that this protein coelutes with the FLN-270 isoform from a gel filtration chromatography suggests a specific interaction between both proteins. Copyright © 2012 Elsevier B.V. All rights reserved.

  1. Subjective and objective image differences in pediatric computed tomography cardiac angiography using lower iodine concentration

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Jae-Yeon [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Pusan National University Yangsan Hospital, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Choo, Ki Seok; Choi, Yoon Young; Kim, Jin Hyeok; Ryu, Hwaseong; Kim, Yong-Woo; Jeon, Ung Bae; Nam, Kyung Jin [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Han, Junhee [Pusan National University Yangsan Hospital, Division of Biostatistics, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of)

    2017-05-15

    Several recent studies showed the optimal contrast enhancement with a low-concentration and iso-osmolar contrast media in both adult and pediatric patients. However, low contrast media concentrations are not routinely used due to concerns of suboptimal enhancement of cardiac structures and small vessels. To evaluate the feasibility of using iso-osmolar contrast media containing a low iodine dose for CT cardiac angiography at 80 kilovolts (kVp) in neonates and infants. The iodixanol 270 group consisted of 79 CT scans and the iopromide 370 group of 62 CT scans in patients ≤1 year old. Objective measurement of the contrast enhancement was analyzed and contrast-to-noise ratios of the ascending aorta and left ventricle were calculated. Regarding subjective measurement, a four-point scale system was devised to evaluate degrees of contrast enhancement, image noise, motion artifact and overall image quality of each image set. Reader performance for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment was evaluated. Group objective and subjective measurements were nonsignificantly different. Overall sensitivity, specificity and diagnostic accuracy for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment were 42.8%, 59%, and 50%, respectively. The application of iodixanol 270 achieved optimal enhancement for performing pediatric cardiac CT angiography at 80 kVp in neonates and infants. Objective measurements of contrast enhancement and subjective image quality assessments were not statistically different in the iodixanol 270 and iopromide 370 groups. (orig.)

  2. The two domain hypothesis of limb prepattern and its relevance to congenital limb anomalies.

    Science.gov (United States)

    Tao, Hirotaka; Kawakami, Yasuhiko; Hui, Chi-Chung; Hopyan, Sevan

    2017-07-01

    Functional annotation of mutations that cause human limb anomalies is enabled by basic developmental studies. In this study, we focus on the prepatterning stage of limb development and discuss a recent model that proposes anterior and posterior domains of the early limb bud generate two halves of the future skeleton. By comparing phenotypes in humans with those in model organisms, we evaluate whether this prepatterning concept helps to annotate human disease alleles. WIREs Dev Biol 2017, 6:e270. doi: 10.1002/wdev.270 For further resources related to this article, please visit the WIREs website. © 2017 Wiley Periodicals, Inc.

  3. Sistem Pengukur Suhu dan Kelembaban Ruang Server

    Directory of Open Access Journals (Sweden)

    Muhammad Fahmi Awaj

    2014-01-01

    Full Text Available Makalah ini membahas tentang perancangan sistem pengukur suhu dan kelembaban ruang server yang dapat meningkatkan efisiensi daya listrik dengan menggunakan arduino. Sistem terdiri dari sensor DHT 11 yang berfungsi untuk mengambil data berupa suhu dan kelembaban ruang server kemudian ditampilkan dalam LCD 16x2. Data suhu dan kelembaban ditampilkan juga ke dalam website dengan menggunakan IP address tertentu yang sebelumnya board arduino telah terhubung dengan ethernet shield. Suhu yang melebihi 270C akan menyalakan relay dan kipas serta sistem akan mengirim peringatan sms secara otomatis kepada administrator ruang server melalui sistem sms secara periodik hanya setiap tiga detik. Sistem peringatan sms akan berhenti jika suhu kurang 270C.

  4. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    1993-01-01

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  5. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  6. Low-energy electron transmission through high aspect ratio Al O nanocapillaries

    DEFF Research Database (Denmark)

    Milosavljević, A.R.; Jureta, J.; Víkor, G.

    2009-01-01

    Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined with resp......Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined...

  7. International Conference on Indium Phosphide and Related Materials (22nd) (IPRM) held on 31 May-4 Jun 2010, at Takamatsu Symbol Tower, Kagawa, Japan

    Science.gov (United States)

    2010-08-13

    Integrada HF2007-0014 and by the Consejeria de Educacion of the Junta de Castilla y Leon (Spain) through the projects GR270 and SA0I9A08...Project TFC2007- 6I259/MIC and the Accion Integrada HF2007-00I4. by the Consejeria de Educacion . Junta de Castilla y Leon through Projects SA0I9A08 and...and by the Consejeria de Educacion of the Junta de Castilla y Leon (Spain) through the projects GR270 and SA0I9A08. References (1) D. Mittleman

  8. Mud Pit Risk-Based Closure Strategy Report, Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Brain Hoenes

    2004-08-01

    This report presents the findings of the human and ecological risk assessment for the NTS mud pits. The risk assessment utilizes data from 52 of the 270 NTS mud pits in conjunction with corroborative data from 87 other DOE mud pits associated with nuclear testing (at locations on the NTS, in the western United States, and Alaska) as well as relevant process knowledge. Based on the risk assessment findings, the report provides a strategy for further evaluation, characterization, and closure of all 270 NTS mud pit CASs using the Streamlined Approach for Environmental Restoration (SAFER).

  9. Data on nation-wide activity in intensive cardiac care units in France in 2014

    Directory of Open Access Journals (Sweden)

    François Roubille

    2017-08-01

    A French nation-wide database on 277,845 admissions in 270 ICCUs”.(10.1016/j.ijcard.2017.04.002 (Roubille et al., 2017 [1]: the main characteristics of the pathologies managed in the intensive cardiac care units (ICCUs, the details on the interventions performed and the main differences between centers following the size of the centers and a figure presenting the monthly variations of admissions in the ICCUs in France in a total of 277,845 patients in 270 centers admitted at least one time in the ICCUs in 2014 (exhaustive data.

  10. 12 MW

    DEFF Research Database (Denmark)

    Hasager, Charlotte Bay; Pena Diaz, Alfredo; Mikkelsen, Torben

    '12MW: final report' is for the project with the full title ‘12 MW wind turbines: the scientific basis for their operation at 70 to 270 m height offshore’ that had the goal to experimentally investigate the wind and turbulence characteristics between 70 and 270 m above sea level and thereby...... establish the scientific basis relevant for the next generation of huge 12 MW wind turbines operating offshore. The project started 1st October 2005 and ended 31st March 2009. Firstly was conducted a 6-month experiment at the Horns Rev offshore wind farm deploying a lidar and a sodar on the transformer...

  11. An Investigation of the Relative Safety of Alternative Navigational System Designs for the New Sunshine Skyway Bridge: A CAORF (Computer Aided Operations Research Facility) Simulation.

    Science.gov (United States)

    1985-09-01

    34R12" was replaced with buoy "R20" and moved: 27. Buoy "R2" was renamed " RiO " and moved to: L 270 36’ 09" N/X 820 44" 20"W, and is FI.R. L 270 36’ 07...London, Connecticut 17. Puget Sound, Washington 0 Maneuver a waterway or follow a course 18. Port Arun, Indonesia 19. Coatzacoalcos , Mexico 0 Make

  12. Muscle fiber characteristics and performance correlates of male Olympic-style weightlifters.

    Science.gov (United States)

    Fry, Andrew C; Schilling, Brian K; Staron, Robert S; Hagerman, Fredrick C; Hikida, Robert S; Thrush, John T

    2003-11-01

    Biopsies fro the vastus lateralis muscle of male weightlifters (WL; n=6; X +/- SE, age=27.0 +/- 2.1 years), and non-weight-trained men (CON; n=7; age=27.0 +/- 2.0 years) were compared for fiber types, myosin heavy chain (MHC) and titin content, and fiber type-specific capillary density. Differences (pWeightlifting performances and vertical jump power were correlated with type II fiber characteristics. These results suggest that successful weightlifting performance is not dependent on IIB fibers, and that weightlifters exhibit large percentages of type IIA muscle fibers and MHC IIa isoform content.

  13. A Setback-Drag Simulator

    Science.gov (United States)

    1982-02-01

    Crush strength—3.3 k-psi (0.23 k- bar ) Diameter—2.37 in. (6.02 cm) Length—1.03 in. (2.62 cm) Weight—0.953 oz (27.0 grams) MEM: Figure C-3...0.34 kilo- bar weight 0.882 oz 25.0 gm Initial Length 1.027 in. 2.61 cm Single WEDGE 0.500 In. 1.270 cm Crushed Length 0.385 In...SAN DIEGO, CA 92132 COMMANDER NAVAL SEA SYSTEMS COMMAND DEPARTMENT OF THE NAVY ATTN CODE 3306, MS. RAYE J. MONTAGUE CHINA LAKE, CA 93555 NAVAL

  14. Virksomheden som felt: et casestudie

    DEFF Research Database (Denmark)

    Bourdieu, Pierre

    2012-01-01

    Oversættelse af Pierre Bourdieu: “Annexe. Le champ de l’entreprise: une étude de cas”, i Les structures sociales de l’économie (Editions du Seuil, 2000), s. 267-270, med tilladelse fra Polity Press.......Oversættelse af Pierre Bourdieu: “Annexe. Le champ de l’entreprise: une étude de cas”, i Les structures sociales de l’économie (Editions du Seuil, 2000), s. 267-270, med tilladelse fra Polity Press....

  15. Lignin-containing Feedstock Hydrogenolysis for Biofuel Component Production

    OpenAIRE

    Elena Shimanskaya; Аntonina A. Stepacheva; Esther Sulman; Evgeny Rebrov; Valentina Matveeva

    2018-01-01

    In this paper, the commercial 5%Pd/C and 5%Pt/C catalysts and synthesized 5%Pt/MN-270 and 5%Pd/MN-270 were used in the hydrogenolysis of lignocellulosic material (softwood sawdust) to obtain liquid fuels in the form of hydrocarbons. As lignin has a very complex structure, anisole was used as a model compound. It was found that the use Pt-containing catalysts based on hypercrosslinked polystyrene in both processes of anisole and lignin-containing feedstock conversion allowed obtaining the high...

  16. Effects of reclaimed water irrigation on microbial diversity and composition of soil with reducing nitrogen fertilization

    DEFF Research Database (Denmark)

    Wei, Guo; Qi, Xuebin; Xiao, Yatao

    2018-01-01

    community diversity and chemical properties of topsoil was investigated by monitoring nitrogen (N) rates. Tomato plants were grown on plots which had been irrigated with reclaimed water for 5 years with varying levels of N fertilization (N270, 270 kg ha−1; N216, 216 kg ha−1; N189, 189 kg ha−1; and N135, 135......Reclaimed water (RW) is an alternative water resource that has been utilized all over the world, but its environmental effects are not fully understood. Soil biodiversity is an important indicator of soil tolerance and resilience. In the present study, the impact of RW irrigation on the microbial...

  17. Blood parasites in northern goshawk (Accipiter gentilis) with an emphasis to Leucocytozoon toddi

    Czech Academy of Sciences Publication Activity Database

    Hanel, J.; Doležalová, J.; Stehlíková, Š.; Modrý, David; Chudoba, J.; Synek, P.; Votýpka, Jan

    2016-01-01

    Roč. 115, č. 1 (2016), s. 263-270 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : avian blood parasites * Haemosporida * Trypanosoma * PCR detection * birds of prey * raptors * mixed infection Subject RIV: EG - Zoology Impact factor: 2.329, year: 2016

  18. Cross-Sectional and Longitudinal Comparisons of Adolescent Self-Esteem.

    Science.gov (United States)

    Mullis, Ann K.; And Others

    1992-01-01

    Examined self-esteem of adolescents over three years of high school. Ninth graders (n=270) completed Coopersmith Self-Esteem Inventory for each of three years. Found grade level significantly related to self-esteem in longitudinal but not cross-sectional design. Mediational effects of gender and socioeconomic status were found to be minimal.…

  19. Testing of PCM Heat Storage Modules with Solar Collectors as Heat Source

    DEFF Research Database (Denmark)

    Englmair, Gerald; Dannemand, Mark; Johansen, Jakob Berg

    2016-01-01

    was to actively utilize the ability of the material to supercool to obtain long storage periods. The modules were charged with solar heat supplied by 22.4 m2 evacuated tubular collectors. The investigation showed that it was possible to fully charge one module within a period of 270 minutes with clear skies...

  20. Goal Orientations, Locus of Control and Academic Achievement in Prospective Teachers: An Individual Differences Perspective

    Science.gov (United States)

    Bulus, Mustafa

    2011-01-01

    The aim of this study is to investigate the role of the prospective teachers' locus of control in goal orientations and of both orientations in academic achievement. The participants were 270 undergraduate students studying in different majors at the Faculty of Education in Pamukkale University. Goal Orientations and Locus of Control Scales were…

  1. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 280 ... The objective of this project is to make strategic use of information and communication technology (ICT) to speed up the eradication of female genital mutilation (FGM) in francophone West Africa. Project. Prioritizing Gender among Palestinians in Israel : Establishing a Gender Unit at the Arab Centre ...

  2. Methods applied for the characterization of Si:H thin films with embedded nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlíková, The-Ha; Remeš, Zdeněk; Purkrt, Adam; Stuchlík, Jiří; Král, Karel

    2015-01-01

    Roč. 7, č. 4 (2015), s. 270-274 ISSN 2164-6627 R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : electrical conductivity * activation energy * CPM * SEM * I - V characteristics * nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism

  3. The Multiplicity of Massive Stars: A High Angular Resolution Survey With The HST Fine Guidance Sensor

    Science.gov (United States)

    2015-01-01

    classifications in Table 1 with intrinsic colors from Wegner (1994), a ratio of total-to-selective extinction of R = 3.1, and absolute magnitudes from...M. 1997, A&A, 327, 1070 Wegner , W. 1994, MNRAS, 270, 229 Williams, S. J., Gies, D. R., Hillwig, T. C., McSwain, M. V., & Huang, W. 2011, AJ, 142

  4. Symptom burden in the last week of life

    NARCIS (Netherlands)

    Klinkenberg, Marianne; Willems, Dick L.; van der Wal, Gerrit; Deeg, Dorly J. H.

    2004-01-01

    In order to investigate symptom burden in the last week of life, we conducted after-death interviews with close relatives of deceased older persons from a population-based sample of older people in The Netherlands (n=270). Results show that fatigue, pain, and shortness of breath were common (83%,

  5. Male and Female Delinquency Trajectories from Pre through Middle Adolescence and Their Continuation in Late Adolescence

    Science.gov (United States)

    Landsheer, Johannes A.; van Dijkum, C.

    2005-01-01

    This study of male and female adolescent delinquency trajectories focuses on the prediction of late adolescence delinquency, based on earlier delinquency and social support. In this 3-wave longitudinal survey, 270 Dutch adolescents (113 males and 157 females) ages 12 to 14, were followed for a period of 6 years. For males, the level of delinquent…

  6. Owning the Environment: Stealth Soldier - Research Outline

    Science.gov (United States)

    2012-05-01

    used in the 2006 Summer War with Israel, and many others ( Latimer , 2001; Acosta, 2011). The deceptive actions used in these wars included all the...1979; Vol. 5, pp. 270–285. Latimer , J. Deception in War. The Overlook Press: New York, NY, 2001. LeHockey, J. Strategic and Operational Military

  7. Opõtõ analititsheskogo tshtenija : "Russkije nots'i" V. Odojevskogo, "Ussomnivs'iisja Makar" A. Platonova / Jelena Grigorjeva

    Index Scriptorium Estoniae

    Grigorjeva, Jelena, 1959-

    1999-01-01

    Bibl. lk. 268-269. Kokkuvõte inglise k. " Analytical reading: "Russkie nochi" by V. Odoyevsky. "Usomnivschijsja Makar" by A. Platonov, lk. 269. Kokkuvõte eesti k. "Analüütilise lugemise kogemus: V. Odojevski "Vene ööd". A. Platonovi "Kahtleja Makar", lk. 269-270

  8. Dynamic Assessment of EFL Reading: Revealing Hidden Aspects at Different Proficiency Levels

    Science.gov (United States)

    Ajideh, Parviz; Farrokhi, Farahman; Nourdad, Nava

    2012-01-01

    Dynamic assessment as a complementary approach to traditional static assessment emphasizes the learning process and accounts for the amount and nature of examiner investment. The present qualitative study analyzed interactions for 270 reading test items which were recorded and tape scripted. The reading ability of 9 EFL participants at three…

  9. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270 ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  10. DMPD: Signals and receptors involved in recruitment of inflammatory cells. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 7744810 Signals and receptors involved in recruitment of inflammatory cells. Ben-Ba...ruch A, Michiel DF, Oppenheim JJ. J Biol Chem. 1995 May 19;270(20):11703-6. (.png) (.svg) (.html) (.csml) Show Signals... and receptors involved in recruitment of inflammatory cells. PubmedID 7744810 Title Signals and r

  11. Economic analysis of the marketing margin of Benniseed in ...

    African Journals Online (AJOL)

    The performance of the marketing system of benniseed in Nasarawa State was determined by using marketing margin models, Analysis of Variance and Duncan multiple range test. Primary data used for analysis were generated through random sampling of 90 farmers and 270 regular middlemen. The results showed that ...

  12. The transformations of disease in expert and lay medical cultures

    Directory of Open Access Journals (Sweden)

    Maarten Bode

    2011-01-01

    Full Text Available Every culture has rules for translating signs into symptoms, for linking symptomatologies to etiologies and interventions, and for using the evidence provided by interventions to confirm translations and legitimize outcomes. The path a person follows from translation to socially significant outcome constitutes his sickness (Allan Young 1982. p. 270.

  13. Prenatal Diagnosis: Appraisal Of Awareness And Utlization Among ...

    African Journals Online (AJOL)

    Objective: To appraise the level of awareness about prenatal diagnosis among health workers in southwestern Nigeria and its utilization. Methodology: Questionnaires were administered to 270% were in randomly selected from private and public health institution in south western Nigeria. Result: The distribution of health ...

  14. The beach-seine fishery off durban, Kwazulu-Natal | Beckley ...

    African Journals Online (AJOL)

    . During this period the fishermen completed 270 hauls on 146 days of operation. In total, 119 species of fish as well as squid, cuttlefish and crabs were recorded in the catches. Most of these were small shoaling species belonging to the ...

  15. Population Size and Diet of Bush Hyrax Hetrohyrax brucei (Gray ...

    African Journals Online (AJOL)

    user

    Crnokrak, P & Roff, D.A. 1999. Inbreeding depression in the wild. Heredity, 83: 260–270. Estes, R.P. 1991. The behavior guide to African mammals, including hoofed mammals, carnivores, primates. University of California Press, Berkeley, pp. 250-258. Frankham, R. 2003. Genetics and conservation biology. C.R. Biologies ...

  16. Incidence of Glucose-6-Phosphate Dehydrogenase (G-6-PD ...

    African Journals Online (AJOL)

    A community based study of the incidence of G-6-PD deficiency in apparently healthy individuals in Jos South (Plateau State) and Jaba (Kaduna State) Local Government Areas (LGAs) of North Central Nigeria was carried-out. The screening of G-6-PD deficiency was performed on 270 subjects which comprised 120 ...

  17. 75 FR 24748 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-05-05

    ..., Sanitation Division, Leased Workers of Mancan, Inc., Big Prairie, OH: May 28, 2008. TA-W-72,270: Nielsen..., Skyware Global, Smithfield, NC: August 14, 2008. TA-W-72,218: SOMA Networks, Inc., San Francisco, CA... Corp., Network Maintenance Operations Center, Falls Church, VA. TA-W-72,899: Weatherford International...

  18. Association of dietary patterns and weight change in rural older adults 75 years and older

    Science.gov (United States)

    Little is known about the relationship between weight change and dietary patterns (DP) in older adults, especially in those of advanced age (_75 years). We examined the association of DP with obesity and five-year weight change in community-dwelling older adults (n=270; mean±SD age: 78.6±3.9 years)....

  19. Book Reviews | Keogh | African Zoology

    African Journals Online (AJOL)

    Book Review 1. Book Title: Atlas of Microscopic Structures of Fur Skins Vol. 1. Book Authors: Anton Blažej et al. Elsevier Amsterdam and SNTl, Prague, 1989. 378 pages. Book Review 2. Book Title: Ornithology for Africa. Book Author: Gordon L. Maclean. University of Natal Press, 1990. 270 pages. Book Review 3. Book Title: ...

  20. Amegbor et al., Afr J Tradit Complement Altern Med. (2012) 9(4):584 ...

    African Journals Online (AJOL)

    AJTCAM

    The genus Vitex belonging to the family of Verbenaceae approximately includes 270 known species of trees and shrubs within tropical and sub-tropical regions, although few species may be found in temperate zones. Vitex species (V. piramidata, V. pubescens, V. agnus-castus, V. doniana, V. gaumeri, V. trifolia, V.

  1. Theoretical Studies of Two-Dimensional Effects in Free Electron Lasers.

    Science.gov (United States)

    1984-12-01

    from the electrons is balanced by the energy losses at the mirrors. 871 TABLE Bl MATH SCIENCES FEL PARAMETERS ELECTRON BEAM EXPERIMENTAL SIMULATION...the EM pulse is: mc 2 AP = ,y, --- I(amps)e - 270 "IGW Yr ( Clil ) Let the power loss at the mirrors in the interval between interactions of the beam

  2. 76 FR 50680 - Endangered and Threatened Wildlife and Plants; Removal of the Lake Erie Watersnake (Nerodia...

    Science.gov (United States)

    2011-08-16

    ... polymorpha) and quagga mussels (Dreissena bugensis) (Ray and Corkum 1997, p. 270). Zebra and quagga mussels... 3.4x10\\5\\ mussels per m\\2\\ in the western basin of Lake Erie (Leach 1993, p. 381). Zebra and quagga...

  3. Investigating Time and Spectral Dependence in Neutron Radiation Environments for Semiconductor Damage Studies

    Science.gov (United States)

    2014-09-18

    Benton, R. Sauer , and L. Kimerling, “Interstitial defect reactions in silicon,” Appl. Phys. Lett., vol. 51, pp. 256–258, 1987. 13. J. Srour, C. Marshall...vol. 55, no. 6, pp. 3055–3059, December 2008. 13. “MCNPX user’s manual , version 2.7.0,” Los Alamos National Laboratory, Albu- querque, NM, Tech

  4. The Soviet Union: Population Trends and Dilemmas.

    Science.gov (United States)

    Feshbach, Murray

    1982-01-01

    Recent trends and differentials among the Soviet Union's 15 republics and major nationalities are reviewed, focusing on fertility, mortality and urbanization, the prospect for labor supplies and military manpower, emigration, and projected population growth to 2000. Estimated at 270 million as of mid-1982, the Soviet population is currently…

  5. Structure modifications in silikon irradiated by ultra-short pulses of XUV free electron laser

    Czech Academy of Sciences Publication Activity Database

    Pelka, J. B.; Andrejczuk, A.; Reniewicz, H.; Schell, N.; Krzywinski, J.; Sobierajski, R.; Wawro, A.; Zytkiewicz, Z. R.; Klinger, D.; Juha, Libor

    2004-01-01

    Roč. 382, - (2004), s. 264-270 ISSN 0925-8388 R&D Projects: GA MŠk 1P04LA235; GA MŠk LN00A100 Institutional research plan: CEZ:AV0Z1010914 Keywords : XUV ablation * free electron laser Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.562, year: 2004

  6. Prevalence of malaria parasitaemia in the booking antenatal (ANC ...

    African Journals Online (AJOL)

    We studied 270 patients attending the booking antenatal clinic recruited for three months in the Lagos State University Teaching Hospital (LASUTH), Nigeria. Each patient was screened for malaria parasites using Giemsa's stain of thick and thin blood films on 2 ml venous blood. Parameters on the age, parity, gestation at ...

  7. Team-Based Learning: Perceptions of Instructors and Students in Thai Universities

    Science.gov (United States)

    Sovajassatakul, Thanongsak; Jitgarun, Kalayanee; Shinatrakool, Raveewan

    2011-01-01

    The purpose of the study reported on in this paper was to identify and compare instructors' and students' perceptions of Team-Based Learning (TBL). Participants were 270 instructors and 288 fourth year students from the faculties of Industrial Education at six universities in Bangkok. The data were analyzed using factor analysis and structural…

  8. 77 FR 70409 - System Safety Program

    Science.gov (United States)

    2012-11-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF TRANSPORTATION Federal Railroad Administration 49 CFR Part 270 2130-AC31 System Safety Program AGENCY: Federal Railroad... commuter and intercity passenger railroads to develop and implement a system safety program (SSP) to...

  9. Noise Measurement Flight Test for Boeing Vertol 234/CH 47-D Helicopter: Data/Analyses

    Science.gov (United States)

    1984-09-01

    45" emission angle, while the minimum noise is directed from the 270’ emission angle. This asymetrical pattern may be associated with forward/aft 64...not possible to comment on left-right side acoustical directivity of the helicopter. Synthesis of Results - It is now possible to merge the results of

  10. Wideband Piezomagnetoelastic Vibration Energy Harvesting

    DEFF Research Database (Denmark)

    Lei, Anders; Thomsen, Erik Vilain

    2014-01-01

    softening effect. In linear operation (without magnets) the harvester generates a RMS power of 141 μW/g2 at 588 Hz with a relative bandwidth of 3.8% over a 100 kΩ load resistor. When operated with one magnet ideally positioned opposite the cantilever, a RMS power of 265 μW/g2 is generated at 270 Hz...

  11. 75 FR 66621 - Reporting of Proxy Votes on Executive Compensation and Other Matters

    Science.gov (United States)

    2010-10-28

    ... Exchange Commission 17 CFR Parts 240, 249, 270 et al. Reporting of Proxy Votes on Executive Compensation... RIN 3235-AK67 Reporting of Proxy Votes on Executive Compensation and Other Matters AGENCY: Securities... Section 13(f) of the Securities Exchange Act to report annually how it voted proxies relating to executive...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 270 ... MU Uhumwangho, P Adebayo. Vol 12, No 1 (2015), Investigation Of The Myometrial Stimulatory Effect Of Amide Anaesthetics, Abstract. Enitome E Bafor, Joyce L Itamaomon, Philip A Obarisiagbon. Vol 14, No 3 (2017), Isolation and characterization of lactobacillus and bacillus producing biosurfactants ...

  13. COMMUNITY HEALTH & PRIMARY HEALTH CARE

    African Journals Online (AJOL)

    adedamla

    Latin America and Southeast Asia. Cervical cancer is a leading cause of mortality worldwide. (representing 13% of all female cancers) with an estimated 270 000 women deaths reported every year and 85% of these deaths occur in the. 3,6 developing world. In Nigeria each year approximately 10,000 women develop ...

  14. The Self Between Cacophony and Monologue: A Conceptualization and Empirical Examination of Dialogical Complexity

    Czech Academy of Sciences Publication Activity Database

    Filip, Miroslav; Kovářová, Marie

    2017-01-01

    Roč. 30, č. 3 (2017), s. 270-294 ISSN 1072-0537 Institutional support: RVO:68081740 Keywords : dialogical complexity * dialogical self theory * cognitive complexity * integrative complexity * personal position repertoire Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations) Impact factor: 0.476, year: 2016

  15. 78 FR 266 - Radio Broadcasting Services; Maysville, GA

    Science.gov (United States)

    2013-01-03

    ...-270; RM-11676; DA 12-2024] Radio Broadcasting Services; Maysville, GA AGENCY: Federal Communications... Review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting...: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to read as follows...

  16. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Issue 3. Issue front cover thumbnail. Volume 89, Issue 3. September 2010, pages 269-390. Special issue - How is sex determined in insects? pp 269-270. Preface · J. Nagaraju Giuseppe Saccone · More Details Fulltext PDF. pp 271-277 Review Article. The role of the ...

  17. A Methodology for Assessing the Impact of Sea Level Rise on Representative Military Installations in the Southwestern United States (RC-1703)

    Science.gov (United States)

    2014-03-03

    impacts to buildings. ....... 270 Table 4‐12. MDI groupings associated with building usage descriptions...International Conference on Coastal Engineering ID Inside Diameter IE Invert Elevation INFADS Internet Facility Real Estate Data Store INLS Improved...short of the millennial time scales associated with glaciations and de‐glaciations (Cayan et al., 2008a). Peak tides may be particularly important to

  18. Myco-Flora of a Kerosene-Polluted Soil in Nigeria | WEMEDO ...

    African Journals Online (AJOL)

    The myco-flora of a Kerosene-polluted soil was investigated. Soil samples collected from a fallow patch of land were polluted with 90 ml, 180 ml, and 270 ml concentrations of kerosene. The 0 ml (untreated soil) served as control. Cultivation of the organisms was done on potato dextrose agar (PDA) after 2 days, 7 days and ...

  19. Age-related changes in expression of neural cell adhesion molecule (NCAM) in heart

    DEFF Research Database (Denmark)

    Gaardsvoll, H; Krog, L; Zhernosekov, D

    1993-01-01

    The neural cell adhesion molecule (NCAM) has been implicated in cellular interactions involved in cardiac morphogenesis and innervation. In this study, expression of NCAM mRNA and protein was characterized in rat heart during postnatal development and aging (postnatal days 1, 10, 40, 270, and 730...

  20. Consequences of early postnatal benzodiazepines exposure in rats. II. Social behavior

    Czech Academy of Sciences Publication Activity Database

    Mikulecká, Anna; Šubrt, Martin; Pařízková, Martina; Mareš, Pavel; Kubová, Hana

    2014-01-01

    Roč. 8, May 8 (2014), s. 169 ISSN 1662-5153 R&D Projects: GA ČR(CZ) GBP304/12/G069; GA ČR(CZ) GA305/09/0846 Institutional support: RVO:67985823 Keywords : benzodiazepines * clonazepam * social behavior * development * rats Subject RIV: FH - Neurology Impact factor: 3.270, year: 2014

  1. Attitudes and Perceptions of Healthcare Providers and Medical ...

    African Journals Online (AJOL)

    Purpose: To explore healthcare providers' (HCPs) and medical students' attitudes to, and perceptions of the pharmaceutical services that clinical pharmacists can provide in United Arab Emirates. Methods: A total of 535 participants (265 HCPs and 270 medical students) were asked to complete a questionnaire over a ...

  2. Circulatory Shock. Volume 27, Number 4, 1989

    Science.gov (United States)

    1990-02-01

    Downstate Med. Ctr. PO Box 2925 450 Clarkson Ave. Riyadh, Saudi Arabia 11461 Brooklyn, NY 11203 212-270-2616 Albina , Jorge E. Dept. of Surgery Alverdy...Thomas C. Nelson, Robert M. Panacek, Edward A. Rhodes, Robert S. RHODE ISLAND Albina , Jorge Burchard, Kenneth W. OKLAHOMA Caldwell, Michael D

  3. Inappropriate Antidiuretic Hormone Secretion

    African Journals Online (AJOL)

    1974-06-08

    7. 4;5. Blood urea (mg/l00 ml). 28. 26. 28. Serum osmolality (m-osmole/kg). 262. 270. 280. Urine osmolality (m-osmole/kg). 675. 515. 306. Plasma cortisol (l'-g/100 ml). 25. Creatinine clearance (ml/min). 70. Urine Na+ (mEq{L).

  4. Original Research Original Research

    African Journals Online (AJOL)

    RAGHAVENDRA

    rts Research Journal. 2015, 4(4): 58-64. ://www.starjournal.org/ ts of Some Species stern Ghats. 577 451, vempu University,. Article Information. Article History: ..... Journal of. Medicinal Plants Research 4(3): 267-270. Johns, T., Duquette, M. (1991). Deficiency of phosphorus in man. The American Journal of Clinical Nutrition ...

  5. Application of multilinear regression analysis in modeling of soil ...

    African Journals Online (AJOL)

    The application of Multi-Linear Regression Analysis (MLRA) model for predicting soil properties in Calabar South offers a technical guide and solution in foundation designs problems in the area. Forty-five soil samples were collected from fifteen different boreholes at a different depth and 270 tests were carried out for CBR, ...

  6. Growth performance and nutrient digestibility of broiler chickens fed ...

    African Journals Online (AJOL)

    Two hundred and seventy (270), day old chicks were used in a completely randomized design experimental layout to test the growth performance and nutrient digestibility of broiler chickens fed single phase diets containing natuzyme™ treated groundnut shell at 0, 5, 10, 15, 20 and 25 % inclusion levels. The treatments ...

  7. Development of a variable stiffness and damping tunable vibration isolator

    CSIR Research Space (South Africa)

    Cronje, JM

    2005-03-01

    Full Text Available , was used to separate the springs at the center. An experimental isolator was constructed and tested. The isolation frequency was shifted from 22.8 to 36.2 Hz by changing the stiffness of the spring by 270%. A transmissibility of less than 10% was achieved...

  8. In vitro response of promising tomato genotypes for tolerance to ...

    African Journals Online (AJOL)

    USER

    2010-06-28

    Jun 28, 2010 ... Abbreviations: PEG, Polyethylene glycol; 2, 4 –D, 2, 4 - ... Tomato seeds of four cultivars (Nora, PS-10, Peto and Roma) were used in this study. The seeds ... mol m-2 s-1). Drought was simulated by the addition of polyethylene glycol (6000) at four concentrations (0, 200, 270 and 295 gL-1) to the media.

  9. Improving Cervical Cancer Prevention by HPV Self-sampling, Colposcopy and Biomarkers

    NARCIS (Netherlands)

    R. van Baars (Romy)

    2014-01-01

    markdownabstract__Abstract__ The worldwide incidence rate of cervical cancer is around 500 000 per year with a mortality rate of around 270 000 women per year. With these figures, it represents the third most common cancer among women worldwide, after breast and colorectal cancer. However, the

  10. Detection and delineation of coal mine fire in Jharia coal field (JCF ...

    Indian Academy of Sciences (India)

    71

    techniques used in the present study are: apparent resistivity, self-potential (SP), and. 57 magnetic .... method (self-potential (SP), electrical resistivity, magnetic) and thermography) has been. 126 used method for ..... signals are further fed into the monitor where it is processed and presented in many forms. 270 like simple ...

  11. Support at Work and Home: The Path to Satisfaction through Balance

    Science.gov (United States)

    Ferguson, Merideth; Carlson, Dawn; Zivnuska, Suzanne; Whitten, Dwayne

    2012-01-01

    This study examines social support (from both coworkers and partners) and its path to satisfaction through work-family balance. This study fills a gap by explaining how support impacts satisfaction in the same domain, across domains, and how it crosses over to impact the partner's domain. Using a matched dataset of 270 job incumbents and their…

  12. Gynaecological Malignancies Seen in a Tertiary Health Facility in ...

    African Journals Online (AJOL)

    59.2%), 41 (27.0%) and 18 (11.8%) of the cases respectively, while cancer of the vulva 3 patients (2%) and vagina 1 patient (0.7%) were rarely seen. The ovarian cancers were predominantly of the epithelial type, with serous cystadenocarcinoma ...

  13. Laserový systém pro odměřování reliéfu MIEMS vytvářeného metodou hlubokého reaktivního leptání

    Czech Academy of Sciences Publication Activity Database

    Maňka, Tadeáš; Šerý, Mojmír; Lazar, Josef; Číp, Ondřej; Krátký, Stanislav; Zemánek, Pavel

    2017-01-01

    Roč. 62, č. 10 (2017), s. 270-272 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : laser interferometry * reactive ion etching * micro electro-mechanical system Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 270 ... Roshan T. Ramessur, Kishore Boodhoo, Janita Balgobin, Pavel Povinec, W.C Burnett. Vol 12, No 1 (2013), Distribution, abundance and ecology of the sponge Spheciospongia vagabunda (Phylum: Porifera, Class: Demospongiae) in a shallow lagoon of Mauritius. Abstract PDF. Sandeep Shivram ...

  15. Terroristi kukutamine on enam kui õigustatud / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Naftaturu stabiilsuse nimel Muammar Gaddafile kõik tema vanad kuriteod andeks andnud USA ja Euroopa riigid on nüüd keerulises olukorras, sest on selgunud, et käsu 21. detsembril 1988. aastal Šotimaa kohal 270 ohvriga lõppenud lennukiplahvatus korraldada andis Gaddafi isiklikult. Liibüa genotsiid jätkub

  16. 77 FR 8302 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-02-14

    ... the investment policy is fundamental or that the fund has adopted a policy to provide its shareholders... extension and approval. Rule 35d-1 (17 CFR 270.35d-1) under the Investment Company Act of 1940 (15 U.S.C... other things, a name suggesting that a registered investment company or series thereof (a ``fund...

  17. 78 FR 28899 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-05-16

    ..., such as the approval of an investment advisory contract and the approval of changes in fundamental... extension and approval. Rule 20a-1 (17 CFR 270.20a-1) was adopted under Section 20(a) of the Investment..., consents, and authorizations with respect to securities issued by registered investment companies (``Funds...

  18. Untitled

    African Journals Online (AJOL)

    facilities for waste disposal. used unclean utensils and were ... holding utensils. sanitary condition of vending sites, cleanliness of the ... mixed with tomato-based sauce. A single serving weighed about 270g. Home-cooked. "macaroni" was brought to the vending station for sale where its sauce was prepared. It was sold at ...

  19. Surgery in World War II. Orthopedic Surgery in the Zone of Interior

    Science.gov (United States)

    1970-01-01

    Lesions of the Knee-Continued Osteochondritis Dissecans .................................................................... 690 Osgood - Schlatter Disease...trolled. OSGOOD - SCHLATTER DISF -SE Osgood - Schlatter disease (osteochondrosis of the tibial tubercle) was perhaps the most frequent of a number of...injuries on, 64, 270 for Osgood - Schlatter disease, 693 Casualties: for previous injuries of ankle, 734 from Pearl Harbor, status of, 926-929 instead of

  20. Cu induced morphology changes at Pb/Si (111) interface: separation of "5 x 5"-Cu structure into individual domains

    Czech Academy of Sciences Publication Activity Database

    Shukrynau, Pavel; Mutombo, Pingo; Hietschold, M.; Cháb, Vladimír

    2013-01-01

    Roč. 270, Apr (2013), s. 157-162 ISSN 0169-4332 R&D Projects: GA AV ČR IAA1010413 Institutional support: RVO:68378271 Keywords : scanning tunnelling microscopy * copper * lead * silicon * surface chemical reaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.538, year: 2013

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 270 ... (Rhodophyta, Corallinales): A new threat to massive coral Porites lutea at Reunion Island, Western Indian Ocean, Abstract PDF. Mathieu Sere, M. H. Schleyer, P. Chabanet, J. P. Quod. Vol 3, No 2 (2004), Impact of Improvement of the Entrance Channel on the Rate of Sediment Deposition into the Dar ...

  2. A High-Value Best-Value Approach to Public Shipyard Human Capital Management to Improve Ship Availability

    Science.gov (United States)

    2015-09-01

    rules, regulations, and requirements (housekeeping, safety) 8. Overall customer satisfaction and hiring again based on performance (comfort level in...11. Nosal, Ed. 2001. “Optimal At-Will Labour Contracts.” Economica 68(270): 187–201. Office of Management and Budget. 2013. “Circular No. A-131

  3. influence of simultaneous infestations of prostephanus truncatus ...

    African Journals Online (AJOL)

    significant differences in the percentage change of adult insect numbers between single and simultaneous infestations at P< 0.01. Further, the grain ... complete development over a wide range of temperatures, 270C to 320C and between ... Aging, sexing and conditioning P. truncatus and S. zeamais. Adults were removed ...

  4. THE SOCIAL AND CLINICAL CHARACTERISTIC OF PATIENTS WITH THE ISOLATED GENITAL TUBERCULOSIS ASSOCIATED WITH INFERTILITY, THE ACTIVE AND CLINICALLY CURED TUBERCULOSIS OF RESPIRATORY ORGANS IN COMBINATION WITH PREGNANCY

    OpenAIRE

    A. V. Mordyk; G. A. Valeyeva; A. A. Yakovleva; L. V. Puzyreva

    2015-01-01

    Due to the high incidence of tuberculosis of women of reproductive age research at 270 patients was conducted. The group of research included women with infertility and genital tuberculosis, pregnant women with active tuberculosis of lungs, pregnant women with clinically cured tuberculosis of respiratory organs. Pregnant women with tuberculosis of lungs were more often from sociopathic families, had venereal diseases, HIV infection, hepatitises.

  5. post-1994

    African Journals Online (AJOL)

    nothing to do with real human problems in real human life but are machine engendered,. "composite images of images of ... an overview of the subject English, the shift from teaching English literature to English. 270 .... time, encourages both the masking and reinforcing of deep-seated academic learning and attitudinal ...

  6. Manohar V Kulkarni

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Manohar V Kulkarni. Articles written in Journal of Chemical Sciences. Volume 116 Issue 5 August 2004 pp 265-270. Synthesis of spiro[indolo-1,5-benzodiazepines] from 3-acetyl coumarins for use as possible antianxiety agents · Raviraj A Kusanur Manjunath Ghate Manohar ...

  7. Effect of post-growth annealing on secondary phase formation in low-temperature-grown Mn-doped GaAs

    DEFF Research Database (Denmark)

    Kovács, A.; Sadowski, J.; Kasama, Takeshi

    2013-01-01

    The microstructures of annealed GaAs layers containing 0.1%, 0.5% and 2% Mn are studied using aberration-corrected transmission electron microscopy (TEM). The layers were grown by molecular beam epitaxy at 270 °C. After heat treatment at 400, 560 and 630 °C, they are found to contain precipitate ...

  8. 48 CFR 2152.231-70 - Accounting and allowable cost.

    Science.gov (United States)

    2010-10-01

    ... allowable cost. As prescribed in 2131.270, insert the following clause: Accounting and Allowable Cost (OCT... cost; (ii) Incurred with proper justification and accounting support; (iii) Determined in accordance... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Accounting and allowable...

  9. Transmission of electrons through Al2O3 nanocapillaries

    DEFF Research Database (Denmark)

    Milosavljević, A.R.; Jureta, J.J.; Víkor, Gy.

    2012-01-01

    We investigate transmission of low-energy electrons (250 eV) through insulating AlO nanocapillaries (270 nm diameter and 15 μm length). Kinetic energy distribution of electrons transmitted through the nanocapillaries in the straightforward direction, time dependence of the transmission rate both...

  10. Effect of feeding strategies on weaning weight and milk production of Holstein × Zebu calves in dual purpose milk production systems.

    Science.gov (United States)

    de Menezes, Gustavo Chamon de Castro; Valadares Filho, Sebastião de campos; Lopez-Villalobos, Nicolas; Ruas, José Reinaldo Mendes; Detmann, Edenio; Zanetti, Diego; Menezes, Arismar de Castro; Morris, Stephen; Mariz, Lays Débora Silva; de Duarte, Marcio de Souza

    2015-08-01

    The objective of this study was to evaluate the effect of five feeding strategies on calf weaning weight, and cow milk production and composition in Brazilian Holstein × Zebu cows. A total of 60 cows and their calves were allocated to each of five treatments. Cows in treatments 1, 2 and 3 were milked for 270 days and cows in treatments 4 and 5 were milked for 180 days. Calves in treatment 1 (CON) were not supplemented with concentrate whereas calves from treatment 2 (CLPN) received 1 kg of concentrate daily from 90 to 270 days of age and calves from treatment 3 received 1 kg of concentrated from 180 to 270 days of age. Calves in treatment 4 (CCPS) were supplemented with 1 kg of concentrate from 90 to 180 days of age and calves in treatment 5 (CLPS) were supplemented with 1 kg of concentrate from 90 to 270 days of age. Calves from the CLPS treatment had greater milk and protein intakes (P feeding calves with no concentrate results in a weight gain of 600 g/day. The CLPS treatment produced calves with the highest live weight and growth rate. The nutritional strategy with restricted supply of milk for the calves with concomitantly short-term concentrate supplementation does not improve performance of calves but did increase feed costs.

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... in modulating MutS binding to mismatches. Volume 32 Issue 2 March 2007 pp 261-270 Articles. A homologue of the defender against the apoptotic death gene (dad1) in UV-exposed Chlamydomonas cells is downregulated with the onset of programmed cell death · Swati Moharikar Jacinta S D'souza Basuthkar J Rao.

  12. The Place of Leadership Quality and Role of Coaches in Sports ...

    African Journals Online (AJOL)

    The study examined the place of leadership quality and role of coaches in sports performance by Nigerian university students. Participants were made up of 153 sports officials and 270 students from nine universities in Southern Nigeria. A validated self – structured questionnaire with a test – retest reliability co – efficient of ...

  13. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The SANS profiles indicate surface fractal morphology of the pore space with fractal dimensionality lying between 2.70 and 2.76. Volume 71 Issue 5 November 2008 pp 1075-1078 Small Angle Neutron Scattering. Small angle neutron scattering and small angle X-ray scattering studies of platinum-loaded carbon foams.

  14. 76 FR 5110 - Hazardous Waste Management System; Identification and Listing of Hazardous Waste; Proposed Rule

    Science.gov (United States)

    2011-01-28

    ... ethyl ketone 5.40E-01 8.47E+01 Methyl isobutyl ketone......... 6.00E-01 1.13E+01 Nickel 2.70E-01 5.74E... to identify plausible exposure routes (i.e., groundwater, surface water, air) for hazardous... health-based data and standard risk assessment and exposure algorithms to predict maximum compliance...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 270 ... Vol 7, No 3 (2010), In vitro permeation studies of diclofenac diethylamine from newly developed oleogel bases, Abstract. DC Goupale, B Rajkapoor ... Vol 14, No 1 (2017), Antidermatophytic properties of formulated ointments containing Azadirachta indica A. Juss seed oil extract, Abstract. H.Y. Ungo-Kore ...

  16. Sandpit lakes vegetation in the Třeboň biosphere reserve: effect of anthropogenic activities

    Czech Academy of Sciences Publication Activity Database

    Křiváčková, O.; Pecharová, E.; Čížková, Hana

    2006-01-01

    Roč. 25, č. 3 (2006), s. 270-281 ISSN 1335-342X Institutional research plan: CEZ:AV0Z60870520 Keywords : Sandpit lakes * vegetation * succession * Illecebrum verticillatum * Lycopodiella inundata * Drosera rotundifoia * Lysimachia thyrsiflora Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  17. Workplace Incivility and Conflict Management Styles: Predicting Job Performance, Organizational Commitment and Turnover Intent

    Science.gov (United States)

    Reio, Thomas G., Jr.; Trudel, Jeannie

    2013-01-01

    The purpose of this study was to examine the relations among conflict management styles and target and instigator incivility and job performance, organizational commitment, and turnover intent. Data from 270 employees suggested that experiencing and instigating uncivil behavior occurred frequently. Using an integrative conflict management style…

  18. A molecular analysis reveals hidden species diversity within the current concept of Russula maculata (Russulaceae, Basidiomycota)

    Czech Academy of Sciences Publication Activity Database

    Adamčík, S.; Caboň, M.; Eberhardt, U.; Saba, M.; Hampe, F.; Slovák, M.; Kleine, J.; Marxmüller, H.; Jančovičová, S.; Pfister, D.H.; Khalid, A. N.; Kolařík, Miroslav; Marhold, K.; Verbeken, A.

    2016-01-01

    Roč. 270, č. 2 (2016), s. 71-88 ISSN 1179-3155 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : DNA barcode * ectomycorrhizal fungi * morphology Subject RIV: EE - Microbiology, Virology Impact factor: 1.240, year: 2016

  19. Effect of dietary vitamin E supplementation on lipid and colour ...

    African Journals Online (AJOL)

    Chickens were fed with diets containing 25 (control), 100, 200 or 300 mg vitamin E/kg of food for 20 days before slaughtering. Peroxide value (PV) and oxidation products specific extinctions (K232 and K270), chosen as markers for oxidative deterioration of lipids, were lower in chicken meat from animals supplemented with ...

  20. Cobalt and molybdenum activated electrodes in foam based alkaline electrolysis cells at 150-250 °C and 40 bar

    DEFF Research Database (Denmark)

    Allebrod, Frank; Chatzichristodoulou, Christodoulos; Mogensen, Mogens Bjerg

    2014-01-01

    A new type of alkaline electrolysis cells with nickel foam based gas diffusion electrodes and KOH (aq) immobilized in mesoporous SrTiO3 has been developed and tested at temperatures of 150 C, 200 C and 250 C at a pressure of 40 bar. Two cells have been characterized during the 270 h long test...

  1. Preliminary estimation of bryophyte biomass and carbon pool from three contrasting different vegetation types

    Czech Academy of Sciences Publication Activity Database

    Singh, M.K.; Juhász, A.; Csintalan, Z.; Kaligaric, M.; Marek, Michal V.; Urban, Otmar; Tuba, Z.

    2005-01-01

    Roč. 33, č. 1 (2005), s. 267-270 ISSN 0133-3720 Grant - others:EU(CZ) HPRI-CT-2002-00197 Institutional research plan: CEZ:AV0Z60870520 Keywords : bryophyte * carbon pool * rain forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.320, year: 2005

  2. The effects of employment on longitudinal trajectories of offending: A follow up in high risk youth from ages 18 to 32.

    NARCIS (Netherlands)

    van der Geest, V.R.; Bijleveld, C.C.J.H.; Blokland, A.A.J.

    2011-01-01

    This article analyzes the effects of employment on delinquent development from 18 to 32 years of age in 270 high-risk males. Prior to 18 years of age, all men had undergone residential treatment for serious problem behavior in a juvenile justice institution in the Netherlands. We use semiparametric

  3. Body image among secondary school boys and girls in south-west ...

    African Journals Online (AJOL)

    Methods: Data regarding body surveillance, body shame and appearance control belief of the Objectified Body Consciousness Scale, in addition to neuroticism, and self-esteem were collected from 270 respondents. Analysis was done in group of gender, and differences in the scores were compared. Results: The females ...

  4. Review | Mpofu- Muzenda | New Agenda: South African Journal of ...

    African Journals Online (AJOL)

    Zimbabwe's Migrants and South Africa's Border Farms: The Root of Impermanence Maxim Bolt Wits University Press: Johannesburg, 2016. 270pp. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  5. The Effect of Computer Games on Students' Critical Thinking Disposition and Educational Achievement

    Science.gov (United States)

    Seifi, Mohammad; Derikvandi, Zahra; Moosavipour, Saeed; Khodabandelou, Rouhollah

    2015-01-01

    The main aim of this research was to investigate the effect of computer games on student' critical thinking disposition and educational achievement. The research method was descriptive, and its type was casual-comparative. The sample included 270 female high school students in Andimeshk town selected by multistage cluster method. Ricketts…

  6. Clinical Investigation Program: Annual Progress Report

    Science.gov (United States)

    1992-09-30

    Arrhythmias Following Epinephrine and Cocaine Use During Nasal Surgery ................... 270 91/206A 0 Use of Goats for Training Advanced Trauma Life...NWTS-4), A Pediatric Hematology-Oncology Phase III Study ........................... 368 91/400 0 Normative Electrocardiographic Data in Healthy Newborns ...384 92/405 0 Hypertrophic Cardiomyopathy and Disproportionate Septal Hypertrophy in Newborns ................................... 385 92/406 0 POG

  7. Capsular Myrtaceae 10. The Metrosideros Complex: M. angustifolia (South Africa)

    NARCIS (Netherlands)

    Dawson, J.W.

    1975-01-01

    As is the case with Tepualia stipularis for South America, Metrosideros angustifolia Sm., Trans. Linn. Soc. 3 (1797) 270, is the sole representative of the capsular Myrtaceae in Africa. It occurs as a shrub or small tree at lower elevations, often along river banks, in the south-west corner of South

  8. Needs Assessment of Guidance Services in Schools as A Method

    African Journals Online (AJOL)

    Emeka Egbochuku

    Needs Assessment of Guidance Services in Schools as A Method For Achieving Quality Education in Nigeria: An Exploration Study. Esere M.O., Omotosho J.A, & Eweniyi G.B.. 270. Key Words: Academic programme evaluation; counselling; educational standards; guidance services; needs assessment. Introduction. A need ...

  9. Acceptability of routine offer of HIV testing (opt-out approach) among ...

    African Journals Online (AJOL)

    Background: With the introduction of the opt out HIV testing policy in Ghana, the HIV test is offered routinely to all pregnant women unless they decline testing. Objective: To assess acceptability of the routine offer of HIV testing antenatal clinic (ANC) clients in the Wa municipality, Ghana. Design: Cross-sectional study of 270 ...

  10. Prevalence of Acute Kidney Injury in neonates admitted at a referral ...

    African Journals Online (AJOL)

    Objectives: To determine prevalence of acute kidney injury and associated factors, among neonates admitted at a referral hospital. Design: Cross sectional study conducted 1 May to 31 July 2010. Setting: Harare Central Hospital, Neonatal Unit. Subjects: 270 neonates ≥ 37 weeks gestation admitted within 12 hours of birth.

  11. Simulation of reflectivity spectrum for non-absorbing multilayer ...

    Indian Academy of Sciences (India)

    Applied Physics Department, Faculty of Technology & Engineering,. The M.S. University of Baroda, ... beam (e-beam) evaporation technique for facet coating of laser diodes emitting at. 1200 nm. The results of .... using a 6 kW e-beam evaporation system equipped with 270◦ bend e-beam gun. Pramana – J. Phys., Vol. 72, No ...

  12. Influence of a 2- to 6-year physical education intervention on scholastic performance

    DEFF Research Database (Denmark)

    Bugge, Anna; Möller, Sören; Tarp, Jakob

    2018-01-01

    The aim of this study was to investigate the influence of a school-based intervention with a tripling of physical education (PE) lessons from two (90 minutes) to six lessons per week (270 minutes) on scholastic performance. This study is part of the CHAMPS study-DK, a quasi-experimental study...

  13. 1222-IJBCS-Article- Ibrahim Alkoiret

    African Journals Online (AJOL)

    DR GATSING

    Factors affecting stallion semen survival and fertility. In Proc. 10th. Congress on Anim. Repro and AI. Urbana. Champaign, IL USA. (3) 377. Quin PJ, White IG. 1966. The effect of cold shock and deep freezing on the concentration of major cations in spermatozoa. J. Reprod. Fert., 12 : 263-. 270. Salisbury GW, Vandemark NL.

  14. Ignition-promoting effect of NO2 on methane, ethane and methane/ethane mixtures in a rapid compression machine

    NARCIS (Netherlands)

    Gersen, S.; Mokhov, A. V.; Darmeveil, J. H.; Levinsky, H. B.; Glarborg, P.

    2011-01-01

    Autoignition delay times of stoichiometric methane, ethane and methane/ethane mixtures doped with 100 and 270 ppm of NO2 have been measured in a RCM in the temperature range 900-1050 K and pressures from 25 to 50 bar. The measurements show that addition of NO2 to CH4/O-2/N-2/ Ar and

  15. Piqures massives par un essaim d'abeilles chez un enfant | Berdai ...

    African Journals Online (AJOL)

    environ 270. Ses complications étaient l'insuffisance rénale, l'anémie et une conjonctivite. La prise en charge était symptomatique avec bonne évolution clinique et biologique. Key words: Abeille, envenimation, anaphylaxie, allergie, choc, Maroc ...

  16. Do Specific Classroom Reading Activities Predict English Language Learners' Later Reading Achievement?

    Science.gov (United States)

    Swanson, H. Lee; Orosco, Michael J.; Kudo, Milagros Fatima

    2017-01-01

    This study investigated the relationship between elementary classroom (N = 50) reading activities in Year 1 and reading performance (i.e., passage comprehension, letter-word identification, and word attack) 1 year later for English language learners (ELLs; N = 270). A cross-classification hierarchical model indicated that compared to other reading…

  17. International trends in clinical characteristics and oral anticoagulation treatment for patients with atrial fibrillation: Results from the GARFIELD-AF, ORBIT-AF I, and ORBIT-AF II registries

    NARCIS (Netherlands)

    Steinberg, B.A.; Gao, H.; Shrader, P.; Pieper, K.; Thomas, L.; Camm, A.J.; Ezekowitz, M.D.; Fonarow, G.C.; Gersh, B.J.; Goldhaber, S.; Haas, S.; Hacke, W.; Kowey, P.R.; Ansell, J.; Mahaffey, K.W.; Naccarelli, G.; Reiffel, J.A.; Turpie, A.; Verheugt, F.W.; Piccini, J.P.; Kakkar, A.; Peterson, E.D.; Fox, K.A.

    2017-01-01

    Atrial fibrillation (AF) is the most common cardiac arrhythmia in the world. We aimed to provide comprehensive data on international patterns of AF stroke prevention treatment. METHODS: Demographics, comorbidities, and stroke risk of the patients in the GARFIELD-AF (n=51,270), ORBIT-AF I (n=10,132),

  18. Civil-Military Relations: A Selected Bibliography

    Science.gov (United States)

    2011-05-01

    2009) Brooks, Risa . Political-Military Relations and the Stability of Arab Regimes. New York: Oxford University Press for the International...Press, 2005. 270pp. (UA23 .B333 2005) Brooks, Risa A. Shaping Strategy: The Civil-Military Politics of Strategic Assessment. Princeton: Princeton

  19. 75 FR 51271 - Agency Information Collection Activities; Proposed Collection; Comment Request; Testing...

    Science.gov (United States)

    2010-08-19

    ... products intended for use in animals. This information will be used to explore concepts of interest and... techniques, when appropriate, and other forms of information technology. Testing Communications on the Food... Response Responses Response Total Hours Individual indepth interviews 360 1 360 .75 270 General public...

  20. Investigation of Effect of KBr Matrix on Drift Infrared Spectra of Some ...

    African Journals Online (AJOL)

    MBI

    2014-09-28

    Sep 28, 2014 ... ABSTRACT. Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopy was used in this work to investigate the effect of KBr on infrared spectra of calcite and illite/smectite. 30 mg of each of these minerals were dispersed in. 270 mg of KBr and their drifts spectra were obtained and analysed using ...