WorldWideScience

Sample records for meitnerium 268

  1. 39 CFR 268.1 - General principles.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false General principles. 268.1 Section 268.1 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION PRIVACY OF INFORMATION-EMPLOYEE RULES OF CONDUCT § 268.1 General principles. In order to conduct its business, the Postal Service has the...

  2. 32 CFR 268.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... requirements of the National Advisory Council on International Monetary and Financial Policies (NAC). ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 268.3 Section 268.3 National Defense... REPORTING OF FOREIGN INDEBTEDNESS WITHIN THE DEPARTMENT OF DEFENSE § 268.3 Policy. It is the policy of the...

  3. 29 CFR 1910.268 - Telecommunications.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Telecommunications. 1910.268 Section 1910.268 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Special Industries § 1910.268 Telecommunications. (a) Application. (1..., methods, operations, installations and processes performed at telecommunications centers and at...

  4. 12 CFR 268.203 - Rehabilitation Act.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Rehabilitation Act. 268.203 Section 268.203... Rehabilitation Act. (a) Model employer. The Board shall be a model employer of individuals with disabilities. The... Rehabilitation Act of 1973, as amended (29 U.S.C. 791), has been violated in a complaint alleging nonaffirmative...

  5. 32 CFR 268.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... REPORTING OF FOREIGN INDEBTEDNESS WITHIN THE DEPARTMENT OF DEFENSE § 268.1 Purpose. This part establishes standard procedures to be used for the collecting and reporting of foreign indebtedness. Such indebtedness...

  6. 12 CFR 268.705 - Employment.

    Science.gov (United States)

    2010-01-01

    ... Physical or Mental Disability § 268.705 Employment. No qualified individual with a disability shall, on the basis of a disability, be subjected to discrimination in employment under any program or activity...

  7. 12 CFR 268.702 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... learning disabilities. The term physical or mental impairment includes, but is not limited to, such... Physical or Mental Disability § 268.702 Definitions. For purposes of this subpart, the following... conveyances, or other real or personal property. (d) Person with a disability means any person who has a...

  8. 12 CFR 268.601 - EEO group statistics.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false EEO group statistics. 268.601 Section 268.601... RULES REGARDING EQUAL OPPORTUNITY Matters of General Applicability § 268.601 EEO group statistics. (a... solely statistical purpose for which the data is being collected, the need for accuracy, the Board's...

  9. 40 CFR 268.2 - Definitions applicable in this part.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) LAND DISPOSAL RESTRICTIONS General § 268.2 Definitions applicable in this part. When used in this... mixture is comprised primarily of debris, by volume, based on visual inspection. (h) Hazardous debris... organic or cyanide content as described in § 268.3(c)(1), and is specifically listed in appendix XI of...

  10. 49 CFR 268.17 - Project selection criteria.

    Science.gov (United States)

    2010-10-01

    ... development status of the Maglev technology selected by the applicant for the project. (c) Benefits for the..., DEPARTMENT OF TRANSPORTATION MAGNETIC LEVITATION TRANSPORTATION TECHNOLOGY DEPLOYMENT PROGRAM Procedures For Financial Assistance § 268.17 Project selection criteria. Except as qualified by § 268.19, the following...

  11. 40 CFR 268.44 - Variance from a treatment standard.

    Science.gov (United States)

    2010-07-01

    ... disposal restriction treatment standards that, using a reasonable maximum exposure scenario: (A) For... Chromium .32 NA Lead .040 NA Nickel .44 NA CWM Chemical Services, LLC, Model City, New York K0889 Standards... Lead .040 NA Nickel .44 NA St. Gobain Containers, El Monte, CA 5,7 D010 Standards under § 268.40...

  12. 12 CFR 268.704 - General prohibitions against discrimination.

    Science.gov (United States)

    2010-01-01

    ... Programs and Activities Because of Physical or Mental Disability § 268.704 General prohibitions against discrimination. (a) No qualified individual with a disability shall, on the basis of a disability, be excluded... disability: (i) Deny a qualified individual with a disability the opportunity to participate in or benefit...

  13. 28 CFR 2.68 - Prisoners transferred pursuant to treaty.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Prisoners transferred pursuant to treaty... RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS Transfer Treaty Prisoners and Parolees § 2.68 Prisoners transferred pursuant to treaty. (a) Applicability, jurisdiction and statutory...

  14. 40 CFR 268.39 - Waste specific prohibitions-spent aluminum potliners; reactive; and carbamate wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste specific prohibitions-spent aluminum potliners; reactive; and carbamate wastes. 268.39 Section 268.39 Protection of Environment... Land Disposal § 268.39 Waste specific prohibitions—spent aluminum potliners; reactive; and carbamate...

  15. 49 CFR 268.3 - Different phases of the Maglev Deployment Program.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Different phases of the Maglev Deployment Program. 268.3 Section 268.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL... DEPLOYMENT PROGRAM Overview § 268.3 Different phases of the Maglev Deployment Program. (a) The Maglev...

  16. 40 CFR 268.20 - Waste specific prohibitions-Dyes and/or pigments production wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste specific prohibitions-Dyes and/or pigments production wastes. 268.20 Section 268.20 Protection of Environment ENVIRONMENTAL... Disposal § 268.20 Waste specific prohibitions—Dyes and/or pigments production wastes. (a) Effective August...

  17. Effects of LG268 on Cell Proliferation and Apoptosis of NB4 Cells.

    Science.gov (United States)

    Xu, Ting; Zhong, Liang; Gan, Liu-Gen; Xiao, Chun-Lan; Shan, Zhi-Ling; Yang, Rong; Song, Hao; Li, Liu; Liu, Bei-Zhong

    2016-01-01

    To investigate the effect of LG100268 (LG268) on cell proliferation and apoptosis in NB4 cells. NB4 cells were treated with LG268 for 24 h or 48 h. The effect of LG268 on cell proliferation was assessed by the CCK-8 assay and colony-forming assay. Apoptosis and cell cycle were evaluated by flow cytometry. The protein expression levels of Survivin, PARP, c-Myc, cyclin D1, ERK, p-ERK, p38 MAPK, and p- p38 MAPK were detected by western blot. We found that LG268 inhibited the proliferation of NB4 cells in a dose-dependent manner. Flow cytometry analysis showed that LG268 accelerated apoptosis in NB4 cells in a time- dependent manner and that LG268 treatment led to cell cycle arrest at G0/G1 phase. Moreover, LG268 significantly decreased the protein levels of Survivin, c-Myc, and cyclinD1. Cleaved PARP was observed in the LG268 treatment group but not in the control group. In addition, LG268 increased the phosphorylation level of p38 MAPK and decreased the phosphorylation level of ERK. LG268 inhibited cell proliferation and promoted cell apoptosis in NB4 cells.

  18. 40 CFR 268.36 - Waste specific prohibitions-inorganic chemical wastes

    Science.gov (United States)

    2010-07-01

    ... specific prohibitions—inorganic chemical wastes (a) Effective May 20, 2002, the wastes specified in 40 CFR... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste specific prohibitions-inorganic chemical wastes 268.36 Section 268.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  19. 40 CFR 268.3 - Dilution prohibited as a substitute for treatment.

    Science.gov (United States)

    2010-07-01

    ... restricted waste or the residual from treatment of a restricted waste as a substitute for adequate treatment... under section 402 of the Clean Water Act (CWA), or which treat wastes in a CWA-equivalent treatment... for treatment. 268.3 Section 268.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  20. Behavioral experience induces zif268 expression in mature granule cells but suppresses its expression in immature granule cells

    Science.gov (United States)

    Huckleberry, Kylie A.; Kane, Gary A.; Mathis, Rita J.; Cook, Sarah G.; Clutton, Jonathan E.; Drew, Michael R.

    2015-01-01

    Thousands of neurons are born each day in the dentate gyrus (DG), but many of these cells die before reaching maturity. Both death and survival of adult-born neurons are regulated by neuronal activity in the DG. The immediate-early gene (IEG) zif268 appears to be an important mediator of these effects, as its expression can be induced by neural activity and knockout of zif268 impairs survival of adult-born neurons (Richardson et al., 1992; Veyrac et al., 2013). Despite the apparent importance of zif268 for adult neurogenesis, its behavior-induced expression has not been fully characterized in adult-born neurons. Here we characterize behavior-evoked expression of zif268 in mature and newborn dentate granule cells (DGCs). We first quantified zif268 expression in doublecortin-positive (DCX+) immature neurons and in the general granule cell population after brief exposure to a novel environment (NE). In the general granule cell population, zif268 expression peaked 1 h after NE exposure and returned to baseline by 8 h post-exposure. However, in the DCX+ cells, zif268 expression was suppressed relative to home cage for at least 8 h post-exposure. We next asked whether suppression of zif268 in DCX+ immature cells occurs in other behavioral paradigms that recruit the hippocampus. Exposure to Morris water maze (MWM) training, an enriched environment, or a NE caused approximately equal suppression of zif268 expression in DCX+ cells and approximately equal activation of zif268 expression among the general granule cell population. The same behavioral procedures activated zif268 expression in 6-week-old BrdU-labeled adult-born neurons, indicating that zif268 suppression is specific to immature neurons. Finally, we asked whether zif268 suppression varied as a function of age within the DCX+ population, which ranges in age from 0 to approximately 4 weeks. NE exposure had no significant effect on zif268 expression in 2- or 4-week-old BrdU-labeled neurons, but it significantly

  1. 12 CFR 268.205 - Employment of aliens; Access to sensitive information.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Employment of aliens; Access to sensitive... Complaints § 268.205 Employment of aliens; Access to sensitive information. (a) Definitions. The definitions...— (i) A citizen or National of the United States, (ii) An alien who: (A) Meets the conditions set forth...

  2. Consolidated Checklist for C8 Title 40 of the Code of Federal Regulations (CFR) Part 268

    Science.gov (United States)

    This Consolidated Checklist corresponds to the 40 CFR Part 268, published on July 1, 2002, and as amended by the following final rules: 67 FR 48393, July 24, 2002 (Revision Checklist 200); and 67 FR 62618, October 7, 2002 (Revision Checklist 201).

  3. 24 CFR 203.268 - Pro rata payment of periodic MIP.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata payment of periodic MIP...-Periodic Payment § 203.268 Pro rata payment of periodic MIP. (a) If the insurance contract is terminated... rata MIP shall not be due or payable where the mortgagee notifies the Commissioner that foreclosure or...

  4. 49 CFR 268.15 - Form and contents of applications for preconstruction planning assistance.

    Science.gov (United States)

    2010-10-01

    ...)(i); (e) Management plan, schedule, and financial plan for accomplishing the preconstruction planning... TRANSPORTATION TECHNOLOGY DEPLOYMENT PROGRAM Procedures For Financial Assistance § 268.15 Form and contents of... have Maglev projects are invited to submit applications in Phase I of the Maglev Deployment Program...

  5. 12 CFR 268.606 - Joint processing and consolidation of complaints.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Joint processing and consolidation of... § 268.606 Joint processing and consolidation of complaints. Complaints of discrimination filed by two or... judge on the consolidated complaints any time after 180 days from the date of the first filed complaint...

  6. Technical and Clinical Outcomes Following Colonic Stenting: A Seven-Year Analysis of 268 Procedures.

    Science.gov (United States)

    Little, M W; Oakley, T; Briggs, J H; Sutcliffe, J A; Allouni, A K; Makris, G; Bratby, M J; Tapping, C R; Patel, R; Wigham, A; Anthony, S; Phillips-Hughes, J; Uberoi, R

    2016-10-01

    To assess the factors contributing to the technical and clinical success of colorectal stenting for large bowel obstruction. 268 cases of colonic stenting for large bowel obstruction were performed in 249 patients of mean age of 72 years (28-98) between 2006 and 2013. The majority of strictures were due to malignant disease, 244/268 (91 %). Diverticular strictures accounted for 24/268 (9 %). Overall technical success rate was 81 % (217/268), with a clinical success rate of 65 % (174/268). Duration of symptoms ranged from 0 to 180 days (mean 8 days). Technical success rate was seen to decrease with increasing symptom duration. For symptom duration of less than 1 week, technical success was 85.4 % (181/212) versus 69.6 % (39/56) for those with symptoms of greater than a week (p < 0.05). Clinical success rates fell from 71.3 % (107/150) to 59.3 % (70/118) (p < 0.05) when attempting to stent lesions of greater than 5 cm. There was also a significant reduction in clinical success when stenting lesions on a bend rather than a straight segment of colon 75.7 % (109/144) versus 59.7 % (74/124) (p < 0.05). A total of 20 (7.46 %) perforations were identified during the study. Stent migration occurred in 6.6 % of cases. In-stent stenosis occurred in 3.3 %. The overall 30-day all cause mortality rate was 9 %. Lesion size, location and duration of obstructive symptoms are statistically significant determinants of patient outcome. These factors could be used to advise patient selection for colonic stenting or direct progression to surgical intervention.

  7. Technical and Clinical Outcomes Following Colonic Stenting: A Seven-Year Analysis of 268 Procedures

    International Nuclear Information System (INIS)

    Little, M. W.; Oakley, T.; Briggs, J. H.; Sutcliffe, J. A.; Allouni, A. K.; Makris, G.; Bratby, M. J.; Tapping, C. R.; Patel, R.; Wigham, A.; Anthony, S.; Phillips-Hughes, J.; Uberoi, R.

    2016-01-01

    AimsTo assess the factors contributing to the technical and clinical success of colorectal stenting for large bowel obstruction.Methodology268 cases of colonic stenting for large bowel obstruction were performed in 249 patients of mean age of 72 years (28–98) between 2006 and 2013. The majority of strictures were due to malignant disease, 244/268 (91 %). Diverticular strictures accounted for 24/268 (9 %).ResultsOverall technical success rate was 81 % (217/268), with a clinical success rate of 65 % (174/268). Duration of symptoms ranged from 0 to 180 days (mean 8 days). Technical success rate was seen to decrease with increasing symptom duration. For symptom duration of less than 1 week, technical success was 85.4 % (181/212) versus 69.6 % (39/56) for those with symptoms of greater than a week (p < 0.05). Clinical success rates fell from 71.3 % (107/150) to 59.3 % (70/118) (p < 0.05) when attempting to stent lesions of greater than 5 cm. There was also a significant reduction in clinical success when stenting lesions on a bend rather than a straight segment of colon 75.7 % (109/144) versus 59.7 % (74/124) (p < 0.05). A total of 20 (7.46 %) perforations were identified during the study. Stent migration occurred in 6.6 % of cases. In-stent stenosis occurred in 3.3 %. The overall 30-day all cause mortality rate was 9 %.ConclusionLesion size, location and duration of obstructive symptoms are statistically significant determinants of patient outcome. These factors could be used to advise patient selection for colonic stenting or direct progression to surgical intervention.

  8. Technical and Clinical Outcomes Following Colonic Stenting: A Seven-Year Analysis of 268 Procedures

    Energy Technology Data Exchange (ETDEWEB)

    Little, M. W.; Oakley, T.; Briggs, J. H.; Sutcliffe, J. A.; Allouni, A. K.; Makris, G.; Bratby, M. J.; Tapping, C. R.; Patel, R.; Wigham, A.; Anthony, S.; Phillips-Hughes, J.; Uberoi, R., E-mail: Raman.uberoi@ouh.nhs.uk [Oxford University Hospitals NHS Foundation Trust, Department of Interventional Radiology, John Radcliffe Hospital (United Kingdom)

    2016-10-15

    AimsTo assess the factors contributing to the technical and clinical success of colorectal stenting for large bowel obstruction.Methodology268 cases of colonic stenting for large bowel obstruction were performed in 249 patients of mean age of 72 years (28–98) between 2006 and 2013. The majority of strictures were due to malignant disease, 244/268 (91 %). Diverticular strictures accounted for 24/268 (9 %).ResultsOverall technical success rate was 81 % (217/268), with a clinical success rate of 65 % (174/268). Duration of symptoms ranged from 0 to 180 days (mean 8 days). Technical success rate was seen to decrease with increasing symptom duration. For symptom duration of less than 1 week, technical success was 85.4 % (181/212) versus 69.6 % (39/56) for those with symptoms of greater than a week (p < 0.05). Clinical success rates fell from 71.3 % (107/150) to 59.3 % (70/118) (p < 0.05) when attempting to stent lesions of greater than 5 cm. There was also a significant reduction in clinical success when stenting lesions on a bend rather than a straight segment of colon 75.7 % (109/144) versus 59.7 % (74/124) (p < 0.05). A total of 20 (7.46 %) perforations were identified during the study. Stent migration occurred in 6.6 % of cases. In-stent stenosis occurred in 3.3 %. The overall 30-day all cause mortality rate was 9 %.ConclusionLesion size, location and duration of obstructive symptoms are statistically significant determinants of patient outcome. These factors could be used to advise patient selection for colonic stenting or direct progression to surgical intervention.

  9. 20 CFR 416.268 - What is done to determine if you must have Medicaid in order to work.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What is done to determine if you must have Medicaid in order to work. 416.268 Section 416.268 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Special Provisions for People Who Work Despite A Disabling Impairment § 41...

  10. Behavioral experience induces zif268 expression in mature granule cells but suppresses its expression in immature granule cells

    Directory of Open Access Journals (Sweden)

    Kylie A. Huckleberry

    2015-08-01

    Full Text Available Thousands of neurons are born each day in the dentate gyrus (DG, but many of these cells die before reaching maturity. Both death and survival of adult-born neurons are regulated by neuronal activity in DG. The immediate-early gene (IEG zif268 is an important mediator of these effects, as its expression is induced by neural activity and knockout of zif268 impairs survival of adult-born neurons (Veyrac et al., 2013. Despite the apparent importance of zif268 for adult neurogenesis, its behavior-induced expression has not been fully characterized in adult-born neurons. Here we characterize behavior-evoked expression of zif268 in mature and newborn dentate granule cells (DGCs. In the general granule cell population, zif268 expression peaked 1 hour after novel environment exposure and returned to baseline by 8 hours post-exposure. However, in the doublecortin-positive (DCX+ immature neurons, zif268 expression was suppressed relative to home cage for at least 8 hours post-exposure. We next determined that exposure to water maze training, an enriched environment, or a novel environment caused approximately equal suppression of zif268 expression in DCX+ cells and approximately equal activation of zif268 in the general DGC population and in 6-week-old adult-born neurons. Finally, we asked whether zif268 suppression varied as a function of age within the DCX+ population, which ranges in age from 0 to approximately 4 weeks. Novel environment exposure had no significant effect on zif268 expression in 2- or 4-week-old BrdU-labeled neurons, but it significantly suppressed zif268 expression in 3-week-old neurons. In summary, behavioral experience transiently activated expression of zif268 in mature DGCs but caused a more long-lasting suppression of zif268 expression in immature, adult-born DGCs. We hypothesize that zif268 suppression inhibits memory-related synaptic plasticity in immature DGCs or mediates learning-induced apoptosis of immature adult

  11. Role of the plasticity-associated transcription factor zif268 in the early phase of instrumental learning.

    Directory of Open Access Journals (Sweden)

    Matthieu Maroteaux

    Full Text Available Gene transcription is essential for learning, but the precise role of transcription factors that control expression of many other genes in specific learning paradigms is yet poorly understood. Zif268 (Krox24/Egr-1 is a transcription factor and an immediate-early gene associated with memory consolidation and reconsolidation, and induced in the striatum after addictive drugs exposure. In contrast, very little is known about its physiological role at early stages of operant learning. We investigated the role of Zif268 in operant conditioning for food. Zif268 expression was increased in all regions of the dorsal striatum and nucleus accumbens in mice subjected to the first session of operant conditioning. In contrast, Zif268 increase in the dorsomedial caudate-putamen and nucleus accumbens core was not detected in yoked mice passively receiving the food reward. This indicates that Zif268 induction in these structures is linked to experiencing or learning contingency, but not to reward delivery. When the task was learned (5 sessions, Zif268 induction disappeared in the nucleus accumbens and decreased in the medial caudate-putamen, whereas it remained high in the lateral caudate-putamen, previously implicated in habit formation. In transgenic mice expressing green fluorescent protein (GFP in the striatonigral neurons, Zif268 induction occured after the first training session in both GFP-positive and negative neurons indicating an enhanced Zif268 expression in both striatonigral and striatopallidal neurons. Mutant mice lacking Zif268 expression obtained less rewards, but displayed a normal discrimination between reinforced and non-reinforced targets, and an unaltered approach to food delivery box. In addition, their motivation to obtain food rewards, evaluated in a progressive ratio schedule, was blunted. In conclusion, Zif268 participates in the processes underlying performance and motivation to execute food-conditioned instrumental task.

  12. Methylphenidate (Ritalin) induces Homer 1a and zif 268 expression in specific corticostriatal circuits.

    Science.gov (United States)

    Yano, M; Steiner, H

    2005-01-01

    Corticostriatal circuits participate in limbic, attentional, motor and other networks, and are implicated in psychostimulant addiction. The psychostimulant methylphenidate is used in the treatment of attention-deficit hyperactivity disorder and for recreational purposes. Recent studies indicate that methylphenidate alters gene expression in striatal neurons. We investigated whether methylphenidate affects gene regulation in specific corticostriatal circuits, by comparing drug-induced molecular changes in different functional domains of the striatum with changes in their cortical input regions. In order to assess the potential functional significance of methylphenidate-induced molecular changes, we examined members of two different classes of plasticity-related molecules, the transcription factor zif 268 and the synaptic plasticity factor Homer 1a. Acute methylphenidate administration in adult rats increased the expression of Homer 1a and zif 268 in both cortex and striatum in a dose-dependent and regionally selective manner. These changes in gene expression occurred after doses of 2 mg/kg (i.p.) and higher, and were highly correlated between cortical regions and their striatal targets. In the cortex, increases were maximal in the medial agranular (premotor) and cingulate cortex, followed by motor and somatosensory cortex, and were minimal in the insular cortex. Correspondingly, in the striatum, increases were most robust in sensorimotor sectors that receive medial agranular input, and were weaker or absent in ventral sectors. The methylphenidate-induced increases in cortical Homer 1a and zif 268 expression were also correlated with increases in striatal substance P and dynorphin expression (direct pathway). Overall, the regional distribution of methylphenidate-induced molecular changes in the striatum was similar to that of changes induced by psychostimulants such as cocaine. These findings demonstrate that methylphenidate affects transcription and synaptic

  13. A PRECISE PHYSICAL ORBIT FOR THE M-DWARF BINARY GLIESE 268

    Energy Technology Data Exchange (ETDEWEB)

    Barry, R. K.; Danchi, W. C. [NASA Goddard Space Flight Center, Laboratory for Exoplanets and Stellar Astrophysics, Code 667, Greenbelt, MD 20771 (United States); Demory, B.-O.; Segransan, D.; Di Folco, E.; Queloz, D.; Udry, S. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Forveille, T.; Delfosse, X.; Mayor, M.; Perrier, C. [Geneva Observatory, Geneva University, 51 Ch.des Maillettes, CH-1290 Versoix (Switzerland); Spooner, H. R. [University of Maryland, College Park, MD 20742 (United States); Torres, G. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02136 (United States); Traub, W. A., E-mail: Richard.K.Barry@nasa.gov [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

    2012-11-20

    We report high-precision interferometric and radial velocity (RV) observations of the M-dwarf binary Gl 268. Combining measurements conducted using the IOTA interferometer and the ELODIE and Harvard Center for Astrophysics RV instruments leads to a mass of 0.22596 {+-} 0.00084 M {sub Sun} for component A and 0.19230 {+-} 0.00071 M {sub Sun} for component B. The system parallax as determined by these observations is 0.1560 {+-} 0.0030 arcsec-a measurement with 1.9% uncertainty in excellent agreement with Hipparcos (0.1572 {+-} 0.0033). The absolute H-band magnitudes of the component stars are not well constrained by these measurements; however, we can place an approximate upper limit of 7.95 and 8.1 for Gl 268A and B, respectively. We test these physical parameters against the predictions of theoretical models that combine stellar evolution with high fidelity, non-gray atmospheric models. Measured and predicted values are compatible within 2{sigma}. These results are among the most precise masses measured for visual binaries and compete with the best adaptive optics and eclipsing binary results.

  14. A Precise Physical Orbit For The M-Dwarf Binary Gliese 268

    Science.gov (United States)

    Barry, R. K.; Demory, B. -O.; Segransan, D.; Forveille, T.; Danchi, W. C.; Di Folco, E.; Queloz, D.; Spooner, H. R.; Torres, G.; Traub, W. A.; hide

    2012-01-01

    We report high-precision interferometric and radial velocity (RV) observations of the M-dwarf binary Gl 268. Combining measurements conducted using the IOTA interferometer and the ELODIE and Harvard Center for Astrophysics RV instruments leads to a mass of 0.22596 plus-minus 0.00084 Mass compared to the sun for component A and 0.19230 plus-minus 0.00071 Mass compared to the sun for component B. The system parallax as determined by these observations is 0.1560 plus-minus 0.0030 arcsec - a measurement with 1.9% uncertainty in excellent agreement with Hipparcos (0.1572 plus-minus 0.0033). The absolute H-band magnitudes of the component stars are not well constrained by these measurements; however, we can place an approximate upper limit of 7.95 and 8.1 for Gl 268A and B, respectively.We test these physical parameters against the predictions of theoretical models that combine stellar evolution with high fidelity, non-gray atmospheric models. Measured and predicted values are compatible within 2sigma. These results are among the most precise masses measured for visual binaries and compete with the best adaptive optics and eclipsing binary results.

  15. Amino acid substitutions at positions 242, 255 and 268 in rabies virus glycoprotein affect spread of viral infection.

    Science.gov (United States)

    Ito, Yuki; Ito, Naoto; Saito, Shouichiro; Masatani, Tatsunori; Nakagawa, Keisuke; Atoji, Yasuro; Sugiyama, Makoto

    2010-02-01

    Rabies virus Nishigahara strain kills adult mice after intracerebral inoculation, whereas the derivative RC-HL strain does not. It has previously been reported by us that the R(G 242/255/268) strain, in which amino acids at positions 242, 255 and 268 on the G protein have been replaced by those from the Nishigahara strain in the genetic background of the RC-HL strain, kills adult mice. This indicates that these three amino acids of G protein are important for pathogenicity of the Nishigahara strain. In order to obtain insights into the mechanism by which these amino acids affect pathogenicity, in this study spread of viral infection and apoptosis-inducing ability of the attenuated RC-HL strain and the virulent R(G 242/255/268) strain were compared. RC-HL infection spread less efficiently in the mouse brain than did R(G 242/255/268) infection. However, the apoptosis-inducing abilities of both viruses were almost identical, as shown by both in vitro and in vivo experiments. It was demonstrated that cell-to-cell spread of RC-HL strain was less efficient than that of R(G 242/255/268) strain in mouse neuroblastoma cells. These results indicate that the three amino acid substitutions affect efficiency of cell-to-cell spread but not apoptosis-inducing ability, probably resulting in the distinct distributions of RC-HL and R(G 242/255/268) strain-infected cells in the mouse brain and, consequently, the different pathogenicities of these strains.

  16. Data on Arc and Zif268 expression in the brain of the α-2A adrenergic receptor knockout mouse

    Directory of Open Access Journals (Sweden)

    Jeff Sanders

    2016-06-01

    Full Text Available The α2-adrenergic receptor (α2-AR is widely distributed in the brain with distinct roles for α2-AR subtypes (A, B and C. In this article, data are provided on Activity Regulated Cytoskeleton Associated Protein (Arc and Zif268 expression in the brain of the α2A-AR knockout (α2A-AR KO mouse. These data are supplemental to an original research article examining Arc and Zif268 expression in rats injected with the α2-AR antagonist, RX821002 (http://dx.doi.org/10.1016/j.neulet.2015.12.002. [1].

  17. 25 CFR 26.8 - Where do I go to apply for Job Placement and Training assistance?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Where do I go to apply for Job Placement and Training... PLACEMENT AND TRAINING PROGRAM General Applicability § 26.8 Where do I go to apply for Job Placement and Training assistance? You may apply for Job Placement and Training assistance at the servicing office...

  18. 40 CFR 268.38 - Waste specific prohibitions-newly identified organic toxicity characteristic wastes and newly...

    Science.gov (United States)

    2010-07-01

    ... identified organic toxicity characteristic wastes and newly listed coke by-product and chlorotoluene...) SOLID WASTES (CONTINUED) LAND DISPOSAL RESTRICTIONS Prohibitions on Land Disposal § 268.38 Waste...-product and chlorotoluene production wastes. (a) Effective December 19, 1994, the wastes specified in 40...

  19. Amalgam pigmentation (amalgam tattoo) of the oral mucosa. A clinicopathologic study of 268 cases.

    Science.gov (United States)

    Buchner, A; Hansen, L S

    1980-02-01

    A series of 268 cases of amalgam tattoo is analyzed both clinically and histologically. The most common location was the gingiva and alveolar mucosa, followed by the buccal mucosa. Histologically, the amalgam was present in the tissues as discrete, fine, dark granules and as irregular solid fragments. The dark granules were arranged mainly along collagen bundles and around blood vessels. They were also associated with the walls of blood vessels, nerve sheaths, elastic fibers, basement membranes of mucosal epithelium, striated muscle fibers, and acini of minor salivary glands. Dark granules were also present intracellularly within macrophages, multinucleated giant cells, endothelial cells, and fibroblasts. Although in 45% of the cases there was no tissue reaction to the amalgam, in 17% there was a macrophagic reaction and in 38% there was a chronic inflammatory response, usually in the form of a foreign body granuloma, with multinucleated giant cells of the foreign body and Langhans types. Asteroid bodies were also found in some of the foreign body giant cells.

  20. Work history and mortality risks in 90,268 US radiological technologists.

    Science.gov (United States)

    Liu, Jason J; Freedman, D Michal; Little, Mark P; Doody, Michele M; Alexander, Bruce H; Kitahara, Cari M; Lee, Terrence; Rajaraman, Preetha; Miller, Jeremy S; Kampa, Diane M; Simon, Steven L; Preston, Dale L; Linet, Martha S

    2014-12-01

    There have been few studies of work history and mortality risks in medical radiation workers. We expanded by 11 years and more outcomes our previous study of mortality risks and work history, a proxy for radiation exposure. Using Cox proportional hazards models, we estimated mortality risks according to questionnaire work history responses from 1983 to 1989 through 2008 by 90,268 US radiological technologists. We controlled for potential confounding by age, birth year, smoking history, body mass index, race and gender. There were 9566 deaths (3329 cancer and 3020 circulatory system diseases). Mortality risks increased significantly with earlier year began working for female breast (p trend=0.01) and stomach cancers (p trend=0.01), ischaemic heart (p trend=0.03) and cerebrovascular diseases (p trend=0.02). The significant trend with earlier year first worked was strongly apparent for breast cancer during baseline through 1997, but not 1998-2008. Risks were similar in the two periods for circulatory diseases. Radiological technologists working ≥5 years before 1950 had elevated mortality from breast cancer (HR=2.05, 95% CI 1.27 to 3.32), leukaemia (HR=2.57, 95% CI 0.96 to 6.68), ischaemic heart disease (HR=1.13, 95% CI 0.96 to 1.33) and cerebrovascular disease (HR=1.28, 95% CI 0.97 to 1.69). No other work history factors were consistently associated with mortality risks from specific cancers or circulatory diseases, or other conditions. Radiological technologists who began working in early periods and for more years before 1950 had increased mortality from a few cancers and some circulatory system diseases, likely reflecting higher occupational radiation exposures in the earlier years. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  1. Understanding the mechanism of atovaquone drug resistance in Plasmodium falciparum cytochrome b mutation Y268S using computational methods.

    Directory of Open Access Journals (Sweden)

    Bashir A Akhoon

    Full Text Available The rapid appearance of resistant malarial parasites after introduction of atovaquone (ATQ drug has prompted the search for new drugs as even single point mutations in the active site of Cytochrome b protein can rapidly render ATQ ineffective. The presence of Y268 mutations in the Cytochrome b (Cyt b protein is previously suggested to be responsible for the ATQ resistance in Plasmodium falciparum (P. falciparum. In this study, we examined the resistance mechanism against ATQ in P. falciparum through computational methods. Here, we reported a reliable protein model of Cyt bc1 complex containing Cyt b and the Iron-Sulphur Protein (ISP of P. falciparum using composite modeling method by combining threading, ab initio modeling and atomic-level structure refinement approaches. The molecular dynamics simulations suggest that Y268S mutation causes ATQ resistance by reducing hydrophobic interactions between Cyt bc1 protein complex and ATQ. Moreover, the important histidine contact of ATQ with the ISP chain is also lost due to Y268S mutation. We noticed the induced mutation alters the arrangement of active site residues in a fashion that enforces ATQ to find its new stable binding site far away from the wild-type binding pocket. The MM-PBSA calculations also shows that the binding affinity of ATQ with Cyt bc1 complex is enough to hold it at this new site that ultimately leads to the ATQ resistance.

  2. Correlation of loss of activity of human aldehyde dehydrogenase with reaction of bromoacetophenone with glutamic acid-268 and cysteine-302 residues. Partial-sites reactivity of aldehyde dehydrogenase.

    Science.gov (United States)

    Abriola, D P; MacKerell, A D; Pietruszko, R

    1990-01-01

    Bromoacetophenone (2-bromo-1-phenylethanone) has been characterized as an affinity reagent for human aldehyde dehydrogenase (EC 1.2.1.3) [MacKerell, MacWright & Pietruszko (1986) Biochemistry 25, 5182-5189], and has been shown to react specifically with the Glu-268 residue [Abriola, Fields, Stein, MacKerell & Pietruszko (1987) Biochemistry 26, 5679-5684] with an apparent inactivation stoichiometry of two molecules of bromoacetophenone per molecule of enzyme. The specificity of bromoacetophenone for reaction with Glu-268, however, is not absolute, owing to the extreme reactivity of this reagent. When bromo[14C]acetophenone was used to label the human cytoplasmic E1 isoenzyme radioactively and tryptic fragmentation was carried out, peptides besides that containing Glu-268 were found to have reacted with reagent. These peptides were purified by h.p.l.c. and analysed by sequencing and scintillation counting to quantify radioactive label in the material from each cycle of sequencing. Reaction of bromoacetophenone with the aldehyde dehydrogenase molecule during enzyme activity loss occurs with two residues, Glu-268 and Cys-302. The activity loss, however, appears to be proportional to incorporation of label at Glu-268. The large part of incorporation of label at Cys-302 occurs after the activity loss is essentially complete. With both Glu-268 and Cys-302, however, the incorporation of label stops after one molecule of bromoacetophenone has reacted with each residue. Reaction with other residues continues after activity loss is complete. PMID:1968743

  3. Viral-mediated Zif268 expression in the prefrontal cortex protects against gonadectomy-induced working memory, long-term memory, and social interaction deficits in male rats.

    Science.gov (United States)

    Dossat, Amanda M; Jourdi, Hussam; Wright, Katherine N; Strong, Caroline E; Sarkar, Ambalika; Kabbaj, Mohamed

    2017-01-06

    In humans, some males experience reductions in testosterone levels, as a natural consequence of aging or in the clinical condition termed hypogonadism, which are associated with impaired cognitive performance and mood disorder(s). Some of these behavioral deficits can be reversed by testosterone treatment. Our previous work in rats reported that sex differences in the expression of the transcription factor Zif268, a downstream target of testosterone, within the medial prefrontal cortex (mPFC) mediates sex differences in social interaction. In the present study, we aimed to examine the effects of gonadectomy (GNX) in male rats on mPFC Zif268 expression, mood and cognitive behaviors. We also examined whether reinstitution of Zif268 in GNX rats will correct some of the behavioral deficits observed following GNX. Our results show that GNX induced a downregulation of Zif268 protein in the mPFC, which was concomitant with impaired memory in the y-maze and spontaneous object recognition test, reduced social interaction time, and depression-like behaviors in the forced swim test. Reinstitution of mPFC Zif268, using a novel adeno-associated-viral (AAV) construct, abrogated GNX-induced working memory and long-term memory impairments, and reductions in social interaction time, but not GNX-induced depression-like behaviors. These findings suggest that mPFC Zif268 exerts beneficial effects on memory and social interaction, and could be a potential target for novel treatments for behavioral impairments observed in hypogonadal and aged men with declining levels of gonadal hormones. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

  4. 49 CFR 268.21 - Down-selection of one or more Maglev projects for further study and selection of one project for...

    Science.gov (United States)

    2010-10-01

    ..., and benefit/cost comparisons; and (2) The credibility of the financial plan. (d) FRA intends to make... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION MAGNETIC LEVITATION TRANSPORTATION TECHNOLOGY DEPLOYMENT PROGRAM Procedures For Financial Assistance § 268.21 Down-selection of one or more Maglev projects for further study...

  5. HI absorption in 3C 49 and 3C 268.3 - Probing the environment of compact steep spectrum and GHz peaked spectrum sources

    NARCIS (Netherlands)

    Labiano, A; Vermeulen, RC; Barthel, PD; O'Dea, CP; Gallimore, JF; Baum, S; de Vries, W

    Aims. Localize and study the redshifted 21 cm H I absorption known to occur in the subgalactic sized compact steep spectrum galaxies 3C 49 and 3C 268.3. Methods. We carried out European VLBI Network UHF hand spectral line observations. Results. We have detected H I absorption towards the western

  6. Interaction of the 268-282 region of glycoprotein Ibalpha with the heparin-binding site of thrombin inhibits the enzyme activation of factor VIII.

    Science.gov (United States)

    De Cristofaro, R; De Filippis, V

    2003-01-01

    Activation of factor VIII (FVIII) by thrombin plays a fundamental role in the amplification of the coagulation cascade and takes place through specific proteolytic cleavages at Arg(372), Arg(740) and Arg(1689). Full FVIII activation requires cleavage at Arg(372), a process involving the alpha-thrombin exosite-II; referred to as heparin-binding site (HBS). The present study was aimed at investigating the effect of glycoprotein Ibalpha (GpIbalpha; 1-282 fragment) binding to thrombin HBS on FVIII activation. Similar experiments were also performed using a synthetic peptide modelled on the 268-282 sequence of GpIbalpha, and sulphated successfully at all tyrosine residues present along its sequence, at positions 276, 278 and 279. Both GpIbalpha 1-282 and the sulphated GpIb 268-282 peptides induced a progressive decrease (up to 70%) in activated FVIII generation, assessed by coagulation and FXa-generation assays. Furthermore, SDS/PAGE and Western-blot experiments showed that the specific appearance of the 44 kDa A2 domain on cleavage of the FVIII Arg(372)-Ser(373) peptide bond was delayed significantly in the presence of either GpIbalpha 1-282 or GpIb 268-282 peptide. Moreover, the effect of the latter on thrombin-mediated hydrolysis of a peptide having the sequence 341-376 of FVIII was investigated using reverse-phase HPLC. The k (cat)/ K (m) values of the FVIII 341-376 peptide hydrolysis by thrombin decreased linearly as a function of the GpIbalpha 268-282 peptide concentration, according to a competitive inhibition effect. Taken together, these experiments suggest that the sulphated 268-282 region of GpIbalpha binds to thrombin HBS, and is responsible for the inhibition of the Arg(372)-Ser(373) bond cleavage and activation of FVIII. PMID:12689334

  7. Determinants of home parenteral nutrition dependence and survival of 268 patients with non-malignant short bowel syndrome.

    Science.gov (United States)

    Amiot, Aurelien; Messing, Bernard; Corcos, Olivier; Panis, Yves; Joly, Francisca

    2013-06-01

    Short bowel syndrome (SBS) is a rare and severe condition where home parenteral nutrition (HPN) dependence can be either permanent or transient. The timing of HPN discontinuation and the survival, according to SBS characteristics, need to be further reported to help plan pre-emptive intestinal transplantation and reconstructive surgery. 268 Non-malignant SBS patients have been followed in our institution since 1980. HPN dependence and survival rate were studied with univariate and multivariate analysis. Median follow-up was 4.4 (0.3-24) years. Actuarial HPN dependence probabilities were 74%, 64% and 48% at 1, 2 and 5 years, respectively. In multivariate analysis, HPN dependence was significantly decreased with an early (20 μmol/l, a remaining colon >57% (4/7) and a remnant small bowel length >75 cm. Among the 124 patients who became HPN independent, 26.5% did so more than 2 years after SBS constitution. This study indicates that long-term HPN is required in 47% of SBS patients started on this therapy. HPN independence is significantly associated with the remnant small bowel length, remaining colon and early plasma citrulline concentration. Noteworthy, HPN dependence could be reversed until 5 years after SBS constitution. Copyright © 2012. Published by Elsevier Ltd.

  8. 40__268

    African Journals Online (AJOL)

    pc

    ABSTRACT. Seasonal dynamics of zooplankton compositi parameters of Thomas Dam were studied be ... Key words: Seasonal dynamics, Physico. Thomas Dam. INTRODUCTION. Zooplanktons are the ... namics, Physico-chemical parameters, Zooplankton composition, Divers animal component r body and found either at.

  9. The time course of systems consolidation of spatial memory from recent to remote retention: A comparison of the Immediate Early Genes Zif268, c-Fos and Arc.

    Science.gov (United States)

    Barry, Daniel N; Coogan, Andrew N; Commins, Sean

    2016-02-01

    Systems consolidation is a process involving the stabilisation of memory traces in the neocortex over time. The medial prefrontal cortex becomes increasingly important during the retrieval of older memories, however the timescale of its involvement is unclear, and the contribution of other neocortical brain regions to remote memory have received little attention. The Immediate Early Genes (IEGs) Zif268, c-Fos and Arc have been utilised as markers of neural activity during spatial memory retrieval, however the lack of a direct comparison between them hinders the interpretation of results. To address these questions, we examined the expression of Zif268, Arc and c-Fos protein in the medial prefrontal cortex, as well as the hippocampus, and the entorhinal, perirhinal, retrosplenial and parietal cortices of male Wistar rats following a probe trial of the Morris water maze either one day, seven days, 14 days or 30 days after acquisition. Activity of the medial prefrontal cortex during retrieval, as measured by all three IEGs, increased in correspondence with the age of the memory, reaching significance between 14 and 30 days. Similar increases in c-Fos and Arc were observed over the course of consolidation in other neocortical and parahippocampal areas, however this pattern was not observed with Zif268. Activity of the hippocampus remained largely unchanged across retention intervals. These findings suggest that systems consolidation of spatial memory takes at least two weeks, are consistent with an ongoing role for the hippocampus in the retrieval of spatial memory, and suggest that c-Fos and Arc may be a more sensitive measure of neural activity in response to behavioural tasks than Zif268. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Whole-Exome Sequencing Reveals an M268T Mutation in the Angiotensinogen Gene of Four Unrelated Renal Failure Patients from the Hail Region of Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Nuglozeh Edem

    2017-06-01

    Full Text Available Aims: Chronic kidney disease and renal failure are major health concerns in Saudi Arabia, especially in the Hail region. These diseases are commonly coupled with hypertension and hypercholesterolemia. Genetic factors strongly contribute to them. This study was undertaken in an effort to identify genetic variations that might contribute to renal failure in the Hail population. Methods: We performed Whole Exome Sequencing (WES on genomic DNA of four unrelated Hail patients afflicted by renal failure. Exonic variations located in genes known to be implicated the disease were selected and validated by Sanger sequencing. Results: In all four patients, we identified a c.C803T transition in exon 2 of the angiotensinogen gene (AGT, causing an M268T amino acid substitution in the protein. All four patients were homozygous for T268 allele. Conclusion: AGT is implicated in blood pressure regulation; it contributes to normal kidney function. The M268T AGT mutation has been known to be associated with hypertension and kidney disease. Whether or not it is a determinant of the kidney failure of our patients could be established if family studies show segregation of the mutant allele with the disease. This study illustrates how WES can be used to identify candidate genetic variations for inherited kidney diseases.

  11. Survival and associated factors in 268 adults with Pompe disease prior to treatment with enzyme replacement therapy

    Directory of Open Access Journals (Sweden)

    Reuser Arnold JJ

    2011-06-01

    Full Text Available Abstract Background Pompe disease is a rare lysosomal storage disorder characterized by muscle weakness and wasting. The majority of adult patients have slowly progressive disease, which gradually impairs mobility and respiratory function and may lead to wheelchair and ventilator dependency. It is as yet unknown to what extent the disease reduces the life span of these patients. Our objective was to determine the survival of adults with Pompe disease not receiving ERT and to identify prognostic factors associated with survival. Methods Data of 268 patients were collected in a prospective international observational study conducted between 2002 and 2009. Survival analyses from time of diagnosis and from time of study entry were performed using Kaplan-Meier curves and Cox-proportional-hazards regression. Results Median age at study entry was 48 years (range 19-79 years. Median survival after diagnosis was 27 years, while median age at diagnosis was 38 years. During follow-up, twenty-three patients died prior to ERT, with a median age at death of 55 (range 23-77 years. Use of wheelchair and/or respiratory support and patients' score on the Rotterdam Handicap Scale (RHS were identified as prognostic factors for survival. Five-year survival for patients without a wheelchair or respiratory support was 95% compared to 74% in patients who were wheelchair-bound and used respiratory support. In a Dutch subgroup of 99 patients, we compared the observed number of deaths to the expected number of deaths in the age- and sex-matched general population. During a median follow-up of 2.3 years, the number of deaths among the Dutch Pompe patients was higher than the expected number of deaths in the general population. Conclusion Our study shows for the first time that untreated adults with Pompe disease have a higher mortality than the general population and that their levels of disability and handicap/participation are the most important factors associated with

  12. Chronic stress enhanced fear memories are associated with increased amygdala zif268 mRNA expression and are resistant to reconsolidation.

    Science.gov (United States)

    Hoffman, Ann N; Parga, Alejandro; Paode, Pooja R; Watterson, Lucas R; Nikulina, Ella M; Hammer, Ronald P; Conrad, Cheryl D

    2015-04-01

    The chronically stressed brain may present a vulnerability to develop maladaptive fear-related behaviors in response to a traumatic event. In rodents, chronic stress leads to amygdala hyperresponsivity and dendritic hypertrophy and produces a post traumatic stress disorder (PTSD)-like phenotype that includes exaggerated fear learning following Pavlovian fear conditioning and resistance to extinction. It is unknown whether chronic stress-induced enhanced fear memories are vulnerable to disruption via reconsolidation blockade, as a novel therapeutic approach for attenuating exaggerated fear memories. We used a chronic stress procedure in a rat model (wire mesh restraint for 6h/d/21d) to create a vulnerable brain that leads to a PTSD-like phenotype. We then examined freezing behavior during acquisition, reactivation and after post-reactivation rapamycin administration (i.p., 40mg/kg) in a Pavlovian fear conditioning paradigm to determine its effects on reconsolidation as well as the subsequent functional activation of limbic structures using zif268 mRNA. Chronic stress increased amygdala zif268 mRNA during fear memory retrieval at reactivation. Moreover, these enhanced fear memories were unaffected by post reactivation rapamycin to disrupt long-term fear memory. Also, post-reactivation long term memory processing was also associated with increased amygdala (LA and BA), and decreased hippocampal CA1 zif268 mRNA expression. These results suggest potential challenges for reconsolidation blockade as an effective approach in treating exaggerated fear memories, as in PTSD. Our findings also support chronic stress manipulations combined with fear conditioning as a useful preclinical approach to study a PTSD-like phenotype. Copyright © 2015 Elsevier Inc. All rights reserved.

  13. Influence of Histones on the Antibody Response in Guinea Pigs to Vaccination with A/Aichi/2/68 (H3 N2) Influenza Virus

    Science.gov (United States)

    Drescher, Joachim; Gillissen, Günther

    1973-01-01

    The influence of total, F1, and F3 histones on the primary antibody response in guinea pigs to vaccination with influenza virus A/2/Aichi/2/68 (H3 N2) was investigated. It was found that histones can greatly reduce the immunoglobulin (Ig) M and, to a smaller degree, the IgG antibody response. The immunosuppressive effect of histones was found to depend critically on the dose of virus used for vaccination, on the type and dose of histones, and on the schedule of histone application. PMID:4742973

  14. Project W-314 acceptance test report HNF-4651 for HNF-4650 SN-268 encasement leak detection ANA-WT-LDSTA-335 for project W-314

    International Nuclear Information System (INIS)

    HAMMERS, J.S.

    1999-01-01

    The purpose of the test was to verify that the AN Tank Farm Encasement Leak Detector components are functionally integrated and operate in accordance with engineering design specifications The Acceptance Test Procedure HNF-4650, SN-268 Encasement Leak Detection ANA-W-LDSTA-335, was conducted between 22 June and 01 July 1999 at the 200E AN Tank Farm. The test has been completed with no open test exceptions The test was conducted prior to final engineering ''as built'' activities being completed this had no impact on the procedure or test results. All components, identified in the procedure, were found to be labeled and identified as written in the procedure

  15. Determination of diffusion coefficients of carbon dioxide in water between 268 and 473 K in a high-pressure capillary optical cell with in situ Raman spectroscopic measurements

    Science.gov (United States)

    Lu, Wanjun; Guo, Huirong; Chou, I.-Ming; Burruss, R.C.; Li, Lanlan

    2013-01-01

    Accurate values of diffusion coefficients for carbon dioxide in water and brine at reservoir conditions are essential to our understanding of transport behavior of carbon dioxide in subsurface pore space. However, the experimental data are limited to conditions at low temperatures and pressures. In this study, diffusive transfer of carbon dioxide in water at pressures up to 45 MPa and temperatures from 268 to 473 K was observed within an optical capillary cell via time-dependent Raman spectroscopy. Diffusion coefficients were estimated by the least-squares method for the measured variations in carbon dioxide concentration in the cell at various sample positions and time. At the constant pressure of 20 MPa, the measured diffusion coefficients of carbon dioxide in water increase with increasing temperature from 268 to 473 K. The relationship between diffusion coefficient of carbon dioxide in water [D(CO2) in m2/s] and temperature (T in K) was derived with Speedy–Angell power-law approach as: D(CO2)=D0[T/Ts-1]m where D0 = 13.942 × 10−9 m2/s, Ts = 227.0 K, and m = 1.7094. At constant temperature, diffusion coefficients of carbon dioxide in water decrease with pressure increase. However, this pressure effect is rather small (within a few percent).

  16. Regulatory issues for Waste Isolation Pilot Plant long-term compliance with U.S. Environmental Protection Agency 40 CFR 191B and 268

    International Nuclear Information System (INIS)

    Anderson, D.R.; Marietta, M.G.; Higgins, P.J. Jr.

    1993-10-01

    Before disposing of transuranic radioactive waste at the Waste Isolation Pilot Plant (WIPP), the United States Department of Energy (DOE) must evaluate compliance with long-term regulations of the United States Environmental Protection Agency (EPA), specifically the Environmental Standards for the Management and Disposal of Spent Nuclear Fuel, High-Level and Transuranic Radioactive Wastes (40 CFR 191), and the Land Disposal Restrictions (40 CFR 268) of the Hazardous and Solid Waste Amendments to the Resource Conservation and Recovery Act (RCRA). Sandia National Laboratories (SNL) is conducting iterative performance assessments (PAs) of the WIPP for the DOE to provide interim guidance while preparing for final compliance evaluations. This paper provides background information on the regulations, describes the SNL WIPP PA Departments approach to developing a defensible technical basis for consistent compliance evaluations, and summarizes the major observations and conclusions drawn from the 1991 and 1992 PAs

  17. Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children

    DEFF Research Database (Denmark)

    Kilpeläinen, Tuomas O; Lu, Qi; Brage, Soren

    2011-01-01

    The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whe...... whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166) and nine studies of children and adolescents (n = 19,268).......The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously...

  18. Patellar tendinopathy in junior basketball players: a controlled clinical and ultrasonographic study of 268 patellar tendons in players aged 14-18 years.

    Science.gov (United States)

    Cook, J L; Khan, K M; Kiss, Z S; Griffiths, L

    2000-08-01

    Anterior knee pain is a common presenting complaint amongst adolescent athletes. We hypothesised that patellar tendinopathy may occur at a younger age than is generally recognised. Thus, we studied the patellar tendons in 134 elite 14- to 18-year-old female (n=64) and male (n=70) basketball players and 29 control swimmers (17 female, 12 male) clinically and with ultrasonography. We found that of 268 tendons, 19 (7%) had current patellar tendinopathy on clinical grounds (11% in males, 2% in females). Twenty-six percent of the basketball players' patellar tendons contained an ultrasonographic hypoechoic region. Ultrasonographic abnormality was more prevalent in the oldest tertile of players (17-18 years) than the youngest tertile (14-15.9 years). Of tendons categorised clinically as 'Never patellar tendinopathy', 22% had an ultrasonographic hypoechoic region nevertheless. This study indicates that patellar tendinopathy can occur in 14- to 18-year-old basketball players. Ultrasonographic tendon abnormality is 3 times as common as clinical symptoms.

  19. Retinal vascular abnormalities and dragged maculae in a carrier with a new NDP mutation (c.268delC) that caused severe Norrie disease in the proband.

    Science.gov (United States)

    Lin, Phoebe; Shankar, Suma P; Duncan, Jacque; Slavotinek, Anne; Stone, Edwin M; Rutar, Tina

    2010-02-01

    Norrie disease (ND) is caused by mutations in the ND pseudoglioma (NDP) gene (MIM 300658) located at chromosome Xp11.4-p11.3. ND is characterized by abnormal retinal vascular development and vitreoretinal disorganization presenting at birth. Systemic manifestations include sensorineural deafness, progressive mental disorder, behavioral and psychological problems, growth failure, and seizures. Other vitreoretinopathies that are associated with NDP gene mutations include X-linked familial exudative vitreoretinopathy, Coats disease, persistent fetal vasculature, and retinopathy of prematurity. Phenotypic variability associated with NDP gene mutations has been well documented in affected male patients. However, there are limited data on signs in female carriers, with mild peripheral retinal abnormalities reported in both carrier and noncarrier females of families with NDP gene mutations. Here, we report a family harboring a single base-pair deletion, c.268delC, in the NDP gene causing a severe ND phenotype in the male proband and peripheral retinal vascular abnormalities with dragged maculae similar to those observed in familial exudative vitreoretinopathy in his carrier mother. Copyright (c) 2010 American Association for Pediatric Ophthalmology and Strabismus. Published by Mosby, Inc. All rights reserved.

  20. Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children.

    Directory of Open Access Journals (Sweden)

    Tuomas O Kilpeläinen

    2011-11-01

    Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction  = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.

  1. Physical Activity Attenuates the Influence of FTO Variants on Obesity Risk: A Meta-Analysis of 218,166 Adults and 19,268 Children

    Science.gov (United States)

    Kilpeläinen, Tuomas O.; Qi, Lu; Brage, Soren; Sharp, Stephen J.; Sonestedt, Emily; Demerath, Ellen; Ahmad, Tariq; Mora, Samia; Kaakinen, Marika; Sandholt, Camilla Helene; Holzapfel, Christina; Autenrieth, Christine S.; Hyppönen, Elina; Cauchi, Stéphane; He, Meian; Kutalik, Zoltan; Kumari, Meena; Stančáková, Alena; Meidtner, Karina; Balkau, Beverley; Tan, Jonathan T.; Mangino, Massimo; Timpson, Nicholas J.; Song, Yiqing; Zillikens, M. Carola; Jablonski, Kathleen A.; Garcia, Melissa E.; Johansson, Stefan; Bragg-Gresham, Jennifer L.; Wu, Ying; van Vliet-Ostaptchouk, Jana V.; Onland-Moret, N. Charlotte; Zimmermann, Esther; Rivera, Natalia V.; Tanaka, Toshiko; Stringham, Heather M.; Silbernagel, Günther; Kanoni, Stavroula; Feitosa, Mary F.; Snitker, Soren; Ruiz, Jonatan R.; Metter, Jeffery; Larrad, Maria Teresa Martinez; Atalay, Mustafa; Hakanen, Maarit; Amin, Najaf; Cavalcanti-Proença, Christine; Grøntved, Anders; Hallmans, Göran; Jansson, John-Olov; Kuusisto, Johanna; Kähönen, Mika; Lutsey, Pamela L.; Nolan, John J.; Palla, Luigi; Pedersen, Oluf; Pérusse, Louis; Renström, Frida; Scott, Robert A.; Shungin, Dmitry; Sovio, Ulla; Tammelin, Tuija H.; Rönnemaa, Tapani; Lakka, Timo A.; Uusitupa, Matti; Rios, Manuel Serrano; Ferrucci, Luigi; Bouchard, Claude; Meirhaeghe, Aline; Fu, Mao; Walker, Mark; Borecki, Ingrid B.; Dedoussis, George V.; Fritsche, Andreas; Ohlsson, Claes; Boehnke, Michael; Bandinelli, Stefania; van Duijn, Cornelia M.; Ebrahim, Shah; Lawlor, Debbie A.; Gudnason, Vilmundur; Harris, Tamara B.; Sørensen, Thorkild I. A.; Mohlke, Karen L.; Hofman, Albert; Uitterlinden, André G.; Tuomilehto, Jaakko; Lehtimäki, Terho; Raitakari, Olli; Isomaa, Bo; Njølstad, Pål R.; Florez, Jose C.; Liu, Simin; Ness, Andy; Spector, Timothy D.; Tai, E. Shyong; Froguel, Philippe; Boeing, Heiner; Laakso, Markku; Marmot, Michael; Bergmann, Sven; Power, Chris; Khaw, Kay-Tee; Chasman, Daniel; Ridker, Paul; Hansen, Torben; Monda, Keri L.; Illig, Thomas; Järvelin, Marjo-Riitta; Wareham, Nicholas J.; Hu, Frank B.; Groop, Leif C.; Orho-Melander, Marju; Ekelund, Ulf; Franks, Paul W.; Loos, Ruth J. F.

    2011-01-01

    Background The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166) and nine studies of children and adolescents (n = 19,268). Methods and Findings All studies identified to have data on the FTO rs9939609 variant (or any proxy [r 2>0.8]) and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active) in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A−) allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20–1.26), but PA attenuated this effect (p interaction  = 0.001). More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19–1.25) than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24–1.36). No such interaction was found in children and adolescents. Conclusions The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity. Please see later in the article for the Editors' Summary PMID:22069379

  2. Remaining Sites Verification Package for the 1607-F1 Sanitary Sewer System (124-F-1) and the 100-F-26:8 (1607-F1) Sanitary Sewer Pipelines Waste Sites, Waste Site Reclassification Form 2005-004

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2008-03-14

    The 100-F-26:8 waste site consisted of the underground pipelines that conveyed sanitary waste water from the 1701-F Gatehouse, 1709-F Fire Station, and the 1720-F Administrative Office to the 1607-F1 septic tank. The site has been remediated and presently exists as an open excavation. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  3. Remaining Sites Verification Package for the 1607-F1 Sanitary Sewer System (124-F-1) and the 100-F-26:8 (1607-F1) Sanitary Sewer Pipelines Waste Sites, Waste Site Reclassification Form 2004-130

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2008-03-14

    The 1607-F1 Sanitary Sewer System (124-F-1), consisted of a septic tank, drain field, and associated pipelines that received sanitary waste water from the 1701-F Gatehouse, 1709-F Fire Station, and the 1720-F Administrative Office via the 100-F-26:8 pipelines. The septic tank required remedial action based on confirmatory sampling. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  4. Publications | Page 268 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rural women in the wired world. In this age of instantaneous electronic communication, the term “digital divide” has become standard shorthand to describe the gap between those who have access to advanced communication.

  5. Publications | Page 268 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... Income from illegal opium poppy cultivation helps sustain the livelihoods of millions of rural Afghans, but also provides significant revenues to criminals and armed groups fighting ...

  6. 268-IJBCS-Article-Ngueguim Jules Romain

    African Journals Online (AJOL)

    Dr Gatsing

    was needed for feature extraction and overlay. For this task, Arc View GIS 3.2a and ERDAS. IMAGINE 8.5 were used. Land cover change detection, qualification and quantification. The objective of analyzing the spatio- temporal dynamics of the land cover was to monitor the changes of the tropical rainforest vegetation cover ...

  7. Publications | Page 268 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Thirty-one countries from war-torn Afghanistan to Yemen are queued for membership in the World Trade Organization (WTO). Despite the disarray in the current Doha Round of trade talks and the growing number of regional and bilateral... Pandora's Box: A new model for education in Asia. Distance education. Just say the ...

  8. 12 CFR 268.108 - Hearings.

    Science.gov (United States)

    2010-01-01

    ... investigative file, for documents, records, comparative data, statistics, affidavits, or the attendance of... hearing. The Board shall provide for the attendance at a hearing of all employees approved as witnesses by an administrative judge. Attendance at hearings will be limited to persons determined by the...

  9. 12 CFR 268.204 - Class complaints.

    Science.gov (United States)

    2010-01-01

    ... discriminates against the group on the basis of their race, color, religion, sex, national origin, age or... agent or representative and must identify the policy or practice adversely affecting the class as well...

  10. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

    1984-01-01

    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most o...

  11. 1935 15' Quad #268 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. 40 CFR 268.48 - Universal treatment standards.

    Science.gov (United States)

    2010-07-01

    ...-chloropropane 96-12-8 0.11 15 1,2-Dibromoethane/Ethylene dibromide 106-93-4 0.028 15 Dibromomethane 74-95-3 0.11....056 0.28 Aldrin 309-00-2 0.021 0.066 4-Aminobiphenyl 92-67-1 0.13 NA Aniline 62-53-3 0.81 14 o...-89-9 0.0017 0.066 Barban 6 101-27-9 0.056 1.4 Bendiocarb 6 22781-23-3 0.056 1.4 Benomyl 6 17804-35-2...

  13. All projects related to | Page 268 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: AGRICULTURAL RESEARCH, AGRICULTURAL ENGINEERING, AGRICULTURAL PRODUCTION, ADAPTATION TO CHANGE. Region: Kenya, North of Sahara, South of Sahara. Program: Climate Change. Total Funding: CA$ 0.00. Agricultural Productivity and Climate Change in Arid and Semiarid Kenya. Project.

  14. Foch as Military Commander. London, 1972, pp 268. Marshal Foch ...

    African Journals Online (AJOL)

    proceed to an evaluation of the European poli- tical situation in the years before 1914, in- cluding the evolution of the Entente CordiaIe. Thereafter the account moves to the frontier battle in Lorraine in August 1914, the retreat to the Marne in early September, the Battle of the Marne (6-9 September), the establish- ment of the ...

  15. 7 CFR 2.68 - Administrator, National Agricultural Statistics Service.

    Science.gov (United States)

    2010-01-01

    ... promote and support the development of a viable and sustainable global agricultural system. Such work may..., price, and other aspects of the U.S. agricultural economy, collection of statistics, conduct of... committees concerned with agricultural science, education, and development activities, including library and...

  16. 77 FR 268 - Marine Mammals; File No. 16998

    Science.gov (United States)

    2012-01-04

    ... on Steller sea lions (Eumetopias jubatus) in Alaska. DATES: Written, telefaxed, or email comments... written request or by appointment in the following offices: Permits and Conservation Division, Office of..., Permits and Conservation Division, at the address listed above. Comments may also be submitted by...

  17. President Ilves andis teenetemärgi 268 inimesele

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Vabariigi 90. aastapäeva puhul riiklike autasudega tunnustatud isikute nimekiri. Vt. samas: Allar Viivik. Ärimees ja kirjanik on saanud kolm autasu. Kolm teenetemärki on saanud kirjanik ja riigitegelane Lehte Sööt (Hainsalu) ning ärimees Toomas Luman; Kadri Paas. Valgetähe orden purjutajast naaklejale. President Toomas Hendrik Ilves annab Valgetähe III klassi ordeni Indrek Tarandile kaasa aitamise eest Eesti liitumisele Euroopa Liidu ja NATOga; Teenetemärke on antud välja 5544. Eesti riiklikke teenetemärke jagab Vabariigi President 1995. aastast. Statistilised andmed eri aastatel antud teenetemärkide kohta. Vt. ka lk. 10 juhtkiri: Ärma ordenipuu. Autasustatute nimekiri ilmunud ka: Eesti Päevaleht 7. veebr. 2008, lk. 8-9, pealk.: Vabariigi president Toomas Hendrik Ilves jagab teenetemärke; Postimees 7. veebr. 2008, lk. 12-15, pealk.: Riiklike teenetemärkide saajad; Postimees : na russkom jazõke 7. veebr. 2008, lk. 2, 4-5 ; Maaleht 7. veebr. 2008, lk. 12-13, pealk.: Eesti tänab 2008; Linnaleht : Tallinn 7. veebr. 2008, lk. 4, pealk.: Eesti tänab; Eesti Päevaleht (Stockholm) 21. veebr. 2008, lk. 3, 11, pealk.: Selgusid 2008. aasta Eesti riiklikud autasud; Eesti Elu 22. veebr. 2008, lk. 12-13, pealk.: Riiklike autasude andmine

  18. Dicty_cDB: VHK268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tsn htf*kptvqsvrvtyf*yvvv*ep*nlklskptqvnivslhqrhlyivkvrqsrermktv smr--- ---**vg*yctfxrfitr*cwwcw**syqsnfn*ngwyerqxxrf...hhwxyq*tryhrsxy ppsrxfrsthlhsitrftxxxchfqglxq*ixsrqgyrfxifgskxsrfxwxrfn*

  19. Dicty_cDB: SFC268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N AF222688 |AF222688.1 Dictyostelium discoideum dynaco... AF222688_1( AF222688 |pid:none) Dictyostelium discoideum dynacorti... 523 e-147

  20. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... a visual indication whenever the transmitter is supplying power to the antenna. (4) Have a two-tone... between masts or other supports subject to whipping, a safety link must be installed which under heavy stress will reduce breakage of the antenna, the halyards, or any other supporting elements. (d) The...

  1. 40 CFR 268.45 - Treatment standards for hazardous debris.

    Science.gov (United States)

    2010-07-01

    ... debris that has been treated using one of the specified extraction or destruction technologies in Table 1... using simple physical or mechanical means; and (ii) Residue from the treatment of hazardous debris is... restrictions 2 A. Extraction Technologies: 1. Physical Extraction a. Abrasive Blasting: Removal of contaminated...

  2. 12 CFR 268.104 - Pre-complaint processing.

    Science.gov (United States)

    2010-01-01

    ...-complaint processing. (a) Aggrieved persons who believe they have been discriminated against on the basis of race, color, religion, sex, national origin, age or disability must consult a Counselor prior to filing... person contacted the Board's EEO Programs Office to request counseling. If the matter has not been...

  3. 40 CFR 268.40 - Applicability of treatment standards.

    Science.gov (United States)

    2010-07-01

    ... K002 Wastewater treatment sludge from the production of chrome yellow and orange pigments. Chromium... from the production of molybdate orange pigments. Chromium (Total)Lead 7440-47-37439-92-1 2.770.69 0.60 mg/L TCLP0.75 mg/L TCLP K004 Wastewater treatment sludge from the production of zinc yellow pigments...

  4. 32 CFR 268.9 - Discussion of terms.

    Science.gov (United States)

    2010-07-01

    ... official multinational organizations, with the institution name. When the project is located in, or goods... Puerto Rico, American Samoa, the Canal Zone, Guam, Midway Island, U.S. Virgin Islands, and Wake Island... consistent with the standardized names and codes contained in the Military Assistance and Sales Manual (MASM...

  5. 49 CFR 268.11 - Project eligibility standards.

    Science.gov (United States)

    2010-10-01

    ... from the technology (e.g. energy consumption compared to other transportation options); generic noise... high-speed ground transportation corridor that exhibit Partnership Potential; (ii) Require an amount of... between distinct points, rather than a service solely for the passengers' riding pleasure. (ii) The...

  6. 40 CFR 268.6 - Petitions to allow land disposal of a waste prohibited under subpart C of part 268.

    Science.gov (United States)

    2010-07-01

    ... analysis of background air, soil, and water quality. (4) A monitoring plan that detects migration at the... reproducible to the extent that state-of-the-art techniques allow; (2) All sampling, testing, and estimation techniques for chemical and physical properties of the waste and all environmental parameters must have been...

  7. Ammonothermal synthesis of alkali-alkaline earth metal and alkali-rare earth metal carbodiimides. K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}

    Energy Technology Data Exchange (ETDEWEB)

    Mallmann, Mathias; Haeusler, Jonas; Cordes, Niklas; Schnick, Wolfgang [Department of Chemistry, University of Munich (LMU) (Germany)

    2017-12-13

    Alkali-alkaline earth metal and alkali-rare earth metal carbodiimides, namely K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (x = 0 - 1) (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}, were synthesized under ammonothermal conditions in high-pressure autoclaves. The structures of the three compounds can be derived from homeotypic K{sub 5}H(CN{sub 2}){sub 3} and Na{sub 5}H(CN{sub 2}){sub 3} by partial substitution of K{sup +} or Na{sup +}by Sr{sup 2+} or Eu{sup 2+}. The reactions were carried out in two step syntheses (T{sub 1} = 673 K, T{sub 2} = 823 K) starting from sodium or potassium azide, dicyandiamide and strontium or Eu(NH{sub 2}){sub 2}, respectively. The crystal structures were solved and refined from single-crystal X-ray diffraction data [K{sub 4.16}Sr{sub 0.84}(CN{sub 2}){sub 2.84}(HCN{sub 2}){sub 0.16}: space group Im3m (no. 229), a = 7.8304(5) Aa, Z = 2, R{sub 1} = 0.024, wR{sub 2} = 0.052; K{sub 4.40}Eu{sub 0.60}(CN{sub 2}){sub 2.60}(HCN{sub 2}){sub 0.40}: space group Im anti 3m (no. 229), a = 7.8502(6) Aa, Z = 2, R{sub 1} = 0.022, wR{sub 2} = 0.049]. In contrast to the potassium carbodiimides, the sodium-strontium carbodiimide was only synthesized as microcrystalline powder. The crystal structure was determined by powder X-ray diffraction and refined by the Rietveld method [Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}: space group Im3m (no. 229), a = 7.2412(1) Aa, Z = 2, R{sub wp} = 0.050]. The presence of hydrogencyanamide units ([HNCN]{sup -}) next to carbodiimide units ([CN{sub 2}]{sup 2-}) in all compounds was confirmed by FT-IR spectroscopy. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. 40 CFR Appendix Xi to Part 268 - Metal Bearing Wastes Prohibited From Dilution in a Combustion Unit According to 40 CFR 268.3(c)

    Science.gov (United States)

    2010-07-01

    ... Wastewater treatment sludge from the production of chrome yellow and orange pigments. K003 Wastewater treatment sludge from the production of molybdate orange pigments. K004 Wastewater treatment sludge from the production of zinc yellow pigments. K005 Wastewater treatment sludge from the production of chrome green...

  9. Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 268

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Fling, Rick; McClung, Christina; Robitaille, George

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...

  10. Yeast Interacting Proteins Database: YOR124C, YGR268C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available that of Type I J-proteins; computational analysis of large-scale protein-protein interaction data suggests a...plasmic protein containing a zinc finger domain with sequence similarity to that of Type I J-proteins; computation

  11. Yeast Interacting Proteins Database: YGR268C, YER125W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available larity to that of Type I J-proteins; computational analysis of large-scale protein-protein interaction data ...equence similarity to that of Type I J-proteins; computational analysis of large-scale protein-protein inter

  12. Yeast Interacting Proteins Database: YDL239C, YGR268C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ith sequence similarity to that of Type I J-proteins; computational analysis of large-scale protein-protein ...equence similarity to that of Type I J-proteins; computational analysis of large-scale protein-protein inter

  13. : tous les projets | Page 268 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TOBACCO INDUSTRY, SMOKING, CROP DIVERSIFICATION, INCOME GENERATION. Région: India, Central Asia, Far East Asia, South Asia. Programme: Alimentation, environnement et santé. Financement total : CA$ 200,500.00. Solutions de remplacement à la culture du tabac et aux activités connexes (Inde).

  14. 40 CFR 268.37 - Waste specific prohibitions-ignitable and corrosive characteristic wastes whose treatment...

    Science.gov (United States)

    2010-07-01

    ... Clean Water Act (CWA), or that inject in Class I deep wells regulated under the Safe Drinking Water Act... organics, alkaline chlorination or ferrous sulfate precipitation for cyanide, precipitation/sedimentation...

  15. People and things. CERN Courier, Oct 1986, v. 26(8)

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Already acknowledged as the world's most versatile system of particle accelerators, CERN's complex of big machines put on a spectacular performance after the short summer shutdown. On 3 September, the new LEP Injection Linac (LIL) was put through its paces and the ejection line tested in readiness for the next step. The 1986 Dirac Medals of the International Centre for Theoretical Physics, Trieste, Italy, have been awarded to Ybichiro Nambu and Alexander Polyakov for their important contributions to mathematical physics

  16. 12 CFR 268.102 - Board program for equal employment opportunity.

    Science.gov (United States)

    2010-01-01

    ... discrimination from the Board's personnel policies, practices and working conditions; (4) Communicate the Board's... throughout the workplace; (6) Ensure that full cooperation is provided by all Board employees to EEO... and for the receipt and processing of individual and class complaints of discrimination; and (5...

  17. Sud du Sahara | Page 268 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sud du Sahara. Sud du Sahara. Read more about Taxes sur les cigarettes en Tanzanie. Langue French. Read more about Cigarette Taxation in Tanzania. Langue English. Read more about Vers une structure de sécurité régionale dans la Corne de l'Afrique - phase II. Langue French. Read more about Toward a Regional ...

  18. SU-F-T-268: A Feasibility Study of Independent Dose Verification for Vero4DRT

    International Nuclear Information System (INIS)

    Yamashita, M; Kokubo, M; Takahashi, R; Takayama, K; Tanabe, H; Sueoka, M; Okuuchi, N; Ishii, M; Iwamoto, Y; Tachibana, H

    2016-01-01

    Purpose: Vero4DRT (Mitsubishi Heavy Industries Ltd.) has been released for a few years. The treatment planning system (TPS) of Vero4DRT is dedicated, so the measurement is the only method of dose verification. There have been no reports of independent dose verification using Clarksonbased algorithm for Vero4DRT. An independent dose verification software program of the general-purpose linac using a modified Clarkson-based algorithm was modified for Vero4DRT. In this study, we evaluated the accuracy of independent dose verification program and the feasibility of the secondary check for Vero4DRT. Methods: iPlan (Brainlab AG) was used as the TPS. PencilBeam Convolution was used for dose calculation algorithm of IMRT and X-ray Voxel Monte Carlo was used for the others. Simple MU Analysis (SMU, Triangle Products, Japan) was used as the independent dose verification software program in which CT-based dose calculation was performed using a modified Clarkson-based algorithm. In this study, 120 patients’ treatment plans were collected in our institute. The treatments were performed using the conventional irradiation for lung and prostate, SBRT for lung and Step and shoot IMRT for prostate. Comparison in dose between the TPS and the SMU was done and confidence limits (CLs, Mean ± 2SD %) were compared to those from the general-purpose linac. Results: As the results of the CLs, the conventional irradiation (lung, prostate), SBRT (lung) and IMRT (prostate) show 2.2 ± 3.5% (CL of the general-purpose linac: 2.4 ± 5.3%), 1.1 ± 1.7% (−0.3 ± 2.0%), 4.8 ± 3.7% (5.4 ± 5.3%) and −0.5 ± 2.5% (−0.1 ± 3.6%), respectively. The CLs for Vero4DRT show similar results to that for the general-purpose linac. Conclusion: The independent dose verification for the new linac is clinically available as a secondary check and we performed the check with the similar tolerance level of the general-purpose linac. This research is partially supported by Japan Agency for Medical Research and Development (AMED)

  19. The Evolving Threat of al Qaeda in the Islamic Maghreb (Strategic Forum, Number 268, July 2011)

    Science.gov (United States)

    2011-07-01

    33 Richard Edwards, “Terrorism Threat to England Opening Match against USA at Football World Cup,” The Telegraph, April 10, 2010. 34 “Mauritania...innovation Christopher J. Lamb and evan Munsing (Center for Strategic research, Strategic Perspectives no. 4, March 2011) Brazil and the United

  20. 40 CFR 268.42 - Treatment standards expressed as specified technologies.

    Science.gov (United States)

    2010-07-01

    ...) chelation/solvent extraction; (5) freeze crystalization; (6) ultrafiltration and/or (7) simple precipitation... operating requirements; and certain non-combustive technologies, such as the Catalytic Extraction Process... requirements of 40 CFR part 264 subpart 0 and part 265 subpart 0. LLEXT: Liquid-liquid extraction (often...

  1. 40 CFR Appendix Vii to Part 268 - LDR Effective Dates of Surface Disposed Prohibited Hazardous Wastes

    Science.gov (United States)

    2010-07-01

    ... All Aug. 8, 1990. P096 All Aug. 8, 1990. P097 All June 8, 1989. P098 All June 8, 1989. P099 (silver... Aug. 8, 1990. P104 (silver) Wastewater Aug. 8, 1990. P104 All others June 8, 1989. P105 All Aug. 8... incineration, vitrification, or mercury retorting, acid leaching followed by chemical precipitation, or thermal...

  2. 40 CFR 268.31 - Waste specific prohibitions-Dioxin-containing wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste specific prohibitions-Dioxin... specific prohibitions—Dioxin-containing wastes. (a) Effective November 8, 1988, the dioxin-containing... F026-F028 dioxin-containing waste is contaminated soil and debris resulting from a response action...

  3. The Atlantic Alliance at 35. Foreign Policy Association Headline Series, No. 268.

    Science.gov (United States)

    DePorte, A. W.

    One in a series of booklets whose purpose is to stimulate greater and more effective understanding of world affairs among Americans, this six-chapter report examines the North Atlantic Treaty Organization's (NATO) first 35 years and probes the extent to which the alliance can find common ground on the perennial issues of military doctrine,…

  4. IAEA Newsbriefs. V. 10, no. 2(68). Jun-Jul 1995

    International Nuclear Information System (INIS)

    1995-01-01

    This issue gives brief information on the following topics: IAEA General Conference opens in September in Vienna, IAEA Board of Governors' June meetings (Safeguards proposals, Technical cooperation, Radiation safety, Radioactive waste management, Liability for nuclear damage, IAEA regular budget for 1996), NPT Conference reaffirms support for IAEA roles, Director General addresses NPT Conference, Seminar on nuclear waste management in Russian Federation, Safety Reviews of Medzamor in Armenia, Update on Nuclear Safety Convention, Cuba and Brazil: Public information seminars, India: Donation to the IAEA Laboratories, Simulated emergency tests global procedures, INIS: Happy Anniversary, China hosts international isotope conference, Nuclear power: Status and outlook, and other short information

  5. SU-F-T-268: A Feasibility Study of Independent Dose Verification for Vero4DRT

    Energy Technology Data Exchange (ETDEWEB)

    Yamashita, M; Kokubo, M [Kobe City Medical Center General Hospital, Kobe, Hyogo (Japan); Institute of Biomedical Research and Innovation, Kobe, Hyogo (Japan); Takahashi, R [Cancer Institute Hospital of Japanese Foundation for Cancer Research, Koto, Tokyo (Japan); Takayama, K [Institute of Biomedical Research and Innovation, Kobe, Hyogo (Japan); Kobe City Medical Center General Hospital, Kobe, Hyogo (Japan); Tanabe, H; Sueoka, M; Okuuchi, N [Institute of Biomedical Research and Innovation, Kobe, Hyogo (Japan); Ishii, M; Iwamoto, Y [Kobe City Medical Center General Hospital, Kobe, Hyogo (Japan); Tachibana, H [National Cancer Center, Kashiwa, Chiba (Japan)

    2016-06-15

    Purpose: Vero4DRT (Mitsubishi Heavy Industries Ltd.) has been released for a few years. The treatment planning system (TPS) of Vero4DRT is dedicated, so the measurement is the only method of dose verification. There have been no reports of independent dose verification using Clarksonbased algorithm for Vero4DRT. An independent dose verification software program of the general-purpose linac using a modified Clarkson-based algorithm was modified for Vero4DRT. In this study, we evaluated the accuracy of independent dose verification program and the feasibility of the secondary check for Vero4DRT. Methods: iPlan (Brainlab AG) was used as the TPS. PencilBeam Convolution was used for dose calculation algorithm of IMRT and X-ray Voxel Monte Carlo was used for the others. Simple MU Analysis (SMU, Triangle Products, Japan) was used as the independent dose verification software program in which CT-based dose calculation was performed using a modified Clarkson-based algorithm. In this study, 120 patients’ treatment plans were collected in our institute. The treatments were performed using the conventional irradiation for lung and prostate, SBRT for lung and Step and shoot IMRT for prostate. Comparison in dose between the TPS and the SMU was done and confidence limits (CLs, Mean ± 2SD %) were compared to those from the general-purpose linac. Results: As the results of the CLs, the conventional irradiation (lung, prostate), SBRT (lung) and IMRT (prostate) show 2.2 ± 3.5% (CL of the general-purpose linac: 2.4 ± 5.3%), 1.1 ± 1.7% (−0.3 ± 2.0%), 4.8 ± 3.7% (5.4 ± 5.3%) and −0.5 ± 2.5% (−0.1 ± 3.6%), respectively. The CLs for Vero4DRT show similar results to that for the general-purpose linac. Conclusion: The independent dose verification for the new linac is clinically available as a secondary check and we performed the check with the similar tolerance level of the general-purpose linac. This research is partially supported by Japan Agency for Medical Research and Development (AMED)

  6. 2-[6,8-Dibromo-3-(4-hydroxycyclohexyl-1,2,3,4-tetrahydroquinazolin-2-yl]-6-methoxyphenol

    Directory of Open Access Journals (Sweden)

    2009-03-01

    Full Text Available The title compound, C21H24Br2N2O3, was synthesized by the condensation reaction of 3-methoxysalicylaldehyde with 4-(2-amino-3,5-dibromobenzylaminocyclohexanol in a methanol solution. The dihedral angle between the two benzene rings is 76.4 (3°. The cyclohexyl ring adopts a chair configuration. There is an intramolecular O—H...N hydrogen bond which affects the solid state conformation of the molecule. The crystal structure is stabilized by intermolecular O—H...O hydrogen bonds, forming chains running along the b axis.

  7. S. Afr. J. Anim. ScL I I , 255-268 ( I9S I ) THE INFLUENCE OF ...

    African Journals Online (AJOL)

    take, frclm the time of conception, and body mass or the components of body composition, as will be evident. In- dividual feed intake from conception up to 5 weeks of age had to be estimated. The total body protein and fat content of the l2 pigs slaughtered at 5,7 and 8 weeks of age were determined according to the method ...

  8. Technical realisation of the VISA-II project, phase I, part IV, IZ-165-o268-1962

    International Nuclear Information System (INIS)

    Pavicevic, M.

    1962-12-01

    Project VISA-II is described in IX chapters as follows: introduction, definition of experiments and possibilities of performance; VISA-II channel, new experimental space in the RA reactor; hydraulic tests in the VISA-II channel; measurement of fast neutron and gamma flux in VISA-II channels; measurement of water flow through different VISA-2 irradiation capsules; fabrication of VISA-II capsules; corrosion and heavy water purity problems; safety problems of experiment VISA-2; experimental operation of VISA-II. This chapter VI includes documentation for each type of capsule, review about each experiment within the VISA-II project, the objective and purpose of the experiment as well as experimental device [sr

  9. The relationship among early food introduction, family socioeconomic status and respiratory diseases - doi:10.5020/18061230.2010.p268

    Directory of Open Access Journals (Sweden)

    Vagner de Souza Vargas

    2012-01-01

    Full Text Available Objective: To assess the characteristics of early supplementary feeding and socioeconomic and demographic characteristics of families of children aged 0-59 months with respiratory diseases. Methods: A comparison of data from two population-based cross-sectional studies conducted in Rio Grande / RS, in 1995 and 2004 in order to observe changes in prevalence. Results: In both studies we perceived that the majority of children received water, teas, juices, soups and fruits before six months. In contrast, powdered milk, cow milk, meats and bean were introduced after the sixth month of life to most children. In both studies, there was greater proportion of families with incomes up to 5.9 minimum wages, with up to 8 completed years of schooling, adequate housing conditions, married women, with a son and birth intervals longer than 3 years. Conclusions: We observed, in both studies, that the introduction of food before the sixth month of life is still common in this population, although during this period the children should be under exclusive breastfeeding.

  10. Expression of the Immediate-Early Gene-Encoded Protein Egr-1 ("zif268") during in Vitro Classical Conditioning

    Science.gov (United States)

    Mokin, Maxim; Keifer, Joyce

    2005-01-01

    Expression of the immediate-early genes (IEGs) has been shown to be induced by activity-dependent synaptic plasticity or behavioral training and is thought to play an important role in long-term memory. In the present study, we examined the induction and expression of the IEG-encoded protein Egr-1 during an in vitro neural correlate of eyeblink…

  11. 268 Origine du phénomène d'ensablement déduite par combinaison ...

    African Journals Online (AJOL)

    zakaria

    Validité du modèle de McLaren et Bowles (1985) ″. Thèse. Univ. Med V. Rabat, (1996) 151p. [10] - H. DELANNOY, Contribution à l'étude climatologique de la province de Tarfaya (Maroc). In : Contribution à l'étude scientifique de la province de Tarfaya. Trav. Inst. Chér., série générale, vol. 3. (1975) p. 15-60. [11] - F. BONN ...

  12. The current and future role of general practitioners in skin cancer care: an assessment of 268 general practitioners

    NARCIS (Netherlands)

    Rijsingen, M.C.J. van; Bon, B.W. van; Wilt, G.J. van der; Lagro-Janssen, A.L.M.; Gerritsen, M.J.P.

    2014-01-01

    BACKGROUND: Given the increase in skin cancer (SC) it seems inevitable that general practitioners (GPs) will play a larger role in SC care in the near future. OBJECTIVES: To obtain insights into the opinion of GPs with respect to their role in SC care, and their SC knowledge and skills. METHODS: A

  13. New rules to ensure the protection of animals in Spain. Spanish Animal Welfare Act. 32/2007. 7th November (BOE. 268, 8th November 2007. Number 19321)

    OpenAIRE

    Giménez-Candela, Teresa

    2009-01-01

    Law 32/2007, on 7th November for the care of animals in their exploitation, transport, experimentation and sacrifice. The law ist composed of an Preamble and structured in three titles, completed by an additional provision and six final provisions. This Act provides, in compliance with the Community mandate, a set of principles on the Animal care and schedule off offenses and penalties that gives legal effect to the obligations under current regulations. The Act also provides the foundation f...

  14. 2-[6,8-Dibromo-3-(4-hydroxycyclohexyl-1,2,3,4-tetrahydroquinazolin-2-yl]phenol methanol 0.25-solvate

    Directory of Open Access Journals (Sweden)

    Zhi-Gang Wang

    2011-04-01

    Full Text Available The title compound, C20H22Br2N2O2·0.25CH4O, was synthesized by the condensation reaction of salicylaldehyde with 4-(2-amino-3,5-dibromobenzylaminocyclohexanol in methanol. There are four independent main molecules and two half-occupied methanol solvent molecules in the asymmetric unit. The dihedral angles between the two benzene rings in the four molecules are 87.8 (6, 86.6 (6, 89.3 (6 and 83.1 (6°. Each molecule features an intramolecular O—H...N hydrogen bond and a short N—H...Br link. In the crystal components are linked by O—H...O hydrogen bonds.

  15. Direct C-H arylation of purines: Development of methodology and its use in regioselective synthesis of 2,6,8-trisubstituted purines

    Czech Academy of Sciences Publication Activity Database

    Čerňa, Igor; Pohl, Radek; Klepetářová, Blanka; Hocek, Michal

    2006-01-01

    Roč. 8, č. 23 (2006), s. 5389-5392 ISSN 1523-7060 R&D Projects: GA ČR(CZ) GA203/05/0043; GA MŠk(CZ) LC06077 Institutional research plan: CEZ:AV0Z40550506 Keywords : purines * cross-coupling * C-H activation * arylation Subject RIV: CC - Organic Chemistry Impact factor: 4.659, year: 2006

  16. Multibeam collection for TN268: Multibeam data collected aboard Thomas G. Thompson from 2011-08-11 to 2011-09-01, Seattle, WA to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. 20 CFR 667.269 - What procedures and sanctions apply to violations of §§ 667.260 through 667.268?

    Science.gov (United States)

    2010-04-01

    ... investigation and resolution of the violations are provided for under the Grant Officer's resolution process at....266(b)(1)). (c) Sanctions and remedies are provided for in WIA section 181(d)(3) for violations of...

  18. Physical Activity Attenuates the Influence of FTO Variants on Obesity Risk : A Meta-Analysis of 218,166 Adults and 19,268 Children

    NARCIS (Netherlands)

    Kilpelaeinen, Tuomas O.; Qi, Lu; Brage, Soren; Sharp, Stephen J.; Sonestedt, Emily; Demerath, Ellen; Ahmad, Tariq; Mora, Samia; Kaakinen, Marika; Sandholt, Camilla Helene; Holzapfel, Christina; Autenrieth, Christine S.; Hyppoenen, Elina; Cauchi, Stephane; He, Meian; Kutalik, Zoltan; Kumari, Meena; Stancakova, Alena; Meidtner, Karina; Balkau, Beverley; Tan, Jonathan T.; Mangino, Massimo; Timpson, Nicholas J.; Song, Yiqing; Zillikens, M. Carola; Jablonski, Kathleen A.; Garcia, Melissa E.; Johansson, Stefan; Bragg-Gresham, Jennifer L.; Wu, Ying; van Vliet-Ostaptchouk, Jana V.; Onland-Moret, N. Charlotte; Zimmermann, Esther; Rivera, Natalia V.; Tanaka, Toshiko; Stringham, Heather M.; Silbernagel, Guenther; Kanoni, Stavroula; Feitosa, Mary F.; Snitker, Soren; Ruiz, Jonatan R.; Metter, Jeffery; Martinez Larrad, Maria Teresa; Atalay, Mustafa; Hakanen, Maarit; Amin, Najaf; Cavalcanti-Proenca, Christine; Grontved, Anders; Hallmans, Goran; Jansson, John-Olov; Kuusisto, Johanna; Kahonen, Mika; Lutsey, Pamela L.; Nolan, John J.; Palla, Luigi; Pedersen, Oluf; Perusse, Louis; Renstrom, Frida; Scott, Robert A.; Shungin, Dmitry; Sovio, Ulla; Tammelin, Tuija H.; Ronnemaa, Tapani; Lakka, Timo A.; Uusitupa, Matti; Serrano Rios, Manuel; Ferrucci, Luigi; Bouchard, Claude; Meirhaeghe, Aline; Fu, Mao; Walker, Mark; Borecki, Ingrid B.; Dedoussis, George V.; Fritsche, Andreas; Ohlsson, Claes; Boehnke, Michael; Bandinelli, Stefania; van Duijn, Cornelia M.; Ebrahim, Shah; Lawlor, Debbie A.; Gudnason, Vilmundur; Harris, Tamara B.; Sorensen, Thorkild I. A.; Mohlke, Karen L.; Hofman, Albert; Uitterlinden, Andre G.; Tuomilehto, Jaakko; Lehtimaki, Terho; Raitakari, Olli; Isomaa, Bo; Njolstad, Pal R.; Florez, Jose C.; Liu, Simin; Ness, Andy; Spector, Timothy D.; Tai, E. Shyong; Froguel, Philippe; Boeing, Heiner; Laakso, Markku; Marmot, Michael; Bergmann, Sven; Power, Chris; Khaw, Kay-Tee; Chasman, Daniel; Ridker, Paul; Hansen, Torben; Monda, Keri L.; Illig, Thomas; Jarvelin, Marjo-Riitta; Wareham, Nicholas J.; Hu, Frank B.; Groop, Leif C.; Orho-Melander, Marju; Ekelund, Ulf; Franks, Paul W.; Loos, Ruth J. F.

    2011-01-01

    Background: The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute

  19. Physical activity attenuates the influence of FTO variants on obesity risk: A meta-analysis of 218,166 adults and 19,268 children

    NARCIS (Netherlands)

    T.O. Kilpeläinen (Tuomas); L. Qi (Lu); S. Brage (Soren); S.J. Sharp (Stephen); E. Sonestedt (Emily); E.W. Demerath (Ellen); T. Ahmad (Tariq); S. Mora (Samia); M. Kaakinen (Marika); C. Sandholt (Camilla); C. Holzapfel (Christina); C.S. Autenrieth (Christine); E. Hyppönen (Elina); S. Cauchi (Stephane); M. He (Meian); Z. Kutalik (Zoltán); M. Kumari (Meena); A. Stancáková (Alena); K. Meidtner (Karina); B. Balkau (Beverley); J.T. Tan (Jonathan); M. Mangino (Massimo); N.J. Timpson (Nicholas); Y. Song (Yiqing); M.C. Zillikens (Carola); K.A. Jablonski (Kathleen); M. Garcia (Melissa); S. Johansson (Stefan); J.L. Bragg-Gresham (Jennifer L.); Y. Wu (Ying); J.V. van Vliet-Ostaptchouk (Jana); N.C. Onland-Moret (Charlotte); E. Zimmermann (Esther); N.V. Rivera (Natalia); T. Tanaka (Toshiko); H.M. Stringham (Heather); G. Silbernagel (Günther); S. Kanoni (Stavroula); M.F. Feitosa (Mary Furlan); S. Snitker (Soren); J.R. Ruiz (Jonatan); J. Metter (Jeffery); M.T.M. Larrad; M. Atalay (Mustafa); M. Hakanen (Maarit); N. Amin (Najaf); C. Cavalcanti-Proença (Christine); A. Grøntved (Anders); G. Hallmans (Göran); J.O. Jansson; J. Kuusisto (Johanna); M. Kähönen (Mika); P.L. Lutsey (Pamela); J.J. Nolan (John); L. Palla (Luigi); O. Pedersen (Oluf); L. Pérusse (Louis); F. Renström (Frida); R.A. Scott (Robert); D. Shungin (Dmitry); U. Sovio (Ulla); T.H. Tammelin (Tuija); T. Rönnemaa (Tapani); T.A. Lakka (Timo); M. Uusitupa (Matti); M.S. Rios; L. Ferrucci (Luigi); C. Bouchard (Claude); A. Meirhaeghe (Aline); M. Fu (Mao); M. Walker (Mark); I.B. Borecki (Ingrid); G.V. Dedoussis (George); A. Fritsche (Andreas); C. Ohlsson (Claes); M. Boehnke (Michael); S. Bandinelli (Stefania); P. Tikka-Kleemola (Päivi); D.A. Lawlor (Debbie); V. Gudnason (Vilmundur); T.B. Harris (Tamara); T.I.A. Sørensen (Thorkild); K.L. Mohlke (Karen); A. Hofman (Albert); A.G. Uitterlinden (André); J. Tuomilehto (Jaakko); T. Lehtimäki (Terho); O. Raitakari (Olli); B. Isomaa (Bo); P. Njolstad (Pal); J.C. Florez (Jose); S. Liu (Simin); A.R. Ness (Andrew); T.D. Spector (Timothy); E.S. Tai (Shyong); P. Froguel (Philippe); H. Boeing (Heiner); M. Laakso (Markku); M. Marmot (Michael); S.M. Bergmann (Sven); C. Power (Chris); K.-T. Khaw; D.I. Chasman (Daniel); P.M. Ridker (Paul); T. Hansen (Torben); K.L. Monda (Keri); T. Illig (Thomas); M.R. Järvelin; N.J. Wareham (Nick); S. Ebrahim (Shanil); F.B. Hu (Frank); L. Groop (Leif); M. Orho-Melander (Marju); U. Ekelund (Ulf); P.W. Franks (Paul); R.J.F. Loos (Ruth)

    2011-01-01

    textabstractBackground: The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or

  20. SU-E-J-268: Is It Necessary to Account for Organs at Risk Respiratory Induced Motion Effects in Radiotherapy Planning with Tumor Tracking?

    International Nuclear Information System (INIS)

    Gilles, M; Boussion, N; Visvikis, D; Fayad, H; Pradier, O

    2014-01-01

    Purpose: The objective of this study was to evaluate the necessity to account for the organs at risk (OARs) respiratory induced motion in addition to the tumor displacement when planning a radiotherapy treatment that accounts for tumor motion. Methods: For 18 lung cancer patients, conformational radiotherapy treatment plans were generated using 3 different CT volumes: the two extreme respiratory phases corresponding to either the full inspiration (plan 1) or expiration (plan 3), as well as a manually deformed phase consisting in full inspiration combined with the full expiration tumor location (plan 2) simulating a tumor tracking plan without addressing OARs motion. Treatment plans were initially created on plan 1 and then transferred to plan 2 and 3 which represent respectively the tumor displacement only and the whole anatomic variations due to breathing. The dose coverage and the dose delivered to the OARs were compared using conformational indexes and generalized equivalent uniform dose. Results: The worst conformational indexes were obtained for plans with all anatomic deformations (Table 1) with an underestimation of the 95% isodose spreading on healthy tissue compared to plans considering the tumor displacement only. Furthermore, mean doses to the OARs when accounting for all the anatomic changes were always higher than those associated with the tumor displacement only: the mean difference between these two plans was 1±1.37 Gy (maximum of 3.8 Gy) for the heart and 1.4±1.42 Gy (maximum of 4.1 Gy) for the lung in which the tumor was located (Figure 1). Conclusion: OARs deformations due to breathing motion should be included in the treatment planning in order to avoid unnecessary OARs dose and/or allow for a tumor dose escalation. This is even more important for treatments like stereotactic radiation therapy which necessitates a high precision ballistic and dose control

  1. Comparison of alterations in c-fos and Egr-1 (zif268) expression throughout the rat brain following acute administration of different classes of antidepressant compounds.

    Science.gov (United States)

    Slattery, David A; Morrow, John A; Hudson, Alan L; Hill, David R; Nutt, David J; Henry, Brian

    2005-07-01

    The majority of immediate-early gene (IEG) studies focus on a few key brain regions associated with the class of psychoactive compound being studied. Recently, using a meta-analysis of the c-fos literature, we demonstrated the utility of c-fos profiling to classify such compounds. The present study examined acute delivery of a range of antidepressant classes; fluoxetine, imipramine, LiCl, and mirtazapine. The dual aims were to study the IEG profiles of these varying classes of antidepressants throughout the rat brain and to compare the utility of c-fos or Egr-1 as IEGs to classify clinically efficacious antidepressants. All antidepressants increased c-fos mRNA in the central amygdala, as previously shown, while c-fos was also increased in the anterior insular cortex and significantly decreased within the septum. Although acute antidepressant administration altered c-fos expression in a number of brain regions, Egr-1 expression was only significantly altered in the central amygdala, suggesting that Egr-1 may not be as useful a marker to investigate acute antidepressant treatment. The fact that these drugs, including the previously unclassified antidepressant mirtazapine, share a number of common loci of activation, which are implicated by human and animal studies in depression, adds further support to the use of IEG mapping to classify psychoactive compounds.

  2. Chemical Bonding and Molecular Geometry: from Lewis to Electron Densities. Ronald J. Gillespie, Paul L.A. Popelier (Eds.); Oxford University Press, Oxford, 2001, xiii+268 pages, ISBN 01951049-X, US$ 39.50

    Science.gov (United States)

    Silvi, B.

    2002-06-01

    This small book will certainly be one of the reference textbooks on the bonding theory of the next decade. The presentation of the different models used to describe and explain the chemical bond is made in both an epistemological and historical perspective in the first five chapters. The authors clearly show the importance of the Pauli principle as the explicative key of the chemical bonding. The respective merits and limitations of the Lewis model, of the orbital picture, of the valence shell electron pair (VSEPR) and ligand close-packing model are emphasised and illustrated by examples belonging to Inorganic Chemistry. The remaining three chapters contain an elegant presentation of the 'Atoms in Molecules' theory which provides a rigorous description of the bonding on the ground of the topological analysis of the electron density distribution. The introduction of the necessary mathematical definitions is made in a very simple and pedagogical fashion, which avoids unnecessary specialised jargon. The information extracted by the AIM analysis is then used to investigate the bonding in molecules belonging to periods 2-6. It is necessary to have read this book before teaching anything on the Chemical Bonding Theory. Its presence in the library is indispensable.

  3. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT259-268 during 2014 (NCEI Accession 0140225)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  4. Discussion of "Fluvial system response to late Pleistocene-Holocene sea-level change on Santa Rosa Island, Channel Islands National Park, California" (Schumann et al., 2016. Geomorphology, 268: 322-340)

    Science.gov (United States)

    Pinter, Nicholas; Hardiman, Mark; Scott, Andrew C.; Anderson, R. Scott

    2018-01-01

    Schumann et al. (2016) presented a field assessment of late Pleistocene to Holocene fluvial sediments preserved in the valleys of Santa Rosa Island, California. This is a rigorous study, based on stratigraphic descriptions of 54 sections and numerous radiocarbon ages. The paper makes important contributions that we would like to highlight, but other parts of the paper rely upon overly simplistic interpretations that lead to misleading conclusions. In one case, a conclusion of the Schumann et al. paper has important management implications for Santa Rosa Island and similar locations, compelling us to discuss and qualify this conclusion.

  5. The mechanism of the glycosylase reaction with hOGG1 base-excision repair enzyme: concerted effect of Lys249 and Asp268 during excision of 8-oxoguanine

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Hattori, Y.; Sato, D.; Řeha, David; Nencka, Radim; Kohno, T.; Kojima, C.; Tanaka, Y.; Sychrovský, Vladimír

    2017-01-01

    Roč. 45, č. 9 (2017), s. 5231-5242 ISSN 0305-1048 R&D Projects: GA ČR GA13-27676S Institutional support: RVO:61388963 ; RVO:61388971 Keywords : 8-oxoguanine * hOGG1 * QM/MM * NMR * base-excision repair Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 10.162, year: 2016 https://academic.oup.com/nar/article-lookup/doi/10.1093/nar/gkx157

  6. Accurate stopping power measurements for (0.21–2.68) MeV/u {sup 1}H{sup +} and {sup 4}He{sup +} ions crossing thin Al foils; extraction of the (I, b) parameters

    Energy Technology Data Exchange (ETDEWEB)

    Moussa, D., E-mail: djamelmoussa@gmail.com [Université des Sciences et Technologie H. Boumediene (USTHB), Laboratoire SNIRM, Faculté de Physique, B.P. 32, 16111 Bab-Ezzouar, Algiers (Algeria); Damache, S. [Division de Physique, CRNA, 02 Bd. Frantz Fanon, B.P. 399 Alger-gare, Algiers (Algeria); Ouichaoui, S., E-mail: souichaoui@gmail.com [Université des Sciences et Technologie H. Boumediene (USTHB), Laboratoire SNIRM, Faculté de Physique, B.P. 32, 16111 Bab-Ezzouar, Algiers (Algeria)

    2015-01-15

    The stopping powers of thin Al foils for H{sup +} and {sup 4}He{sup +} ions have been measured over the energy range E=(206.03–2680.05) keV/amu with an overall relative uncertainty better than 1% using the transmission method. The derived S(E) experimental data are compared to previous ones from the literature, to values derived by the SRIM-2008 code or compiled in the ICRU-49 report, and to the predictions of Sigmund–Schinner binary collision stopping theory. Besides, the S(E) data for H{sup +} ions together with those for He{sup 2+} ions reported by Andersen et al. (1977) have been analyzed over the energy interval E>1.0 MeV using the modified Bethe–Bloch stopping theory. The following sets of values have been inferred for the mean excitation potential, I, and the Barkas–Andersen parameter, b, for H{sup +} and He{sup +} projectiles, respectively: {(I=164±3)) eV, (b=1.40} and {(I=163±2.5)) eV, (b=1.38}. As expected, the I parameter is found to be independent of the projectile electronic structure presumably indicating that the contribution of charge exchange effects becomes negligible as the projectile velocity increases. Therefore, the I parameter must be determined from precise stopping power measurements performed at high projectile energies where the Bethe stopping theory is fully valid.

  7. 2013 Review of Neutron and Non-Neutron Nuclear Data

    Science.gov (United States)

    Holden, N. E.

    2016-02-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature over the past three years since the ISRD-14 Symposium has been performed and the highlights are presented. Included in the data review are the status of new chemical elements, new measurements of the isotopic composition for many chemical elements and the resulting change in the atomic weight values. New half-life measurements for both short-lived and long-lived nuclides, some alpha decay and double beta decay measurements for quasi-stable nuclides are discussed. The latest evaluation of atomic masses has been published. Data from new measurements on the very heavy (trans-meitnerium) elements are discussed and tabulated. Data on various recent neutron cross section and resonance integral measurements are discussed and tabulated.

  8. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  9. C7H7aSupTbs.doc

    Indian Academy of Sciences (India)

    268.693742 0.119554 -268.584529 -268.605503 -268.496290. Table S2. Total energies of 33 C7H7+ isomers as calculated by the B3LYP/6-31G(d) value of total energy Et, ZPE correction EZPE, corrected total energies Et(corr), total free energy ∆Gt ...

  10. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  11. 2010 Review of Neutron and Non-Neutron Nuclear Data

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N. E. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2011-05-27

    The results of a review and evaluation of neutron and nonneutron nuclear data published in the scientific literature over the past three years are presented. The status of new chemical elements is examined. Ten elements have had their atomic weight and uncertainty replaced by interval values of upper and lower bounds. Data on revised values for the isotopic composition of the elements are reviewed and new recommended values are presented for germanium. Radioactive half-lives are reviewed and latest values presented which include measurements on nuclides of interest and very long-lived nuclides such as double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. The latest information and the status on the evaluation of atomic masses are discussed. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. Data on various recent neutron cross-section and resonance integral measurements are also discussed and the latest measurements are tabulated in both cases. The JENDL-4.0 and ENDF/B-VII.1 nuclear data libraries are discussed. A new initiative on the existence and importance of isotopes is presented.

  12. Effect Of Cognitive Stimulation On Hippocampal Ripples In Epileptic Patients

    Czech Academy of Sciences Publication Activity Database

    Brázdil, M.; Cimbálník, J.; Roman, R.; Stead, M.; Daniel, P.; Halámek, Josef; Jurák, Pavel

    2013-01-01

    Roč. 54, S3 (2013), s. 268-268 ISSN 0013-9580. [International Epilepsy Congress /30./. 23.06.2013-27.06.2013, Montreal] Institutional support: RVO:68081731 Keywords : Cognitive Stimulation * Epileptic Patients Subject RIV: FH - Neurology

  13. Confirmation of emergence of mutations associated with atovaquone-proguanil resistance in unexposed Plasmodium falciparum isolates from Africa

    OpenAIRE

    Happi, Christian T; Gbotosho, Grace O; Folarin, Onikepe A; Milner, Danny; Sarr, Ousmane; Sowunmi, Akintunde; Kyle, Dennis E; Milhous, Wilbur K; Wirth, Dyann F; Oduola, Ayoade MJ

    2006-01-01

    Abstract Background In vitro and in vivo resistance of Plasmodium falciparum to atovaquone or atovaquone-proguanil hydrochloride combination has been associated to two point mutations in the parasite cytochrome b (cytb) gene (Tyr268Ser and Tyr268Asn). However, little is known about the prevalence of codon-268 mutations in natural populations of P. falciparum without previous exposure to the drug in Africa. Methods The prevalence of codon-268 mutations in the cytb gene of African P. falciparum...

  14. J.-P. Giraud, F. Pons, Th. Janin, dir., Nécropoles protohistoriques de la région de Castres (Tarn. Le Causse, Gourjade, Le Martinet. Volume 1 : études et synthèses, 276 p. ; volume 2 : catalogue des ensembles funéraires, 268 p. ; volume 3 : planches du mobilier, 231 p., DAF n° 94

    Directory of Open Access Journals (Sweden)

    Pierre-Yves Milcent

    2006-05-01

    Full Text Available Entre 1987 et 1995, plusieurs campagnes de fouilles préventives ont permis l'exploration de trois importantes nécropoles à incinération de la fin de l'âge du Bronze et du premier âge du Fer dans les environs de Castres, en Midi-Pyrénées. Trois volumes, l'un de planches, un autre de description et un troisième d'analyse et de synthèse, nous apportent, dans des délais qu'il faut saluer pour leur brièveté, la publication exhaustive d'un corpus exceptionnel par la quantité des informations collec...

  15. Confirmation of emergence of mutations associated with atovaquone-proguanil resistance in unexposed Plasmodium falciparum isolates from Africa

    Directory of Open Access Journals (Sweden)

    Kyle Dennis E

    2006-10-01

    Full Text Available Abstract Background In vitro and in vivo resistance of Plasmodium falciparum to atovaquone or atovaquone-proguanil hydrochloride combination has been associated to two point mutations in the parasite cytochrome b (cytb gene (Tyr268Ser and Tyr268Asn. However, little is known about the prevalence of codon-268 mutations in natural populations of P. falciparum without previous exposure to the drug in Africa. Methods The prevalence of codon-268 mutations in the cytb gene of African P. falciparum isolates from Nigeria, Malawi and Senegal, where atovaquone-proguanil has not been introduced for treatment of malaria was assessed. Genotyping of the cytb gene in isolates of P. falciparum was performed by PCR-restriction fragment length polymorphism and confirmed by sequencing. Results 295 samples from Nigeria (111, Malawi (91 and Senegal (93 were successfully analyzed for detection of either mutant Tyr268Ser or Tyr268Asn. No case of Ser268 or Asn268 was detected in cytb gene of parasites from Malawi or Senegal. However, Asn268 was detected in five out of 111 (4.5% unexposed P. falciparum isolates from Nigeria. In addition, one out of these five mutant Asn268 isolates showed an additional cytb mutation leading to a Pro266Thr substitution inside the ubiquinone reduction site. Conclusion No Tyr268Ser mutation is found in cytb of P. falciparum isolates from Nigeria, Malawi or Senegal. This study reports for the first time cytb Tyr268Asn mutation in unexposed P. falciparum isolates from Nigeria. The emergence in Africa of P. falciparum isolates with cytb Tyr268Asn mutation is a matter of serious concern. Continuous monitoring of atovaquone-proguanil resistant P. falciparum in Africa is warranted for the rational use of this new antimalarial drug, especially in non-immune travelers.

  16. Confirmation of emergence of mutations associated with atovaquone-proguanil resistance in unexposed Plasmodium falciparum isolates from Africa.

    Science.gov (United States)

    Happi, Christian T; Gbotosho, Grace O; Folarin, Onikepe A; Milner, Danny; Sarr, Ousmane; Sowunmi, Akintunde; Kyle, Dennis E; Milhous, Wilbur K; Wirth, Dyann F; Oduola, Ayoade M J

    2006-10-04

    In vitro and in vivo resistance of Plasmodium falciparum to atovaquone or atovaquone-proguanil hydrochloride combination has been associated to two point mutations in the parasite cytochrome b (cytb) gene (Tyr268Ser and Tyr268Asn). However, little is known about the prevalence of codon-268 mutations in natural populations of P. falciparum without previous exposure to the drug in Africa. The prevalence of codon-268 mutations in the cytb gene of African P. falciparum isolates from Nigeria, Malawi and Senegal, where atovaquone-proguanil has not been introduced for treatment of malaria was assessed. Genotyping of the cytb gene in isolates of P. falciparum was performed by PCR-restriction fragment length polymorphism and confirmed by sequencing. 295 samples from Nigeria (111), Malawi (91) and Senegal (93) were successfully analyzed for detection of either mutant Tyr268Ser or Tyr268Asn. No case of Ser268 or Asn268 was detected in cytb gene of parasites from Malawi or Senegal. However, Asn268 was detected in five out of 111 (4.5%) unexposed P. falciparum isolates from Nigeria. In addition, one out of these five mutant Asn268 isolates showed an additional cytb mutation leading to a Pro266Thr substitution inside the ubiquinone reduction site. No Tyr268Ser mutation is found in cytb of P. falciparum isolates from Nigeria, Malawi or Senegal. This study reports for the first time cytb Tyr268Asn mutation in unexposed P. falciparum isolates from Nigeria. The emergence in Africa of P. falciparum isolates with cytb Tyr268Asn mutation is a matter of serious concern. Continuous monitoring of atovaquone-proguanil resistant P. falciparum in Africa is warranted for the rational use of this new antimalarial drug, especially in non-immune travelers.

  17. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rain Clip11262) ... Length = 171 ... Query: 209 ISLTAEELDVFLEVCNIGIGSASTVLSKL...LNRKVSLQIPTARVIDSKEFEFNERPCLVTS 268 ... ISLTAEELDVFLEVCNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTS ...Sbjct: 1 ... ISLTAEELDVFLEVCNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTS 60 ... Query: 329 TAMSEMLGTKIDISPPTMEFC

  18. ORF Alignment: NC_003210 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ocytogenes (strain ... EGD-e) ... Length = 171 ... Query: 209 ISLTAEELDVFLEVCNIG...IGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTS 268 ... ISLTAEELDVFLEVCNIGIGSASTVLSKLLNRKVSLQIPT...ARVIDSKEFEFNERPCLVTS Sbjct: 1 ... ISLTAEELDVFLEVCNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTS 60 ... Query: 329

  19. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bacillus clausii KSM-K16] ... Length = 166 ... Query: 209 RVVIDPGHGGRDPGAKGNGLIEKNITLLFAKQIKKSLQENGIE...VYLTRSSDEYVYLQERA 268 ... RVVIDPGHGGRDPGAKGNGLIEKNITLLFAKQIKKSLQENGIE...VYLTRSSDEYVYLQERA Sbjct: 1 ... RVVIDPGHGGRDPGAKGNGLIEKNITLLFAKQIKKSLQENGIEVYLTRSSDEYVYLQERA 60 ... Query: 32

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AEIARRSGLSAQTASVIMRSLEADGLLVRGAPVRGRVGQ 60 ... Query: 148 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDR...WRDFDLQAAVASRIRHPVF 207 ... KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHP...VF Sbjct: 121 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHPVF 180 ... Query: 268 GKDGKSTQLLKIASVFV

  1. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RMIEELRRREIPVRFLSNNPTKDPDQYVDKLTRLGLPT 60 ... Query: 133 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTG...QQCKVS 192 ... TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKV...S Sbjct: 121 TFDYRKLQIAFDAIWFHKRAFLIQTNPDRFCPFPGGRGEPDCAAVTAAIEACTGQQCKVS 180 ... Query: 253 DVEHRPTWTLDRIDRL 268 ... DVEHRPTWTLDRIDRL Sbjct: 241 DVEHRPTWTLDRIDRL 256

  2. Blindness and visual impairment in the Niger Delta: A study of ...

    African Journals Online (AJOL)

    %) and chorioretinitis (12.5%), while the common causes of visual impairment were cataract (33.8%), refractive error (26.8%) and glaucoma (26.8%). Conclusion: A relatively high rate of blindness was found in the study area, caused by ...

  3. Emotional/Behavioral Problems and Functional Impairment in Clinic- and Community-Based Children with Attention-Deficit/Hyperactivity Disorder in Taiwan

    Science.gov (United States)

    Gau, Susan Shur-Fen; Lin, Yu-Ju; Shang, Chi-Yung; Liu, Shih-Kai; Chiu, Yen-Nan; Soong, Wei-Tsuen

    2010-01-01

    Using a sample of 268 patients and 137 community-based children with DSM-IV ADHD, and 268 school controls, aged 6-15, this study aimed to compare the emotional/behavioral problems and functional impairment between clinic- and community-based children with ADHD. Children's ADHD-related symptoms, a wide range of emotional/behavioral problems, and…

  4. Materials engineering on candidate alloys to be used for remotely handled fasteners within nuclear fusion power plants

    International Nuclear Information System (INIS)

    Colaiuda, A.; Amelotti, F.; Crippa, L.; Merckling, G.

    1995-01-01

    Materials mechanical properties for remotely handled components are summarized and discussed as a function of temperature in the range between -268.8 C and 200 C. It is emphasized that at -268.8 C mechanisms occur, that do not allow safe extrapolation of room temperature data towards cryogenic ranges. (orig.)

  5. Synthesis and characterization of nanocomposites based on poly (3 ...

    Indian Academy of Sciences (India)

    Faculty of Materials Technology, Ho Chi Minh University of Technology, 268 Ly Thuong Kiet, Ward 14, District 10, Ho Chi Minh City, Vietnam; Materials Technology Key Laboratory (Mtlab), Ho Chi Minh City University of Technology, Vietnam National University, 268 Ly Thuong Kiet, District 10, Ho Chi Minh City, Vietnam ...

  6. Matthew Crabbe, Myth-Busting China's Numbers: Understandig and Using China's Statistics

    DEFF Research Database (Denmark)

    Grünberg, Nis

    2014-01-01

    Book review of: Matthew Crabbe: Myth-Busting China's Numbers: Understandig and Using China's Statistics. Houndmills, Basingstoke: Palgrave Macmillan, 2014. 268 pp.......Book review of: Matthew Crabbe: Myth-Busting China's Numbers: Understandig and Using China's Statistics. Houndmills, Basingstoke: Palgrave Macmillan, 2014. 268 pp....

  7. 33 CFR 110.95 - Newport Bay Harbor, Calif.

    Science.gov (United States)

    2010-07-01

    ... 268° from Lido Isle East Light 2, this line being the northwest line of the main fairway; west of the... of a line bearing 268° from Newport Bay Channel Light 11, this line being the south line of the main... Channel Light 11, this line being the southerly line of the main fairway. Note: This area is reserved for...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 268 of 268 ... Vol 37 (2011), Two Phase Heuristic Algorithm for the University Course Timetabling Problem: The Case of University of Dar Es Salaam, Abstract PDF. AR Mushi. Vol 36 (2010), Urban Dietary Heavy Metal Intake from Protein Foods and Vegetables in Dar Es Salaam, Abstract PDF. FN Ngassapa, OC ...

  9. Fungal phylogenetic diversity in estuarine sediments of Gautami Godavari River, Andhra Pradesh, India

    Digital Repository Service at National Institute of Oceanography (India)

    Khandavilli, R.; Meena, R.; Shenoy, B.D.

    Submitted 12 July 2016, Accepted 25 October 2016, Published online 16 November 2016 Corresponding Author: B. D. Shenoy – e-mail – shenoynio@gmail.com, belleshenoy@nio.org 268 Current Research in Environmental & Applied Mycology 6 (4): 268–276(2016) ISSN..., India. Current Research in Environmental & Applied Mycology 6 (4): 268–276, Doi 10.5943/cream/6/4/4 Abstract Mangroves are a unique ecosystem that experiences fluctuations in salinity which is influenced by terrestrial and marine environment...

  10. Obtaining isochrones from pollution signals in a fluvial sediment record: A case study in a uranium-polluted floodplain of the Ploucnice River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Matys Grygar, Tomáš; Elznicová, J.; Bábek, O.; Hošek, Michal; Engel, Z.; Kiss, T.

    2014-01-01

    Roč. 48, SEP (2014), s. 1-15 ISSN 0883-2927 Institutional support: RVO:61388980 Keywords : GEOCHEMICAL BASE-LINES * HEAVY-METALS * CONTAMINATION ASSESSMENT Subject RIV: DD - Geochemistry Impact factor: 2.268, year: 2014

  11. Policy Statement: Clarification of the Dilution Prohibition and Combustion of Inorganic Metal-Bearing Hazardous Wastes for Land Disposal Restrictions

    Science.gov (United States)

    This memorandum sets out a Statement of Policy under the RCRA clarifying the application of the Land Disposal Restrictions (LDR) prohibition on dilution (see 40 CFR 268.3) to combustion of certain inorganic metal-bearing hazardous wastes.

  12. The Constitutional Review Chamber of the Republic of Estonia judgment : no. of the case 3-4-1-1-03 : date of decision 17 February 2003

    Index Scriptorium Estoniae

    2003-01-01

    Riigikohtu lahendi 3-4-1-1-03 (Vabariigi Valitsuse 06. 11. 1996 määrusega nr. 268 kinnitatud "Maa enampakkumisega erastamise korra" p. 47 vastavuse kontrollimiseks Põhiseaduse §-ga 11) tekst inglise keeles

  13. 75 FR 80041 - Pacific Fishery Management Council; Public Meetings and Hearings

    Science.gov (United States)

    2010-12-21

    ....pcouncil.org . The report will include a description of the adopted salmon management alternatives and a..., Westport, WA 98595, telephone: (360) 268-9101. March 28, 2011: Red Lion Hotel, Umpqua Room, 1313 N Bayshore...

  14. 77 FR 73987 - Pacific Fishery Management Council; Public Meetings and Hearings

    Science.gov (United States)

    2012-12-12

    ... include a description of the adopted salmon management alternatives and a summary of their biological and..., 710 W Hancock, Westport, WA 98595, telephone 360-268-9101. March 25, 2013: Red Lion Hotel, South...

  15. The NDUFS4 nuclear gene of complex 1 encodes a subunit essential for the assembly and cAMP-dependent regulation of the activity of the complex

    Czech Academy of Sciences Publication Activity Database

    Papa, S.; Sardanelli, A. M.; Petruzzella, V.; Scacco, S.; Vergari, R.; Dobrová, Zuzana; Lamantea, E.; Zeviani, M.; van den Heuvel, L.; Smeitink, J.

    2001-01-01

    Roč. 268, Suppl 1 (2001), s. 69 [Meeting of the Federation of European Biochemical Societies /27./. 30.06.2001-05.07.2001, Lisbon] Institutional research plan: CEZ:AV0Z5020903 Subject RIV: CE - Biochemistry

  16. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965553 >1rkd0 3 268 9 275 2e-23 ... emb|CAC46379.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_385906.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  17. Molar Heat Increment under Impact of Transverse Contraction in Metals

    Czech Academy of Sciences Publication Activity Database

    Pekárek, Viktor

    2007-01-01

    Roč. 52, č. 3 (2007), s. 261-268 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20570509 Keywords : atomic structure * thermal agitation * heat expansion Subject RIV: BM - Solid Matter Physics ; Magnetism

  18. Tanel Toom sai UNICA'l pronksi

    Index Scriptorium Estoniae

    2004-01-01

    66. ülemaailmsel mitteprofessionaalsete filmitegijate festivalil (World Festival of Non-professional Film Makers) Saksamaal Veitshöchheimis sai TPÜ III kursuse tudeng Tanel Toom oma filmiga "2.68" pronksmedali

  19. Towards a Common Toolbox for Rarity: A Response to Violle et al.

    Czech Academy of Sciences Publication Activity Database

    Carmona, C. P.; de Bello, Francesco; Sasaki, T.; Uchida, K.; Pärtel, M.

    2017-01-01

    Roč. 32, č. 12 (2017), s. 889-891 ISSN 0169-5347 Institutional support: RVO:67985939 Keywords : rarity * species loss * functional composition Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 15.268, year: 2016

  20. Proposal of new Oβ oxidation criterion for new types of the Zr1Nb alloy of fuel claddings

    Czech Academy of Sciences Publication Activity Database

    Negyesi, M.; Klouček, V.; Lorinčík, Jan; Novotný, L.; Kabátová, J.; Linhart, S.; Adámek, J.; Siegl, J.; Vrtílková, V.

    2013-01-01

    Roč. 261, August (2013), s. 260-268 ISSN 0029-5493 Institutional support: RVO:67985882 Keywords : Oxygen * Experimental methods * Kinetics equation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.972, year: 2013

  1. Eragrostis tef (Zucc.) Trotter

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-16

    3): 295-299. Mengesha MH (1966). Chemical composition of tef (Eragrostis tef) compared with that of wheat, barley, and grain sorghum. Econ. Bot. 20: 268-273. Raghavendra AS, Rama Das VS (1993). C4 photosynthesis and ...

  2. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav

    2016-01-01

    Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016

  3. Intelligent Advanced Communications IP Telephony Feasibility for the U.S. Navy (DVD)

    National Research Council Canada - National Science Library

    Binns, Todd D; Naas, Bill

    2007-01-01

    ...: 2 DVD-ROMs; 4 3/4 in.; 2.68 GB. ABSTRACT: The purpose of this research paper is to research technologies and solutions supporting the communications infrastructure necessary to implement an integrated VoIP (IP telephony...

  4. Inactivation of Francisella tularensis Gene Encoding Putative ABC Transporter Has a Pleiotropic Effect upon Production of Various Glycoconjugates

    Czech Academy of Sciences Publication Activity Database

    Daňková, V.; Balonová, L.; Link, M.; Strašková, Adéla; Sheshko, V .; Stulík, J.

    2016-01-01

    Roč. 15, č. 2 (2016), s. 510-524 ISSN 1535-3893 Institutional support: RVO:61388971 Keywords : Francisella tularensis * glycosylation * lipopolysaccharide Subject RIV: EE - Microbiology, Virology Impact factor: 4.268, year: 2016

  5. 77 FR 40587 - Fisheries of the South Atlantic, Gulf of Mexico, and Caribbean; Southeast Data, Assessment, and...

    Science.gov (United States)

    2012-07-10

    ..., 268 Mu oz Rivera Ave., Suite 1108, San Juan, Puerto Rico 00918. FOR FURTHER INFORMATION CONTACT: John... with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed...

  6. 75 FR 31424 - Fisheries of the South Atlantic, Gulf of Mexico, and Caribbean; Southeast Data, Assessment, and...

    Science.gov (United States)

    2010-06-03

    ... Management Council, 268 Mu oz Rivera Ave., Suite 1108, San Juan, Puerto Rico 00918. FOR FURTHER INFORMATION... with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed...

  7. Believeability and Plausibility Functions over Infinite Sets

    Czech Academy of Sciences Publication Activity Database

    Kramosil, Ivan

    1995-01-01

    Roč. 23, č. 2 (1995), s. 173-198 ISSN 0308-1079 Keywords : uncertainty processing * believeability function * plausibility function * probability measure * Dempster-Shafer theory Impact factor: 0.268, year: 1995

  8. 76 FR 10562 - Caribbean Fishery Management Council; Public Meeting

    Science.gov (United States)

    2011-02-25

    ... Caribbean Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will hold a... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National.... FOR FURTHER INFORMATION CONTACT: Caribbean Fishery Management Council, 268 Mu[ntilde]oz Rivera Avenue...

  9. 75 FR 6178 - Caribbean Fishery Management Council; Public Meeting

    Science.gov (United States)

    2010-02-08

    ... Caribbean Fishery Management Council's (CFMC) Scientific and Statistical Committee (SSC) will hold a meeting... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National... FOR FURTHER INFORMATION CONTACT: Caribbean Fishery Management Council, 268 Munoz Rivera Avenue, Suite...

  10. 75 FR 55759 - Floor-Standing, Metal-Top Ironing Tables and Certain Parts Thereof From the People's Republic of...

    Science.gov (United States)

    2010-09-14

    ... and Parts Thereof, Finished and Unfinished, From the People's Republic of China; Final Results of... Shakeproof Assembly Components, Div. of Ill. Tool Works, Inc. v. United States, 268 F. 3rd 1376, 1382-1383...

  11. 75 FR 55754 - Floor-Standing, Metal-Top Ironing Tables and Certain Parts Thereof from the People's Republic of...

    Science.gov (United States)

    2010-09-14

    ... Unfinished, From the People's Republic of China; Final Results of Antidumping Duty Administrative Review, 62... Works, Inc. v. United States, 268 F. 3rd 1376, 1382-1383 (Fed. Cir. 2001) (affirming the Department's...

  12. 77 FR 41746 - Chlorinated Isocyanurates From the People's Republic of China: Preliminary Results of Antidumping...

    Science.gov (United States)

    2012-07-16

    ... Initiation Notice, 75 FR at 44224. \\39\\ See Tapered Roller Bearings and Parts Thereof, Finished or Unfinished... Shakeproof Assembly Components, Div. of Illinois Tool Works, Inc. v. United States, 268 F.3d 1376, 1382-1383...

  13. 76 FR 40689 - Chlorinated Isocyanurates From the People's Republic of China: Preliminary Results of Antidumping...

    Science.gov (United States)

    2011-07-11

    ..., Finished or Unfinished, from the People's Republic of China: Final Results of 2005-2006 Administrative... Components, Div. of Illinois Tool Works, Inc. v. United States, 268 F.3d 1376, 1382-1383 (Fed. Cir. 2001...

  14. A Journey with Mid-life Hearing Loss | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  15. Understanding Asthma from the Inside Out | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  16. New Breast Cancer Treatment Approved | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  17. The ABCs of GERD | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  18. From the lab - New Discovery About Middle-Age Weight Gain | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  19. Don’t Let Asthma Define You | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF 2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  20. NIH Launches National COPD Action Plan | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  1. From the lab - Rare Gene Mutation May Have Link to Common Cold | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  2. The Opioid Crisis | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  3. The Future of Asthma Monitoring | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  4. Solving the Undiagnosed Disease Puzzle at NIH | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  5. Too ‘Stubborn’ to Give in to COPD | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  6. A Lifelong Asthma Struggle | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  7. Breathtaking: Managing a COPD Diagnosis | NIH MedlinePlus the Magazine

    Science.gov (United States)

    Skip to main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] Trusted Health Information from the National Institutes of Health Home Current Issue ...

  8. An introduction to differential equations and their applications

    CERN Document Server

    Farlow, Stanley J

    2006-01-01

    This introductory text explores 1st- and 2nd-order differential equations, series solutions, the Laplace transform, difference equations, much more. Numerous figures, problems with solutions, notes. 1994 edition. Includes 268 figures and 23 tables.

  9. Viral pathogenesis in diagrams

    National Research Council Canada - National Science Library

    Tremblay, Michel; Berthiaume, Laurent; Ackermann, Hans-Wolfgang

    2001-01-01

    .... The 268 diagrams in Viral Pathogenesis in Diagrams were selected from over 800 diagrams of English and French virological literature, including one derived from a famous drawing by Leonardo da Vinci...

  10. O ČEZu, UNESCU a Ikee. Psaní iniciálových zkratkových slov a tendence k jejich skloňování

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2016-01-01

    Roč. 99, č. 5 (2016), s. 256-268 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : initialism * acronym * declension * orthography Subject RIV: AI - Linguistics

  11. Chinese Middle Classes: Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik

    2018-01-01

    Book review of: Chinese Middle Classes:Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao. Abingdon: Routledge, 2014. Pp. 268. ISBN 10: 1138120847; ISBN 13: 978-1138120846......Book review of: Chinese Middle Classes:Taiwan, Hong Kong, Macao and China. Edited by Hsin-Huang Michael Hsiao. Abingdon: Routledge, 2014. Pp. 268. ISBN 10: 1138120847; ISBN 13: 978-1138120846...

  12. The Shock and Vibration Digest. Volume 12, Number 7,

    Science.gov (United States)

    1980-07-01

    a bachelor Contact: Bob Kiefer , Spectral Dynamics, P.O. Box of science degree in engineering or equivalent. 671, San Diego, CA 92112 - (714) 268-7100...appropriate. Santa Barbara , CA 93105 - (815) 682-7171. Contact: Graduate Studies and Continuing Educa- tion, Union College, Wells House. 1 Union Ave...materials. Contact: Bob Kiefer , Spectral Dynamics, P.O. Box These tests help to introduce the concepts of simi- 67 1, San Diego, CA 92112 - (714) 268- 7100

  13. Stability results for a soil model with singular hysteretic hydrology

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; O'Kane, J.P.; Pokrovskii, A.; Rachinskii, D.

    2011-01-01

    Roč. 268, č. 1 (2011), 012016 ISSN 1742-6588. [5th International workshop on multi-rate processes and hysteresis. Pecs, 31.05.2010-03.06.2010] R&D Projects: GA ČR GAP201/10/2315 Institutional research plan: CEZ:AV0Z10190503 Keywords : hysteresis * evolution equation * stability Subject RIV: BA - General Mathematics http://iopscience.iop.org/1742-6596/268/1/012016

  14. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  15. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  16. Center for Coastline Security Technology, Year 3

    Science.gov (United States)

    2008-05-01

    Figure 2.6.8: Close-Up Photograph of RPUUV Tail Section. Figure 2.6.9: Force and moments applied on a hydrofoil . Figure 2.6.10: The NACA 21016... hydrofoil profile. Florida Atlantic University 4/28/08 Page 10 Center for Coastline Security Technology Year Three-Final Report Figure...as a 3D wing with a NACA 21016 hydrofoil profile (Figure 2.6.10) held by 3 cylinders (Figure 2.6.8). Center for Coastline Security Technology Year

  17. Analysis of M2 muscarinic acetylcholine receptors coupling to Gi/o, Gs and Gq heterotrimeric GTP-binding proteins

    Czech Academy of Sciences Publication Activity Database

    Smyčková, Helena; Jakubík, Jan; Doležal, Vladimír

    2007-01-01

    Roč. 102, Suppl.1 (2007), s. 268-268 ISSN 0022-3042. [Biennial meeting of the International Society for Neurochemistry /21./ and Annual meeting of the American Society for Neurochemistry /38./. 19.08.2007-24.08.2007, Cancun] R&D Projects: GA MŠk(CZ) LC554; GA ČR(CZ) GA305/05/0452 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * muscarinic receptors * agonist-specific conformations * allosteric interaction Subject RIV: FH - Neurology

  18. Medical Surveillance Monthly Report (MSMR). Volume 19, Number 2, February 2012

    Science.gov (United States)

    2012-02-01

    and depression .21 Findings of this report also document that psychiatric problems increase risk for suicide, even though suicide attempt- ers may...disor- ders included deployment itself as well as diagnoses of concussion, anxiety disorder (including post-traumatic stress disorder), and depression ...125 2.0 Breast disorders (610-611) 502 1.0 117 0.3 385 6.0 Pregnancy and childbirth (630-679, relevant V codes) 268 0.5 0 0.0 268 4.2 Congenital

  19. Prenatal Exposure to Carbon Black (Printex 90)

    DEFF Research Database (Denmark)

    Jackson, Petra; Vogel, Ulla; Wallin, Håkan

    2011-01-01

    Maternal pulmonary exposure to ultrafine particles during pregnancy may affect the health of the child. Developmental toxicity of carbon black (Printex 90) nanoparticles was evaluated in a mouse model. Time-mated mice were intratracheally instilled with Printex 90 dispersed in Millipore water...... on gestation days (GD) 7, 10, 15 and 18, with total doses of 11, 54 and 268 mu g Printex 90/animal. The female offspring prenatally exposed to 268 mu g Printex 90/animal displayed altered habituation pattern during the Open field test....

  20. The Constitutional Court of the Republic of Estonia : 3-4-1-10-2000 (22 Dec 2000) : review of the petition of Administrative Law Chamber of the Supreme Court to declare clause 17 of the Procedure for Privatisation of Land by Auction partly unconstitu

    Index Scriptorium Estoniae

    2000-01-01

    Riigikohtu lahendi 3-4-1-10-00 (Riigikohtu halduskolleegiumi taotlus tunnistada, et Vabariigi Valitsuse 06. 11. 96. a. määrusega nr. 268 kinnitatud "Maa enampakkumisega erastamise korra" p. 17 lg 2 alapunkt 2 see osa, mis sätestas maa enampakkumisel osalejale 1000-kroonise osavõtutasu maksmise kohustuse (kuni 08. 03. 2000), oli põhiseadusevastane ning tunnistada Vabariigi Valitsuse 06. 11. 96. a. määrusega nr. 268 kinnitatud "Maa enampakkumisega erastamise korra" p. 49 esimene lause kehtetuks) tekst inglise keeles

  1. CGRP infusion in unanesthetized rats increases expression of c-Fos in the nucleus tractus solitarius and caudal ventrolateral medulla, but not in the trigeminal nucleus caudalis

    DEFF Research Database (Denmark)

    Bhatt, Deepak K; Ramachandran, Roshni; Christensen, Sarah Louise Tangsgaard

    2015-01-01

    infusion caused a significant dose-dependent fall in mean arterial blood pressure. No significant activation of c-Fos in the TNC at mRNA and protein levels was observed after CGRP infusion. A significant increase in c-Fos protein was observed in the NTS and CVLM in the brain stem. Zif268 expression...... sites in the brain stem for processing cardiovascular signals. We also investigated Zif268 protein expression (another immediate early gene) in TNC. The protein expression of p-ERK, p-CREB and c-Fos was analyzed in dura mater, trigeminal ganglion (TG) and TNC samples using Western blot. RESULTS: CGRP...

  2. Correlation of Ultrastructural Changes of Endothelial Cells and Astrocytes Occurring during Blood Brain Barrier Damage after Traumatic Brain Injury with Biochemical Markers of Blood Brain Barrier Leakage and Inflammatory Response

    Czech Academy of Sciences Publication Activity Database

    Vajtr, D.; Benada, Oldřich; Kukačka, J.; Průša, R.; Houšťava, L.; Toupalík, P.; Kizek, R.

    2009-01-01

    Roč. 58, č. 2 (2009), s. 263-268 ISSN 0862-8408 Institutional research plan: CEZ:AV0Z50200510 Keywords : Blood brain barrier * Expansive contusion * Metalloproteinases Subject RIV: EE - Microbiology, Virology Impact factor: 1.430, year: 2009

  3. Exponentially Weighted Moving Average Chart as a Suitable Tool for Nuchal Translucency Quality Review

    Czech Academy of Sciences Publication Activity Database

    Hynek, M.; Smetanová, D.; Stejskal, D.; Zvárová, Jana

    2014-01-01

    Roč. 34, č. 4 (2014), s. 367-376 ISSN 0197-3851 Institutional support: RVO:67985807 Keywords : nuchal translucency * exponentially weighted moving average model * statistics Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 3.268, year: 2014

  4. Applying Western models of volunteering in Hong Kong : The role of empathy, prosocial motivation and motive-experience fit for volunteering

    NARCIS (Netherlands)

    Aydinli, A.; Bender, M.; Chong, A.; Yue, X.

    2016-01-01

    The present research investigates the applicability of prominent Western volunteering frameworks in Hong Kong. Two cross-sectional surveys involving a total of 268 respondents were conducted. In Study 1, we tested a model of volunteering among 149 Hong Kong Chinese adult individuals (Mage = 34.8

  5. Opõtõ analititsheskogo tshtenija : "Russkije nots'i" V. Odojevskogo, "Ussomnivs'iisja Makar" A. Platonova / Jelena Grigorjeva

    Index Scriptorium Estoniae

    Grigorjeva, Jelena, 1959-

    1999-01-01

    Bibl. lk. 268-269. Kokkuvõte inglise k. " Analytical reading: "Russkie nochi" by V. Odoyevsky. "Usomnivschijsja Makar" by A. Platonov, lk. 269. Kokkuvõte eesti k. "Analüütilise lugemise kogemus: V. Odojevski "Vene ööd". A. Platonovi "Kahtleja Makar", lk. 269-270

  6. Cognitive Attributions and Emotional Expectancies Predict Emotions in Mother-Adolescent Interactions

    Science.gov (United States)

    Lindsey, Eric W.; MacKinnon-Lewis, Carol; Frabutt, James M.; Campbell Chambers, Jessica

    2015-01-01

    The purpose of this study was to examine adolescent's hostile attributions of mother's intent and emotional self-expectancies as contributors to expression of emotion between mothers and adolescents. Data were collected from 268 10- to 12-year-olds (133 girls, 135 boys) and their mothers. Each dyad was observed in a conversational activity that…

  7. The Impact of Instructional Design on College Students' Cognitive Load and Learning Outcomes in a Large Food Science and Human Nutrition Course

    Science.gov (United States)

    Andrade, Jeanette; Huang, Wen-Hao David; Bohn, Dawn M.

    2015-01-01

    The effective design of course materials is critical for student learning, especially for large lecture introductory courses. This quantitative study was designed to explore the effect multimedia and content difficulty has on students' cognitive load and learning outcomes. College students (n = 268) were randomized into 1 of 3 multimedia groups:…

  8. Production of glycerol from palm kernel oil | Antia | Nigerian Journal ...

    African Journals Online (AJOL)

    Glycerol production using Palm Kernel Oil (PKO) as a potential raw material was investigated. PKO was optimally hydrolyzed at 268 °C and 500psi (34 atm) pressure using only water. A 96.85 percent maximum yield of the extent of hydrolysis at 61.86 percent water and 38.14 percent oil was achieved The percentage Df ...

  9. 76 FR 37328 - Caribbean Fishery Management Council; Public Meeting

    Science.gov (United States)

    2011-06-27

    ... will be held at the Holiday Inn Hotel in Mayaguez, Puerto Rico. FOR FURTHER INFORMATION CONTACT: Caribbean Fishery Management Council, 268 Munoz Rivera Avenue, Suite 1108, San Juan, Puerto Rico 00918-2577..., San Juan, Puerto Rico, 00918-2577; telephone: (787) 766-5926, at least 5 days prior to the meeting...

  10. 75 FR 69054 - Caribbean Fishery Management Council; Public Meeting

    Science.gov (United States)

    2010-11-10

    ... will be held at the Holiday Inn Hotel in Mayaguez, Puerto Rico. FOR FURTHER INFORMATION CONTACT: Caribbean Fishery Management Council, 268 Mu oz Rivera Avenue, Suite 1108, San Juan, Puerto Rico 00918-2577... collection of statistical data for the deep- water fishes in the west coast of Puerto Rico. --Report on the...

  11. Journal of Computational Electronics: Proceedings of the International Workshop on Computational Electronics (8th) (IWCE-8), Beckman Institute, University of Illinois, 15-18 October 2001. Volume 1, Issue 1-2

    Science.gov (United States)

    2002-01-01

    Chris Bowen, 1997. J. Appl. Phys. 81: 3207. Dr. Roger Lake and Dr. Timothy B. Boykin. I would Cwik T., Klimeck G., McAuley M., Norton C., Sterling T...quan- tTo whom correspondence should be addressed, tum effects in the SOI MOSFET structure depicted in 268 Raney gate packet. As a result of this

  12. On the effect of oxygen flooding on the detection of noble gas ions in a SIMS instrument

    Czech Academy of Sciences Publication Activity Database

    Williams, P.; Franzreb, K.; Sobers Jr., R. C.; Lorinčík, Jan

    2010-01-01

    Roč. 268, 17-18 (2010), s. 2758-2765 ISSN 0168-583X Institutional research plan: CEZ:AV0Z20670512 Keywords : SIMS * noble gases * uranium Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.042, year: 2010

  13. PENGARUH KEPADATAN Nannochloropsis sp. PADA PEMELIHARAAN LARVA KERAPU BEBEK (Cromileptes altivelis SECARA TERKONTROL

    Directory of Open Access Journals (Sweden)

    Suko Ismi

    2012-12-01

    pada perlakuan D (penambahan Nannochloropsis sp. 500.000 sel/mL menghasilkan sintasan 26,8%; lebih tinggi dari perlakuan yang lain, berikut perlakuan C, B, dan A masing-masing 19,5%; 14,2%; dan 3,5% sedangkan panjang total larva umur 45 hari relatif sama antara 2,47-2,53 cm.

  14. Development of risk-taking: contributions from adolescent testosterone and the orbito-frontal cortex

    NARCIS (Netherlands)

    Peper, J.S.; Koolschijn, P.C.M.P.; Crone, E.A.

    2013-01-01

    The role of puberty in the development of risk taking remains poorly understood. Here, in a normative sample of 268 participants between 8 and 25 years old, we applied a psycho-endocrine neuroimaging approach to investigate the contribution of testosterone levels and OFC morphology to individual

  15. Analysing correlations after the financial crisis of 2008 and ...

    Indian Academy of Sciences (India)

    2015-02-06

    Feb 6, 2015 ... Lett. B 268, 21 (1991). J Feinberg and A Zee, J. Stat. Phys. 87, 473 (1997). [4] R N Mantegna and H E Stanley, An introduction to econophysics (Cambridge University Press,. Cambridge, UK, 2000). J-P Bouchaud and M Potters, Theory of financial risks (Cambridge University Press,. Cambridge, UK, 2000).

  16. A magnetic filter with permanent magnets on the basis of rare earths

    Czech Academy of Sciences Publication Activity Database

    Žežulka, Václav; Straka, Pavel; Mucha, Pavel

    2004-01-01

    Roč. 268, - (2004), s. 219-226 ISSN 0304-8853 R&D Projects: GA AV ČR IBS3046004 Institutional research plan: CEZ:AV0Z3046908 Keywords : magnetic filtration * rare earth magnets * high gradient magnetic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

  17. Antenatal clinical pelvimetry in primigravidae and outcome of labour ...

    African Journals Online (AJOL)

    Method: A retrospective study of clinical pelvimetry and outcome of labour in primigravidae. Results: The total number of primigravidae included in the study was 268 and of these, 74 were adjudged to have adequate pelvis at antenatal clinical pelvimetry. The APGAR scores at one and five minutes were significantly higher ...

  18. Half collisions by photodissociation

    International Nuclear Information System (INIS)

    Vries, M.S. de.

    1980-01-01

    The photodissociation of ICl, IBr and TlBr is studied. In the case of ICl and IBr, experiments are reported at various wavelengths between 480 and 530 nm. For TlBr, photodissociation for a range of wavelengths between 264 and 268 nm is reported. (Auth.)

  19. Factors Affecting Adoption of Educational Discipline and Satisfaction Level among Higher Education Students

    Science.gov (United States)

    Raza, Irfan

    2016-01-01

    This study examines the education career change behavior of male and female students. Factors like current trends, own preferences, parental pressure, and career counselors can influence their career adoption. Quantitative method research design was conducted for the study and a sample of 268 students was taken: 145 female and 123 male students,…

  20. Impact of periodic selective mebendazole treatment on soil-transmitted helminth infections in Cuban schoolchildren.

    NARCIS (Netherlands)

    van der Werff, S.D.; Vereecken, K.; van der Laan, K.; Campos Ponce, M.; Junco Diaz, R.; Nunez, F.A.; Rojas Rivero, L.; Bonet Gorbea, M.; Polman, K.

    2014-01-01

    Objective: To evaluate the impact of periodic selective treatment with 500 mg mebendazole on soil-transmitted helminth (STH) infections in Cuban schoolchildren. Methods: We followed up a cohort of 268 STH-positive schoolchildren, aged 5-14 years at baseline, at six-month intervals for two years and

  1. 78 FR 71557 - Radio Broadcasting Services; Tohatchi, New Mexico

    Science.gov (United States)

    2013-11-29

    ...] Radio Broadcasting Services; Tohatchi, New Mexico AGENCY: Federal Communications Commission. ACTION... Channel 268C2, Tohatchi, New Mexico, as a first local service under the Tribal Priority. A staff... [Amended] 0 2. Section 73.202(b), the Table of FM Allotments under New Mexico, is amended by adding...

  2. Career Paths in Sport Management

    Science.gov (United States)

    Schwab, Keri A.; Legg, Eric; Tanner, Preston; Timmerman, Danielle; Dustin, Daniel; Arthur-Banning, Skye G.

    2015-01-01

    Sport management alumni (N = 268) from five universities that offer undergraduate programs with an emphasis in sport management within departments of parks, recreation, and tourism were sampled via an electronic survey. The survey sought to learn where alumni were working, and how they felt about their career choice and undergraduate professional…

  3. Implementation of Health Promotion in the Older Adults in Bangkok, Thailand

    Science.gov (United States)

    Assantachai, Prasert; Bunnag, Chaweewan; Piya-Anant, Manee; Thamlikitkul, Visanu

    2006-01-01

    Effective strategies that bring health promotion messages to older adults in a developing country are needed. To evaluate the impact of various education media upon changes in knowledge and health behavior, a double-blind, randomized controlled trial was conducted involving 1,268 older adults in a southwest Bangkok suburb. Group teaching…

  4. Short communication report Dr Ndams Siliadse

    African Journals Online (AJOL)

    Dr. Ahmed

    .; Doom, J. P.; Chuenkova, M.; Manger, I. D. &. Pereira, M. E. (1993). Enzymatic characterization of B-D- galactoside & 2,3 trans-sialidase from Trypanosoma cruzi. Journal of Biological Chemistry. 268: 9886-9891. Service, M.W. (1980). A guide ...

  5. Transport Properties Of Cu 2 S n S 3 Thin Films | Kuku | Nigeria ...

    African Journals Online (AJOL)

    A single source vacuum evaporation process has been employed to prepare thin films of Cu2SnS3. Electrical Hall measurements using Van der Pauw technique have revealed that film resistivity was a strong function of the substrate temperature for film deposition. The activation energy for the resistivity was 0.268 eV for ...

  6. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-03-01

    Mar 1, 2017 ... 86 years old. Twenty-five surveys (45.7% of respondents) were 12-50 years, 19 studies (26.8% of respondents) were 12-70 years and 7 surveys. (25.7% of respondents) were 12-86 years ... performance of screening procedures. The levels ..... suggest fear of mastectomy and other hospital related factors as ...

  7. FDA Developments: Food Code 2013 and Proposed Trans Fat Determination

    NARCIS (Netherlands)

    Grossman, M.R.

    2014-01-01

    268 Reports EFFL 4|2014 USA FDA Developments: Food Code 2013 and Proposed Trans Fat Determination Margaret Rosso Grossman* I. Food Code 2013 and Food Code Reference System Since 1993, the US Food and Drug Administration has published a Food Code, now updated every four years. In November 2013, the

  8. (DArT) markers

    Indian Academy of Sciences (India)

    wilt and sterility mosaic disease, etc.) stresses. Despite past. ∗For correspondence. E-mail: r.k.varshney@cgiar.org .... Shi Ying Yang et al. Table 2. Details on 466 polymorphic DArT markers. Female specific. Male specific. Total. 198. 268. Class I. 142. 203. Class II. 27. 16. Others. 29. 49. Mapped. 122. 172. Linkage mapping.

  9. On quantum harmonic oscillator being subjected to absolute ...

    Indian Academy of Sciences (India)

    2016-12-03

    Dec 3, 2016 ... Model of cosmology, on a mass–energy equivalence basis, observed that the Universe consists of about. 26.8% dark matter, 68.3% dark energy (DE) and 4.9% ordinary matter. So, about 95% of the Universe remains elusive to us. Most quantum field theories predict the magnitude of the vacuum energy ...

  10. Husband and Wife Interaction and Family Regulation in Rural Uruguay.

    Science.gov (United States)

    De Winter, A. M.

    Decision-making and family planning were studied in the rural city of Durazno, Uruguay, by means of answers to questions by both husbands and wives. A sample size of 268 couples in which at least one partner was between 21 and 50 years of age was used. Data were collected by means of a pretested and precoded interview schedule. Major conclusions…

  11. 40 CFR 260.11 - References.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false References. 260.11 Section 260.11... WASTE MANAGEMENT SYSTEM: GENERAL Definitions § 260.11 References. (a) When used in parts 260 through 268 and 278 of this chapter, the following publications are incorporated by reference. These...

  12. Alexandria Journal of Medicine - Vol 52, No 3 (2016)

    African Journals Online (AJOL)

    Finite element model to study two dimensional unsteady state calcium distribution in cardiac myocytes · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kunal Pathak, Neeru Adlakha, 261–268. http://dx.doi.org/10.1016/j.ajme.2015.09.007 ...

  13. Effects of bovine prolactin gene polymorphism within exon 4 on milk ...

    African Journals Online (AJOL)

    In this study, polymorphism of prolactin gene was analyzed as a candidate gene responsible for variation and genetic trends in milk yield and composition traits. Genomic DNAs were extracted from 268 semen samples belonged to Iranian Holstein bulls. Genotyping for the prolactin gene using PCRRFLP technique and RsaI ...

  14. Evidence on the Effectiveness of Comprehensive Error Correction in Second Language Writing

    Science.gov (United States)

    Van Beuningen, Catherine G.; De Jong, Nivja H.; Kuiken, Folkert

    2012-01-01

    This study investigated the effect of direct and indirect comprehensive corrective feedback (CF) on second language (L2) learners' written accuracy (N = 268). The study set out to explore the value of CF as a revising tool as well as its capacity to support long-term accuracy development. In addition, we tested Truscott's (e.g., 2001, 2007) claims…

  15. Evidence on the effectiveness of comprehensive error correction in second language writing

    NARCIS (Netherlands)

    van Beuningen, C.G.; de Jong, N.H.; Kuiken, F.

    2012-01-01

    This study investigated the effect of direct and indirect comprehensive corrective feedback (CF) on second language (L2) learners’ written accuracy (N = 268). The study set out to explore the value of CF as a revising tool as well as its capacity to support long-term accuracy development. In

  16. Density-functional study of the CO adsorption on the ferromagnetic fcc Co(001) film surface

    Czech Academy of Sciences Publication Activity Database

    Pick, Štěpán

    2010-01-01

    Roč. 604, 3-4 (2010), s. 265-268 ISSN 0039-6028 Institutional research plan: CEZ:AV0Z40400503 Keywords : Density functional calculations * chemisorption * magnetic films Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.010, year: 2010

  17. Effects of damage to auditory cortex on the discrimination of speech sounds by rats

    Czech Academy of Sciences Publication Activity Database

    Floody, O. R.; Ouda, Ladislav; Porter, B. A.; Kilgard, M. P.

    2010-01-01

    Roč. 101, č. 2 (2010), s. 260-268 ISSN 0031-9384 R&D Projects: GA ČR GA309/07/1336 Institutional research plan: CEZ:AV0Z50390703 Keywords : auditory cortex * brain lesions * prepulse inhibition Subject RIV: FH - Neurology Impact factor: 2.891, year: 2010

  18. HIV among Transgender People

    Science.gov (United States)

    ... Prevention VIH En Español Get Tested Find an HIV testing site near you. Enter ZIP code or city Follow HIV/AIDS CDC HIV CDC HIV/AIDS See RSS | ... Email Updates on HIV Syndicated Content Website Feedback HIV Among Transgender People Format: Select One PDF [268K] ...

  19. Obesity and health problems among South African healthcare workers

    African Journals Online (AJOL)

    2011-01-08

    Jan 8, 2011 ... Obesity and overweight in IMSS female workers in Mexico City. Salud Publica Mex. 2005;47(4):268-275. 13. Chiu-Fang C, Johnson PJ. Health disparities among America's healthcare providers: evidence from the integrated health interview series, 1982 to 2004. J. Occup Environ Med. 2008;50(6):696-704.

  20. Performance evaluation of prototype mechanical cassava harvester ...

    African Journals Online (AJOL)

    Large-scale cassava harvesting, especially during the dry season, is a major constraint to its industrial demand and commercial production. Manual harvesting is slow and ... Results from field trials showed prototype harvesters weighing 268 – 310 kg can achieve optimum performance on ridged landforms. When harvested ...

  1. Esca eius erant locustae. The origin and meaning of the imaginary quadruped locusta

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    2015-01-01

    Roč. 138, 3/4 (2015), s. 231-268 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : medieval latin lexicography * ancient zoology * medieval zoology * quadrupeds * locust * lobster * locusta * Thomas of Cantimpré * Jacques de Vitry * Bartholomaeus de Solencia * Claretus * Albert the Great * diet of John the Baptist * lepusculus * Aristoteles Latinus Subject RIV: AI - Linguistics

  2. Structural and Functional Characterization of the Wnt Inhibitor APC Membrane Recruitment 1 (Amer1)

    Czech Academy of Sciences Publication Activity Database

    Tanneberger, K.; Pfister, A.S.; Kříž, Vitězslav; Bryja, Vítězslav; Schambony, A.; Behrens, J.

    2011-01-01

    Roč. 268, č. 22 (2011), s. 19204-19214 ISSN 0021-9258 R&D Projects: GA ČR(CZ) GC204/09/J030 Institutional support: RVO:68081707 Keywords : BETA-CATENIN * SIGNALING PATHWAY * EMBRYONIC AXIS Subject RIV: BO - Biophysics Impact factor: 4.773, year: 2011

  3. Foot dimensions of a young adult Nigerian population | Obikili | Port ...

    African Journals Online (AJOL)

    Background: Variations in physical characteristics are due to interactions between genetic and environmental factors. Aim: The aim of the study is to provide normal values of foot length and breadth for our population. Methods: A cross sectional study of 402 male and 268 females of students of University of Nigeria Enugu ...

  4. AJOL

    African Journals Online (AJOL)

    Cancer, and out of 268 abstracts, already 36 concerned clinical work, which reflects great progress. The total number of contributors shows a phenomenal interest in a captivating· scientific field for chemists, physicists, engineers, biologists and medical doctors (radiation oncologists). Presently BNCT is usually reserved for ...

  5. The Potential of in situ Rain Water Harvesting for Water Resources ...

    African Journals Online (AJOL)

    and central (Endachewa s.d.; 2050masl) zones of Tigray, in northern Ethiopia, where large scale construction of half-moon ponds (HMP) and ditches was in progress. A total of 990 blood slides taken from under 10 children revealed 268 infections of which 90.7% were P. falciparum, 7.5% P. vivax and 1.9% mixed.

  6. Nanophase iron production through laser irradiation and magnetic detection of space weathering analogs

    Czech Academy of Sciences Publication Activity Database

    Markley, M.; Kletetschka, Günther

    2016-01-01

    Roč. 268, April (2016), s. 204-214 ISSN 0019-1035 Institutional support: RVO:67985831 Keywords : experimental techniques asteroids * surfaces Mercury * surface Moon * surface spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016

  7. Improvement of Working Memory in Preschoolers and Its Impact on Early Literacy Skills: A Study in Deprived Communities of Rural and Urban Areas

    Science.gov (United States)

    Rojas-Barahona, Cristian A.; Förster, Carla E.; Moreno-Ríos, Sergio; McClelland, Megan M.

    2015-01-01

    Research Findings: The present study evaluated the impact of a working memory (WM) stimulation program on the development of WM and early literacy skills (ELS) in preschoolers from socioeconomically deprived rural and urban schools in Chile. The sample consisted of 268 children, 144 in the intervention group and 124 in the comparison group. The…

  8. a te atal care service utilizatio ad associated factors i metekel zo e ...

    African Journals Online (AJOL)

    user

    For the 521 non-users, lack of awareness 268(51.4%) and absence of health problems during pregnancy 213(40.9%) were the main reasons mentioned for not attending ... technique, a design effect of 2 was considered to have adequate and representative sample size and. 10% was added for non-response. Thus, the final.

  9. The SILCC (SImulating the LifeCycle of molecular Clouds) project - I. Chemical evolution of the supernova-driven ISM

    Czech Academy of Sciences Publication Activity Database

    Walch, S.; Girichidis, P.; Naab, T.; Gatto, A.; Glover, S.C.O.; Wünsch, Richard; Klessen, R.S.; Clark, P.C.; Peters, T.; Derigs, D.; Baczynski, C.

    2015-01-01

    Roč. 454, č. 1 (2015), s. 238-268 ISSN 0035-8711 R&D Projects: GA ČR GAP209/12/1795 Institutional support: RVO:67985815 Keywords : magnetodydrodynamics * ISM clouds * ISM evolution Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.952, year: 2015

  10. Frequency and Pattern of Gynecological Cancers in Federal ...

    African Journals Online (AJOL)

    rate of cervical cancer.[5] In developed countries, endometrial carcinoma is the commonest gynecological cancer; while in. African countries, carcinoma of the cervix has been reported in many series to be the commonest, with most of the patients presenting in late stages of the disease.[2,6-8]. Ovarian cancer is the second ...

  11. A genome-wide scan in affected sib-pairs with idiopathic recurrent miscarriage suggests genetic linkage

    DEFF Research Database (Denmark)

    Kolte, Astrid Marie; Nielsen, Henriette Svarre; Moltke, Ida

    2011-01-01

    Previously, siblings of patients with idiopathic recurrent miscarriage (IRM) have been shown to have a higher risk of miscarriage. This study is comprised of two parts: 1) an epidemiological part, in which we introduce data on the frequency of miscarriage among 268 siblings of 244 patients with I...

  12. Journal of Agriculture and Social Research (JASR) Vol. 16, No. 2 ...

    African Journals Online (AJOL)

    user

    respondents were involved in problem identification and research planning activities. Mean of 2.74, 2.68 ... Cassava is one of the major food crops grown in Nigeria with annual production output of 45 million metric tons .... (54.84%) of respondents have their master degree (M.Sc) whereas many 35.48% have their. Ph.D. the ...

  13. Cigarette Smoking and Anti-Smoking Counselling: Dilemmas of Chinese Physicians

    Science.gov (United States)

    Li, Han Z.; Sun, Huisheng; Liu, Zhenqi; Zhang, Yu; Cheng, Qingchun

    2007-01-01

    Purpose: The purpose of this paper is to find out the anti-smoking counselling frequency and its correlates in a sample of Chinese physicians. Design/methodology/approach: In this paper, 268 physicians in Baoding, a city near Beijing, filled out a questionnaire asking about their own smoking status, their anti-smoking behaviors as well as their…

  14. Assessment of Revenue Generation Avenues in Ecotourism ...

    African Journals Online (AJOL)

    A set of structured questionnaires were randomly administered to 50% of tourism officials in Rayfield Resort (RR), Naraguta Tourist Village (NTV), Jos Wildlife Park (JWLP), Jos National Museum and Zoo (JNMZ), Assop Falls (AF), and Pandam Wildlife Park (PWLP). In all, 268 officials were sampled. Data collected were ...

  15. Prognostic Health Management of DoD Assets

    Science.gov (United States)

    2015-06-01

    emission technique can be a sensitive tool for monitoring the condition of surfaces. References [1] V. Baranov, E. Kudryavtsev , G. Sarychev, V...emissions generated by sliding friction, Wear 268 (2010) 811-815. [9] V. Baranov, E. Kudryavtsev , G. Sarychev, Modeling of the parameters of

  16. Photonic bandgap structures in planar waveguides

    Czech Academy of Sciences Publication Activity Database

    Čtyroký, Jiří

    2001-01-01

    Roč. 18, č. 2 (2001), s. 435-441 ISSN 0740-3232 Grant - others:EU COST(XE) OC 268.10 Institutional research plan: CEZ:AV0Z2067918 Keywords : photonic band gap * optical waveguide theory Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.521, year: 2001

  17. Structure, composition, and condition of overstory trees

    Science.gov (United States)

    Daniel A. Yaussy; Todd F. Hutchinson; Elaine Kennedy Sutherland

    2003-01-01

    The structure, composition, and condition of overstory trees in the four study areas prior to prescribed fire treatments are summarized. Stand initiation dates were similar among the study areas (ca. 1885), and coincided with the decline of the charcoal iron industry in southern Ohio. Tree basal area averaged 26.8m²/ha and was not significantly different among...

  18. PFP Commercial Grade Food Pack Cans for Plutonium Handling and Storage Critical Characteristics

    Energy Technology Data Exchange (ETDEWEB)

    BONADIE, E.P.

    2000-10-26

    This document specifies the critical characteristics for containers procured for Plutonium Finishing Plant's (PFP's) Vault Operations system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to perform its safety function.

  19. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sangappa. Articles written in Journal of Biosciences. Volume 30 Issue 2 March 2005 pp 259-268 Articles. Crystal structure of raw pure Mysore silk fibre based on (Ala-Gly)2-Ser-Gly peptide sequence using Linked-Atom-Least-Squares method · Sangappa S S Mahesh R Somashekar.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Issue front cover thumbnail Issue back cover thumbnail. Volume 10, Issue 12. December 2005, pages 1-268. World Year of Physics - 2005. pp 1-3 Editorial. Editorial · T V Ramakrishnan · More Details Fulltext PDF. pp 4-5 Table of Contents.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 268 ... Vol 10, No 2 (2013), Prescription pattern of anxiolytic drugs in burn patients: a case study of national orthopaedic hospital, Enugu, Nigeria, Abstract. ALE Uzondu, JO Okafor. Vol 9, No 2 (2012), Prescription pattern of fluoroquinolones in two selected secondary health facilities in Bayelsa State of Nigeria ...

  2. Celoplošná příprava půdy v lesích a její důsledky pro biodiverzitu

    Czech Academy of Sciences Publication Activity Database

    Čížek, Lukáš; Roleček, J.; Danihelka, Jiří

    2007-01-01

    Roč. 55, č. 6 (2007), s. 266-268 ISSN 0044-4812 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50070508; CEZ:AV0Z60050516 Keywords : biodiversity Subject RIV: EH - Ecology, Behaviour

  3. Egyptian Journal of Medical Human Genetics - Vol 16, No 3 (2015)

    African Journals Online (AJOL)

    Sarcopenic obesity and dyslipidemia response to selective exercise program after liver transplantation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Basha, ZE Mowafy, EA Morsy, 263-268. http://dx.doi.org/10.1016/j.ejmhg.2014.12.006 ...

  4. Conduct Disorder and Initiation of Substance Use: A Prospective Longitudinal Study

    Science.gov (United States)

    Hopfer, Christian; Salomonsen-Sautel, Stacy; Mikulich-Gilbertson, Susan; Min, Sung-Joon; McQueen, Matt; Crowley, Thomas; Young, Susan; Corley, Robin; Sakai, Joseph; Thurstone, Christian; Hoffenberg, Analice; Hartman, Christie; Hewitt, John

    2013-01-01

    Objective: To examine the influence of conduct disorder (CD) on substance use initiation. Method: Community adolescents without CD (n = 1,165, mean baseline age = 14.6 years), with CD (n = 194, mean baseline age = 15.3 years), and youth with CD recruited from treatment (n = 268, mean baseline age = 15.7 years) were prospectively followed and…

  5. Graph-Theoretic Statistical Methods for Detecting and Localizing Distributional Change in Multivariate Data

    Science.gov (United States)

    2015-06-01

    of each method. Number of IQR deviations above the third quartile M ed ia n A la rm T im e 0 1.5 2 3 5 0 50 0 10 00 15 00 20 00 Half Factor...Kotsiantis, S. B. (2007). Supervised Machine Learning: A Review of Classification Techniques. Informatica , 31, 249–268. 122 Koul, H. L., & Qian, L

  6. Classroom Organization and Teacher Stress Predict Learning Motivation in Kindergarten Children

    Science.gov (United States)

    Pakarinen, Eija; Kiuru, Noona; Lerkkanen, Marja-Kristiina; Poikkeus, Anna-Maija; Siekkinen, Martti; Nurmi, Jari-Erik

    2010-01-01

    This study examined the extent to which observed teaching practices and self-reported teacher stress predict children's learning motivation and phonological awareness in kindergarten. The pre-reading skills of 1,268 children were measured at the beginning of their kindergarten year. Their learning motivation and phonological awareness were…

  7. Electrochemical properties of undoped hydrogen terminated CVD diamond

    Czech Academy of Sciences Publication Activity Database

    Nebel, C.E.; Kato, H.; Rezek, Bohuslav; Shin, D.; Takeuchi, D.; Watanabe, H.; Yamamoto, T.

    2006-01-01

    Roč. 15, - (2006), s. 264-268 ISSN 0925-9635 Institutional research plan: CEZ:AV0Z10100521 Keywords : ion-sensitive field effect transistor * intrinsic CVD diamond * hydrogen termination, Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.935, year: 2006

  8. Jaderná bezpečnost fúzních elektráren a jejich vliv na životní prostředí.

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír; Dostál, V.

    2017-01-01

    Roč. 25, 9-10 (2017), s. 262-268 ISSN 1210-7085 Grant - others:AV ČR(CZ) StrategieAV21/2 Program:StrategieAV Institutional support: RVO:61389021 Keywords : design * reactor safety * thermonuclear fuels * thermonuclear reactions * thermonuclear reactor materials * thermonuclear reactors * tokamak devices Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering

  9. 77 FR 15376 - State Median Income Estimates for a Four-Person Household: Notice of the Federal Fiscal Year (FFY...

    Science.gov (United States)

    2012-03-15

    ..., see http://www.census.gov/acs/www/ or contact the Census Bureau's Social, Economic and Housing... Nevada 69,197 41,518 New Hampshire 92,216 55,330 New Jersey 102,552 61,531 New Mexico 55,446 33,268 New...

  10. Die betekenis van Abraham Kuyper (1837-1920) vir Suid-Afrika op ...

    African Journals Online (AJOL)

    ENGELBRECHT, SP 1946, Dr A Kuyper en John Milton. HTS, Jrg 3, 46-53. HAITJEMA, ThL 1936. De doleantie en otts kerkelijk vraagstuk. Onder Eigen Vaandel. Jrg 11,. 256-268. HAITJEMA, ThL 1964. De nieuwere geschiedenis van Neerlands Kerk der Hervorming. 's-Gravenhage: Boekencentrum NV. KRUGER, DW ...

  11. Combinations of artemisinin and quinine for uncomplicated falciparum malaria: efficacy and pharmacodynamics

    NARCIS (Netherlands)

    de Vries, P. J.; Bich, N. N.; van Thien, H.; Hung, L. N.; Anh, T. K.; Kager, P. A.; Heisterkamp, S. H.

    2000-01-01

    Combinations of artemisinin and quinine for uncomplicated falciparum malaria were studied. A total of 268 patients were randomized to 7 days of quinine at 10 mg/kg of body weight three times a day (Q) or to artemisinin at 20 mg/kg of body weight followed by 3 (AQ3) or 5 (AQ5) days of quinine.

  12. Avalanche transmission and critical behaviour in load-bearing ...

    Indian Academy of Sciences (India)

    explored further. We hope to explore some of these directions in future work. Acknowledgements. AD thanks the University Grants Commission, India, for a fellowship. References. [1] S H Strogatz, Nature (London) 410, 268 (2001). [2] R Albert and A-L Barabási, Rev. Mod. Phys. 74, 47 (2002). [3] S N Coppersmith, C-h Liu, ...

  13. Peering into the black hole - the quality of black mortality data in Por ...

    African Journals Online (AJOL)

    In the year ending 30 June 1989, 26,8% of 5345 deaths in the Port Elizabeth area were classified as ill-defined. A study was undertaken in an attempt to identify the reasons for the high proportion of such deaths. Copies of all death notifications and death register forms of black people in the area served by the Port Elizabeth ...

  14. Mobile Applications in Cell Biology Present New Approaches for Cell Modelling

    Science.gov (United States)

    de Oliveira, Mayara Lustosa; Galembeck, Eduardo

    2016-01-01

    Cell biology apps were surveyed in order to identify whether there are new approaches for modelling cells allowed by the new technologies implemented in tablets and smartphones. A total of 97 apps were identified in 3 stores surveyed (Apple, Google Play and Amazon), they are presented as: education 48.4%, games 26.8% and medicine 15.4%. The apps…

  15. Profile of children with cerebral palsy attending outpatient ...

    African Journals Online (AJOL)

    Jaundice (39.9%), asphyxia (26.8%) and infection (17.4%) were the leading causes of CP and spastic CP was the most common type (81.7%). Quadriplegic CP presentation was predominant (67.1%), and leading co-morbidities were mental retardation (31%) and speech impairment (26.3%). About 50% of the children ...

  16. Relationship between starch and lipid accumulation induced by nutrient depletion and replenishment in the microalga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Fernandes, B.; Teixeira, J.; Dragone, G.; Vicente, A. A.; Kawano, S.; Bišová, Kateřina; Přibyl, Pavel; Zachleder, Vilém; Vítová, Milada

    2013-01-01

    Roč. 144, SEP 2013 (2013), s. 268-274 ISSN 0960-8524 R&D Projects: GA MŠk LH12145; GA TA ČR TE01020080 Institutional support: RVO:61388971 ; RVO:67985939 Keywords : Lipids * Nutrient depletion * Nutrient replenishment Subject RIV: EE - Microbiology, Virology Impact factor: 5.039, year: 2013

  17. Alternative testing methodologies for ecotoxicity

    Czech Academy of Sciences Publication Activity Database

    Walker, C.; Kaiser, K.; Klein, W.; Lagadic, L.; Peakall, D.; Sheffield, S.; Soldán, Tomáš; Yasuno, M.

    1998-01-01

    Roč. 106, č. 2 (1998), s. 441-451 ISSN 0091-6765. [Meeting of the scientific group on methodologies for the safety evaluation of chemicals (SGOMSEC) /13./. Ispra, 26.01.1997-31.01.1997] Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 2.268, year: 1998

  18. The studies of particle diffusion on a heterogeneous one-dimensional lattice

    Czech Academy of Sciences Publication Activity Database

    Tarasenko, Alexander; Jastrabík, Lubomír

    2015-01-01

    Roč. 641, Nov (2015), s. 266-268 ISSN 0039-6028 R&D Projects: GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : heterogeneous one-dimensional lattice * diffusion * kinetic Monte Carlo simulations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.931, year: 2015

  19. All projects related to | Page 130 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Governance and Justice. Total Funding: CA$ 268,900.00. Bringing Women's Voices into the Mainstream: A Media Research Fellowship on Militarization and Women in South Asia. Project. South Asia is the most densely populated region of the world, second only to sub-Saharan Africa in poverty indicators.

  20. Plasma sprayed basalt/chromium oxide coatings

    Czech Academy of Sciences Publication Activity Database

    Ageorges, H.; Medarhri, Z.; Ctibor, Pavel; Fauchais, P.

    2007-01-01

    Roč. 11, č. 1 (2007), s. 71-82 ISSN 1093-3611 Institutional research plan: CEZ:AV0Z20430508 Keywords : Chromia, basalt * plasma spraying * microstructure * phase analysis Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.268, year: 2007

  1. The Phanerochaete chrysosporium secretome : database predictions and initial mass spectrometry peptide identifications in cellulose-grown medium

    Science.gov (United States)

    Amber J. Vanden Wymelenberg; Grzegorz Sabat; Diego Martinez; Alex S. Rajangam; Tuula T. Teeri; Jill A. Gaskell; Philip J. Kersten; Daniel Cullen

    2005-01-01

    The white rot basidiomycete, Phanerochaete chrysosporium, employs an array of extracellular enzymes to completely degrade the major polymers of wood : cellulose, hemicellulose and lignin. Towards the identification of participating enzymes, 268 likely secreted proteins were predicted using SignalP and TargetP algorithms. To assess the reliability of secretome...

  2. Search for dark matter produced in association with a hadronically decaying vector boson in pp collisions at √s = 13 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 763, Dec (2016), 251-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : ATLAS * effective field theory * transverse momentum * missing-energy * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  3. Using Common Themes: Cost-Effectiveness of Permanent Supported Housing for People with Mental Illness

    Science.gov (United States)

    McLaughlin, Thomas Chalmers

    2011-01-01

    This article examines the cost-effectiveness of providing permanent supported housing to homeless people with mental illness. Through the use of billing records and frequency of use charts, researchers were able to map the service usage of a cohort of 268 homeless individuals from both urban and rural communities. The results suggest that…

  4. Numerical solution of modified fokker-planck equation with poissonian input

    Czech Academy of Sciences Publication Activity Database

    Náprstek, Jiří; Král, Radomil

    2010-01-01

    Roč. 17, 3/4 (2010), s. 251-268 ISSN 1802-1484 R&D Projects: GA AV ČR(CZ) IAA200710805; GA ČR(CZ) GA103/09/0094 Institutional research plan: CEZ:AV0Z20710524 Keywords : Fokker-Planck equation * poisson ian exciation * numerical solution * transition effects Subject RIV: JN - Civil Engineering

  5. Production of human papillomavirus type16 E7 oncoprotein fused with ß-glucuronidase in transgenic tomato and potato

    Czech Academy of Sciences Publication Activity Database

    Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Ludvíková, V.; Niedermeierová, Hana

    2007-01-01

    Roč. 51, č. 2 (2007), s. 268-276 ISSN 0006-3134 R&D Projects: GA ČR GA521/05/2092 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * human papillomavirus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.259, year: 2007

  6. Copper(II) complexes derived from substituted 2,2 '-bis-(4-isopropyl-4-methyl-4,5-dihydro-1H-imidazol-5-one) ligands: Synthesis, structure and catalytic activity

    Czech Academy of Sciences Publication Activity Database

    Drabina, P.; Valenta, P.; Jansa, Petr; Růžička, A.; Hanusek, J.; Sedlák, M.

    2008-01-01

    Roč. 27, č. 1 (2008), s. 268-274 ISSN 0277-5387 Institutional research plan: CEZ:AV0Z40550506 Keywords : enantioselective Henry reactions * asymmetric catalysis * NMR spectra * density Subject RIV: CC - Organic Chemistry Impact factor: 1.801, year: 2008

  7. Kohakaasluskorras töötamise tingimuste määrustik

    Index Scriptorium Estoniae

    1989-01-01

    Lisatud tööde loetelu, mida ei peeta kohakaasluseks. Vene keeles: В помощь профсоюзному активисту 1989 nr. 3, lk. 9-14. Selgitused vt. Nõukogude Õigus 1989 nr. 4, lk. 267-268

  8. The Impact of Placements on the Academic Performance of UK and International Students in Higher Education

    Science.gov (United States)

    Crawford, Ian; Wang, Zhiqi

    2016-01-01

    Motivated by an increasing number of international students in UK higher education, this study investigates the effect of year-long placements on the academic performance of 268 accounting and finance students enrolled between 2006 and 2009. The results show differences between UK and international students although both statistically and…

  9. Biosynthesis of acid phosphatase of baker's yeast . Characterization of a protoplast-bound fraction containing precursors of the exo-enzyme

    NARCIS (Netherlands)

    Boer, Pieter; Rijn, Herman J.M. van; Reinking, A.; Steyn-Parvé, Elizabeth P.

    1975-01-01

    1. 1.|Yest protoplasts, secreting acid phosphatase (orthophosphoric-monoester phosphohydrolase (acid optimum) EC 3.1.3.2) contain a small amount of firmly bound enzyme, even after lysis (Van Rijn, H.J.M.; Boer, P. and Steyn-Parvé, E.P. (1972) Biochim. Biophys. Acta 268, 431–441). The major part

  10. Conceptual Basis for a Hazardous Waste Component of the Army Environmental Data Management System (AEDMS)

    Science.gov (United States)

    1988-09-01

    Requirements RP/RK Description Reference Remarks i.: estr - eo * ,, Soi ic Waste Generators 4’) CR ca SG are requireo to test an,, solid 2c8.7 wastes to oe...testing/analyaes. .§ estr -, P *0SG s of Restricted Wastes 4o CFR aste o. tensazs *Senerators of restricted wastes that 268.l 1 ~ erpci~ns require

  11. Food and feeding of sperm whales physeter macrocephalus off the ...

    African Journals Online (AJOL)

    The stomach contents of 1 268 sperm whales Physeter macrocephalus processed at the Donkergat whaling station, South Africa, were examined during the 1962 and 1963 whaling seasons. Results were compared with. Clarkefs analysis of cephalopod beaks collected in 1963 (Clarke 1980). There was no significant ...

  12. Nuclear orientation of radioactive nuclei the spin program

    Czech Academy of Sciences Publication Activity Database

    Dupák, Jan; Finger, M.; Finger jr., M.; Janata, A.; Kracíková, T. I.; Lebedev, N. A.; Nováková, D.; Ota, J.; Rotter, M.; Slunečka, M.; Slunečková, V.; Virus, M.; Yushkevich, Y. V.

    2000-01-01

    Roč. 50, Supp. S1 (2000), s. 253-268 ISSN 0011-4626. [Symmetry and Spin. Praha, 05.09.1999-12.09.1999] R&D Projects: GA AV ČR KSK1067601 Institutional research plan: CEZ:AV0Z2065902 Subject RIV: JR - Other Machinery Impact factor: 0.298, year: 2000

  13. Application of polyaniline dispersions by means of screen printing

    Czech Academy of Sciences Publication Activity Database

    Držková, M.; Peřinka, N.; Hajná, Milena; Kaplanová, M.; Stejskal, Jaroslav

    2013-01-01

    Roč. 19, č. 2013 (2013), s. 257-268 ISSN 1211-5541 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * colloids * screen printing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  14. Discrimination of Xihulongjing tea grade using an electronic tongue

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-15

    Dec 15, 2009 ... Available online at http://www.academicjournals.org/AJB. ISSN 1684–5315 © 2009 ... 1College of Biosystems Engineering and Food Science, Zhejiang University, 268 Kaixuan Road, Hangzhou 310029,. China. ... discriminant analysis (CDA) and back-propagation neural networks (BPNN). Results of PCA ...

  15. Proteomic Analysis of Prostate Cancer Field Effect

    Science.gov (United States)

    2011-02-01

    sapiens] cytochrome b5 outer mitochondrial membrane precursor [Homo sapiens] S1 00 calcium binding protein A 11 [Homo sapiens] LIM domain containing...prosome, macropain) 268 subunit, non-ATPase, 6 [Homo sapiens] polypyrimidine tract-binding protein 1 isoform a [Homo sapiens] vitamin D-binding

  16. Early Treatment in Shock

    Science.gov (United States)

    2010-06-17

    Vitamin E in Health and Disease, Marcel Dekker, Inc., New York, pp 247-268. 17. Qureshi AA, Mo H, Packer L, and Peterson DM. (2000) Isolation and...increases in thromboxane A3, prostacyclin 9 PGI3., and leukotriene B5 . More generally, the leukotrienes, prostacyclins, 10 thromboxanes, and

  17. Modeling the Relationship between High School Students' Chemistry Self-Efficacy and Metacognitive Awareness

    Science.gov (United States)

    Kirbulut, Zubeyde Demet

    2014-01-01

    In this study, the relationship between students' chemistry self-efficacy beliefs and metacognitive awareness was investigated utilizing a path model. There were 268 chemistry high school students (59% 10th grade and 41% 11th grade) participated in the study. The students took two-hour chemistry course in the 9th and 10th grade and three-hour…

  18. South Africa

    African Journals Online (AJOL)

    STORAGESEVER

    2008-10-20

    Oct 20, 2008 ... Fax: +27 15 268 3234 is used in the treatment of nose bleeds, haematemesis, haematuria, uterine bleeding, dysmenor-rhoea, postpar- tum abdominal pain andgastralgia, scrofula and abscess- ses (Yeung, 1985). It is also contradicated for pregnant women (Yeung, 1985). The seed down is haemostatic.

  19. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  20. Complexity in behavioural organization and strongylid infection among wild chimpanzees

    Czech Academy of Sciences Publication Activity Database

    Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.

    2017-01-01

    Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

  1. Factors Influencing the Outcomes in Extradural Haematoma Patients

    African Journals Online (AJOL)

    was recorded for only 30.8% of the patients. Other common symptoms included headaches (32.6%) and nausea (29.5%). Additional neurological symptoms that were encountered were confusion (27.7%), focal limb weakness (26.8%), convulsions (14.7%), memory loss (6.7%), visual disturbances (5%) and sensory deficits ...

  2. Assessment of Awareness, Attitudes and Perceptions of Students on ...

    African Journals Online (AJOL)

    One hundred and four (26.8%) were of the opinion that an HIV vaccine can cause infection to the person vaccinated. A total of 317 (82.0%) perceived an HIV vaccine as an addition rather than a substitute to other existing preventive measures such as condom use, in the fight against HIV and AIDS. The attitude towards an ...

  3. Low Cycle Fatigue Behavior of Cast Superalloy Inconel 713LC with Al Coating at 800 °C

    Czech Academy of Sciences Publication Activity Database

    Obrtlík, Karel; Pospíšilová, S.; Juliš, M.; Podrábský, T.; Polák, Jaroslav

    452-453, - (2011), s. 265-268 ISSN 1013-9826. [Advances in Fracture and Damage Mechanics IX. Nagasaki, 20.09.2010-22.09.2010] Institutional research plan: CEZ:AV0Z20410507 Keywords : High temperature fatigue * diffusion coating * Inconel 713LC Subject RIV: JL - Materials Fatigue, Friction Mechanics

  4. Multi-scale Modeling and Simulation of Compressible Multimaterial Flows

    Science.gov (United States)

    2012-09-11

    Asghari, Estimation of the reservoir permeability by petrophysical information using intelligent systems. Petroleum Science and Technology, 2008. 26...fractured reservoirs. Computers & Geosciences , 2000. 26(8): p. 877-905. 14. Unger, J.F. and C. Konke, Neural networks as material models within a

  5. A Three-Dimensional Eulerian Code for Simulation of High-Speed Multimaterial Interactions

    Science.gov (United States)

    2011-08-01

    1994-2003. 60. Ahmadi, M., et al., Estimation of the reservoir permeability by petrophysical information using intelligent systems. Petroleum Science...characterization and upscaling of fractured reservoirs. Computers & Geosciences , 2000. 26(8): p. 877-905. 63. Unger, J.F., et al., Neural networks as material

  6. Fulltext PDF

    Indian Academy of Sciences (India)

    Biol. 76 241–256. Richardson JS 1976 Handedness of crossover connections in β-sheets. Proc. Natl. Acad. Sci. USA 73 2619–2623. Richardson JS 1977 β-sheet topology and the relatedness of proteins. Nature (London) 268 495–500. Richardson JS 1981 The anatomy and taxonomy of protein structure. Adv. Prot. Chem.

  7. Cyklus a bilance uhlíku v mokřadech

    Czech Academy of Sciences Publication Activity Database

    Čížková, Hana; Pokorný, Jan; Květ, Jan; Bauer, Václav

    2004-01-01

    Roč. 21, č. 3 (2004), s. 265-268 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03 Institutional research plan: CEZ:AV0Z6087904 Keywords : carbon * wetland * sustainable management Subject RIV: EH - Ecology, Behaviour

  8. Nurses' knowledge about and attitudes toward organ donation in ...

    African Journals Online (AJOL)

    organs after death (172/268; 64.2%). English home-language nurses were more willing to donate compared with those of other language groups. (p=0.015). When asked to consider their personal choice regarding deceased organ donation, 51.1% of nurses felt that the most important person to make this decision should be ...

  9. Solar Research with ALMA

    Czech Academy of Sciences Publication Activity Database

    Karlický, Marian; Bárta, Miroslav; Dabrowski, Bartosz Premyslaw; Heinzel, Petr

    2011-01-01

    Roč. 268, č. 1 (2011), s. 165-173 ISSN 0038-0938 R&D Projects: GA AV ČR IAA300030701; GA ČR GAP209/10/1680 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * atmosphere * radio radiation * radioheliograph Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.776, year: 2011

  10. The Temporal and Scalar Mechanics of Conflict: Strategic Implications of Speed and Time on the American Way of War

    Science.gov (United States)

    2006-03-15

    if technology artificially creates an alternative information tunnel that traverses normal space-time, bypassing the standard flow of information and...263-268. Quantum physics and special relativity theorizes the possibility of “ wormholes ” which are bridges or tunnels providing a shortcut through one

  11. The epitope recognized by pan-HLA class I-reactive monoclonal antibody W6/32 and its relationship to unusual stability of the HLA-B27/beta2-microglobulin complex

    Czech Academy of Sciences Publication Activity Database

    Tran, T. M.; Ivanyi, P.; Hilgert, Ivan; Brdička, Tomáš; Pla, M.; Breur, B.; Flieger, Miroslav; Ivašková, E.; Hořejší, Václav

    2001-01-01

    Roč. 53, - (2001), s. 440-446 ISSN 0093-7711 R&D Projects: GA MZd NI5314; GA MZd IZ3647; GA MŠk LN00A026 Institutional research plan: CEZ:AV0Z5020903 Keywords : HLA class I * epitope * W6/32 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.268, year: 2001

  12. 76 FR 46719 - Western Pacific Bottomfish and Seamount Groundfish Fisheries; 2011-12 Main Hawaiian Islands Deep...

    Science.gov (United States)

    2011-08-03

    ... Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Proposed... 268,089 lb (121,603 kg). In general, the relative importance of MHI bottomfish to commercial participants as a percentage of overall fishing or household income is unknown, as the total suite of fishing...

  13. America's Star Libraries: Top-Rated Libraries

    Science.gov (United States)

    Lance, Keith Curry; Lyons, Ray

    2009-01-01

    "Library Journal"'s national rating of public libraries, the "LJ" Index of Public Library Service 2009, Round 2, identifies 258 "star" libraries. Created by Keith Curry Lance and Ray Lyons and based on 2007 data from the IMLS, it rates 7,268 public libraries. The top libraries in each group get five, four, or three stars. All included libraries,…

  14. 206 Aerobasics–An Introduction to Aeronautics

    Indian Academy of Sciences (India)

    IAS Admin

    The Airplane Structure. S P Govinda Raju. GENERAL ARTICLES. 223. Xylem Hydraulics: Rising Up and Higher! Dilip Amritphale and Santosh K Sharma. 232. Mahlburg's Work on Crank Functions. Ramanujan's Partitions Revisited. Nagesh Juluru and Arni S R Srinivasa Rao. REFLECTIONS. 268. The Scientific Enterprise.

  15. Texte zum Ausstellungskatalog

    DEFF Research Database (Denmark)

    Grinder-Hansen, Poul

    2013-01-01

    Nr. 268 Das Bonderup-Kreuz, Nr. 302 Goldreliefs aus der Kirche von Tamdrup, Nr. 303 Das Krucifix von Tirstrup, Nr. 304 Bronzemadonna von Randers, Nr. 327 Kelch aus der Kirche von Svalbard, Island, Nr. 338 Byzantiniche Elfenbeintafel mit Darstellungeiner Kreuzigung....

  16. On adaptive time stepping for large-scale parabolic problems: Computer simulation of heat and mass transfer in vacuum freeze-drying

    Czech Academy of Sciences Publication Activity Database

    Georgiev, K.; Kosturski, N.; Margenov, S.; Starý, Jiří

    2009-01-01

    Roč. 226, č. 2 (2009), s. 268-274 ISSN 0377-0427 Institutional research plan: CEZ:AV0Z30860518 Keywords : Vacuum freeze drying * Zeolites * Heat and mass transfer * Finite element method * MIC(0) preconditioning Subject RIV: BA - General Mathematics Impact factor: 1.292, year: 2009 http://apps.isiknowledge.com

  17. Who likes circus animals?

    OpenAIRE

    Zanola, Roberto

    2008-01-01

    Using a sample based on 268 questionnaires submitted to people attending the Acquatico Bellucci circus, Italy, this paper analyzes the circusgoers's preferences for circus animals. Results show that higher preferences for circus animals are related to frequency of consumption. However, differently from what commonly expected, more educated and younger people seem to be less sensitive to the claims of animal welfare organizations.

  18. 76 FR 8965 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2011-02-16

    ... Burnettown, Unincorporated Areas of Aiken County. Approximately 2.56 None +440 miles upstream of Old Friar... upstream of the Town Aiken County. Creek confluence. Approximately 0.55 mile None +216 upstream of the Town... upstream of the Town Aiken County. Creek confluence. Approximately 950 feet None +268 upstream of the Town...

  19. 40 CFR 260.3 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of number and gender. 260.3... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.3 Use of number and gender. As used in parts 260 through 265 and 268 of this chapter: (a) Words in the masculine gender also include the...

  20. Discussion on Wang et al. (2000) "Chemistry of Hf-rich zircons from the Laoshan I- and A-type granites, Eastern China"

    Czech Academy of Sciences Publication Activity Database

    Kempe, U.; Gruner, T.; Renno, A.; Wolf, D.; René, Miloš

    2004-01-01

    Roč. 68, č. 4 (2004), s. 669-675 ISSN 0026-461X R&D Projects: GA MŠk ME 364 Institutional research plan: CEZ:AV0Z3046908 Keywords : topaz granite * zirkon * hafnium Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.268, year: 2004

  1. Could we have predicted the recent downturn in the South African housing market?

    CSIR Research Space (South Africa)

    Das, Sonali

    2009-01-01

    Full Text Available This paper develops large-scale Bayesian Vector Autoregressive (BVAR) models, based on 268 quarterly series, for forecasting annualized real house price growth rates for large-, medium- and small-middle-segment housing for the South African economy...

  2. The Cape horse mackerel Trachurus trachurus capensis is the most ...

    African Journals Online (AJOL)

    denise

    25 cm being sampled by the latter. Also, the .... Parallel trawl comparison tests .... fish (>27 cm). The modal length of the fish in both. 268. A Decade of Namibian Fisheries Science. South African Journal of Marine Science 23. 2001. B. A C W u.

  3. International Physiotherapy Eduication

    African Journals Online (AJOL)

    brownb

    didactic and clinical teaching practices and options, and also provides insights into the future of professional .... ability to perform a specific task in a given situation, while cultural competence involves the nuances and. 2 .... Job satisfaction traits of Nigerian physiotherapists. Physiotherapy Theory and Practice 17: 257-. 268.

  4. Onemocnění člověka způsobená hantaviry – stále opomíjené zoonózy?

    Czech Academy of Sciences Publication Activity Database

    Vrbovská, V.; Chalupa, P.; Straková, Petra; Hubálek, Zdeněk; Rudolf, Ivo

    2015-01-01

    Roč. 64, č. 4 (2015), s. 188-196 ISSN 1210-7913 Institutional support: RVO:68081766 Keywords : hantaviruses * Dobrava-Belgrade * Puumala * rodents * insectivores * emerging diseases * surveillance Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 0.268, year: 2015

  5. Brief Report: Autistic Features in Children and Adolescents with Gender Dysphoria

    Science.gov (United States)

    Skagerberg, Elin; Di Ceglie, Domenico; Carmichael, Polly

    2015-01-01

    This paper looks at the association between gender dysphoria (GD), scores on the Social Responsiveness Scale (SRS), and reported diagnoses of autism spectrum disorder (ASD). Parents of 166 young people presenting with GD (Mean age = 14.26, SD = 2.68) completed the SRS. Information concerning an ASD diagnosis was also extracted from the patient…

  6. Surface Geometry and Chemistry of Hydrothermally Synthesized Single Crystal Thorium Dioxide

    Science.gov (United States)

    2015-03-01

    Member Alex G. Li, PhD Member iv AFIT-ENP-MS-15-M-87 Abstract The surface chemistry and geometry of hydrothermally grown, single...Interactions with Materials and Atoms 268(9), pp. 1482-1485. 2010. . DOI: 10.1016/j.nimb.2010.01.027. [4] J. A. Felix , D. M. Fleetwood, R. D. Schrimpf, J. G

  7. Alkaline peroxide pretreatment of corn stover for enzymatic saccharification and ethanol production

    Science.gov (United States)

    Alkaline hydrogen peroxide (AHP) pretreatment and enzymatic saccharification were evaluated for conversion of corn stover cellulose and hemicellulose to fermentable sugars. Corn stover used in this study contained 37.0±0.2% cellulose, 26.8±0.2% hemicellulose and 18.0±0.1% lignin on dry basis. Unde...

  8. The Role of Perceived Social Support and Coping Styles in Predicting Adolescents' Positivity

    Science.gov (United States)

    Çevik, Gülsen Büyüksahin; Yildiz, Mehmet Ali

    2017-01-01

    The current research aims to examine the perceived social support and coping styles predicting positivity. Research participants included 268 adolescents, attending high school, with 147 females (54.9%) and 121 males (45.1%). Adolescents participating in the research were 14 to 18 years old and their average age was 16.12 with SD = 1.01. Research…

  9. A new geographical gradient in vole population dynamics

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Stenseth, N. C.

    2001-01-01

    Roč. 268, č. 1476 (2001), s. 1547-1552 ISSN 0962-8452 R&D Projects: GA ČR GA524/01/1316; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : common vole * density dependence * population cycles Subject RIV: EH - Ecology, Behaviour Impact factor: 3.192, year: 2001

  10. 2018-04-07T19:21:22Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    The mean value of 2.68 (approximately 3.0) implies that an average food crop farmer experienced up to three different sources of risk in the studyarea. Risk management strategies available to the farmers were extension services, 67.3%; access to fertilizer, 41.2%; mixed cropping/farming, 79.3%; cooperative society 54.5%, ...

  11. Monogenic diabetes syndromes

    DEFF Research Database (Denmark)

    Astuti, Dewi; Sabir, Ataf; Fulton, Piers

    2017-01-01

    (n = 268), and SLC19A2 (n = 48) for Wolfram type 1, Wolfram type 2, Alström, and Thiamine-responsive megaloblastic anemia syndromes, respectively; and included 23 previously unpublished novel germline variants in WFS1 and 17 variants in ALMS1. We then investigated genotype-phenotype relations...

  12. Beyond the root: dilatation of the distal aorta in Marfan's syndrome

    NARCIS (Netherlands)

    Engelfriet, P. M.; Boersma, E.; Tijssen, J. G. P.; Bouma, B. J.; Mulder, B. J. M.

    2006-01-01

    OBJECTIVE: To investigate dilatory changes of the aorta distal to the root in patients with Marfan's syndrome. METHODS AND RESULTS: Data of 268 patients with Marfan's syndrome who were enrolled in the Euro Heart Survey on adult congenital heart disease were analysed. Data used for this study were

  13. Regional calibration models for predicting loblolly pine tracheid properties using near-infrared spectroscopy

    Science.gov (United States)

    Mohamad Nabavi; Joseph Dahlen; Laurence Schimleck; Thomas L. Eberhardt; Cristian Montes

    2018-01-01

    This study developed regional calibration models for the prediction of loblolly pine (Pinus taeda) tracheid properties using near-infrared (NIR) spectroscopy. A total of 1842 pith-to-bark radial strips, aged 19–31 years, were acquired from 268 trees from 109 stands across the southeastern USA. Diffuse reflectance NIR spectra were collected at 10-mm...

  14. Cloning and characterization of a pathogen-induced chitinase in Brassica napus

    DEFF Research Database (Denmark)

    Rasmussen, U.; Bojsen, K.; Collinge, D.B.

    1992-01-01

    A chitinase cDNA clone from rapeseed (Brassica napus L. ssp. oleifera) was isolated. The cDNA clone, ChB4, represents a previously purified and characterized basic chitinase isozyme. The longest open reading frame in ChB4 encodes a polypeptide of 268 amino acids. This polypeptide consists of a 24...

  15. OMC: an optical monitoring camera for INTEGRAL

    Czech Academy of Sciences Publication Activity Database

    Mas-Hesse, J. M.; Giménez, A.; Culhane, J. L.; Jamar, C.; McBreen, B.; Torra, J.; Hudec, René; Fabregat, J.; Meurs, E.; Swings, J. P.; Alcacera, M. A.; Balado, A.; Beiztegui, R.; Belenguer, T.; Bradley, L.; Caballero, M. D.; Cabo, P.; Defise, J. M.; Díaz, E.; Domingo, A.; Figueras, F.; Figueroa, I.; Hanlon, L.; Hroch, Filip; Hudcová, Věra; García, T.; Jordan, B.; Jordi, C.; Kretschmar, P.; Laviada, C.; March, M.; Martín, E.; Mazy, E.; Menéndez, M.; Mi, J. M.; de Miguel, E.; Munoz, T.; Nolan, K.; Olmedo, R.; Pesseria, J. Y.; Polcar, Jiří; Reina, M.; Renotte, E.; Rochus, P.; Sánchez, A.; San Martín, J. C.; Smith, A.; Soldán, Jan; Thomas, P.; Timón, V.; Walton, D. J.

    2003-01-01

    Roč. 411, č. 1 (2003), L261-L268 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z1003909 Keywords : photometers instrumentation * stars * photometric Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.843, year: 2003

  16. Determination of Markers by GUHA Method for Neural Network Training

    Czech Academy of Sciences Publication Activity Database

    Šebesta, Václav; Straka, L.

    1998-01-01

    Roč. 8, č. 3 (1998), s. 255-268 ISSN 1210-0552 R&D Projects: GA AV ČR IAA2030801 Grant - others:MZ(CZ) IZ3773 Keywords : neural network training * medical informatics * decision suppoort system Subject RIV: BA - General Mathematics

  17. The production, digestibility and chemical composition of five eco ...

    African Journals Online (AJOL)

    The highest number of grazing days and a grazing capacity of 2,68ha/LSU at a high grazing intensity, was recorded for the ecotype VH20 in the ripe seed stage. The relatively high protein content (14,1%) and digestibility (69,9%) of grazing material, collected by oesophageally fistulated steers indicated a pasture of potential ...

  18. Some new Eocene elasmobranch reports from the outer Western Carpathians (Moravia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Skupien, P.

    2013-01-01

    Roč. 268, č. 1 (2013), s. 113-123 ISSN 0077-7749 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : Elasmobranchii * Leidybatis jugossus * Centrophorus * Eocene * Western Carpathian Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.541, year: 2013

  19. 77 FR 23509 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-04-19

    ... American Compressor Engineering Group, Tecumseh Product, Manpower. 81,189A Tecumseh Compressor Tecumseh, MI......... February 13, 2010. Company, North American Compressor Engineering Group, Tecumseh Product, Manpower. 81,224... Phillips-Van Heusen New York, NY......... Corporation, Izod Women's Wholesale Division. 81,268 Follansbee...

  20. Relationship between Motivation for Learning EFL and Intrinsic Motivation for Learning in General among Japanese Elementary School Students

    Science.gov (United States)

    Carreira, Junko Matsuzaki

    2011-01-01

    This study investigated children's motivation for learning English as a foreign language (EFL) and intrinsic motivation for learning in general. The participants were 268 third-sixth graders in a public school in Japan. Data were collected using two questionnaires, one measuring motivation for learning EFL and the other investigating intrinsic…

  1. Measuring Physical Activity with Pedometers in Older Adults with Intellectual Disability : Reactivity and Number of Days

    NARCIS (Netherlands)

    Hilgenkamp, Thessa; Van Wijck, Ruud; Evenhuis, Heleen

    The minimum number of days of pedometer monitoring needed to estimate valid average weekly step counts and reactivity was investigated for older adults with intellectual disability. Participants (N = 268) with borderline to severe intellectual disability ages 50 years and older were instructed to

  2. Decreased hepatotoxic bile acid composition and altered synthesis in progressive human nonalcoholic fatty liver disease

    Czech Academy of Sciences Publication Activity Database

    Lake, A.D.; Novák, Petr; Shipkova, P.; Aranibar, N.; Robertson, D.; Reily, M.D.; Lu, Z.; Lehman-McKeeman, L.D.; Cherrington, N.J.

    2013-01-01

    Roč. 268, č. 2 (2013), s. 132-140 ISSN 0041-008X Institutional research plan: CEZ:AV0Z50510513 Institutional support: RVO:60077344 Keywords : Bile Acids * Liver * Metabolomics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.630, year: 2013

  3. Neutrophil superoxide-anion generating capacity in chronic smoking ...

    Indian Academy of Sciences (India)

    Unknown

    IU (268 mg) vitamin E as dL-α-tocopherol (n = 64) or placebo capsules (n = 64), provided by Hoffman La. Roche Ltd (Basel, Switzerland). Fasting blood samples for analysis of different parameters, were collected before and after the intervention. Written informed con- sent was obtained from all participants, and the protocol.

  4. Validation of k(0) Standardization Method in Neutron Activation Analysis Using Kayzero Program for Windows

    Czech Academy of Sciences Publication Activity Database

    Kubešová, Marie; Kučera, Jan

    2011-01-01

    Roč. 105, č. 4 (2011), s. 261-268 ISSN 0009-2770 R&D Projects: GA ČR GA202/09/0363 Institutional research plan: CEZ:AV0Z10480505 Keywords : ELECTRONIC DATABASE * ASSISTED NAA * COMPILATION Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.529, year: 2011

  5. 76 FR 66087 - Telecommunications; Extension of the Office of Management and Budget's (OMB) Approval of...

    Science.gov (United States)

    2011-10-25

    ...] Telecommunications; Extension of the Office of Management and Budget's (OMB) Approval of Information Collection... the Standard on Telecommunications (29 CFR 1910.268). The purpose of this requirement is to ensure... of the information collection requirement contained in the Standard on Telecommunications (29 CFR...

  6. Effects of Homework Motivation and Worry Anxiety on Homework Achievement in Mathematics and English

    Science.gov (United States)

    Hong, Eunsook; Mason, Elsa; Peng, Yun; Lee, Nancy

    2015-01-01

    Direct and mediating effects of homework worry anxiety on homework effort and homework achievement and the differences in the structural relations among homework motivation constructs and homework achievement across mathematics and English homework were examined in 268 tenth graders in China. Homework motivation included task value, homework…

  7. K výročí nedožitých pětasedmdesátin archiváře a historika Antonína Verbíka

    Czech Academy of Sciences Publication Activity Database

    Novotný, Gustav

    2009-01-01

    Roč. 51, - (2009), s. 263-268 ISSN 0583-5569 R&D Projects: GA ČR(CZ) GA404/06/0167 Institutional research plan: CEZ:AV0Z80150510 Keywords : history * biography * archival science * Czech lands * Moravia Subject RIV: AB - History

  8. Can Ethics Be Taught? A Quasi-Experimental Study of the Impact of Class Size on the Cognitive Moral Reasoning of Freshmen Business Students

    Science.gov (United States)

    Sullivan, Ethan A.

    2011-01-01

    The purpose of this study was to determine the impact of a business ethics course on the cognitive moral reasoning of freshmen business students. The sample consisted of 268 college students enrolled in a required business ethics course. The students took Rest's Defining Issues Test--Version 2 (DIT2) as a pre-test and then post-test (upon…

  9. 75 FR 32210 - United States v. Idaho Orthopaedic Society, Timothy Doerr, Jeffrey Hessing, Idaho Sports Medicine...

    Science.gov (United States)

    2010-06-07

    ..., Jeffrey Hessing, Idaho Sports Medicine Institute, John Kloss, David Lamey, and Troy Watkins; Proposed... Sports Medicine Institute, John Kloss, David Lamey, and Troy Watkins, Civil Case No. 10-268. On May 28..., Jeffrey Hessing, Idaho Sports Medicine Institute, John Kloss, David Lamey, and Troy Watkins, Defendants...

  10. Patient-centred continuing professional development for Canadian ...

    African Journals Online (AJOL)

    Of 310 surveys returned, a total of 268 physicians from one province in Canada were studied. On average, the participants had 16 years of practice experience with family medicine making up the largest component of the study cohort – 41%. Physicians were asked how useful learning about specific topics would be to ...

  11. Introducing CSR - The Missing Ingredient in the Land Reform Recipe?

    African Journals Online (AJOL)

    10332324

    268-305; and Wood and Jones 1995 International Journal of Organisational Analysis 229-267. Burke and Logsdon 1996 Long Range Planning 495-502 note that, in the ...... [date of use 20. Sep 2011]. Anon 2011 www.gcis.gov.za. Anonymous 2011 Pocket Guide to South Africa 2010/11 Agriculture, Forestry and Fisheries ...

  12. ELVIS

    DEFF Research Database (Denmark)

    Andersen, Ove; Krogh, Benjamin Bjerre; Torp, Kristian

    2017-01-01

    to the popular EV Nissan Leaf. It is shown that for a typical scenario it is possible reduce CO2 emissions by 28% when substituting a CV for an EV. ELVIS bases its estimations on 268 million GPS records from 325 CVs and 219 million records from 177 EVs, annotated with fuel/energy consumption data....

  13. ELVIS: Comparing Electric and Conventional Vehicle Energy Consumption and CO2 Emissions

    DEFF Research Database (Denmark)

    Andersen, Ove; Krogh, Benjamin Bjerre; Torp, Kristian

    2017-01-01

    to the popular EV Nissan Leaf. It is shown that for a typical scenario it is possible reduce CO2 emissions by 28% when substituting a CV for an EV. ELVIS bases its estimations on 268 million GPS records from 325 CVs and 219 million records from 177 EVs, annotated with fuel/energy consumption data....

  14. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Issue 2. Issue front cover thumbnail. Volume 89, Issue 2. August 2010, pages 121-268. pp 121-133 Research Article. Comparative evaluation of genetic diversity using RAPD, SSR and cytochrome P450 gene based markers with respect to calcium content in finger millet ...

  15. Water SA - Vol 44, No 2 (2018)

    African Journals Online (AJOL)

    Potential of dyes as draw solutions in forward osmosis for the South African textile industry. Marshall Sheldon, Estella Zandile Jingxi, Debbie De Jager, Robyn Augustine, Jasmina Korenak, C Helix-Nielsen, Irena Petrinic, 258-268. Driving factors of temporary and permanent shallow lakes in and around Hwange National ...

  16. Coupling of seasonal variations in the zooplankton community within the limnetic and littoral zones of a shallow pond

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Devetter, Miloslav

    2011-01-01

    Roč. 47, č. 3 (2011), s. 259-268 ISSN 0003-4088 Institutional research plan: CEZ:AV0Z60660521 Keywords : limnetic zone * littoral zone * seasonal succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.930, year: 2011

  17. Optimization of the Development of a Plastic Recycling Machine ...

    African Journals Online (AJOL)

    Nigerian Journal of Technology ... The performance test analysis carried out defines the characteristics of the machine and shows that at a speed of 268 rpm the machine functions effectively and efficiently in performing its task producing a high finishing recycling efficiency or recyclability of 97%, takes 2 minutes to recycle a ...

  18. 76 FR 58045 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance and...

    Science.gov (United States)

    2011-09-19

    ... Division of Trade Adjustment Assistance to issue a certification of eligibility to apply for Alternative... Information Management, Inc., Boston, MA: May 17, 2010 TA-W-80,268; Cadmus Journal Services, Inc., Ephrata, PA...) have not been met. TA-W-80,323; Allen Family Foods, Inc., Cordova, MD The workers' firm does not...

  19. The situation of the nucleo-electric power in the world

    International Nuclear Information System (INIS)

    Souza, Jair A.M. de.

    1995-10-01

    In this report, several global aspects of nucleo-electric power generation are presented. The role of nuclear power in the world electric system and its economical, social and environmental aspects are described. The nuclear program of the main countries are presented together with several tables and graphics. 268 refs., 59 figs., 62 tabs

  20. A database and synthesis of northern peatland soil properties and Holocene carbon and nitrogen accumulation

    NARCIS (Netherlands)

    Loisel, J.; Yu, Z.; Beilman, D.W.; Camill, P.; Alm, J.; Amesbury, M.J.; Anderson, D.; Andersson, S.; Bochicchio, C.; Barber, K.; Belyea, L.R.; Bunbury, J.; Chambers, F.M.; Charman, D.J.; De Vleeschouwer, F.; Fiałkiewicz-Kozieł, B.; Finkelstein, S.A.; Gałka, M.; Garneau, M.; Hammarlund, D; Hinchcliffe, W.; Holmquist, J.; Hughes, P.; Jones, M.C.; Klein, E.S.; Kokfelt, U.; Korhola, A.; Kuhry, P.; Lamarre, A.; Lamentowicz, M.; Large, D.; Lavoie, M.; Macdonald, G.; Magnan, G.; Mäkilä, M.; Mallon, G.; Mathijssen, P.; Mauquoy, D.; McCarroll, J.; Moore, T.R.; Nichols, J.; O'Reilly, B.; Oksanen, P.; Packalen, M.; Peteet, D.; Richard, P.J.H.; Robinson, S.; Ronkainen, T.; Rundgren, M.; Sannel, A.B.K.; Tarnocai, C.; Thom, T.; Tuittila, E.S.; Turetsky, M.; Väliranta, M.; van der Linden, M.; van Geel, B.; van Bellen, S.; Vitt, D.; Zhao, Y.; Zhou, W.

    2014-01-01

    Here, we present results from the most comprehensive compilation of Holocene peat soil properties with associated carbon and nitrogen accumulation rates for northern peatlands. Our database consists of 268 peat cores from 215 sites located north of 45°N. It encompasses regions within which peat

  1. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Issue 2. Issue front cover thumbnail. Volume 89, Issue 2. August 2010, pages 121-268. pp 121-133 Research Article ..... or autosomal chromosomes in the Siberian jay (Perisoreus infaustus): insights into avian genome evolution from cross-species amplification tests.

  2. Electrocardiographic abnormalities among dialysis naïve chronic ...

    African Journals Online (AJOL)

    analysis of dialysis patients in Okinawa Japan. Kidney. Int 1993;43:404-9. 28. Walker WG, Neaton JD, Cutler JA, Newwirth R, Cohen. JD. Renal function change in hypertensive members of Multiple Risk Factor Intervention Trial. Racial and treatment effects. The MRFIT Research Group. JAMA. 1992;268:3085-91. 29. Adeera ...

  3. Traits Without Borders:Integrating Functional Diversity Across Scales

    Czech Academy of Sciences Publication Activity Database

    Carmona, C. P.; de Bello, Francesco; Mason, N. W. H.; Lepš, Jan

    2016-01-01

    Roč. 31, č. 5 (2016), s. 382-394 ISSN 0169-5347 R&D Projects: GA ČR GAP505/12/1296; GA ČR GB14-36079G Institutional support: RVO:67985939 ; RVO:60077344 Keywords : functional trait * functional diversity * functional niche Subject RIV: EH - Ecology, Behaviour Impact factor: 15.268, year: 2016

  4. Rotaphone, a Self-Calibrated Six-Degree-of-Freedom Seismic Sensor and Its Strong-Motion Records

    Czech Academy of Sciences Publication Activity Database

    Brokešová, J.; Málek, Jiří

    2013-01-01

    Roč. 84, č. 5 (2013), s. 737-744 ISSN 0895-0695 R&D Projects: GA ČR GAP210/10/0925; GA MŠk LM2010008 Institutional support: RVO:67985891 Keywords : rotation al seismology * sensor * six-degree-of-freedom Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.268, year: 2013

  5. Multi-wavelength observations of Asteroid 2100 Ra-Shalom

    Czech Academy of Sciences Publication Activity Database

    Shepard, M.K.; Clark, B. E.; Nolan, M. C.; Benner, L. A. M.; Ostro, S. J.; Giorgini, J. D.; Vilas, F.; Jarvis, K.; Lederer, S.; Lim, L.F.; McConnochie, T.; Bell, J.; Margot, J. L.; Rivkin, A. S.; Magrik, C.; Scheeres, D.J.; Pravec, Petr

    2008-01-01

    Roč. 193, č. 1 (2008), s. 20-38 ISSN 0019-1035 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids composition * radar observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.268, year: 2008

  6. Peter Van Elsuwege and Roman Petrov, eds. Legislative Approximation and Application of EU Law in the Eastern Neighbourhood of the European Union: Towards a Common Regulatory Space?

    Directory of Open Access Journals (Sweden)

    Andriy Tyushka

    2016-02-01

    Full Text Available Peter Van Elsuwege and Roman Petrov, eds. Legislative Approximation and Application of EU Law in the Eastern Neighbourhood of the European Union: Towards a Common Regulatory Space? London and New York: Routledge, 2014. xxx, 268 pp. Notes on Contributors. Preface by Marc Maresceau. Foreward by Kostiantyn Yelisieiev. Illustrations. Informative table and list. Index. $145.00, cloth.

  7. First report of sunflower white mold caused by Sclerotinia minor Jagger in Inner Mongolia region, China

    Science.gov (United States)

    During the 2014 growing season, sunflower plants with symptoms of basal stem rot and whole plant wilt were observed in sunflower fields in Inner Mongolia, China. The average disease incidence was between 10-15%. Tiny (0.30 to 2.68 mm) black sclerotia were usually observed on the stem of infected pla...

  8. Literature and Practice: A Critical Review of MOOCs

    Science.gov (United States)

    Chiappe-Laverde, Andres; Hine, Nicolas; Martínez-Silva, Jose Andres

    2015-01-01

    This article focuses on a review of both literature and practical experiences concerning MOOCs. The literature analyzed was published in peer-reviewed journals between 2007 and 2013. 268 items were selected for this study, of which 100 were analyzed in detail. The issues raised by this analysis were used as the criteria for the analysis of 10…

  9. Sound Effects: Social Pressure and Identity Negotiation in the Spanish Language Classroom

    Science.gov (United States)

    Lefkowitz, Natalie; Hedgcock, John S.

    2006-01-01

    This study explores how social pressure and identity construction patterns interact with the oral performance of secondary and post-secondary learners of Spanish as a foreign language. Data derive from 268 questionnaires probing students' perceptions of Spanish, Spanish speakers, their peers, and their instructors. Ethnographic interviews…

  10. Search for single production of a vector-like quark via a heavy gluon in the 4b final state with the ATLAS detector in pp collisions at √s = 8 TeV

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2016-01-01

    Roč. 758, Jul (2016), 249-268 ISSN 0370-2693 Institutional support: RVO:68378271 Keywords : CERN LHC Coll * background * composite * benchmark * gluon * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  11. Testing of small and large sign support systems FOIL test numbers : 92F009 and 92F010

    Science.gov (United States)

    1994-07-01

    This test report contains the results of two crash tests performed at the Federal Outdoor Impact Laboratory (FOIL) in McLean, Virginia. The/tests were performed on a small sign support system at 20 rni/h (8.9 m/s), test 92F009 and 60 mi/h (26.8 m/s),...

  12. Diverse retrotransposon families and an AT-rich satellite DNA revealed in giant genomes of Fritillaria lilies

    Czech Academy of Sciences Publication Activity Database

    Ambrožová, K.; Mandáková, T.; Bureš, P.; Neumann, Pavel; Leitch, I. J.; Koblížková, Andrea; Macas, Jiří; Lysák, M.

    2011-01-01

    Roč. 107, č. 2 (2011), s. 255-268 ISSN 0305-7364 R&D Projects: GA ČR GA521/07/0284; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50510513 Keywords : Fritillaria * Liliaceae * repetitive DNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.030, year: 2011

  13. 76 FR 74838 - Agency Information Collection Activities: Proposed Request

    Science.gov (United States)

    2011-12-01

    ... (EDCS) interview, or the Internet application, i3441. This allows claimants to disclose any changes to... disability income Supplemental Security Income (SSI) payments, or who are requesting a hearing before an ALJ...) SSA-3441-BK 5,604 1 45 4,203 EDCS Interview 662,090 1 45 496,568 i3441 (Internet) 605,268 1 28 282,458...

  14. QTL analysis for early yield in a pseudo F2 population of cassava

    African Journals Online (AJOL)

    SERVER

    2008-01-18

    Jan 18, 2008 ... Genetic mapping of early bulking in a full-sib population of cassava was continued in a selfed family of. 268 cassava plants derived from a single progeny of the full-sib population. The pseudo F2 population was analysed with 122 segregating SSR markers. A previously constructed linkage map of cassava.

  15. Simple and efficient methods for isolation and activity measurement ...

    African Journals Online (AJOL)

    Jane

    2011-06-29

    Jun 29, 2011 ... method. Key words: Hirudin, thrombin titration method, chromatography, purification. ... HPLC, high performance liquid chromatography; SDS-PAGE, ..... FEBS Letter, 164: 307-313. Fischer K (2004). The role of recombinant hirudins in the management of thrombotic disorder, Bio. Drugs, 18: 235-268.

  16. Bildungsmäzenatentum und lutherisches Schulwesen in den böhmischen Ländern des 16. und des frühen 17. Jahrhunderts

    Czech Academy of Sciences Publication Activity Database

    Holý, Martin

    2017-01-01

    Roč. 18, č. 2 (2017), s. 268-278 ISSN 1805-790X Institutional support: RVO:67985963 Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  17. Data of evolutionary structure change: 1PVDA-2VBFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBFA 1PVD 2VBF A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...YMADGYARTKKAAAFLTTFGVGELSAINGLAGSYAENLPVVEIVGSPTSKVQNDGKFVHHTLADGDFKHFMKMHEPVTAARTLLT-AENATYEIDRVLSQLLKERKPVYINLPVD...ment> 0 1PVD A 1PVD... ASN CA 268 ALA CA 373 THR CA 367 1PVD... A 1PVDA

  18. Stress Carry-Over and College Student Health Outcomes

    Science.gov (United States)

    Pedersen, Daphne E.

    2012-01-01

    Objective: Using a stress carry-over perspective, this study examines the relationship between stress stemming from school and family domains and physical and mental health outcomes. Methods: The study sample included 268 undergraduate men and women from a Midwestern university. Participants completed an anonymous online questionnaire. OLS…

  19. 2015-2016 Travel and Hospitality Expense Reports for Jean Lebel ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Description: Dinner with IDRC research project stakeholders. Date: 2016-01-14. Attendees: 3 (IDRC 1). Location: Abidjan, Cote D'Ivoire. Total: $268.62. Comments: Gathering intelligence on research and country situation with former. IDRC grantees. 2015-2016 Travel and Hospitality Expense. Reports for Jean Lebel, ...

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    2012-01-24

    Jan 24, 2012 ... Jackson JH, George R and Herring PA 2000 Vectors of Shannon information from Fourier signals characterizing base periodicity in genes and genomes. Biochem. Biophys. Res. Commun. 268. 289–292. Jurka J, Kapitonov VV, Pavlicek A, Klonowski P, Kohany O and. Walichiewicz J 2005 Repbase Update, ...

  1. Evaluation of the dry weight rank method for botanical analysis of grassland by means of simulation.

    NARCIS (Netherlands)

    Neuteboom, J.H.; Lantinga, E.A.; Struik, P.C.

    1998-01-01

    With the Dry Weight Rank (DWR) method of 't Mannetje and Haydock [see Journal of British Grassland Society (1963) 18, 268-275] for botanical analysis in pastures, the dry weight proportions of species are estimated from their first, second and third ranks in dry weight in single quadrats. The yield

  2. iMindMap as an Innovative Tool in Teaching and Learning Accounting: An Exploratory Study

    Science.gov (United States)

    Wan Jusoh, Wan Noor Hazlina; Ahmad, Suraya

    2016-01-01

    Purpose: The purpose of this study is to explore the use of iMindMap software as an interactive tool in the teaching and learning method and also to be able to consider iMindMap as an alternative instrument in achieving the ultimate learning outcome. Design/Methodology/Approach: Out of 268 students of the management accounting at the University of…

  3. Estrogen Metabolism and Prostate Cancer Risk: A Prospective Study

    Science.gov (United States)

    2008-05-01

    Completed bio -assay determinations. • Report completed. • Paper with final results submitted. REPORTABLE OUTCOMES Results We observed...drugs and pancreatic cancer risk for different exposure categories. Aliment Pharm & Therapy 2007 Oct;26(8): 1089-99 11 12) Akl EA, Rohilla S

  4. Elimination of edge effects in micro-thermal field-flow fractionation channel of low aspect ratio by splitting the carrier liquid flow into the main central stream and the thin stream layers at the side channel walls

    Czech Academy of Sciences Publication Activity Database

    Janča, J.; Dupák, Jan

    2005-01-01

    Roč. 1068, č. 2 (2005), s. 261-268 ISSN 0021-9673 Institutional research plan: CEZ:AV0Z20650511 Keywords : Micro-thermal field-flow fractionation * Edge effects * Inlet and outlet hydrodynamic splitting * New injection mode Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.096, year: 2005

  5. Effects of housing system (outdoor vs cages) and age of laying hens on egg characteristics

    NARCIS (Netherlands)

    Brand, van den H.; Parmentier, H.K.; Kemp, B.

    2004-01-01

    1. Effects of two housing systems (cages vs outdoor) on external and internal egg characteristics were investigated. 2. In total 785 eggs from three different lines in cages and 268 eggs from outdoor-housed layers were examined for egg weight, albumen, yolk and shell content, albumen height and pH,

  6. Growth responses of NaCl stressed rice (Oryza sativa L.) plants ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-27

    Sep 27, 2010 ... Mirza RA, Mahmood K (1986). Comparative effect of sodium chloride and sodium bicarbonate on germination, growth and ion accumu- lation in Phaseolus aureus, Roxb, c.v. 6601. Biologia. 32: 257-268. Montgomery R (1961). Further studies of the phenol sulphuric acid reagent for carbohydrates, Biochem.

  7. Attitudes toward the Homeless: A U.S.-Japan Comparison.

    Science.gov (United States)

    Guzewicz, Tony D.; Takooshian, Harold

    1993-01-01

    Compares attitudes toward the homeless in Japan and the United States through a survey of 268 Japanese and 254 U.S. adults and adolescents interviewed in public places. In Japan, homelessness is seldom discussed, and poverty, which may be as widespread as in the United States, is often not recognized. (SLD)

  8. Zur Beteiligung des Bundestages an gemischten völkerrechtlichen Abkommen. Internationale Freihandelsabkommen als Herausforderung des deutschen Europa- und Außenverfassungsrechts / Bernd Grzeszick, Juliane Hettche

    Index Scriptorium Estoniae

    Grzeszick, Bernd

    2016-01-01

    Jagatud pädevusest ELi kaubanduspoliitikas ja liikmesriigi parlamentide osalusest rahvusvaheliste vabakaubanduslepingute sõlmimisel Saksamaa näitel (põhiseaduse artiklite 23 lg 2 ja 59 lg 2 tõlgendamine ning konstitutsioonikohtu hinnang). Kokkuvõte inglise keeles. Samal teemal artikkel ka lk. 268-282.

  9. Meteoritics, Number 19

    Science.gov (United States)

    1964-06-01

    Complete Characteristics of the System for Minerals). Dresden, Arnold Schen Buchhandlung, 223-224, 1823. 9. Cleyton, P. A. and Spencer, L. J., Silica... Gesell . Wiss. Abh., Jahrb., 265- 268, 1787. Prague und Dresden, 1788. 24. Lindaker, J. Th., Einige Nachtrage und Zusatze zu den bohmischen Topasen und...Chrysolithen: Sammlung physikalischer Aufsatze, besonder die bohmische Naturgeschichte betreffend von einer Gesel - lschaft bohmischer Naturforscher

  10. Prognostic factors for weight loss over 1-year period in patients recently diagnosed with mild Alzheimer Disease

    DEFF Research Database (Denmark)

    Hansen, M.L.; Waldorff, F.B.; Waldemar, G.

    2011-01-01

    StudY. The patients were home-living patients with a clinical diagnosis, within the past 12 months, of probable AD or mixed AD; age =50 years; mini-mental state examination score =20; informed consent; and data available at 1-year follow-up. In total, 268 patients were included. We used a cut off of 4...

  11. AMSARA: Accession Medical Standards Analysis and Research Activity. Report of 2007 Attrition and Morbidity Data for 2006 Accessions

    Science.gov (United States)

    2008-08-04

    1.4 313 Disturbance of emotions specific to 302 1.1 99 0.6 childhood and adolescence 784 Headaches 268 1.0 121 0.8 696.1 Psoriasis , current or history...closely with epidemiologists at Walter Reed Army Institute of Research an the concept of a Military Medical Standard Analysis and Evaluation Data Set

  12. Photochemical CO2 reduction: Towards an artificial leaf?

    Czech Academy of Sciences Publication Activity Database

    Michl, Josef

    2011-01-01

    Roč. 3, č. 4 (2011), s. 268-269 ISSN 1755-4330 Institutional research plan: CEZ:AV0Z40550506 Keywords : photosynthesis * hydrogen donors * CO2 recycling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 20.524, year: 2011

  13. Ruthenium Complexes with Vinyl, Styryl, and Vinylpyrenyl Ligands: A Case of Non-Innocence in Organometallic Chemistry

    Czech Academy of Sciences Publication Activity Database

    Maurer, J.; Linseis, M.; Sarkar, B.; Schwederski, B.; Niemeyer, M.; Kaim, W.; Záliš, Stanislav; Anson, Ch.; Zabel, M.; Winter, R. F.

    2008-01-01

    Roč. 130, č. 1 (2008), s. 259-268 ISSN 0002-7863 R&D Projects: GA AV ČR 1ET400400413; GA MŠk OC 139 Institutional research plan: CEZ:AV0Z40400503 Keywords : ruthenium complexes * organometallic chemistry * vinyl Subject RIV: CG - Electrochemistry Impact factor: 8.091, year: 2008

  14. Philometra johnii sp nov (Nematoda, Philometridae), a new gonad-infecting philometrid from the sin croaker Johnius dussumieri (Cuvier) (Perciformes, Sciaenidae) from marine waters of Iraq

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 263-268 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * new species * marine fish * Johnius * Iraq * Arabian Gulf Subject RIV: EA - Cell Biology Impact factor: 0.965, year: 2013

  15. Znovu odkrytá nástěnná malba "Průvod a Klanění tří králů" v presbytáři kostela sv. Martina v Sedlčanech

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, M.; Popová, T.; Všetečková, Zuzana

    -, č. 23 (2016), s. 252-268 ISSN 1211-5169 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Middle Ages (about 1400) * wall painting * iconography Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. Stress-strain-temperature behavior due to B2-R-B19 ' transformation in NiTi polycrystals

    Czech Academy of Sciences Publication Activity Database

    Šittner, Petr; Novák, Václav; Lukáš, Petr; Landa, Michal

    2006-01-01

    Roč. 128, č. 3 (2006), s. 268-278 ISSN 0094-4289 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100520; CEZ:AV0Z20760514 Keywords : shape- memory alloy * situ neutron-diffraction * martensitic transformations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.239, year: 2006

  17. Area Handbook Series: Morocco: A Country Study,

    Science.gov (United States)

    1985-02-01

    alcohol . The Prophet enjoined his followers to convert the infidel to the true faith but specifically exempted the "People of the Book"-Jews and...261, 264. 268. 282 (table); consumoer goods. 166; customs Iran; 263, 276, 298. 3.53_360, 361 duties and other tariffs. 89, 163, 169, Iraql: 174, 228

  18. Tick-borne zoonotic pathogens in ticks feeding on the common nightingale including a novel strain of Rickettsia sp

    Czech Academy of Sciences Publication Activity Database

    Dubská, L.; Literák, I.; Kverek, P.; Roubalová, Eva; Kocianova, E.; Taragelova, V.

    2012-01-01

    Roč. 3, č. 4 (2012), s. 265-268 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : tick * Ixodes ricinus * Borrelia garinii * Anaplasma phagocytophilum * Rickettsia helvetica * Babesia sp. EU1 * Common nightingale Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.353, year: 2012 http://www.sciencedirect.com/science/article/pii/S1877959X12000556

  19. Lack of Association of OPRM1 and ABCB1 Single-Nucleotide Polymorphisms to Oxycodone Response in Postoperative Pain

    DEFF Research Database (Denmark)

    Zwisler, Stine T; Enggaard, Thomas P; Mikkelsen, Soeren

    2012-01-01

    Purpose: The aim of the study was to search for an association between the single-nucleotide polymorphisms A118G in OPRM1 and C3435T and G2677T/A in ABCB1 and the analgesic effect of intravenous oxycodone in postoperative pain. Methods: There were 268 patients with postoperative pain after, prima...

  20. Ahn and Son Afr J Tradit Complement Altern Med. (2014) 11(1):28 ...

    African Journals Online (AJOL)

    cadewumi

    2Dept. of Oriental Internal Medicine, Daejeon Oriental Hospital of Daejeon Univ., Daejeon 301-724, South Korea. *E-mail: .... J. Korean Acad. Community Health. Nurs., 20:259-268. 5. Vergari, F., Tibuzzi, A. and Basile. G. (2010). An overview of the functional food market: from marketing issues and commercial players to.

  1. 77 FR 60380 - Caribbean Fishery Management Council; Public Meeting

    Science.gov (United States)

    2012-10-03

    ... Caribbean Fishery Management Council's Scientific and Statistical Committee (SSC) will hold meetings. DATES... Fishery Management Council; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National... CONTACT: Caribbean Fishery Management Council, 268 Mu[ntilde]oz Rivera Avenue, Suite 1108, San Juan...

  2. A Typology of Behavior Problems in Preschool Children

    Science.gov (United States)

    Beg, Mohsan R.; Casey, Joseph E.; Saunders, Cory D.

    2007-01-01

    The purpose of this study was to produce a typology of behavior problems in preschool children. Distinct subtypes were identified through the use of cluster analytic techniques on data from the Behavior Assessment System for Children (BASC)--Parent Rating Scales. Analyses were based on archival data collected on a sample of 268 children, aged 2 to…

  3. Highly mutagenic PAHs occuring in the environment are potent inducers of Ah receptor-mediated responses in vitro

    Czech Academy of Sciences Publication Activity Database

    Machala, K.; Vondráček, Jan; Bláha, L.; Minksová, Kateřina; Cigánek, M.; Neča, J.

    2000-01-01

    Roč. 49, - (2000), s. 266-268 ISSN 1026-4892. [International Symposium on Halogenated Environmental Organic Pollutants & POPS /20./. Monterey, 13.08.2000-17.08.2000] R&D Projects: GA MŽP SI/340/2/00 Institutional research plan: CEZ:A17/98:Z5-004-9-ii Subject RIV: EH - Ecology, Behaviour

  4. Clinical evaluation of 3D/3D MRI-CBCT automatching on brain tumors for online patient setup verification - A step towards MRI-based treatment planning

    DEFF Research Database (Denmark)

    Buhl, Sune K.; Duun-Christensen, Anne Katrine; Kristensen, Brian H.

    2010-01-01

    experiment CT-CBCT and MRI-CBCT automatching resulted in similar results. A significant difference was observed only in the longitudinal direction where MRI-CBCT resulted in the best match (mean and standard deviations of 1.85 +/- 2.68 mm for CT and -0.05 +/- 2.55 mm for MRI). For the clinical experiment...

  5. The Constitutional Review Chamber of the Republic of Estonia : 3-4-1-5-01 decision of 3 March 2001 : review of the petition of Saare County Court to declare clause 25 (1) of Procedure for Privatisation of Land by Auction invalid

    Index Scriptorium Estoniae

    2001-01-01

    Riigikohtu lahendi 3-4-1-5-01 (Saare Maakohtu taotlus kontrollida Vabariigi Valitsuse 06. 11. 96. a. määrusega nr. 268 kinnitatud "Maa enampakkumisega erastamise korra" p. 25.1 vastavus seadusele ja põhiseadusele) tekst inglise keeles

  6. Revised occurrence of rodents from the tribe Praomyini (Muridae) in Zambia based on mitochondrial DNA analyses: implications for biogeography and conservation

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Mazoch, V.; Patzenhauerová, Hana; Mateke, C.; Zima Jr., J.; Šklíba, J.; Šumbera, R.

    2012-01-01

    Roč. 61, 3-4 (2012), s. 268-283 ISSN 0139-7893 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:68081766 Keywords : zoogeography * faunistics * mtDNA * Murinae * phylogeny * Rodentia * DNA barcoding Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  7. Screening ethnically diverse human embryonic stem cells identifies a chromosome 20 minimal amplicon conferring growth advantage

    Czech Academy of Sciences Publication Activity Database

    Amps, K.; Andrews, P.W.; Anyfantis, G.; Armstrong, L.; Avery, S.; Baharvand, H.; Baker, J.; Baker, D.; Munoz, M. N.; Beil, S.; Benvenisty, N.; Ben-Yosef, D.; Biancotti, J. C.; Bosman, A.; Brena, R. M.; Brison, D.; Caisander, G.; Camarasa, M. V.; Chen, J. M.; Chiao, E.; Choi, Y. M.; Choo, E.; Collins, D.; Colman, A.; Crook, J. M.; Daley, G. Q.; Dalton, A.; De Sousa, P. A.; Denning, C.; Downie, J.; Dvořák, P.; Hampl, Aleš

    2011-01-01

    Roč. 29, č. 12 (2011), s. 1132-1144 ISSN 1087-0156 Institutional research plan: CEZ:AV0Z50390703 Keywords : comparative genomic hybridization * copy number variation * human es cells Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 23.268, year: 2011

  8. Complete Schwarzschild\\'s planetary equation | Howusu | Journal of ...

    African Journals Online (AJOL)

    In this paper we derive the complete planetary equation from the Schwarzschild's equations of motion and compare it with the corresponding well-known planetary equation from the Schwarzchild's line element. Journal of the Nigerian Association of Mathematical Physics Vol. 8 2004: pp. 265-268 ...

  9. African Research Review

    African Journals Online (AJOL)

    Prof

    2016-03-18

    Retrieved on March 18, 2016 from www.freedictionary.htm. Green, J. E. (2010). Three on Schumpeter: Response to Mackie. Retrieved on March 3, 2016 from www.sas.upenn.edu/polisci/sites; http://ptx.sagepub.com/content/38/2/268. Merkel,W. et al. (2011). The Future of Representative Democracy. Cambridge: Cambridge.

  10. NEW POLYTHIOPHENES WITH OLIGO(OXYETHYLENE) SIDE ...

    African Journals Online (AJOL)

    USER

    , GC-MS. 23. Trans-α-Bergamotene. 1430. 2.68. RI, GC-MS. 24. Aromadendrene. 1438. 0.67. RI, GC-MS. 25. Pentadecane. 1498. 0.28. RI, GC-MS. 26 δ-Guaiene. 1500. 1.43. RI, GC-MS. 27. Nerolidol. 1566. 0.29. RI, GC-MS. 28. Heptadecane.

  11. graft-carbon nanotubes with LiNi0.5Mn1.5O4 and

    Indian Academy of Sciences (India)

    2Materials Technology Key Laboratory (Mtlab), Ho Chi Minh City University of Technology, Vietnam National. University, 268 Ly Thuong Kiet, District 10, Ho Chi Minh City, Vietnam. MS received 8 September 2015; accepted 14 March 2016. Abstract. The P3HT grafted on CNTs to form the P3HT-g-CNTs nanocomposites was ...

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 36; Issue 2. Issue front cover thumbnail. Volume 36, Issue 2. June 2015, pages 255-334. pp 255-268. Modeling the Emission from Turbulent Relativistic Jets in Active Galactic Nuclei · Victoria Calafut Paul J. Wiita · More Details Abstract ...

  13. Policy Implication of the Awareness and Use of Biotechnology ...

    African Journals Online (AJOL)

    Madukwe

    was observed that genetically modified cassava variety is the most used biotech product in the study area as it scored a mean of 3.25 followed by biotech maize and tree crops which scored means of 2.68 and 2.67 respectively. It was also revealed that genetically modified cassava varieties was the most available biotech ...

  14. Snooping in Romantic Relationships

    Science.gov (United States)

    Derby, Kelly; Knox, David; Easterling, Beth

    2012-01-01

    A 42 item Internet questionnaire was completed by 268 undergraduates at a large southeastern university to assess the frequency, motivations, and outcome of snooping in romantic relationships. Almost two thirds (66%) reported that they had engaged in snooping behavior, most often when the partner was taking a shower. Primary motives were…

  15. Narrow Viewing: The Vocabulary in Related Television Programs

    Science.gov (United States)

    Rodgers, Michael P. H.; Webb, Stuart

    2011-01-01

    In this study, the scripts of 288 television episodes were analyzed to determine the extent to which vocabulary reoccurs in related and unrelated television programs, and the potential for incidental vocabulary learning through watching one season (approximately 24 episodes) of television programs. The scripts consisted of 1,330,268 running words…

  16. 76 FR 55357 - Floor-Standing, Metal-Top Ironing Tables and Certain Parts Thereof From the People's Republic of...

    Science.gov (United States)

    2011-09-07

    ... Thereof, Finished and Unfinished, From the People's Republic of China; Final Results of Antidumping Duty... Shakeproof Assembly Components, Div. of Ill. Tool Works, Inc. v. United States, 268 F. 3d 1376, 1382-1383...) expenses, and profit the Department used the audited 2009 financial statements of PT Lion Metal Works Tbk...

  17. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... University (NEOMED) 24,803 views 5:39 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society 4,268 views 3:29 Little Stars – ... views 3:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,558 views 5: ...

  18. Panna Marie Příborská. Studie k lokálnímu mariánskému kultu

    Czech Academy of Sciences Publication Activity Database

    Císaríková, Klára; Maňas, V.

    2008-01-01

    Roč. 60, č. 3 (2008), s. 255-268 ISSN 0323-2581 Institutional research plan: CEZ:AV0Z90580513 Keywords : the Virgin Mary * the pilgrim place * Příbor Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Abortion at Gondar College Hospital, Ethiopia | Yusuf | East African ...

    African Journals Online (AJOL)

    Abortion at Gondar College Hospital, Ethiopia. L. Yusuf, Z. A. Zein. Abstract. (East African Medical Journal: 2001 78(5): 265-268). Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/eamj.v78i5.9052 · AJOL African Journals Online.

  20. PFP Commercial Grade Food Pack Cans for Plutonium Handling and Storage Critical Characteristics

    International Nuclear Information System (INIS)

    BONADIE, E.P.

    1999-01-01

    This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for PFP's Vault Operations system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to perform its safety function

  1. Zidovudine-cyclodextrin inclusion complex and its permeability ...

    African Journals Online (AJOL)

    The permeability of zidovudine in zidovudine-cyclodextrin inclusion complex across stomach and intestinal compartments of rat was investigated spectrophotometrically. The absorption maximum ( ) for zidovudine in HCl max buffer (pH 1.2) and in phosphate buffer (pH 7.4) were 267 and 268 nm respectively. The inclusion ...

  2. Children, ethics, and modern medicine

    National Research Council Canada - National Science Library

    Miller, Richard B

    2003-01-01

    ... 220 11. Ethical Issues in Pediatric Research 238 :     ⁄ 275  ⁄ 301 268 AcknowledgmentsACKNOWLEDGMENTS The remotest origin...

  3. Predicting Autism in High-Risk Infants

    Science.gov (United States)

    ... main content NIH MedlinePlus the Magazine NIH MedlinePlus Salud Download the Current Issue PDF [2.68 mb] ... Human Development (NICHD) and the National Institute of Mental Health (NIMH). Using fMRI technology, the researchers scanned ...

  4. Zkoumání vlivu různého procentního plnění nanočásticemi na elektrické vlastnosti epoxidové pryskyřice

    Czech Academy of Sciences Publication Activity Database

    Hudec, Jiří; Neděla, Vilém; Polsterová, H.

    2015-01-01

    Roč. 60, č. 9 (2015), s. 268-271 ISSN 0447-6441 R&D Projects: GA ČR(CZ) GA14-22777S; GA MŠk ED0017/01/01; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : epoxy resin * nanoparticles * oxides * spectral analysis * SEM Subject RIV: BH - Optics, Masers, Lasers

  5. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Issue front cover thumbnail Issue back cover thumbnail. Volume 10, Issue 12. December 2005, pages 1-268. World Year of Physics - 2005. pp 1-3 Editorial. Editorial · T V Ramakrishnan · More Details Fulltext PDF. pp 4-5 Table of Contents.

  6. Different expression of some molecular markers in sporadic cancer of the left and right colon

    Czech Academy of Sciences Publication Activity Database

    Frič, P.; Sovová, Vlasta; Šloncová, Eva; Lojda, Z.; Jirásek, A.; Čermák, J.

    Roč. 9, č. 4 ( 2000 ), s. 265-268 ISSN 0959-8278 R&D Projects: GA ČR GA312/97/1188; GA AV ČR KSK2039602 Institutional research plan: CEZ:AV0Z5052915 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.351, year: 2000

  7. Changing strategies of the retrograde approach for chronic total occlusion during the past 7 years

    NARCIS (Netherlands)

    Muramatsu, Toshiya; Tsukahara, Reiko; Ito, Yoshiaki; Ishimori, Hiroshi; Park, Seung-Jung; de Winter, Robert; Shokry, Khaled; Wang, Lefeng; Chen, Jiyan; Wang, Haichang

    2013-01-01

    We reviewed the technical changes and results achieved with the retrograde approach since we introduced it 7 years ago. The subjects were 1,268 patients who were treated for CTO between January 2004 and December 2010. They were investigated with respect to the success rate, the frequency of

  8. Invasion science: looking forward rather than revisiting old ground – a reply to Zenni et al

    Czech Academy of Sciences Publication Activity Database

    Ricciardi, A.; Blackburn, T. M.; Carlton, J. T.; Dick, J. T. A.; Hulme, P. E.; Iacarella, J. C.; Jeschke, J.M.; Liebhold, A. M.; Lockwood, J. L.; MacIsaac, H. J.; Pyšek, Petr; Richardson, D. M.; Ruiz, G. M.; Simberloff, D.; Sutherland, W. J.; Wardle, D. A.; Aldridge, D.

    2017-01-01

    Roč. 32, č. 11 (2017), s. 809-810 ISSN 0169-5347 Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : invasion * impact * prediction Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 15.268, year: 2016

  9. 33 CFR 117.823 - Cape Fear River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Fear River. 117.823 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.823 Cape Fear River. The draw of the Cape Fear Memorial Bridge, mile 26.8, at Wilmington need not open for the passage of vessel from 8...

  10. Intrinsically passive control using sampled data system passivity

    NARCIS (Netherlands)

    Stramigioli, Stefano; Barbagli, F.; Prattichizzo, D.; Salisbury, K.

    In this chapter, which is a distilled version of [271], we present a novel way to approach the interconnection of a continuous and a discrete time physical system firstly presented in [270, 268, 257]. This is done in a way which preserves passivity of the coupled system independently of the sampling

  11. Frazzled by Facebook? An Exploratory Study of Gender Differences in Social Network Communication among Undergraduate Men and Women

    Science.gov (United States)

    Thompson, Sharon H.; Lougheed, Eric

    2012-01-01

    Although a majority of young adults are members of at least one social networking site, peer reviewed research examining gender differences in social networking communication is sparse. This study examined gender differences in social networking, particularly for Facebook use, among undergraduates. A survey was distributed to 268 college students…

  12. Cryoseston of the Pirin Mountains, Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Cepák, Vladislav; Lukavský, Jaromír

    2013-01-01

    Roč. 72, č. 2 (2013), s. 257-268 ISSN 0365-0588 R&D Projects: GA TA ČR TE01020080; GA TA ČR TA03011027 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlainomonas * Pirin * Bulgaria Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.449, year: 2013

  13. SELKIRK'S THEORY OF VERBAL COMPOUNDING: A CRITICAL ...

    African Journals Online (AJOL)

    (1981 :268) states that "an adverb should be impossible in the lefthand position of a verbal compound noun ..• ". Given an explicit and well-motivated distinction between Adjective and. Adverb, it may be argued that Selkirk's A N compounds of (16) in fact belong to two different structural types. On the one hand, there are.

  14. Applications of Strengths-Based Leadership Theory for the U.S. Army

    Science.gov (United States)

    2012-09-01

    practice: From research to application (pp. 256-268). New York: Wiley. 26 Kaplan, S., Cortina, J., Ruark, G. A., Orvis, K., Engel , K...job satisfaction and work climate. Journal of Nursing Management, 16, 578– 587. Shipman, A., Friedrich , T., Vessey, B., Connelly, S., Day, E

  15. Independent Curriculum Enrichment Studies: Learning Packages for the Gifted. Table of Contents; Teachers' Sheets.

    Science.gov (United States)

    Lafayette School District, CA.

    The looseleaf binder contains a series of 268 learning packages for gifted and talented elementary school students, divided into 13 subject area sections, including art, chess, general, health, language arts, literature, mathematics, perception, reading, science, social studies, study skills, and thinking skills. Two additional sections include…

  16. Epidemiologic and clinical aspects of varicocele among adolescent ...

    African Journals Online (AJOL)

    inguinal hernia, two had vaginal hydrocele, one had an epididymal cyst, and one suffered from cryptorchidism. Schoolboys with varicocele who were sexually mature. (n=142) represented 95.30% of the patients. Varicoceles were predominantly on the left side compared with the right side – 76.51 versus 2.68% (P=0.00) ...

  17. Peering into the black hole - the quality of black mortality data in Por ...

    African Journals Online (AJOL)

    1991-04-20

    Apr 20, 1991 ... Peering into the black hole - the quality of black mortality data in Por~ Elizabeth and the rest of South Africa. S. VAN DER MERWE, D. YACH, C. A. METCALF. -. Summary. In the year ending 30 June 1989, 26,8% of 5345 deaths in the. Port Elizabeth area were classified as ill-defined. A study was.

  18. An item response theory analysis of Harter's Self-Perception Profile for Children or why strong clinical scales should be distrusted

    NARCIS (Netherlands)

    Egberink, Iris J. L.; Meijer, Rob R.

    The authors investigated the psychometric properties of the subscales of the Self-Perception Profile for Children with item response theory (IRT) models using a sample of 611 children. Results from a nonparametric Mokken analysis and a parametric IRT approach for boys (n = 268) and girls (n = 343)

  19. An item response theory analysis of Harter’s self-perception profile for children or why strong clinical scales should be distrusted

    NARCIS (Netherlands)

    Egberink, I.J.L.; Meijer, R.R.

    2011-01-01

    The authors investigated the psychometric properties of the subscales of the Self-Perception Profile for Children with item response theory (IRT) models using a sample of 611 children. Results from a nonparametric Mokken analysis and a parametric IRT approach for boys (n = 268) and girls (n = 343)

  20. The Impact of Years of Teaching Experience on the Classroom Management Approaches of Elementary School Teachers

    Science.gov (United States)

    Unal, Zafer; Unal, Aslihan

    2012-01-01

    This study provided a basis for answering the following essential question: Does the years of experience affect teachers' classroom management approaches? Data were collected from 268 primary school teachers. The findings of this study demonstrated that experienced teachers are more likely to prefer to be in control in their classrooms than…

  1. Kasumi jaotamine aktsiaseltsis : [bakalaureusetöö] / Risto Vahimets ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Vahimets, Risto, 1974-

    1996-01-01

    Kasumijaotamise üldmõisted (viisid aktsiaseltsis, omakapitali mõisted, jaotised, dividendid, eelisaktsiad, mitterahaline vara, uute aktsiate jagamine, reservfond, varjatud kasumijaotamine); kasumijaotamise reeglid Euroopa Liidus; Eesti äriseadustik ja Euroopa Liidu direktiivid; kasumijaotamine Soome Vabariigis. Vt. ka: Juridica (1996) nr. 6, lk. 266-268

  2. 78 FR 32110 - Cranes and Derricks in Construction: Revising the Exemption for Digger Derricks

    Science.gov (United States)

    2013-05-29

    ... for all pole work in the electric-utility and telecommunications industries, including placing utility... objects other than poles; accordingly, electric utilities, telecommunication companies, and their... the OSHA standards governing electric-utility and telecommunications work at Sec. 1910.268...

  3. Exploring the Value of MBA Degrees: Students' Experiences in Full-Time, Part-Time, and Executive MBA Programs

    Science.gov (United States)

    Bruce, Grady D.

    2010-01-01

    Critics of the overall value of the MBA have not systematically considered the attitudes of MBA students about the value of their degree. The author used data from a large sample of graduates (N = 16,268) to do so, and to explore predictors of overall degree value. The author developed separate regression models for full-time, part-time, and…

  4. Optimizing hydraulic retention times in denitrifying woodchip bioreactors treating recirculating aquaculture system wastewater

    Science.gov (United States)

    The performance of wood-based denitrifying bioreactors to treat high-nitrate wastewaters from aquaculture systems has not previously been demonstrated. Four pilot-scale woodchip bioreactors (approximately 1:10 scale) were constructed and operated for 268 d to determine the optimal range of design hy...

  5. Hiking shared-use single-track trails: a look at hikers and hunters along the Falls Lake Trail

    Science.gov (United States)

    Christopher M. Snow; Roger L. Moore

    2007-01-01

    The Falls Lake Trail, a 26.8-mile, single-track pedestrian trail located near the Research Triangle Region of North Carolina, traverses lands managed by the United States Army Corps of Engineers; North Carolina Division of Parks and Recreation; North Carolina Division of Wildlife Resources; and Wake County Parks, Recreation and Open Space. The non-profit trail advocacy...

  6. Methods for Determination of Bioaccessibility and Bioavailability of Hydrophobic Organic Pollutants

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Cajthaml, Tomáš

    2015-01-01

    Roč. 109, č. 4 (2015), s. 254-268 ISSN 0009-2770 R&D Projects: GA TA ČR TE01020218; GA ČR GA13-28283S Institutional support: RVO:61388971 Keywords : bioremediation * bioaccumulation * environmental risk assessment Subject RIV: EE - Microbiology, Virology Impact factor: 0.279, year: 2015

  7. 175 original article bronchopulmonary tuberculosis

    African Journals Online (AJOL)

    Dr Oboro VO

    Also efforts should be made to ensure that all positive cases .... tuberculosis situation in some cities of the country such as Portharcourt .... countries were above the age of 50 (17, 25) . Of the 350 smear-positive patients, 235 were tested for HIV infection. 63 (26.8%) of these were positive. This agrees with the WHO estimate.

  8. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The photoluminescence properties of the synthesized molecules are influenced by peripheral amines. ... used hole transporters. Thermal studies also reveal that these synthesized molecules have good thermal stability with 5% and 10% weight loss temperature ranging from 200 to 355°C and 268 to 442°C, respectively.

  9. Suresh, Prof. Subra

    Indian Academy of Sciences (India)

    Date of birth: 30 May 1956. Address: President, Carnegie-Mellon University, 5000, Forbes Avenue, Pittsburgh, PA 15213, U.S.A.. Contact: Office: (_1-412) 268 2200. Email: president@cmu.edu. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th ...

  10. Caesarean Delivery: Why The Aversion? | Ezechi | Tropical Journal ...

    African Journals Online (AJOL)

    While only 28.9% will accept caesarean section on doctor\\'s advice, 71.1% will not accept caesarean delivery for any reason. 26.8% of the patients that have had previous caesarean section prefer to die while attempting vaginal delivery than to have a repeat caesarean section. Reasons for refusing caesarean section were ...

  11. Vplyv postihnutia na copingové stratégie a osobnostnú štruktúru rannej adolescencie

    Czech Academy of Sciences Publication Activity Database

    Karaffová, Eva

    2009-01-01

    Roč. 44, č. 3 (2009), s. 253-268 ISSN 0555-5574 R&D Projects: GA ČR GA406/09/2096 Institutional research plan: CEZ:AV0Z70250504 Keywords : coping strategies * personality factors * physical disability * early adolescence Subject RIV: AN - Psychology

  12. Separating the wheat from the chaff: Dating charred plant remains extracted from Daub (with reference to the 14C chronology of the Epi-Lengyel culture in Upper Silesia)

    Czech Academy of Sciences Publication Activity Database

    Chmielewski, T. J.; Sady, A.; Goslar, T.; Furmanek, M.; Juchelka, Jiří

    2017-01-01

    Roč. 59, č. 1 (2017), s. 251-268 ISSN 0033-8222 Institutional support: RVO:68081758 Keywords : food residue * dates * pottery * bones * ams * radiocarbon AMS dating * chaff temper dating * Eneolithic * epi-Lengyel * Upper Silesia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.280, year: 2016

  13. Qualitative analysis of trapped Dirac fermions in graphene

    Czech Academy of Sciences Publication Activity Database

    Jakubský, Vít; Krejčiřík, David

    2014-01-01

    Roč. 349, OCT (2014), s. 268-287 ISSN 0003-4916 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : graphene * Dirac fermion * confinement * Varitional principle Subject RIV: BE - Theoretical Physics Impact factor: 2.103, year: 2014

  14. Isect silk contains both a Kunitz-type and a unique Kazal-type proteinase inhibitor

    Czech Academy of Sciences Publication Activity Database

    Nirmala, Xavier; Kodrík, Dalibor; Žurovec, Michal; Sehnal, František

    2001-01-01

    Roč. 268, - (2001), s. 2064-2073 ISSN 0014-2956 R&D Projects: GA ČR GA204/00/0019; GA MŠk ME 204 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: CE - Biochemistry Impact factor: 2.849, year: 2001

  15. Formulation and Release Characteristics of Zidovudine- Loaded ...

    African Journals Online (AJOL)

    novel microencapsulating material for ibuprofen and diltiazem hydrochloride. Indian J. Pharm. Sci. 2007; 67: 263–268. 15. Doktorovova S, Souto EB. Nanostructured lipid carrier- based hydrogel formulations for drug delivery: A comprehensive review. Expert Opin Drug Deliv. 2009; 6: 165–176. 16. Higuchi T. Mechanism of ...

  16. Thoracic wall lipoblastoma: a rare case with rare presentation

    African Journals Online (AJOL)

    Sama Savli Road, 390024 Vadodara, Gujarat. Tel: +919879609195; e-mail: muleyprasad@yahoo.com. Received 14 December 2011 accepted 16 January .... lipoblastoma involving the right common iliac artery and vein. Eur J Pediatr. Surg 2003; 13:268–271. 6 Lorenzen JC, Godballe C, Kerndrup GB. Lipoblastoma of the ...

  17. Oral Pemphigus Vulgaris

    African Journals Online (AJOL)

    GB

    2015-10-04

    Oct 4, 2015 ... Mt Sinai J Med 2001;. 68(4-5):268–78. 17. Toth GG, Jonkman MF. Therapy of pemphigus. Clin Dermatol 2001;19(6):761–7. 18. Lever WF, Schaumburg-Lever G. Treatment of pemphigus vulgaris. Results obtained in 84 patients between 1961 and 1982. Arch. Dermatol 1984;120(1):44–7.

  18. Coarse fraction components in a red-clay sedimemt core, Central Indian Ocean Basin: Their occurrence and significance

    Digital Repository Service at National Institute of Oceanography (India)

    Iyer, S.D.; Fernandes, G.Q.; Mahender, K.

    Coarse Fractions Components of a sediment core (268 cm from a water depth of 5120 m) collected at 18 degrees S and 80 degrees E from the red clay domain in the Central Indian Ocean Basin (CIOB), comprises mineral grains, basaltic fragments...

  19. Mining and Visualizing Research Networks using the Artefact-Actor-Network Approach

    NARCIS (Netherlands)

    Reinhardt, Wolfgang; Wilke, Adrian; Moi, Matthias; Drachsler, Hendrik; Sloep, Peter

    2012-01-01

    Reinhardt, W., Wilke, A., Moi, M., Drachsler, H., & Sloep, P. B. (2012). Mining and Visualizing Research Networks using the Artefact-Actor-Network Approach. In A. Abraham (Ed.), Computational Social Networks. Mining and Visualization (pp. 233-268). Springer. Also available at

  20. Connective Tissue Growth Factor (CTGF) as a Regulator of Lactogenic Differentiation

    Science.gov (United States)

    2009-06-09

    Stat5 in lactogenesis Originally identified in the sheep mammary gland as mammary gland factor (MGF) (268), Stat5 is the primary transcription factor...a failure of the embryo to induce the expression of bone specific matrix proteins such as aggrecan, as well as a failure of chondrocyte

  1. Ecological restoration of central European mining sites: a summary of a multi-site analysis

    Czech Academy of Sciences Publication Activity Database

    Prach, Karel; Řehounková, Klára; Řehounek, J.; Konvalinková, Petra

    2011-01-01

    Roč. 36, č. 2 (2011), 263-268 ISSN 0142-6397 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60050516 Keywords : ecological restoration * mining * succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.677, year: 2011

  2. Violence in Brazil and Its Connection with Transnational Crime

    Science.gov (United States)

    2003-04-07

    point for illicit drugs but now it is the world’s second-largest consumer of cocaine after the United States. 33 MERCOSUL, Mercado Comum do Cone Sul... Estudios Internacionales AAL 098 (16 October 2002): 2. 40 Ibid., 3. 41 Burton, 27. 42 Almanaque Abril (São Paulo, SP: Editora Abril, 2002), 268. 43

  3. NMDA and dopamine D1 receptors within NAc-shell regulate IEG proteins expression in reward circuit during cocaine memory reconsolidation.

    Science.gov (United States)

    Li, Y; Ge, S; Li, N; Chen, L; Zhang, S; Wang, J; Wu, H; Wang, X; Wang, X

    2016-02-19

    Reactivation of consolidated memory initiates a memory reconsolidation process, during which the reactivated memory is susceptible to strengthening, weakening or updating. Therefore, effective interference with the memory reconsolidation process is expected to be an important treatment for drug addiction. The nucleus accumbens (NAc) has been well recognized as a pathway component that can prevent drug relapse, although the mechanism underlying this function is poorly understood. We aimed to clarify the regulatory role of the NAc in the cocaine memory reconsolidation process, by examining the effect of applying different pharmacological interventions to the NAc on Zif 268 and Fos B expression in the entire reward circuit after cocaine memory reactivation. Through the cocaine-induced conditioned place preference (CPP) model, immunohistochemical and immunofluorescence staining for Zif 268 and Fos B were used to explore the functional activated brain nuclei after cocaine memory reactivation. Our results showed that the expression of Zif 268 and Fos B was commonly increased in the medial prefrontal cortex (mPFC), the infralimbic cortex (IL), the NAc-core, the NAc-shell, the hippocampus (CA1, CA2, and CA3 subregions), the amygdala, the ventral tegmental area (VTA), and the supramammillary nucleus (SuM) following memory reconsolidation, and Zif 268/Fos B co-expression was commonly observed (for Zif 268: 51-68%; for Fos B: 52-66%). Further, bilateral NAc-shell infusion of MK 801 and SCH 23390, but not raclopride or propranolol, prior to addictive memory reconsolidation, decreased Zif 268 and Fos B expression in the entire reward circuit, except for the amygdala, and effectively disturbed subsequent CPP-related behavior. In summary, N-methyl-d-aspartate (NMDA) and dopamine D1 receptors, but not dopamine D2 or β adrenergic receptors, within the NAc-shell, may regulate Zif 268 and Fos B expression in most brain nuclei of the reward circuit after cocaine memory reactivation

  4. HLA-A2-restricted cytotoxic T lymphocyte epitopes from human hepsin as novel targets for prostate cancer immunotherapy.

    Science.gov (United States)

    Guo, J; Li, G; Tang, J; Cao, X-B; Zhou, Q-Y; Fan, Z-J; Zhu, B; Pan, X-H

    2013-09-01

    Hepsin is a type II transmembrane serine protease that is overexpressed in prostate cancer, and it is associated with prostate cancer cellular migration and invasion. Therefore, HPN is a biomarker for prostate cancer. CD8(+) T cells play an important role in tumour immunity. This study predicted and identified HLA-A2-restricted cytotoxic T lymphocyte (CTL) epitopes in human hepsin protein. HLA-A2-restricted CTL epitopes were identified using the following four-step procedure: (1) a computer program generated predicted epitopes from the amino acid sequence of human hepsin; (2) an HLA-A2-binding assay detected the affinity of the predicted epitopes to the HLA-A2 molecule; (3) the primary T cell response against the predicted epitopes was stimulated in vitro; and (4) the induced CTLs towards different types of hepsin- or HLA-A2-expressing prostate cancer cells were detected. Five candidate peptides were identified. The effectors that were induced by human hepsin epitopes containing residues 229 to 237 (Hpn229; GLQLGVQAV), 268 to 276 (Hpn268; PLTEYIQPV) and 191 to 199 (Hpn199; SLLSGDWVL) effectively lysed LNCaP prostate cancer cells that were hepsin-positive and HLA-A2 matched. These peptide-specific CTLs did not lyse normal liver cells with low hepsin levels. Hpn229, Hpn268 and Hpn199 increased the frequency of IFN-γ-producing T cells compared with the negative peptide. These results suggest that the Hpn229, Hpn268 and Hpn199 epitopes are novel HLA-A2-restricted CTL epitopes that are capable of inducing hepsin-specific CTLs in vitro. Hpn229, Hpn268 and Hpn199 peptide-based vaccines may be useful for immunotherapy in patients with prostate cancer. © 2013 John Wiley & Sons Ltd.

  5. Dicty_cDB: VHB772 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB772 (Link to dictyBase) - - - Contig-U15043-1 VHB772P (Link to Original site) VHB...772F 580 VHB772Z 774 VHB772P 1334 - - Show VHB772 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB7-C/VHB772Q.Seq.d/ Representative seq. ID VHB...772P (Link to Original site) Representative DNA sequence >VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB...alignments: (bits) Value VHB772 (VHB772Q) /CSM/VH/VHB7-C/VHB772Q.Seq.d/ 1675 0.0 VFD268 (VFD268Q) /CSM/VF/VF

  6. Rational design of Bacillus stearothermophilus US100 L-arabinose isomerase: potential applications for D-tagatose production.

    Science.gov (United States)

    Rhimi, Moez; Aghajari, Nushin; Juy, Michel; Chouayekh, Hichem; Maguin, Emmanuelle; Haser, Richard; Bejar, Samir

    2009-05-01

    L-arabinose isomerases catalyze the bioconversion of D-galactose into D-tagatose. With the aim of producing an enzyme optimized for D-tagatose production, three Bacillus stearothermophilus US100 L-arabinose isomerase mutants were constructed, purified and characterized. Our results indicate that mutant Q268K was significantly more acidotolerant and more stable at acidic pH than the wild-type enzyme. The N175H mutant has a broad optimal temperature range from 50 to 65 degrees C. With the aim of constructing an acidotolerant mutant working at relatively low temperatures we generated the Q268K/N175H construct. This double mutant displays an optimal pH in the range 6.0-7.0 and an optimal activity around 50-65 degrees C, temperatures at which the enzyme was stable without addition of metal ions.

  7. Plutonium Finishing Plant (PFP) Criticality Alarm System Commercial Grade Item (CGI) Critical Characteristics

    International Nuclear Information System (INIS)

    WHITE, W.F.

    1999-01-01

    This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for PFP's criticality alarm system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to properly perform its safety function. There may be several manufacturers or models that meet the critical characteristics for any one item. PFP's Criticality Alarm System includes the nine criticality alarm system panels and their associated hardware. This includes all parts up to the first breaker in the electrical distribution system. Specific system boundaries and justifications are contained in HNF-SD-CP-SDD-003, ''Definition and Means of Maintaining the Criticality Detectors and Alarms Portion of the PFP Safety Envelope.'' The procurement requirements associated with the system necessitates procurement of some system equipment as Commercial Grade Items in accordance with HNF-PRO-268, ''Control of Purchased Items and Services.''

  8. PCB i bygninger - afhjælpning, renovering og nedrivning

    DEFF Research Database (Denmark)

    Andersen, Helle Vibeke

    SBi-anvisning 268 beskriver, hvordan PCB-forurening af indeluften afhjælpes, og hvordan PCB håndteres, når man renoverer eller nedriver bygninger med PCB. Uanset om der er tale om afhjælpning, renovering eller nedrivning, kan arbejdet generere PCB-holdigt affald. Anvisningen forklarer derfor......, hvordan affaldet skal håndteres, og hvordan man beskytter mennesker og miljø under arbejdet. Anvisningen er baseret på byggebranchens erfaringer og den aktuelle forskningsbaserede viden om PCB i bygninger. SBi-anvisning 268 afløser den snart fire år gamle SBi-anvisning 242 om renovering af bygninger med...... PCB, som ikke behandlede spørgsmålet om affaldshåndtering....

  9. Pressure-induced phase transition in C sub 6 O sub 2 I sub 4

    CERN Document Server

    Nakayama, A; Takemura, K; Aoki, K; Carlon, R P

    2002-01-01

    Powder x-ray diffraction measurements on iodanil (C sub 6 O sub 2 I sub 4) have been carried out at pressures up to 39 GPa at room temperature with a diamond-anvil cell under the best hydrostatic conditions using helium as the pressure-transmitting medium. The diffraction patterns up to 23.3 GPa were fitted with a space group P 2 sub 1 /c. New peaks appeared above 26.8 GPa and their intensities increased with increasing pressure while the original ones observed for the low-pressure phase were gradually depressed. This phase transition was accompanied with a mixed state of low- and high-pressure phases over the wide pressure range between 26.8 and at least 39 GPa.

  10. Hyaluronidase-inhibitory activities of glycosaminoglycans from Liparis tessellatus eggs

    DEFF Research Database (Denmark)

    Ticar, Bernadeth F.; Rohmah, Zuliyati; Mussatto, Solange Ines

    2017-01-01

    Polysaccharide fractions isolated from L. tessellatus eggs were purified and eluted using the DEAE-sepharose fast flow column. These were collected, tested and pooled based on their sugars content: F1, F2, and F3 which contain 26.8, 23.3, and 20.2% sulfated glycans; 34.5, 38.2, and 45.0% uronic a...... the presence of uronic acids on F3, which could be a 0,2A2 fragment plus loss of methyl group which is very common among nonmethylated, sulfated disaccharides.......Polysaccharide fractions isolated from L. tessellatus eggs were purified and eluted using the DEAE-sepharose fast flow column. These were collected, tested and pooled based on their sugars content: F1, F2, and F3 which contain 26.8, 23.3, and 20.2% sulfated glycans; 34.5, 38.2, and 45.0% uronic...

  11. Effect of Anti-inflammatory Treatment on Depression, Depressive Symptoms, and Adverse Effects

    DEFF Research Database (Denmark)

    Köhler, Karl Ole; Benros, Michael E; Nordentoft, Merete

    2014-01-01

    -controlled trials assessing the efficacy and adverse effects of pharmacologic anti-inflammatory treatment in adults with depressive symptoms, including those who fulfilled the criteria for depression. DATA EXTRACTION AND SYNTHESIS: Data were extracted by 2 independent reviewers. Pooled standard mean difference (SMD...... investigated cytokine inhibitors (n=2,004). The pooled effect estimate suggested that anti-inflammatory treatment reduced depressive symptoms (SMD, -0.34; 95% CI, -0.57 to -0.11; I2=90%) compared with placebo. This effect was observed in studies including patients with depression (SMD, -0.54; 95% CI, -1.......08 to -0.01; I2=68%) and depressive symptoms (SMD, -0.27; 95% CI, -0.53 to -0.01; I2=68%). The heterogeneity of the studies was not explained by differences in inclusion of clinical depression vs depressive symptoms or use of NSAIDs vs cytokine inhibitors. Subanalyses emphasized the antidepressant...

  12. Polymer composites with plasmonic metal nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Dammer, Ondřej; Vlčková, B.; Podhájecká, Klára; Procházka, M.; Pfleger, Jiří

    2008-01-01

    Roč. 268, č. 1 (2008), s. 91-95 ISSN 1022-1360. [Microsymposium on Advanced Polymer Materials for Photonics and Electronics /47./. Prague, 15.07.2007-19.07.2007] R&D Projects: GA AV ČR IAA4050406 Institutional research plan: CEZ:AV0Z40500505 Keywords : metal nanoparticles * nanocomposites * .pi.-conjugated polymers Subject RIV: CD - Macromolecular Chemistry

  13. Japan as a Paradigm for U.S. Homeland Security

    Science.gov (United States)

    2006-12-01

    aviation industry and offers rewards to those who support efforts to combat international terrorism against U.S. citizens or U.S. property. These...upon Huffman Aviation in Venice, Florida and started training. Jarrah obtained his single-engine private pilot certificate in early August, while Atta...and Britain. The FBO 55 National Commission on Terrorist Attacks upon the United States, 268–69

  14. The Reaction of Cyanoacetylhydrazine with ω-Bromo(4-methylacetophenone: Synthesis of Heterocyclic Derivatives with Antitumor Activity

    Directory of Open Access Journals (Sweden)

    Rafat M. Mohareb

    2010-05-01

    Full Text Available New approaches for the synthesis of hydrazide-hydrazone derivatives were demonstrated as well as some heterocyclizations of such derivatives to afford 1,3,4-triazine, pyridine and 1,3,4-oxadiazine derivatives. The antitumor evaluation of the newly synthesized products against three cancer cell lines, namely breast adenocarcinoma (MCF-7, non-small cell lung cancer (NCI-H460 and CNS cancer (SF-268 were recorded. Most of the synthesized compounds showed high inhibitory effects.

  15. Novel Synthesis of Hydrazide-Hydrazone Derivatives and Their Utilization in the Synthesis of Coumarin, Pyridine, Thiazole and Thiophene Derivatives with Antitumor Activity

    Directory of Open Access Journals (Sweden)

    Rafat M. Mohareb

    2010-12-01

    Full Text Available The reaction of cyanoacetyl hydrazine (1 with 3-acetylpyridine (2 gave the hydrazide-hydrazone derivative 3. The latter compound undergoes a series of heterocyclization reactions to give new heterocyclic compounds. The antitumor evaluation of the newly synthesized products against three cancer cell lines, namely breast adenocarcinoma (MCF-7, non-small cell lung cancer (NCI-H460 and CNS cancer (SF-268 was performed. Most of the synthesized compounds showed high inhibitory effects.

  16. Novel Synthesis of Hydrazide-Hydrazone Derivatives and Their Utilization in the Synthesis of Coumarin, Pyridine, Thiazole and Thiophene Derivatives with Antitumor Activity

    OpenAIRE

    Rafat M. Mohareb; Ola K. Sakka; Daisy H. Fleita

    2010-01-01

    The reaction of cyanoacetyl hydrazine (1) with 3-acetylpyridine (2) gave the hydrazide-hydrazone derivative 3. The latter compound undergoes a series of heterocyclization reactions to give new heterocyclic compounds. The antitumor evaluation of the newly synthesized products against three cancer cell lines, namely breast adenocarcinoma (MCF-7), non-small cell lung cancer (NCI-H460) and CNS cancer (SF-268) was performed. Most of the synthesized compounds showed high inhibitory effects.

  17. Novel synthesis of hydrazide-hydrazone derivatives and their utilization in the synthesis of coumarin, pyridine, thiazole and thiophene derivatives with antitumor activity.

    Science.gov (United States)

    Mohareb, Rafat M; Fleita, Daisy H; Sakka, Ola K

    2010-12-23

    The reaction of cyanoacetyl hydrazine (1) with 3-acetylpyridine (2) gave the hydrazide-hydrazone derivative 3. The latter compound undergoes a series of heterocyclization reactions to give new heterocyclic compounds. The antitumor evaluation of the newly synthesized products against three cancer cell lines, namely breast adenocarcinoma (MCF-7), non-small cell lung cancer (NCI-H460) and CNS cancer (SF-268) was performed. Most of the synthesized compounds showed high inhibitory effects.

  18. Long time behavior and stabilization to equilibria of solutions to the Navier–Stokes–Fourier system driven by highly oscillating unbounded external forces

    Czech Academy of Sciences Publication Activity Database

    Bella, P.; Feireisl, Eduard; Pražák, D.

    2013-01-01

    Roč. 25, č. 2 (2013), s. 257-268 ISSN 1040-7294 R&D Projects: GA ČR GA201/09/0917 Institutional research plan: CEZ:AV0Z10190503 Keywords : full Navier-Stokes-Fourier system * long time behavior * oscillatory forces Subject RIV: BA - General Mathematics Impact factor: 1.000, year: 2013 http://link.springer.com/article/10.1007%2Fs10884-013-9299-0

  19. Food items and general condition of Hyperopisus bebe occidentalis ...

    African Journals Online (AJOL)

    GREG

    co-efficient 'b' was (2.68) for males and 1.76 for females. Both values were less than 3 implying that the fish increased more in total ... Delta region. It takes its source about 10 km away from Utagba-Uno which lies North and East of the Equator within latitude 6° 0I N and longitude 5° 2I E (Figure 1). It covers a surface area of ...

  20. Clinical and Electrodiagnostic Abnormalities of the Median Nerve in US Army Dental Assistants at the Onset of Training

    Science.gov (United States)

    2012-01-01

    EMG studies). Data Management and Analysis Descriptive statistics for subject demographics and nerve conduction study variables were calculated using...having a history of neuropathic disease, renal disease, peripheral vascular disease, thyroid disease, or diabetes . Two subjects reported a history...median nerve sensitivity in practicing dental hygienists. J Dent Hyg. 1993;67(5):268-272. Corks I. Occupational health hazards in dentistry : 6

  1. Synthesis and structural characterization of Na 2 MnP 2 O 7 crystal

    Indian Academy of Sciences (India)

    Na2MnP2O7 crystals were synthesized by hydrothermal technique. Crystals obtained are in the form of single crystals of rhombohedral morphology with lattice parameters as follows: triclinic, 1 ¯ , = 0.71069 Å, = 6.657(3) Å, = 6.714(6) Å, = 6.518(4) Å, = 112.31(6)°, = 92.14(4)°, = 83.89(5)°, = 268.0(3) Å3, ...

  2. An overview of financial sources being utilized to support Zika Virus published research.

    Directory of Open Access Journals (Sweden)

    Keisha Goodridge

    Full Text Available Since its initial detection in Brazil in 2015, Zika Virus (ZIKV has spread rapidly throughout most of the Caribbean and South, Central and North America. An upsurge in congenital syndrome associated with ZIKV and Guillain-Barre Syndrome (GBS has been associated with the increase in ZIKV. This amplification in numbers led to the need for funded research initiatives focusing on various countries globally and on specific experimental types.To determine the financial institutions involved in the production of primary research into the ZIKV epidemic. This research also intends to draw attention to the investigative areas that are dominating, experimental types being conducted and the geographical areas that are producing the bulk of the research utilizing available funds.A cross sectional search of published primary research was conducted using Pan American Health Organization (PAHO Zika platform and PubMed between January 2007 and October 2016. Titles, abstract and full articles were assed and one researcher extracted data. Information was crossed checked by a second researcher to ensure accuracy.268 articles were included and investigations occurred across 48 countries with Brazil and USA dominating the research. Applied Research and Laboratory based studies were most frequently utilized. 38.1% of articles did not report financial sources. Public institutions were the major known contributors. Other financiers included private, non-profits and mixed funders exclusive of public sources. 156 individual financial bodies assisted with National Institute of Health being most frequently mentioned followed by The National Council for Scientific and Technological Development (CNPq and the Institut Pasteur. Virus, vectors and reservoirs was most frequently used (99/268, 36.9% followed by clinical management (70/268, 26.1% and epidemiology (46/268, 17.2%.The evidence suggests international efforts to fund ZIKV research and a need to foster collaborative and

  3. Factors Affecting Adoption of Educational Discipline and Satisfaction Level Among Higher Education Students

    OpenAIRE

    Irfan Raza

    2016-01-01

    This study examines the education career change behavior of male and female students. Factors like current trends, own preferences, parental pressure, and career counselors can influence their career adoption. Quantitative method research design was conducted for the study and a sample of 268 students was taken: 145 female and 123 male students, from different public and private universities of Islamabad. Purposive sampling technique was applied for selection as respondents were those who had...

  4. New fluorene-based conjugated copolymers bearing carboxylic groups

    Czech Academy of Sciences Publication Activity Database

    Kukla, Stanislav; Pavlačková, Petra; Cimrová, Věra; Výprachtický, Drahomír

    2008-01-01

    Roč. 268, č. 1 (2008), s. 53-56 ISSN 1022-1360. [Microsymposium on Advanced Polymer Materials for Photonics and Electronics /47./. Prague, 15.07.2007-19.07.2007] R&D Projects: GA AV ČR IAA4050409; GA MŠk(CZ) 1M06031 Institutional research plan: CEZ:AV0Z40500505 Keywords : aggregation * conjugated polymers * fluorene * luminescence * Suzuki coupling Subject RIV: BM - Solid Matter Physics ; Magnetism

  5. Health-enhancing? Products: development of yogurts containing ingredients with functional properties

    OpenAIRE

    Lemos, Edite Teixeira de; Guiné, Raquel; Ferreira, Ana C.; Aparício, Daniela; Marques, Hugo; Fonseca, Mariana; Loureiro, Sara

    2017-01-01

    INTRODUCTION The importance of yogurt as part of a balanced and healthy diet is recognized by regulatory authorities and scientific institutions in most countries. According to the Portuguese National Statistics Institute, there was an increase of 38% in the value of dairy sales in only four years. In addition, a study carried out by the Portuguese Society of Nutrition and Food Sciences reported that 26.8% of Portuguese adults consumed yogurts daily, ranging from 19% in the elderly to 35%...

  6. Preparedness for the Evaluation and Management of Mass Casualty Incidents Involving Anticholinesterase Compounds: A Survey of Emergency Department Directors in the 12 Largest Cities in the United States

    Science.gov (United States)

    2010-11-01

    weakness, and paralysis; and muscarinic receptor- mediated effects such as miosis, bronchospasm , hyper- peristalsis, the production of copious secretions...settings and that the clinical presentation of such poi- sonings may be atypical in special populations such as children " may make initial ED diagnosis... children . MCN Am J Matern Child Nurs. 1995; 20(5): 261-268. 19. Lewn JB, Thomas RG, Walter FG, et a1.: A review of nerve agent exposure for the

  7. İLKÖĞRETİM MATEMATİK ÖĞRETMENİ ADAYLARININ EĞİTSEL İNTERNET KULLANIMINA YÖNELİK ÖZ-YETERLİK İNANÇLARI

    OpenAIRE

    YENİLMEZ, Kürsat; TURGUT, Melih; anapa, pınar; Ersoy, Mehmet

    2012-01-01

    In this work, educational internet use self-efficacy beliefs of preservice elementary mathematics teachers are investigated. The study was conducted in 2010-2011 education year with 268 preservice elementary teachers enrolled to department of elementary mathematics teaching program of a government university. This research is a descriptive study. To collect data educational internet use self-efficacy beliefs scale is used. The obtained data is analyzed by SPSS package program. The results ind...

  8. Fatty Acid Synthase Inhibitors Engage the Cell Death Program Through the Endoplasmic Reticulum

    Science.gov (United States)

    2007-12-01

    Saccharomyces cerevisiae , J Biol Chem 268 (1993) 27269-27276. Epstein, J. I., Carmichael, M. and Partin, A. W., OA-519 (fatty acid synthase) as an independent...547cholesterol lowering drugs is bile acid sequestrants , which 548prevent reabsorption of bile acids by the intestine and result 549in excretion through the...and measured for protein content using a standard copper reduction/bicinchoninic acid assay (BCA; Pierce Biotech- nology), with bovine serum albumin as

  9. Emotionsspezifität unter Berücksichtigung verschiedener Kontextfaktoren und die Auswirkungen habitueller Emotionsregulationsstrategien

    OpenAIRE

    Opwis, Mareile

    2016-01-01

    Bisherige Untersuchungen zur psychophysiologischen Emotionsspezifität zeigen heterogene Ergebnisse, die damit einhergehende Debatte um die Existenz von Basisemotionen ist bis heute umstritten (Friedman, 2010). In dieser Untersuchung wurden die subjektiven, expressiven und physiologischen Reaktionen von Angst, Trauer, Freude und Heiterkeit bei 105 Probanden (Frauen = 64; Alter: M = 26.8; SD = 6.9) auf Emotionsspezifität geprüft und dabei zur Kontrolle der Stimuluseffekte und ...

  10. Nutrition-related cancer prevention knowledge of undergraduate ...

    African Journals Online (AJOL)

    Results: Less than half (49%) had good nutrition-related knowledge of cancer prevention. ... cereals and grains (χ2 = 13.724; p= 0.000), legumes/nuts (χ2 = 17.268; p = 0.000), meat (χ2= 22.972; p = 0.000), fish χ2 = 23.017; p = 0.000), pastry snacks (χ2 = 36.159; p = 0.000) and sugary drinks (χ2= 6.432; p = 0.011).

  11. Case Study of European Union Antipiracy Operation Naval Force Somalia: Successes, Failures and Lessons Learned for the Hellenic Navy

    Science.gov (United States)

    2012-09-01

    http://www.africom.mil/getArticle.asp? art =2137 Council, E. (2001, January 22). Council Decision of 22 January 2001/78/CFSP setting up the Political...autogenerated2009-5 EU, C. (2001, January 22). Europa Lex. Retrieved October 19, 2010, from Council Decision of 22 January 2001 on the establishment of...European Union: http://www.consilium.europa.eu/showPage.aspx?id=268&lang= en Giplin, R. (2009, June 22). United States Institute of Peace- Working

  12. Immunoglobulin profile of Nigerian children with Plasmodium ...

    African Journals Online (AJOL)

    The immunoglobulin profiles of 126 Nigerian children infected with Plasmodium falciparum in their peripheral blood were investigated. The mean malarial parasitaemia was 4699.17 ± 3695.2 ìl. The mean immunoglobulin profile of these infected children were 2.68 ± 0.019 mg/dl for IgA, 0.031 ± 0.01 mg/dl for IgD, 1358.29 ...

  13. Fragranced consumer products: effects on asthmatics

    OpenAIRE

    Steinemann, Anne

    2017-01-01

    Fragranced consumer products, such as cleaning supplies, air fresheners, and personal care products, can emit a range of air pollutants and trigger adverse health effects. This study investigates the prevalence and types of effects of fragranced products on asthmatics in the American population. Using a nationally representative sample (n = 1137), data were collected with an on-line survey of adults in the USA, of which 26.8% responded as being medically diagnosed with asthma or an asthma-lik...

  14. Extinction Coefficient of Gold Nanostars

    OpenAIRE

    de Puig, Helena; Tam, Justina O.; Yen, Chun-Wan; Gehrke, Lee; Hamad-Schifferli, Kimberly

    2015-01-01

    Gold nanostars (NStars) are highly attractive for biological applications due to their surface chemistry, facile synthesis and optical properties. Here, we synthesize NStars in HEPES buffer at different HEPES/Au ratios, producing NStars of different sizes and shapes, and therefore varying optical properties. We measure the extinction coefficient of the synthesized NStars at their maximum surface plasmon resonances (SPR), which range from 5.7 × 108 to 26.8 × 108 M−1cm−1. Measured values correl...

  15. Optimization of Fit for Mass Customized Apparel Ordering Using Fit Preference and Self Measurement.

    Science.gov (United States)

    2000-01-01

    global economy. With its low start-up costs, limited technology, and labor intensive production system, apparel manufacturing offers a practicable...piece and several global commands would not function initially. These problems were easily overcome with no adverse effects on the pattern. After...Committee. Bishton, D. (1984). The sweatshop report. Birmingham: AFFOR. 268 269 Bjerve, S. & Doksum, K. (1993). Correlation curves: Measures of

  16. Biotechnology methods for plant biomass production under controlled conditions

    Czech Academy of Sciences Publication Activity Database

    Langhansová, Lenka; Maršík, Petr; Landa, Přemysl; Vaněk, Tomáš

    -, č. 723 (2006), s. 263-268 ISSN 0567-7572. [International Symposium on the Labiate: Advances in Production, Biotechnology and Utilisation /1./. Sanremo, 22.02.2006-25.02.2006] R&D Projects: GA AV ČR IBS4055301; GA MŠk 1P04OC926.001 Institutional research plan: CEZ:AV0Z40550506 Keywords : Taxus baccata * Panax ginseng * Labiatae * bioreactors Subject RIV: CE - Biochemistry

  17. The complexity of proving that a graph is Ramsey

    Czech Academy of Sciences Publication Activity Database

    Lauria, M.; Pudlák, Pavel; Rödl, V.; Thapen, Neil

    2017-01-01

    Roč. 37, č. 2 (2017), s. 253-268 ISSN 0209-9683 R&D Projects: GA AV ČR IAA100190902; GA ČR GBP202/12/G061 Institutional support: RVO:67985840 Keywords : complexity * c-Ramsey graph s Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.048, year: 2016 http://link.springer.com/article/10.1007%2Fs00493-015-3193-9

  18. Allergic, Immunological and Infectious Disease Problems in Aerospace Medicine Held in Rome, Italy on 21 - 25 October 1991 (Les Problemes Causes par les Maladies Allergiques, Immunologiques et Contagieuses en Mdecine Aerospatiale).

    Science.gov (United States)

    1992-04-01

    aminoacids should be a suitable vaccine Torrigiani. Chief of the Division of :andidate. Many clinical trials are now in Communicable Diseases. WHO, and by...immunogenicity of the 535 aminoacids composing the diphtheria malaria vaccine candidate antigens by the toxin has been modified: the result i,; the use of novel...muscle in the im- mune system and its importance in surgery, trauma, sepsis and burns. Nutrition 4:261-268. 42. Gmander F.K.,Lorenzi G.,Bechler B

  19. Effects of Transcranial Direct Current Stimulation on Expression of Immediate Early Genes (IEG’s)

    Science.gov (United States)

    2015-12-01

    indicate examples of double labeled cells. ................................ 16 Figure 8: A) mRNA levels in somatosensory cortex , B) mRNA levels in...A Somatosensory Cortex Experiment 1: RNA Hippocampus B CTX1 CTX2 CTX3 C Central Cortex CTX (lateral...animals in both hippocampus and somatosensory cortex regions (Figure 8). Fold change values for zif268: CON 1.04 (SE± 0.09), SHAM 2.86 (SE±0.27) and 75 µA

  20. lung function of zimbabwea farm workers exposed to flue curing and ...

    African Journals Online (AJOL)

    Outcame measures. Lung function indices. Results. Forced vital capacity (FVq, forced expiratory volume in 1 second (FEV,) and peak expiratory flow rate (pEFR) of the TfWs were 3.28 ± 051 litres, 2.68 ± 0.74 litres and 6.41 ±. 2.08litres/second, respectively. These figures were significantly lower than 3.97 ± 0.83 litres, 3.09 ...