WorldWideScience

Sample records for meitnerium 265

  1. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by § 265.13... listed as a hazardous waste. As required by § 265.13, the waste analysis plan must include analyses...

  2. Dicty_cDB: SLH265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH265 (Link to dictyBase) - - - Contig-U13901-1 SLH265Z (Link... to Original site) - - SLH265Z 631 - - - - Show SLH265 Library SL (Link to library) Clone ID SLH265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH265Q.Seq.d/ Representative seq. ID SLH26...5Z (Link to Original site) Representative DNA sequence >SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ XXXXX... alignments: (bits) Value SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ 1059 0.0 VFL442 (VFL442Q) /CSM/VF/V

  3. 40 CFR 265.14 - Security.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Security. 265.14 Section 265.14... Facility Standards § 265.14 Security. (a) The owner or operator must prevent the unknowing entry, and...) for discussion of security requirements at disposal facilities during the post-closure care period...

  4. 40 CFR 265.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and sulfur...

  5. 40 CFR 265.375 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.375 Section 265... FACILITIES Thermal Treatment § 265.375 Waste analysis. In addition to the waste analyses required by § 265.13... of pollutants which might be emitted. At a minimum, the analysis must determine: (a) Heating value of...

  6. 15 CFR 265.41 - Gambling.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Gambling. 265.41 Section 265.41..., GAITHERSBURG, MARYLAND, AND BOULDER AND FORT COLLINS, COLORADO Buildings and Grounds § 265.41 Gambling. No... gambling devices, the conduct of lotteries or pools, or in the selling or purchasing of numbers tickets, or...

  7. 40 CFR 265.252 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.252 Section 265... FACILITIES Waste Piles § 265.252 Waste analysis. In addition to the waste analyses required by § 265.13, the... in the pile to which it is to be added. The analysis conducted must be capable of differentiating...

  8. 8 CFR 265.1 - Forms.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Forms. 265.1 Section 265.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS NOTICES OF ADDRESS § 265.1 Forms. Except... under section 262 of the Act shall report each change of address and new address within 10 days on Form...

  9. 40 CFR 265.73 - Operating record.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Operating record. 265.73 Section 265.73 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Manifest System, Recordkeeping, and Reporting § 265.73 Operating record. (a) The owner or operator...

  10. 25 CFR 265.3 - Roads prohibited.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Roads prohibited. 265.3 Section 265.3 Indians BUREAU OF... ON INDIAN RESERVATIONS § 265.3 Roads prohibited. (a) Within the boundaries of this officially... highways, roads, truck trails, work roads, and all other types of ways constructed to make possible the...

  11. 40 CFR 265.250 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... Piles § 265.250 Applicability. The regulations in this subpart apply to owners and operators of facilities that treat or store hazardous waste in piles, except as § 265.1 provides otherwise. Alternatively, a pile of hazardous waste may be managed as a landfill under subpart N. ...

  12. 40 CFR 265.13 - General waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 265.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... waste analysis requirements for specific waste management methods as specified in §§ 265.200, 265.225... analysis of test data; and, (iii) The annual removal of residues which are not delisted under § 260.22 -of...

  13. 40 CFR 265.276 - Food chain crops.

    Science.gov (United States)

    2010-07-01

    ... of crop and soil characteristics, sample selection criteria, sample size determination, analytical... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Food chain crops. 265.276 Section 265... FACILITIES Land Treatment § 265.276 Food chain crops. (a) An owner or operator of a hazardous waste land...

  14. 40 CFR 265.1087 - Standards: Containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Standards: Containers. 265.1087... DISPOSAL FACILITIES Air Emission Standards for Tanks, Surface Impoundments, and Containers § 265.1087 Standards: Containers. (a) The provisions of this section apply to the control of air pollutant emissions...

  15. 15 CFR 265.34 - Conformity with posted signs.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Conformity with posted signs. 265.34 Section 265.34 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL..., GAITHERSBURG, MARYLAND, AND BOULDER AND FORT COLLINS, COLORADO Buildings and Grounds § 265.34 Conformity with...

  16. 45 CFR 265.5 - May States use sampling?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false May States use sampling? 265.5 Section 265.5... REQUIREMENTS § 265.5 May States use sampling? (a) Each State may report the disaggregated data in the TANF Data... the use of a scientifically acceptable sampling method that we have approved. States may use sampling...

  17. 40 CFR 265.313 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Landfills § 265.313 Special requirements for incompatible wastes... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.313 Section 265.313 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  18. 40 CFR 265.282 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Land Treatment § 265.282 Special requirements for incompatible wastes... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.282 Section 265.282 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  19. 40 CFR 265.199 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Tank Systems § 265.199 Special requirements for incompatible wastes. (a... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.199 Section 265.199 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  20. 40 CFR 265.257 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.257 Special requirements for incompatible wastes. (a... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.257 Section 265.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...

  1. 40 CFR 265.35 - Required aisle space.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Required aisle space. 265.35 Section... FACILITIES Preparedness and Prevention § 265.35 Required aisle space. The owner or operator must maintain aisle space to allow the unobstructed movement of personnel, fire protection equipment, spill control...

  2. 40 CFR 265.173 - Management of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Management of containers. 265.173... DISPOSAL FACILITIES Use and Management of Containers § 265.173 Management of containers. (a) A container... waste. (b) A container holding hazardous waste must not be opened, handled, or stored in a manner which...

  3. 40 CFR 265.171 - Condition of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 265.171... DISPOSAL FACILITIES Use and Management of Containers § 265.171 Condition of containers. If a container... transfer the hazardous waste from this container to a container that is in good condition, or manage the...

  4. 14 CFR 125.265 - Flight engineer requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...

  5. 40 CFR 265.251 - Protection from wind.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Protection from wind. 265.251 Section... FACILITIES Waste Piles § 265.251 Protection from wind. The owner or operator of a pile containing hazardous waste which could be subject to dispersal by wind must cover or otherwise manage the pile so that wind...

  6. 27 CFR 24.265 - Losses by theft.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses by theft. 24.265... OF THE TREASURY LIQUORS WINE Losses of Wine § 24.265 Losses by theft. The proprietor shall be liable... to the satisfaction of the appropriate TTB officer that the theft did not occur as the result of...

  7. 40 CFR 265.51 - Purpose and implementation of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... contingency plan. 265.51 Section 265.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED..., STORAGE, AND DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.51 Purpose and implementation of contingency plan. (a) Each owner or operator must have a contingency plan for his facility. The...

  8. 40 CFR 265.34 - Access to communications or alarm system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Access to communications or alarm system. 265.34 Section 265.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID..., STORAGE, AND DISPOSAL FACILITIES Preparedness and Prevention § 265.34 Access to communications or alarm...

  9. 40 CFR 265.54 - Amendment of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Amendment of contingency plan. 265.54... DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.54 Amendment of contingency plan. The contingency plan must be reviewed, and immediately amended, if necessary, whenever: (a) Applicable regulations...

  10. 40 CFR 265.256 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.256 Special requirements for ignitable or... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.256 Section 265.256 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  11. 21 CFR 137.265 - Degerminated white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Degerminated white corn meal. 137.265 Section 137... Cereal Flours and Related Products § 137.265 Degerminated white corn meal. (a) Degerminated white corn meal, degermed white corn meal, is the food prepared by grinding cleaned white corn and removing bran...

  12. 40 CFR 265.53 - Copies of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Copies of contingency plan. 265.53... DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.53 Copies of contingency plan. A copy of the contingency plan and all revisions to the plan must be: (a) Maintained at the facility; and (b...

  13. 40 CFR 265.177 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.177 Section 265.177 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT...

  14. 40 CFR 265.230 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.230 Section 265.230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT...

  15. 40 CFR 265.406 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.406 Section 265.406 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT...

  16. 18 CFR 284.265 - Cost recovery by interstate pipeline.

    Science.gov (United States)

    2010-04-01

    ... 1978 AND RELATED AUTHORITIES Emergency Natural Gas Sale, Transportation, and Exchange Transactions... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cost recovery by interstate pipeline. 284.265 Section 284.265 Conservation of Power and Water Resources FEDERAL ENERGY...

  17. 12 CFR 265.3 - Board review of delegated actions.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Board review of delegated actions. 265.3 Section 265.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... for determination if the delegee considers it appropriate because of the importance or complexity of...

  18. 40 CFR 265.1080 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... requirements of § 265.1090(c). (f) This section applies only to the facility commonly referred to as the OSi... Water 8 model or other model agreed to by the Sistersville Plant, EPA and WVDEP) under Project XL with...

  19. 30 CFR 206.265 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.265... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.265 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  20. 40 CFR 265.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 265.148 Section 265.148 Protection of Environment ENVIRONMENTAL... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.148 Incapacity of owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the...

  1. 40 CFR 265.110 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Closure... the owners and operators of: (1) All hazardous waste disposal facilities; (2) Waste piles and surface... through 265.115 (which concern closure) apply to the owners and operators of all hazardous waste...

  2. 15 CFR 265.42 - Photography for advertising or commercial purposes; advertising and soliciting.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Photography for advertising or commercial purposes; advertising and soliciting. 265.42 Section 265.42 Commerce and Foreign Trade Regulations... COLLINS, COLORADO Buildings and Grounds § 265.42 Photography for advertising or commercial purposes...

  3. 40 CFR 265.145 - Financial assurance for post-closure care.

    Science.gov (United States)

    2010-07-01

    ... care. 265.145 Section 265.145 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... made, multiplied by an amount equivalent to 85 percent of the most recent investment rate or of the...; and (B) In connection with that procedure, no matters came to his attention which caused him to...

  4. 21 CFR 1271.265 - Receipt, predistribution shipment, and distribution of an HCT/P.

    Science.gov (United States)

    2010-04-01

    ... DRUG ADMINISTRATION HUMAN CELLS, TISSUES, AND CELLULAR AND TISSUE-BASED PRODUCTS Current Good Tissue Practice § 1271.265 Receipt, predistribution shipment, and distribution of an HCT/P. (a) Receipt. You must... distribution of an HCT/P. 1271.265 Section 1271.265 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...

  5. 25 CFR 26.5 - Who may be eligible for Job Placement and Training?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Who may be eligible for Job Placement and Training? 26.5 Section 26.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES JOB PLACEMENT AND TRAINING PROGRAM General Applicability § 26.5 Who may be eligible for Job Placement and Training? You may...

  6. 40 CFR 265.281 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.281 Section 265.281 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  7. 40 CFR 265.176 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.176 Section 265.176 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  8. 40 CFR 265.405 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.405 Section 265.405 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  9. 40 CFR 265.198 - Special requirements for ignitable or reactive wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive wastes. 265.198 Section 265.198 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  10. 40 CFR 265.312 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.312 Section 265.312 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  11. 40 CFR 265.229 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.229 Section 265.229 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... qualified chemist or engineer that, to the best of his knowledge and opinion, the design features or...

  12. 40 CFR 265.114 - Disposal or decontamination of equipment, structures and soils.

    Science.gov (United States)

    2010-07-01

    ... decontamination of equipment, structures and soils. During the partial and final closure periods, all contaminated... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Disposal or decontamination of equipment, structures and soils. 265.114 Section 265.114 Protection of Environment ENVIRONMENTAL PROTECTION...

  13. 12 CFR 265.7 - Functions delegated to Director of Division of Banking Supervision and Regulation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Functions delegated to Director of Division of Banking Supervision and Regulation. 265.7 Section 265.7 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES REGARDING DELEGATION OF AUTHORITY § 265.7 Functions delegated to Director of Division...

  14. 40 CFR 265.1 - Purpose, scope, and applicability.

    Science.gov (United States)

    2010-07-01

    ... issued under the Marine Protection, Research, and Sanctuaries Act; [Comment: These part 265 regulations... wastewater treatment sludge is generated in a surface impoundment as part of the plant's wastewater treatment...

  15. EDPS 265: The Inclusive Classroom

    OpenAIRE

    Begeske, Jasmine

    2014-01-01

    EDPS 265: The Inclusive Classroom is a foundational, large enrollment lecture course and is taught in a lecture hall with a stadium style seating arraignment. This configuration results in a course that is not student-centered, promotes one-way communication and hinders cooperative learning. Education courses should be structured so that the course in itself is instructive. This course teaches interventions for reaching all students, using techniques that engage students in the learning proce...

  16. 40 CFR 265.316 - Disposal of small containers of hazardous waste in overpacked drums (lab packs).

    Science.gov (United States)

    2010-07-01

    ... OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Landfills § 265.316 Disposal of small containers of hazardous waste in overpacked drums (lab packs). Small containers of hazardous waste... hazardous waste in overpacked drums (lab packs). 265.316 Section 265.316 Protection of Environment...

  17. Phenotype abnormality: 265 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 265 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u770i disrupted in or...gan named seedling during process named growth after radicle emergence stage ... seedling ... disrupted radicle emergence stage ... growth ...

  18. 12 CFR 265.8 - Functions delegated to the Staff Director of the Division of International Finance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Functions delegated to the Staff Director of the Division of International Finance. 265.8 Section 265.8 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES REGARDING DELEGATION OF AUTHORITY § 265.8 Functions delegated to the Staff Director...

  19. 40 CFR 60.265 - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... Production Facilities § 60.265 Monitoring of operations. (a) The owner or operator of any electric submerged... side of the transformer. The device must have an accuracy of ±5 percent over its operating range. (c... owner or operator of an electric submerged arc furnace that is equipped with a water cooled cover which...

  20. 40 CFR 265.91 - Ground-water monitoring system.

    Science.gov (United States)

    2010-07-01

    ... this paragraph. (b) Separate monitoring systems for each waste management component of a facility are... which circumscribes the several waste management components. (c) All monitoring wells must be cased in a... Section 265.91 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES...

  1. 40 CFR 265.150 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.150 State assumption of responsibility. (a) If a State either assumes legal responsibility for an owner's or operator's compliance with the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false State assumption of responsibility...

  2. 40 CFR 265.315 - Special requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for containers..., STORAGE, AND DISPOSAL FACILITIES Landfills § 265.315 Special requirements for containers. Unless they are very small, such as an ampule, containers must be either: (a) At least 90 percent full when placed in...

  3. 15 CFR 265.37 - Narcotics and other drugs.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Narcotics and other drugs. 265.37... other drugs. The possession, sale, consumption, or use on the site of narcotic or other drugs illegal... with respect to the possession, sale, consumption, or use of narcotic or other drugs. ...

  4. 40 CFR 265.280 - Closure and post-closure.

    Science.gov (United States)

    2010-07-01

    ... contaminants caused by wind erosion; and (4) Compliance with § 265.276 concerning the growth of food-chain... and post-closure care objectives of paragraph (a) of this section: (1) Type and amount of hazardous..., including amount, frequency, and pH of precipitation; (5) Geological and soil profiles and surface and...

  5. The role of Val-265 for flavin adenine dinucleotide (FAD) binding in pyruvate oxidase: FTIR, kinetic, and crystallographic studies on the enzyme variant V265A.

    Science.gov (United States)

    Wille, Georg; Ritter, Michaela; Weiss, Manfred S; König, Stephan; Mäntele, Werner; Hübner, Gerhard

    2005-04-05

    In pyruvate oxidase (POX) from Lactobacillus plantarum, valine 265 participates in binding the cofactor FAD and is responsible for the strained conformation of its isoalloxazine moiety that is visible in the crystal structure of POX. The contrasting effects of the conservative amino acid exchange V265A on the enzyme's catalytic properties, cofactor affinity, and protein structure were investigated. The most prominent effect of the exchange was observed in the 2.2 A crystal structure of the mutant POX. While the overall structures of the wild-type and the variant are similar, flavin binding in particular is clearly different. Local disorder at the isoalloxazine binding site prevents modeling of the complete FAD cofactor and two protein loops of the binding site. Only the ADP moiety shows well-defined electron density, indicating an "anchor" function for this part of the molecule. This notion is corroborated by competition experiments where ADP was used to displace FAD from the variant enzyme. Despite the fact that the affinity of FAD binding in the variant is reduced, the catalytic properties are very similar to the wild-type, and the redox potential of the bound flavin is the same for both proteins. The rate of electron transfer toward the flavin during turnover is reduced to one-third compared to the wild-type, but k(cat) remains unchanged. Redox-triggered FTIR difference spectroscopy of free FAD shows the nu(C(10a)=N(1)) band at 1548 cm(-)(1). In POX-V265A, this band is found at 1538 cm(-)(1) and thus shifted less strongly than in wild-type POX where it is found at 1534 cm(-)(1). Taking these observations together, the conservative exchange V265A in POX has a surprisingly small effect on the catalytic properties of the enzyme, whereas the effect on the three-dimensional structure is rather big.

  6. 15 CFR 265.43 - Pets and other animals.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Pets and other animals. 265.43 Section... animals. Except in connection with the conduct of official business on the site or with the approval of... person shall bring upon the site any cat, dog, or other animal, provided, however, that blind persons may...

  7. Medical Ultrasound Video Coding with H.265/HEVC Based on ROI Extraction.

    Science.gov (United States)

    Wu, Yueying; Liu, Pengyu; Gao, Yuan; Jia, Kebin

    2016-01-01

    High-efficiency video compression technology is of primary importance to the storage and transmission of digital medical video in modern medical communication systems. To further improve the compression performance of medical ultrasound video, two innovative technologies based on diagnostic region-of-interest (ROI) extraction using the high efficiency video coding (H.265/HEVC) standard are presented in this paper. First, an effective ROI extraction algorithm based on image textural features is proposed to strengthen the applicability of ROI detection results in the H.265/HEVC quad-tree coding structure. Second, a hierarchical coding method based on transform coefficient adjustment and a quantization parameter (QP) selection process is designed to implement the otherness encoding for ROIs and non-ROIs. Experimental results demonstrate that the proposed optimization strategy significantly improves the coding performance by achieving a BD-BR reduction of 13.52% and a BD-PSNR gain of 1.16 dB on average compared to H.265/HEVC (HM15.0). The proposed medical video coding algorithm is expected to satisfy low bit-rate compression requirements for modern medical communication systems.

  8. Medical Ultrasound Video Coding with H.265/HEVC Based on ROI Extraction.

    Directory of Open Access Journals (Sweden)

    Yueying Wu

    Full Text Available High-efficiency video compression technology is of primary importance to the storage and transmission of digital medical video in modern medical communication systems. To further improve the compression performance of medical ultrasound video, two innovative technologies based on diagnostic region-of-interest (ROI extraction using the high efficiency video coding (H.265/HEVC standard are presented in this paper. First, an effective ROI extraction algorithm based on image textural features is proposed to strengthen the applicability of ROI detection results in the H.265/HEVC quad-tree coding structure. Second, a hierarchical coding method based on transform coefficient adjustment and a quantization parameter (QP selection process is designed to implement the otherness encoding for ROIs and non-ROIs. Experimental results demonstrate that the proposed optimization strategy significantly improves the coding performance by achieving a BD-BR reduction of 13.52% and a BD-PSNR gain of 1.16 dB on average compared to H.265/HEVC (HM15.0. The proposed medical video coding algorithm is expected to satisfy low bit-rate compression requirements for modern medical communication systems.

  9. Activation of TAK1 by MYD88 L265P drives malignant B-cell Growth in non-Hodgkin lymphoma

    International Nuclear Information System (INIS)

    Ansell, S M; Hodge, L S; Secreto, F J; Manske, M; Braggio, E; Price-Troska, T; Ziesmer, S; Li, Y; Johnson, S H; Hart, S N; Kocher, J-P A; Vasmatzis, G; Chanan-Kahn, A; Gertz, M; Fonseca, R; Dogan, A; Cerhan, J R; Novak, A J

    2014-01-01

    Massively parallel sequencing analyses have revealed a common mutation within the MYD88 gene (MYD88 L265P ) occurring at high frequencies in many non-Hodgkin lymphomas (NHLs) including the rare lymphoplasmacytic lymphoma, Waldenström's macroglobulinemia (WM). Using whole-exome sequencing, Sanger sequencing and allele-specific PCR, we validate the initial studies and detect the MYD88 L265P mutation in the tumor genome of 97% of WM patients analyzed (n=39). Due to the high frequency of MYD88 mutation in WM and other NHL, and its known effects on malignant B-cell survival, therapeutic targeting of MYD88 signaling pathways may be clinically useful. However, we are lacking a thorough characterization of the role of intermediary signaling proteins on the biology of MYD88 L265P -expressing B cells. We report here that MYD88 L265P signaling is constitutively active in both WM and diffuse large B-cell lymphoma cells leading to heightened MYD88 L265P , IRAK and TRAF6 oligomerization and NF-κB activation. Furthermore, we have identified the signaling protein, TAK1, to be an essential mediator of MYD88 L265P -driven signaling, cellular proliferation and cytokine secretion in malignant B cells. Our studies highlight the biological significance of MYD88 L265P in NHL and reveal TAK1 inhibition to be a potential therapeutic strategy for the treatment of WM and other diseases characterized by MYD88 L265P

  10. 20 CFR 645.265 - What safeguards are there to ensure that participants in Welfare-to-Work employment activities do...

    Science.gov (United States)

    2010-04-01

    ... participants in Welfare-to-Work employment activities do not displace other employees? 645.265 Section 645.265 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR PROVISIONS GOVERNING WELFARE... ensure that participants in Welfare-to-Work employment activities do not displace other employees? (a) An...

  11. 15 CFR 265.21 - Improper use of roads as thoroughfares.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Improper use of roads as thoroughfares... § 265.21 Improper use of roads as thoroughfares. Except as otherwise provided herein, no person shall drive a motor vehicle or bicycle onto the site for the sole purpose of using the roads of the site as a...

  12. The E2.65A mutation disrupts dynamic binding poses of SB269652 at the dopamine D2 and D3 receptors.

    Directory of Open Access Journals (Sweden)

    Ravi Kumar Verma

    2018-01-01

    Full Text Available The dopamine D2 and D3 receptors (D2R and D3R are important targets for antipsychotics and for the treatment of drug abuse. SB269652, a bitopic ligand that simultaneously binds both the orthosteric binding site (OBS and a secondary binding pocket (SBP in both D2R and D3R, was found to be a negative allosteric modulator. Previous studies identified Glu2.65 in the SBP to be a key determinant of both the affinity of SB269652 and the magnitude of its cooperativity with orthosteric ligands, as the E2.65A mutation decreased both of these parameters. However, the proposed hydrogen bond (H-bond between Glu2.65 and the indole moiety of SB269652 is not a strong interaction, and a structure activity relationship study of SB269652 indicates that this H-bond may not be the only element that determines its allosteric properties. To understand the structural basis of the observed phenotype of E2.65A, we carried out molecular dynamics simulations with a cumulative length of ~77 μs of D2R and D3R wild-type and their E2.65A mutants bound to SB269652. In combination with Markov state model analysis and by characterizing the equilibria of ligand binding modes in different conditions, we found that in both D2R and D3R, whereas the tetrahydroisoquinoline moiety of SB269652 is stably bound in the OBS, the indole-2-carboxamide moiety is dynamic and only intermittently forms H-bonds with Glu2.65. Our results also indicate that the E2.65A mutation significantly affects the overall shape and size of the SBP, as well as the conformation of the N terminus. Thus, our findings suggest that the key role of Glu2.65 in mediating the allosteric properties of SB269652 extends beyond a direct interaction with SB269652, and provide structural insights for rational design of SB269652 derivatives that may retain its allosteric properties.

  13. Video traffic characteristics of modern encoding standards: H.264/AVC with SVC and MVC extensions and H.265/HEVC.

    Science.gov (United States)

    Seeling, Patrick; Reisslein, Martin

    2014-01-01

    Video encoding for multimedia services over communication networks has significantly advanced in recent years with the development of the highly efficient and flexible H.264/AVC video coding standard and its SVC extension. The emerging H.265/HEVC video coding standard as well as 3D video coding further advance video coding for multimedia communications. This paper first gives an overview of these new video coding standards and then examines their implications for multimedia communications by studying the traffic characteristics of long videos encoded with the new coding standards. We review video coding advances from MPEG-2 and MPEG-4 Part 2 to H.264/AVC and its SVC and MVC extensions as well as H.265/HEVC. For single-layer (nonscalable) video, we compare H.265/HEVC and H.264/AVC in terms of video traffic and statistical multiplexing characteristics. Our study is the first to examine the H.265/HEVC traffic variability for long videos. We also illustrate the video traffic characteristics and statistical multiplexing of scalable video encoded with the SVC extension of H.264/AVC as well as 3D video encoded with the MVC extension of H.264/AVC.

  14. 20 CFR 1002.265 - If the employee is reemployed with his or her pre-service employer, is the employee's pension...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false If the employee is reemployed with his or her pre-service employer, is the employee's pension benefit the same as if he or she had remained continuously employed? 1002.265 Section 1002.265 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE,...

  15. C- and N-truncated antimicrobial peptides from LFampin 265 - 284: Biophysical versus microbiology results

    Directory of Open Access Journals (Sweden)

    Regina Adão

    2011-01-01

    Full Text Available Lactoferrin is a glycoprotein with two globular lobes, each having two domains. Since the discovery of its antimicrobial properties, efforts have been made to find peptides derived from this protein showing antimicrobial properties. Most peptides initially studied were derived from Lactoferricin B, obtained from the protein by digestion with pepsin. More recently, a new family of antimicrobial peptides (AMPs derived from Lactoferrin was discovered by Bolcher et al, and named Lactoferrampin (LFampin. The original sequence of LFampin contained residues 268 - 284 from the N1 domain of Lactoferrin. From this peptide, the Bolscher′s group synthesized a collection of peptides obtained by extension and / or truncation at the C or N-terminal sides, in order to unravel the main structural features responsible for antimicrobial action. Here, we present results for three of these peptides, namely LFampin 265 - 284, LFampin 265 - 280, and LFampin 270 - 284. The peptides were tested against bacteria (E. coli and S. sanguinis, fungi (C. albicans, and model membranes of 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC, 1,2-dimyristoyl-sn-glycero-3-[phospho-rac-(1-glycerol] (DMPG, and their mixtures at a ratio of 3 : 1 (DMPC : DMPG (3 : 1. The ability to adopt a helical conformation was followed by a circular dichroism (CD, and the perturbation of the gel to the liquid-crystalline phase transition of the membrane was characterized by differential scanning calorimetry (DSC. Distinct behavior was observed in the three peptides, both from the microbiology and model membrane studies, with the biophysical results showing excellent correlation with the microbiology activity studies. LFampin 265 - 284 was the most active peptide toward the tested microorganisms, and in the biophysical studies it showed the highest ability to form an a-helix and the strongest interaction with model membranes, followed by LFampin 265 - 280. LFampin 270 - 284 was inactive, showing

  16. 49 CFR 26.5 - What do the terms used in this part mean?

    Science.gov (United States)

    2010-10-01

    ... BUSINESS ENTERPRISES IN DEPARTMENT OF TRANSPORTATION FINANCIAL ASSISTANCE PROGRAMS General § 26.5 What do... (FTA), and the Federal Aviation Administration (FAA). Disadvantaged business enterprise or DBE means a... percent of the stock is owned by one or more such individuals; and (2) Whose management and daily business...

  17. Safety, tolerability, pharmacokinetics, and activity of the novel long-acting antimalarial DSM265: a two-part first-in-human phase 1a/1b randomised study.

    Science.gov (United States)

    McCarthy, James S; Lotharius, Julie; Rückle, Thomas; Chalon, Stephan; Phillips, Margaret A; Elliott, Suzanne; Sekuloski, Silvana; Griffin, Paul; Ng, Caroline L; Fidock, David A; Marquart, Louise; Williams, Noelle S; Gobeau, Nathalie; Bebrevska, Lidiya; Rosario, Maria; Marsh, Kennan; Möhrle, Jörg J

    2017-06-01

    DSM265 is a novel antimalarial that inhibits plasmodial dihydroorotate dehydrogenase, an enzyme essential for pyrimidine biosynthesis. We investigated the safety, tolerability, and pharmacokinetics of DSM265, and tested its antimalarial activity. Healthy participants aged 18-55 years were enrolled in a two-part study: part 1, a single ascending dose (25-1200 mg), double-blind, randomised, placebo-controlled study, and part 2, an open-label, randomised, active-comparator controlled study, in which participants were inoculated with Plasmodium falciparum induced blood-stage malaria (IBSM) and treated with DSM265 (150 mg) or mefloquine (10 mg/kg). Primary endpoints were DSM265 safety, tolerability, and pharmacokinetics. Randomisation lists were created using a validated, automated system. Both parts were registered with the Australian New Zealand Clinical Trials Registry, number ACTRN12613000522718 (part 1) and number ACTRN12613000527763 (part 2). In part 1, 73 participants were enrolled between April 12, 2013, and July 14, 2015 (DSM265, n=55; placebo, n=18). In part 2, nine participants were enrolled between Sept 30 and Nov 25, 2013 (150 mg DSM265, n=7; 10 mg/kg mefloquine, n=2). In part 1, 117 adverse events were reported; no drug-related serious or severe events were reported. The most common drug-related adverse event was headache. The mean DSM265 peak plasma concentration (C max ) ranged between 1310 ng/mL and 34 800 ng/mL and was reached in a median time (t max ) between 1·5 h and 4 h, with a mean elimination half-life between 86 h and 118 h. In part 2, the log 10 parasite reduction ratio at 48 h in the DSM265 (150 mg) group was 1·55 (95% CI 1·42-1·67) and in the mefloquine (10 mg/kg) group was 2·34 (2·17-2·52), corresponding to a parasite clearance half-life of 9·4 h (8·7-10·2) and 6·2 h (5·7-6·7), respectively. The median minimum inhibitory concentration of DSM265 in blood was estimated as 1040 ng/mL (range 552-1500), resulting in a predicted

  18. MYD88 L265P Mutations Are Correlated with 6q Deletion in Korean Patients with Waldenström Macroglobulinemia

    Directory of Open Access Journals (Sweden)

    Jung-Ah Kim

    2014-01-01

    Full Text Available Waldenström macroglobulinemia (WM is a malignant lymphoplasma-proliferative disorder with IgM monoclonal gammopathy. A recent whole-genome study identified MYD88 L265P as the key mutation in WM. We investigated MYD88 mutations in conjunction with cytogenetic study in 22 consecutive Korean WM patients. Conventional G-banding and interphase fluorescence in situ hybridization (FISH were performed at regions including 6q21 using bone marrow (BM aspirates. Sixteen patients were subjected to Sanger sequencing-based MYD88 mutation study. Five patients (28% showed cytogenetic aberrations in G-banding. The incidence of 6q21 deletion was 17% by conventional G-banding and 37% by FISH. Ten patients (45% showed cytogenetic aberrations using FISH: 6q deletion in eight (37% and IGH rearrangement in four (18%. Two patients had both the 6q deletion and IGH rearrangement, and two had only the IGH rearrangement. Eleven patients (69% presented with the MYD88 L265P mutation. MYD88 mutations were significantly associated with the presence of 6q deletions (P=0.037. Six patients with the 6q deletion for whom sequencing was possible were found to harbor MYD88 mutations. The MYD88 L265P mutation was also associated with increased lymphocyte burden in BM biopsy. This is the first report of high frequency MYD88 L265P mutations in Korean WM patients.

  19. Clone-specific MYD88 L265P and CXCR4 mutation status can provide clinical utility in suspected Waldenström macroglobulinemia/lymphoplasmacytic lymphoma.

    Science.gov (United States)

    Burnworth, Bettina; Wang, Zhixing; Singleton, Timothy P; Bennington, Angela; Fritschle, Wayne; Bennington, Richard; Brodersen, Lisa Eidenschink; Wells, Denise A; Loken, Michael R; Zehentner, Barbara K

    2016-12-01

    MYD88 L265P, a diagnostic marker for lymphoplasmacytic lymphoma (LPL)/Waldenström macroglobulinemia (WM) can also be detected in other hematopoietic malignancies. We demonstrate a novel approach to increase the specificity of this marker for WM/LPL diagnosis by combining flow cytometric cell sorting with molecular analysis. Clonal B-lymphocyte and co-occurring clonal plasma cell populations of low-grade B-cell lymphomas were sorted by flow cytometry and analyzed for immunoglobulin gene rearrangements (PCR), and for MYD88 and CXCR4 mutations. Identical clonal origin was confirmed by PCR for 21 LPL/WM cases and MYD88 L265P was detected in both B-cell and plasma cell fractions. 9/20 other B-cell lymphomas with identical light chain restriction on B-cells and plasma cells were genotypically identical by PCR and MYD88 L265P was detected in both cell fractions in 7/9 whereas in 11/20 specimens with different clonal origin, MYD88 L265P was absent (5/11), or only found in B-lymphocytes (4/11), or plasma cells (2/11). CXCR4 mutations were detected in 17/39 cases, but missed in 63% of these without cell sorting. Confirming MYD88L265P in both B-cells and plasma cell fractions can provide a novel and powerful discriminator to distinguish LPL/WM from phenotypically similar disorders. Furthermore, this approach significantly increases CXCR4 detection sensitivity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Dramatic Response with Single-Agent Ibrutinib in Multiply Relapsed Marginal Zone Lymphoma with MYD88L265P Mutation

    Directory of Open Access Journals (Sweden)

    Ryan C. Lynch

    2017-09-01

    Full Text Available The B-cell receptor signaling pathway is important in the lymphomagenesis of many lymphomas, including marginal zone lymphoma (MZL. Herein we describe a case of extranodal MZL refractory to multiple lines of therapy. The presence of an IgM paraprotein prompted further evaluation, and the patient was found to have an MYD88L265P mutation. Treatment with ibrutinib led to a dramatic response with prompt resolution of symptoms and significant improvement in measurable sites of disease. The excellent response to ibrutinib in our patient with MYD88L265P-mutated refractory MZL supports a biological rationale for its use.

  1. Response of the leaf photosynthetic rate to available nitrogen in erect panicle-type rice (Oryza sativa L. cultivar, Shennong265

    Directory of Open Access Journals (Sweden)

    Chihiro Urairi

    2016-07-01

    Full Text Available Increasing the yield of rice per unit area is important because of the demand from the growing human population in Asia. A group of varieties called erect panicle-type rice (EP achieves very high yields under conditions of high nitrogen availability. Little is known, however, regarding the leaf photosynthetic capacity of EP, which may be one of the physiological causes of high yield. We analyzed the factors contributing to leaf photosynthetic rate (Pn and leaf mesophyll anatomy of Nipponbare, Takanari, and Shennong265 (a EP type rice cultivar varieties subjected to different nitrogen treatments. In the field experiment, Pn of Shennong265 was 33.8 μmol m−2 s−1 in the high-N treatment, and was higher than that of the other two cultivars because of its high leaf nitrogen content (LNC and a large number of mesophyll cells between the small vascular bundles per unit length. In Takanari, the relatively high value of Pn (31.5 μmol m−2 s−1 was caused by the high stomatal conductance (gs; .72 mol m−2 s−1 in the high-N treatment. In the pot experiment, the ratio of Pn/Ci to LNC, which may reflect mesophyll conductance (gm, was 20–30% higher in Nipponbare than in Takanari or Shennong265 in the high N availability treatment. The photosynthetic performance of Shennong265 might be improved by introducing the greater ratio of Pn/Ci to LNC found in Nipponbare and greater stomatal conductance found in Takanari.

  2. Research of Video Steganalysis Algorithm Based on H265 Protocol

    Directory of Open Access Journals (Sweden)

    Wu Kaicheng

    2015-01-01

    This paper researches LSB matching VSA based on H265 protocol with the research background of 26 original Video sequences, it firstly extracts classification features out from training samples as input of SVM, and trains in SVM to obtain high-quality category classification model, and then tests whether there is suspicious information in the video sample. The experimental results show that VSA algorithm based on LSB matching can be more practical to obtain all frame embedded secret information and carrier and video of local frame embedded. In addition, VSA adopts the method of frame by frame with a strong robustness in resisting attack in the corresponding time domain.

  3. Dirac-Hartree-Fock studies of X-ray transitions in meitnerium

    International Nuclear Information System (INIS)

    Thierfelder, C.; Schwerdtfeger, P.; Hessberger, F.P.; Hofmann, S.

    2008-01-01

    The K -shell and L -shell ionizations potentials for 268 109 Mt were calculated at the Dirac-Hartree-Fock level taking into account quantum electrodynamic and finite nuclear-size effects. The K α1 transition energies for different ionization states are accurately predicted and compared with recent experiments in the α -decay of 272 111 Rg. (orig.)

  4. Nuclear Data Evaluations at Manipal University: A=260-265. Status Report: March 31, 2011 to March 31, 2013

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, M. [Manipal University, Manipal (India); Burrows, T. W. [Brookhaven National Laboratory, National Nuclear Data Center, Upton, NY (United States)

    2013-08-15

    A=260-265: The evaluation methodology developed in 2005Gu33 (A=266-294) has been applied to the mass region A=260-265. While the evaluation technique is based on 1992Ba77, additional evaluation tools include using the approximations of 1984Sc13 for estimates of half-lives and an updated parameter set for the Viola-Seaborg phenomenology (1966Vi04). The nuclides which form the subject matter of the present evaluation were covered in 1999Ar21, 1999Ak02, and 2001Ak11 and 2000Fi12 ({sup 265}Rf). New data are available and an update is due. Also, some of the {alpha}-decay mass chains from heavier nuclei (A{>=}266) end in this region and it was felt that the same evaluation methodology adopted for (distant) ancestors could be usefully extended to descendants within a given {alpha}-decay chain for consistency and uniformity of treatment. In instances where no new data are available, a re-evaluation of existing data within this internally consistent framework also yields useful information. The current evaluation spans about 9 elements comprising about Almost-Equal-To 31 observed nuclides. Approximately 40% of these nuclides have been experimentally studied using chemical techniques which often provide increased statistics and could be used for independent verification of the data. Relevant experimental quantities such as information on cross-sections and atomic properties derived from chemical studies are also provided. Future plans are presented.

  5. Tracking the Hercules 265 marine gas well blowout in the Gulf of Mexico

    Science.gov (United States)

    Romero, Isabel C.; Özgökmen, Tamay; Snyder, Susan; Schwing, Patrick; O'Malley, Bryan J.; Beron-Vera, Francisco J.; Olascoaga, Maria J.; Zhu, Ping; Ryan, Edward; Chen, Shuyi S.; Wetzel, Dana L.; Hollander, David; Murawski, Steven A.

    2016-01-01

    On 23 July 2013, a marine gas rig (Hercules 265) ignited in the northern Gulf of Mexico. The rig burned out of control for 2 days before being extinguished. We conducted a rapid-response sampling campaign near Hercules 265 after the fire to ascertain if sediments and fishes were polluted above earlier baseline levels. A surface drifter study confirmed that surface ocean water flowed to the southeast of the Hercules site, while the atmospheric plume generated by the blowout was in eastward direction. Sediment cores were collected to the SE of the rig at a distance of ˜0.2, 8, and 18 km using a multicorer, and demersal fishes were collected from ˜0.2 to 8 km SE of the rig using a longline (508 hooks). Recently deposited sediments document that only high molecular weight (HMW) polycyclic aromatic hydrocarbon (PAH) concentrations decreased with increasing distance from the rig suggesting higher pyrogenic inputs associated with the blowout. A similar trend was observed in the foraminifera Haynesina germanica, an indicator species of pollution. In red snapper bile, only HMW PAH metabolites increased in 2013 nearly double those from 2012. Both surface sediments and fish bile analyses suggest that, in the aftermath of the blowout, increased concentration of pyrogenically derived hydrocarbons was transported and deposited in the environment. This study further emphasizes the need for an ocean observing system and coordinated rapid-response efforts from an array of scientific disciplines to effectively assess environmental impacts resulting from accidental releases of oil contaminants.

  6. Proton-induced fission of actinides at energies 26.5 and 62.9 MeV--Theoretical interpretation

    International Nuclear Information System (INIS)

    Demetriou, P.; Keutgen, Th.; Prieels, R.; El Masri, Y.

    2011-01-01

    Fission properties of proton-induced fission on 232 Th, 237 Np, 238 U, 239 Pu and 241 Am targets, measured at the Louvain-la-Neuve cyclotron facility at proton energies of 26.5 and 62.9 MeV, are compared with the predictions of the state-of-the-art nuclear reaction code TALYS. The sensitivity of the calculations to the input parameters of the code and possible improvements are discussed.

  7. Identification of a novel linear B-cell epitope in the UL26 and UL26.5 proteins of Duck Enteritis Virus

    Directory of Open Access Journals (Sweden)

    Kong Xiangang

    2010-09-01

    Full Text Available Abstract Background The Unique Long 26 (UL26 and UL26.5 proteins of herpes simplex virus are known to function during the assembly of the viruses. However, for duck enteritis virus (DEV, which is an unassigned member of the family Herpesviridae, little information is available about the function of the two proteins. In this study, the C-terminus of DEV UL26 protein (designated UL26c, which contains the whole of UL26.5, was expressed, and the recombinant UL26c protein was used to immunize BALB/c mice to generate monoclonal antibodies (mAb. The mAb 1C8 was generated against DEV UL26 and UL26.5 proteins and used subsequently to map the epitope in this region. Both the mAb and its defined epitope will provide potential tools for further study of DEV. Results A mAb (designated 1C8 was generated against the DEV UL26c protein, and a series of 17 partially overlapping fragments that spanned the DEV UL26c were expressed with GST tags. These peptides were subjected to enzyme-linked immunosorbent assay (ELISA and western blotting analysis using mAb 1C8 to identify the epitope. A linear motif, 520IYYPGE525, which was located at the C-terminus of the DEV UL26 and UL26.5 proteins, was identified by mAb 1C8. The result of the ELISA showed that this epitope could be recognized by DEV-positive serum from mice. The 520IYYPGE525 motif was the minimal requirement for reactivity, as demonstrated by analysis of the reactivity of 1C8 with several truncated peptides derived from the motif. Alignment and comparison of the 1C8-defined epitope sequence with those of other alphaherpesviruses indicated that the motif 521YYPGE525 in the epitope sequence was conserved among the alphaherpesviruses. Conclusion A mAb, 1C8, was generated against DEV UL26c and the epitope-defined minimal sequence obtained using mAb 1C8 was 520IYYPGE525. The mAb and the identified epitope may be useful for further study of the design of diagnostic reagents for DEV.

  8. 42 CFR 137.265 - May a Tribe be reimbursed for actual and reasonable close out costs incurred after the effective...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false May a Tribe be reimbursed for actual and reasonable... HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Reassumption § 137.265 May a Tribe be reimbursed for... be reimbursed for actual and reasonable close out costs incurred after the effective date of...

  9. 2007 Nuclear Data Review

    International Nuclear Information System (INIS)

    Holden, N.E.

    2008-01-01

    The results of a review and evaluation of neutron and non-neutron nuclear data published in the scientific literature are presented. The status of new chemical elements is examined. Data on revised values for the isotopic composition of the elements are reviewed and recommended values are presented. Half-lives of very long-lived nuclides are presented, including double beta decay, double electron capture, long-lived alpha decay and long-lived beta decay. Data from new measurements on the very heavy elements (trans-meitnerium elements) are discussed and tabulated. The first observation of the radioactive decay mode of the free neutron is discussed. New measurements that have expanded the neutron drip line for magnesium and aluminum are discussed. Data on recent neutron cross-section and resonance integral measurements are also discussed

  10. Comparative assessment of H.265/MPEG-HEVC, VP9, and H.264/MPEG-AVC encoders for low-delay video applications

    Science.gov (United States)

    Grois, Dan; Marpe, Detlev; Nguyen, Tung; Hadar, Ofer

    2014-09-01

    The popularity of low-delay video applications dramatically increased over the last years due to a rising demand for realtime video content (such as video conferencing or video surveillance), and also due to the increasing availability of relatively inexpensive heterogeneous devices (such as smartphones and tablets). To this end, this work presents a comparative assessment of the two latest video coding standards: H.265/MPEG-HEVC (High-Efficiency Video Coding), H.264/MPEG-AVC (Advanced Video Coding), and also of the VP9 proprietary video coding scheme. For evaluating H.264/MPEG-AVC, an open-source x264 encoder was selected, which has a multi-pass encoding mode, similarly to VP9. According to experimental results, which were obtained by using similar low-delay configurations for all three examined representative encoders, it was observed that H.265/MPEG-HEVC provides significant average bit-rate savings of 32.5%, and 40.8%, relative to VP9 and x264 for the 1-pass encoding, and average bit-rate savings of 32.6%, and 42.2% for the 2-pass encoding, respectively. On the other hand, compared to the x264 encoder, typical low-delay encoding times of the VP9 encoder, are about 2,000 times higher for the 1-pass encoding, and are about 400 times higher for the 2-pass encoding.

  11. The use of droplet digital PCR in liquid biopsies: A highly sensitive technique for MYD88 p.(L265P) detection in cerebrospinal fluid.

    Science.gov (United States)

    Hiemcke-Jiwa, Laura S; Minnema, Monique C; Radersma-van Loon, Joyce H; Jiwa, N Mehdi; de Boer, Mirthe; Leguit, Roos J; de Weger, Roel A; Huibers, Manon M H

    2018-04-01

    The gold standard for diagnosis of central nervous system lymphomas still regards a stereotactic brain biopsy, with the risk of major complications for the patient. As tumor cells can be detected in cerebrospinal fluid (CSF), CSF analysis can be used as an alternative. In this respect, mutation analysis in CSF can be of added value to other diagnostic parameters such a cytomorphology and clonality analysis. A well-known example of targeted mutation analysis entails MYD88 p.(L265P) detection, which is present in the majority of Bing Neel syndrome and primary central nervous system lymphoma (PCNSL) patients. Unfortunately, tumor yield in CSF can be very low. Therefore, use of the highly sensitive droplet digital PCR (ddPCR) might be a suitable analysis strategy for targeted mutation detection. We analyzed 26 formalin fixed paraffin embedded (FFPE) samples (8 positive and 18 negative for MYD88 p.(L265P) mutation) by ddPCR, of which the results were compared with next generation sequencing (NGS). Subsequently, 32 CSF samples were analyzed by ddPCR. ddPCR and NGS results on FFPE material showed 100% concordance. Among the 32 CSF samples, 9 belonged to patients with lymphoplasmacytic lymphoma (LPL) and clinical suspicion of Bing Neel syndrome, and 3 belonged to patients with PCNSL. Nine of these samples tested positive for MYD88 p.(L265P) (8 LPL and 1 PCNSL). This study shows that sensitive MYD88 mutation analysis by ddPCR in CSF is highly reliable and can be applied even when DNA input is low. Therefore, ddPCR is of added value to current diagnostic parameters, especially when the available amount of DNA is limited. Copyright © 2017 John Wiley & Sons, Ltd.

  12. Effect of thickness on microwave absorptive behavior of La-Na doped Co-Zr barium hexaferrites in 18.0–26.5 GHz band

    Energy Technology Data Exchange (ETDEWEB)

    Arora, Amit [D.A.V. Institute of Engineering and Technology, Jalandhar (India); Narang, Sukhleen Bindra, E-mail: sukhleen2@yahoo.com [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India); Pubby, Kunal [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India)

    2017-02-01

    In this research, the microwave properties of Lanthanum-Sodium doped Cobalt-Zirconium barium hexaferrites, intended as microwave absorbers, are analyzed on Vector Network Analyzer in K-band. The results indicate that the doping has resulted in lowering of real permittivity and enhancement of dielectric losses. Real permeability has shown increase while magnetic losses have shown decrease in value with doping. All these four properties have shown very small variation with frequency in the scanned frequency range which indicates the relaxation type of behavior. Microwave absorption characteristics of these compositions are analyzed with change in sample thickness. The results demonstrate that the matching frequency of the microwave absorber shifts towards lower side of frequency band with increase in thickness. The complete analysis of the prepared microwave absorbers shows a striking achievement with very low reflection loss and wide absorption bandwidth for all the six compositions in 18–26.5 GHz frequency band. - Highlights: • Electromagnetic Characterization of M-hexaferrites in K-band (18–26.5 GHz) • Variation of absorption properties with thickness of sample. • Satisfaction of quarter-wavelength condition for absorption properties • Results of double-layer absorbers (not reports till day by anyone).

  13. Application of 265-nm UVC LED Lighting to Sterilization of Typical Gram Negative and Positive Bacteria

    Science.gov (United States)

    Lee, Yong Wook; Yoon, Hyung Do; Park, Jae-Hyoun; Ryu, Uh-Chan

    2018-05-01

    UV LED lightings have been displacing conventional UV lamps due to their high efficiency, long lifetime, etc. A sterilizing lighting was prepared by assembling a UV LED module composed of 265-nm UVC LEDs and a silica lens array with a driver module comprised of a driver IC controlling pulse width modulation and constant current. The silica lens array was designed and fabricated to focus UV beam and simultaneously to give a uniform light distribution over specimens. Then pasteurizing effect of the lighting was analyzed for four kinds of bacteria and one yeast which are dangerous to people with low immunity. Sterilizing tests on these germs were carried out at the both exposure distances of 10 and 100 mm for various exposure durations up to 600 s.

  14. 12C(n , 2 n )11C cross section from threshold to 26.5 MeV

    Science.gov (United States)

    Yuly, M.; Eckert, T.; Hartshaw, G.; Padalino, S. J.; Polsin, D. N.; Russ, M.; Simone, A. T.; Brune, C. R.; Massey, T. N.; Parker, C. E.; Fitzgerald, R.; Sangster, T. C.; Regan, S. P.

    2018-02-01

    The 12C(n ,2 n )11C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3H(d ,n )4He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β+ decay of 11C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1H(n ,p ) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  15. Combustion inputs into a terrestrial archive over 265 years as evidenced by BPCA molecular markers

    Science.gov (United States)

    Hanke, Ulrich M.; Eglinton, Timothy I.; Wiedemeier, Daniel B.; Schmidt, Michael W. I.

    2015-04-01

    Pyrogenic organic matter (PyOM) such as char and soot is produced during the incomplete combustion of biomass and fossil fuel. It is composed of condensed aromatic structures and can resist degradation processes, maybe over long periods of time. Land-use changes, industrial activity and its transport by wind and water affect the fluxes of PyOM from the source to its sedimentary archive. Investigating environmental PyOM with the molecular marker benzene polycarboxylic acid (BPCA) method provides various information about quantity, quality (BPCA distribution pattern) and about its isotopic composition (13C and 14C). Assessing PyOM quality can indicate whether it is mostly combustion condensate (soot) or combustion residue (charcoal) and potentially allow source apportionment. Our study area is the Pettaquamscutt River catchment area (35 km2), Rhode Island, U.S.A. It is located down-wind of industrial areas recording deposition of long-distance atmospheric transport as well as local catchment inputs, both from natural and anthropogenic sources. We investigated 50 samples of a sediment record over a time span of 265 years (1733-1998 AD). Previous investigations provided information on the age of deposition, the content of polycyclic aromatic hydrocarbons (PAH) as well as of the radiocarbon contents of total organic carbon (TOC) and PAH (Lima, 2004). We used the BPCA molecular marker method to quantify and characterize PyOM in the same record. First results show that quantity and quality of PyOM change over 265 years. Our investigation aims at understanding how different sources of PyOM are reflected in terrestrial archives by comparing the results of BPCA with radiocarbon-dated TOC and PAH records. Among other aspects, the PAH record reflects the Great Depression and the 1970s oil embargo in North America. We interpret the BPCA distribution patterns regarding the simultaneous shift of dominant fuels including wood, coal, petroleum and gas. Future work will include

  16. The 12C(n, 2n)11C cross section from threshold to 26.5 MeV.

    Science.gov (United States)

    Yuly, M; Eckert, T; Hartshaw, G; Padalino, S J; Polsin, D N; Russ, M; Simone, A T; Brune, C R; Massey, T N; Parker, C E; Fitzgerald, R; Sangster, T C; Regan, S P

    2018-02-01

    The 12 C(n, 2n) 11 C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3 H(d,n) 4 He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β + decay of 11 C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1 H(n,p) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  17. Measurement of the reaction {gamma}p{yields}K{sup 0}{sigma}{sup +} for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA; Messung der Reaktion {gamma}p {yields} K{sup 0}{sigma}{sup +} fuer Photonenergien bis 2.65 GeV mit dem SAPHIR-Detektor an ELSA

    Energy Technology Data Exchange (ETDEWEB)

    Lawall, R.

    2004-01-01

    The reaction {gamma}p {yields} K{sup 0}{sigma}{sup +} was measured with the SAPHIR-detector at ELSA during the run periods 1997 and 1998. Results were obtained for cross sections in the photon energy range from threshold up to 2.65 GeV for all production angles and for the {sigma}{sup +}-polarization. Emphasis has been put on the determination and reduction of the contributions of background reactions and the comparison with other measurements and theoretical predictions. (orig.)

  18. High-temperature creep of equiaxed Cd-26.5 at % Zn eutectic in the superplastic regime

    International Nuclear Information System (INIS)

    Tonejc, Anton; Poirier, J.-P.

    1976-01-01

    The temperature and stress dependence on the secondary creep rate of the Cd+26.5Zn eutectoid in the superplastic domain was studied in constant-stress compression creep. Experiments were performed in the following ranges of temperature, stress and grain size: 170C 2 , 1<10μm. In all cases secondary creep was established after a strain approximately equal to 4%. For temperatures higher than 200C all the techniques yielded the same value for m (m=0.49+-0.03) in the whole investigated range of stresses. For T=170C a lower value of m was found (m=0.33). The activation energy was determined and found equal to 25Kcal/mol. Micrographic examinations were performed on sectioned samples at several stages of deformation. The grain size was found to be identical for various conditions of temperature and stress and very stable with respect to deformation. The experimental results of the creep tests are discussed in relation with the microstructural aspects

  19. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. I. Overall retardation from the stage irradiated to nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Neuroblasts of Chortophaga viridifasciata (DeGeer) in culture were exposed to different doses of 225, 265, or 280 nm ultraviolet radiations at 11 different stages and substages of the mitotic cycle and individually selected cells were timed to breakdown of the nuclear membrane. Comparisons of the effectiveness of different wavelengths on the different stages were based on the dose that reduced the cell progression rate to 67 percent of normal (D 67 ) and the slope of the regression line, i.e., the control to treated time (C/T) ratio change/erg/mm 2 at the D 67 level. Cells of the prereplication period (metaphase + anaphase + early telophase) and the S phase (middle and late telophase + interphase + very early prophase) are equally sensitive to uv and contrast sharply with the much lower sensitivity of those in the postreplication period (early and middle prophase). This can best be interpreted if chromosomal DNA is the chromophore for uv-induced mitotic retardation. Cells in the prereplication period at exposure show no wavelength effect. In the S phase all stages except middle telophase and all stages combined are significantly more sensitive to 265 and 280 nm than to 225 nm. Of the postreplication stages, early prophase is retarded significantly more by 280 than by 225 or 265 nm. The C/T ratio/erg/mm 2 is greater after exposure to 265 nm at all prereplication and replication stages, but exhibits no consistent wavelength pattern during the postreplication period. Evidence based on the orientation of the neuroblast with respect to the uv-source suggests that the chromophore for mitotic retardation does not reside within the centrosome and related structures, but may be present, at least partly, in the nucleolus

  20. Fission properties of actinide nuclei from proton-induced fission at 26.5 and 62.9 MeV incident proton energies

    International Nuclear Information System (INIS)

    Demetriou, P.; Keutgen, Th.; Prieels, R.; El Masri, Y.

    2010-01-01

    Fission properties of proton-induced fission on 232 Th, 237 Np, 238 U, 239 Pu, and 241 Am targets, measured at the Louvain-la-Neuve cyclotron facility at proton energies of 26.5 and 62.9 MeV, are compared with the predictions of the state-of-the-art nuclear reaction code talys. The code couples the multimodal random neck-rupture model with the pre-equilibrium exciton and statistical models to predict fission fragment mass yields, pre- and post-scission neutron multiplicities, and total fission cross sections in a consistent approach. The sensitivity of the calculations to the input parameters of the code and possible improvements are discussed in detail.

  1. Investigation of Chlorella vulgaris UTEX 265 Cultivation under Light and Low Temperature Stressed Conditions for Lutein Production in Flasks and the Coiled Tree Photo-Bioreactor (CTPBR).

    Science.gov (United States)

    Gong, Mengyue; Bassi, Amarjeet

    2017-10-01

    Lutein has an increasing share in the pharmaceutical and nutraceutical market due to its benefits to eye health. Microalgae may be a potential source for lutein production while the expense limits the commercialization. In this study, a coiled tubular tree photobioreactor (CTPBR) design was investigated for cultivating the cold tolerant microalgae Chlorella vulgaris UTEX 265 under various conditions for lutein production. The influence and interaction of light irradiance strength, lighting cycle, and temperature on microalgae and lutein production efficiency at low temperature range were also studied in flasks via response surface method (RSM). The results demonstrated that 14 h day-light, 120 μmol photons m -2  s -1 , and 10 °C was the optimal condition for algae growth and lutein production at low temperature experimental ranges. C. vulgaris UTEX 265 showed good potential to produce lutein in cold weather, and the optimum lutein production was contrary to the specific lutein content but corresponds to the trend of optimum growth. Additionally, fast growth (μ = 1.50 day -1 ) and good lutein recovery (11.98 mg g -1  day -1 ) in CTPBR were also achieved at the low irradiance stress condition and the low temperature photo-inhibition conditions.

  2. 265 nm laser flash photolysis of some ortho-substituted anilides and related N-formylkynurenine derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Pileni, M P; Santus, R [Museum National d' Histoire Naturelle, 75 - Paris (France); Land, E J

    1978-06-01

    The physical and chemical properties of the triplet state of eight ortho-substituted anilides including N-formylkynurenine(FK), the major trp UV-photooxidation product and a remarkable photodynamic agent, have been investigated using both pulse radiolysis and 265 nm laser flash photolysis techniques. The molar extinction coefficient, the inter-system-crossing quantum yield and the oscillator strength of the T/sub 1/..-->..Tsub(n) absorption band (lambdasub(max)approximately equal 450nm) have been determined. It is shown that anilides having n..pi..* triplets readily react with most solvents whereas those having ..pi..,..pi..* triplets slowly react with alcohols. In both cases, the semi-reduced species are formed. In water, the formation of the semi-reduced species most probably involves the first excited singlet state. The triplet state properties of the FK derivatives (i.e. ortho-substituted anilides having a side chain bearing charged groups such as carboxylic or amino groups) are strongly modified by the ionization state of the charged side chain. In the case of the FK derivatives possessing an uncharged amino group, quenching of the triplet state occurs via a fast reversible electron transfer reaction from the NH/sub 2/ to the triplet anilide.

  3. High-Power Single-Mode 2.65-micron InGaAsSb/AlInGaAsSb Diode Lasers

    Science.gov (United States)

    Frez, Clifford F.; Briggs, Ryan M.; Forouhar, Siamak; Borgentun, Carl E.; Gupta, James

    2013-01-01

    Central to the advancement of both satellite and in-situ science are improvements in continuous-wave and pulsed infrared laser systems coupled with integrated miniaturized optics and electronics, allowing for the use of powerful, single-mode light sources aboard both satellite and unmanned aerial vehicle platforms. There is a technological gap in supplying adequate laser sources to address the mid-infrared spectral window for spectroscopic characterization of important atmospheric gases. For high-power applications between 2 to 3 micron, commercial laser technologies are unsuitable because of limitations in output power. For instance, existing InP-based laser systems developed for fiber-based telecommunications cannot be extended to wavelengths longer than 2 micron. For emission wavelengths shorter than 3 micron, intersubband devices, such as infrared quantum cascade lasers, become inefficient due to band-offset limitations. To date, successfully demonstrated singlemode GaSb-based laser diodes emitting between 2 and 3 micron have employed lossy metal Bragg gratings for distributed- feedback coupling, which limits output power due to optical absorption. By optimizing both the quantum well design and the grating fabrication process, index-coupled distributed-feedback 2.65-micron lasers capable of emitting in excess of 25 mW at room temperature have been demonstrated. Specifically, lasers at 3,777/cm (2.65 micron) have been realized to interact with strong absorption lines of HDO and other isotopologues of H2O. With minor modifications of the optical cavity and quantum well designs, lasers can be fabricated at any wavelength within the 2-to-3-micron spectral window with similar performance. At the time of this reporting, lasers with this output power and wavelength accuracy are not commercially available. Monolithic ridge-waveguide GaSb lasers were fabricated that utilize secondorder lateral Bragg gratings to generate single-mode emission from InGaAsSb/ Al

  4. Study of the reaction γp→K+Σ-π+ for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA

    International Nuclear Information System (INIS)

    Schulday, I.

    2004-10-01

    The reaction γp→K + Σ - π + was measured in the photon energy range from threshold up to 2.65 GeV. The cross section is dominated by the production of the resonances Σ(1385), Λ(1405) and Λ(1520) which decay into Σ - π + . Cross sections were obtained as a function of the photon energy and the K + production angle for the reaction and the resonance production. The cross section for Λ(1520) rises up to (0.230±0.029) μb in the photon energy range 1.80 γ -2 . The polar decay angular distribution is consistent with being flat. (orig.)

  5. Sinterability and conductivity of barium doped aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} electrolyte of solid oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Cao Xiaoguo [Faculty of Materials and Energy, Guangdong University of Technology, Guangzhou 510006, Guangdong (China); Jiang Sanping, E-mail: s.jiang@curtin.edu.au [Fuels and Energy Technology Institute and Department of Chemical Engineering, Curtin University, Perth, WA 6102 (Australia)

    2012-05-15

    Highlights: Black-Right-Pointing-Pointer Ba doping enhances the sintering and densification properties of aluminium lanthanum apatite. Black-Right-Pointing-Pointer Ba doping improves the oxide conductivity of aluminium lanthanum apatite. Black-Right-Pointing-Pointer The enhancement of Ba doping is mainly due to the significantly reduced grain boundary resistance of the aluminium lanthanum apatite. - Abstract: Apatite ceramics are interesting alternative solid oxide fuel cells (SOFCs) electrolytes because of their open structure for the transportation of oxide ions and their good chemical stability. This study reports the influence of barium doping on the microstructure, sinterability and oxide conductivity properties of the aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5}. SEM results show that lanthanum substitution with barium improves the sinterability of apatite ceramics. The barium doping also enhances the conductivity of the aluminium lanthanum silicates. The oxygen ion conductivity of La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} sintered at 1600 Degree-Sign C is 2.21 Multiplication-Sign 10{sup -2} S cm{sup -1} at 800 Degree-Sign C, higher than 9.81 Multiplication-Sign 10{sup -3} S cm{sup -1} of La{sub 10}Si{sub 5}AlO{sub 26.5} sample prepared under the same conditions. The results in the present study demonstrate that doping Ba on the La site for aluminium lanthanum oxyapatite reduces the sintering temperature and improves the ion conductivity. The enhancement of Ba dopant is mainly on the improvement of the densification and thus substantially reduced grain boundary resistance of aluminium lanthanum oxyapatite particularly at low temperatures.

  6. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  7. Preliminary results on effect of H2S on P265GH commercial material for natural gases and petroleum transportation

    Science.gov (United States)

    Zaharia, Marius Gabriel; Stanciu, Sergiu; Cimpoesu, Ramona; Ionita, Iulian; Cimpoesu, Nicanor

    2018-04-01

    A commercial Fe-C material (P265GH) used for natural gas delivery and transportation systems was analyzed in H2S atmosphere in order to establish the corrosion resistance. In most of the industrial processes for gas purification the corrosion rate is speed up by the presence of sulphur (S) especially as ions (HS-, SO32-) or different species like H2S. The H2S (hydrogen sulphide) is, beside a very toxic compound, a very active element in the acceleration of metallic materials deterioration. For experiments we used a three electrodes cell with Na2SO4 + Na2S solution at pH 3 for two different temperatures, room temperature ∼ 25 °C (sample 1) and at 60 (sample 2) ±1 °C in order to realize EIS (electrochemical impedance spectroscopy) and potentiodynamic polarization. After electro-chemical tests and corrosion resistance characterisation the material surface was analyzed using scanning electron microscopy (SEM), X-ray diffraction (XRD) and energy dispersive spectroscopy (EDS).

  8. Light extraction enhancement of 265 nm deep-ultraviolet light-emitting diodes with over 90 mW output power via an AlN hybrid nanostructure

    Energy Technology Data Exchange (ETDEWEB)

    Inoue, Shin-ichiro, E-mail: s-inoue@nict.go.jp [Advanced ICT Research Institute, National Institute of Information and Communications Technology (NICT), Kobe, Hyogo 651-2492 (Japan); Naoki, Tamari [Advanced ICT Research Institute, National Institute of Information and Communications Technology (NICT), Kobe, Hyogo 651-2492 (Japan); Tsukuba Research Laboratories, Tokuyama Corporation, Tsukuba, Ibaraki 300-4247 (Japan); Kinoshita, Toru; Obata, Toshiyuki; Yanagi, Hiroyuki [Tsukuba Research Laboratories, Tokuyama Corporation, Tsukuba, Ibaraki 300-4247 (Japan)

    2015-03-30

    Deep-ultraviolet (DUV) aluminum gallium nitride-based light-emitting diodes (LEDs) on transparent aluminum nitride (AlN) substrates with high light extraction efficiency and high power are proposed and demonstrated. The AlN bottom side surface configuration, which is composed of a hybrid structure of photonic crystals and subwavelength nanostructures, has been designed using finite-difference time-domain calculations to enhance light extraction. We have experimentally demonstrated an output power improvement of up to 196% as a result of the use of the embedded high-light-extraction hybrid nanophotonic structure. The DUV-LEDs produced have demonstrated output power as high as 90 mW in DC operation at a peak emission wavelength of 265 nm.

  9. Clinical results of excimer laser photorefractive keratectomy: a multicenter study of 265 eyes.

    Science.gov (United States)

    Aron-Rosa, D S; Colin, J; Aron, B; Burin, N; Cochener, B; Febraro, J L; Gallinaro, C; Ganem, S; Valdes, R

    1995-11-01

    Efficacy, predictability, and safety of excimer laser photorefractive keratectomy were evaluated at centers in Paris and Brest, France. Photoablation was performed with the VISX laser on 265 eyes (151 at the Paris center and 114 at the Brest center). The eyes were clinically and statistically evaluated over a six month follow-up. Initial myopia ranged from -0.7 to -19.4 diopters (D) (mean spherical equivalent [SE] -5.9 D) in the Paris center and from -0.9 to -14.5 D (SE -4.5 D) in the Brest center. At both centers, the mean uncorrected visual acuity was worse than 20/200; over 90% of cases in each center had a best uncorrected visual acuity of 20/100 or worse. Results are reported globally and for subgroups of myopia: Group A, SE better than or equal to -3.0 D; Group B, SE worse than -3.0 D and better than or equal to -7.0 D; Group C, SE worse than -7.0 D. Uncorrected visual acuity was significantly improved in the patients followed for six months; 64% of Paris cases and 62% of Brest cases obtained an uncorrected visual acuity of 20/40 or better. Predictability of the treatment was good; 67% of Paris eyes and 74% of Brest eyes were less than 1.0 D from the intended correction after six months. The data suggest that the initial myopia affected the efficacy and predictability of the treatment; results in the mild to moderate myopia eyes were significantly better than results in the severe myopia eyes. One case of visual acuity regression (less than one line) was observed in the two groups. This was associated with corneal haze of moderate intensity.

  10. Study of the reaction {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA; Untersuchung der Reaktion {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} fuer Photonenenergien bis 2.65 GeV mit dem SAPHIR-Detektor an ELSA

    Energy Technology Data Exchange (ETDEWEB)

    Schulday, I.

    2004-10-01

    The reaction {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} was measured in the photon energy range from threshold up to 2.65 GeV. The cross section is dominated by the production of the resonances {sigma}(1385), {lambda}(1405) and {lambda}(1520) which decay into {sigma}{sup -}{pi}{sup +}. Cross sections were obtained as a function of the photon energy and the K{sup +} production angle for the reaction and the resonance production. The cross section for {lambda}(1520) rises up to (0.230{+-}0.029) {mu}b in the photon energy range 1.80

  11. A No-Reference Modular Video Quality Prediction Model for H.265/HEVC and VP9 Codecs on a Mobile Device

    Directory of Open Access Journals (Sweden)

    Debajyoti Pal

    2017-01-01

    Full Text Available We propose a modular no-reference video quality prediction model for videos that are encoded with H.265/HEVC and VP9 codecs and viewed on mobile devices. The impairments which can affect video transmission are classified into two broad types depending upon which layer of the TCP/IP model they originated from. Impairments from the network layer are called the network QoS factors, while those from the application layer are called the application/payload QoS factors. Initially we treat the network and application QoS factors separately and find out the 1 : 1 relationship between the respective QoS factors and the corresponding perceived video quality or QoE. The mapping from the QoS to the QoE domain is based upon a decision variable that gives an optimal performance. Next, across each group we choose multiple QoS factors and find out the QoE for such multifactor impaired videos by using an additive, multiplicative, and regressive approach. We refer to these as the integrated network and application QoE, respectively. At the end, we use a multiple regression approach to combine the network and application QoE for building the final model. We also use an Artificial Neural Network approach for building the model and compare its performance with the regressive approach.

  12. Dynamics and Fragmentation of Hydrogen Bonded and van der Waal Clusters upon 26.5 eV Soft X-ray Laser Ionization

    Science.gov (United States)

    Dong, Feng; Heinbuch, Scott; Bernstein, Elliot; Rocca, Jorge

    2006-05-01

    A desk-top soft x-ray laser is applied to the study of water, methanol, ammonia, sulfur dioxide, carbon dioxide, mixed sulfur dioxide-water, and mixed carbon dioxide-water clusters through single photon ionization time of flight mass spectroscopy. Almost all of the energy above the vertical ionization energy is removed by the ejected electron. Protonated water, methanol, and ammonia clusters dominate the mass spectra for the first three systems. The temperatures of the neutral water and methanol clusters can be estimated. In the case of pure SO2 and CO2, the mass spectra are dominated by (SO2)n^+ and (CO2)n^+ cluster series. When a high or low concentration of SO2/CO2 is mixed with water, we observe (SO2/CO2)nH2O^+ or SO2/CO2(H2O)nH^+ in the mass spectra, respectively. The unimolecular dissociation rate constants for reactions involving loss of one neutral molecule are calculated for the protonated water, methanol, and ammonia clusters as well as for SO2 and CO2 clusters. We find that the 26.5 eV soft x-ray laser is a nearly ideal tool for the study of hydrogen bonded and van der Waals cluster systems and we are currently exploring its usefulness for other more strongly bound systems.

  13. Evaluation of used methodology/methods in Aespoe HRL. Sections 0/700-1/475 and 1/475-2/265

    International Nuclear Information System (INIS)

    Andersson, Kjell; Sundquist, U.; Torssander, P.

    1997-01-01

    Some of the main objectives with the Aespoe Hard Rock Laboratory is reviewing and verifying the suitability of different investigations methods regarding bedrock characterization, test methods for detailed site investigations and to evaluate factors of importance for safety in realistic conditions. The SKB evaluation will result in a strategy planned to be used in the forthcoming site selection of a repository for high level radioactive waste. This report presents an evaluation of the methods used by SKB in the prediction of the bedrock prior to excavation. The prediction was based on the pre investigations carried out during 1986-1990. The review has followed the SKB classification of issue areas: geological/structural model, groundwater flow, groundwater chemistry, transport of solutes and mechanical stability. The review concerns SKB's objectives with the prediction and the different criteria for selection of variables - considering the demands of the performance assessment. This report includes evaluation of two tunnel sections, 0/700 - 1/475 and 1/475 - 2/265, comprising used data, prediction methods and prediction accuracy. By way of comparing predictions before excavation and outcome in the tunnel, a strict validation was performed. Based on the results from the validation, the applicability of different methods was estimated and the predictability of different subjects was assessed. It should be emphasised that the Aespoe predictions have not been directly intended for performance assessment purposes. However, it is of interest to see how the predictions relate to the information needs of performance assessment. By this it is possible to identify areas where more work needs to be done in the future, either in the operational phases at Aespoe or in other parts of the SKB program, thereby setting the predictions in an overall perspective from the point of view of performance assessment

  14. High education is associated with low fat and high fibre, beta-carotene and vitamin C - Computation of nutrient intake based on a short food frequency questionnaire in 17,265 men and women in the Tromsø Study

    Directory of Open Access Journals (Sweden)

    Bjarne Koster Jacobsen

    2009-11-01

    Full Text Available  ABSTRACTEducational level has been correlated to the intake of several nutrients. In a population-based studyincluding 17,265 men and women aged 25-69 years, the intake of nutrients were calculated based on 37questions about food habits. In this paper, we present results from the dietary survey with emphasis onthe relationships between dietary habits and educational level. Compared to subjects with low formaleducation, subjects with high educational level have less fat in their diet and more dietary fibre, betacarotene,vitamin C and alcohol (p-value for linear trend is associated with healthy food habits and relatively higher alcohol consumption. There is a need forefforts in order to change the food habits of the less educated.NORSK SAMMENDRAGPersoner med lang utdanning har ofte et bedre kosthold enn personer med kortere utdanning. I denneundersøkelsen har vi estimert inntaket av en rekke næringsstoffer basert på 37 spørsmål om kostvanersom ble stilt til personer som tok del i Tromsø-IV-undersøkelsen (1994/95. Vår studie inkluderer 17 265menn og kvinner i Tromsø i alderen 25-69 år. Vi presenterer resultater fra denne kostholdsundersøkelsenmed vekt på relasjoner mellom kostvaner og utdanningslengde. Sammenlignet med personer med kortformell utdanning, har personer med lang utdanning mindre fett i kosten og høyere inntak av fiber, betakaroten,vitamin C og alkohol (p helsemessig gunstigere kosthold, men et høyere alkoholinntak, enn personer med kort utdanning.Funnene understreker behovet for målrettede tiltak for å utjevne sosiale forskjeller i kostvaner i Norge.

  15. Study of the photoproduction of the vector meson Φ(1020) and the hyperon Λ(1520) from the production threshold up to a photon energy of 2.65 GeV with SAPHIR

    International Nuclear Information System (INIS)

    Wiegers, B.

    2001-05-01

    The photoproduction of the vector meson φ(1020) and the hyperon Λ(1520) have been measured in the finale state pK + K - from their thresholds up to 2.65 GeV using the high duty-factor electron accelerator ELSA and the 4π-detectorsystem SAPHIR. The t-dependence of φ(1020)-production shows an exponential behavior as expected from diffractive production. s-channel helicity conservation can be seen in the decay angular distribution in the helicity frame. The decay angular distribution in the Gottfried-Jackson frame is not conformable with the exchange of a Pomeron in the t-channel. For the first time, differential cross sections of the Λ(1520) photoproduction from the threshold are measured. The production angular distribution and the decay angular distribution in the Gottfried-Jackson frame show a K * exchange in the t-channel. (orig.)

  16. Ikaite solubility in seawater-derived brines at 1 atm and sub-zero temperatures to 265 K

    Science.gov (United States)

    Papadimitriou, Stathys; Kennedy, Hilary; Kennedy, Paul; Thomas, David N.

    2013-05-01

    The concentration-based (stoichiometric) equilibrium solubility product of ikaite (CaCO3·6H2O) in seawater and cryogenic seawater-derived brines was determined at 1 atm total pressure over the temperature range from -1.1 to -7.5 °C and the salinity range from 34 to 124 in temperature-salinity pairs representative of sea ice brines. The solubility measurements were obtained in solutions that were undersaturated and supersaturated with respect to ikaite by equilibration with CO2/N2 gas mixtures of known pCO2 (20-400 μatm). The solutions were then equilibrated with synthetic ikaite (seed) for up to 3 months in a closed system. Arrival of the solid-solution system at a long-term chemical equilibrium was indicated by attainment of constant chemical solution composition with respect to total dissolved calcium, total dissolved inorganic carbon, and total alkalinity. Using these measurements, the stoichiometric equilibrium solubility product of ikaite (Ksp,ikaite∗=[Ca][CO32-], in molkgsolution-2) was determined, with the carbonate ion concentration computed from the measured total alkalinity and total dissolved inorganic carbon concentrations. The computed carbonate ion concentration and, by extension, the Ksp,ikaite∗ are both contingent on solving the system of equations that describe the parameters of the CO2 system in seawater by extrapolation to the experimental salinity and temperature conditions. The results show that the pKsp,ikaite∗=-logKsp,ikaite∗ in seawater of salinity 34 at -1.1 °C was 5.362 ± 0.004 and that the pKsp,ikaite∗ in sea ice at the freezing point of brines of salinity greater than 34 can be described as a function of temperature (T, in K) by the equation, pKsp,ikaite∗=-15489.09608+623443.70216T-1+2355.14596lnT, in the temperature range of 265.15 K 1 month) approach to chemical equilibrium when incubated without seeding ikaite crystals. Simple modeling indicated that ikaite should not precipitate from sea ice brines evolving under

  17. Ga2O3 Schottky rectifiers with 1 ampere forward current, 650 V reverse breakdown and 26.5 MW.cm-2 figure-of-merit

    Science.gov (United States)

    Yang, Jiancheng; Ren, F.; Tadjer, Marko; Pearton, S. J.; Kuramata, A.

    2018-05-01

    A key goal for Ga2O3 rectifiers is to achieve high forward currents and high reverse breakdown voltages. Field-plated β-Ga2O3 Schottky rectifiers with area 0.01 cm2, fabricated on 10 μm thick, lightly-doped drift regions (1.33 x 1016 cm-3) on heavily-doped (3.6 x 1018 cm-3) substrates, exhibited forward current density of 100A.cm-2 at 2.1 V, with absolute current of 1 A at this voltage and a reverse breakdown voltage (VB) of 650V. The on-resistance (RON) was 1.58 x 10-2 Ω.cm2, producing a figure of merit (VB2/RON) of 26.5 MW.cm-2. The Schottky barrier height of the Ni was 1.04 eV, with an ideality factor of 1.02. The on/off ratio was in the range 3.3 x 106 - 5.7 x 109 for reverse biases between 5 and 100V. The reverse recovery time was ˜30 ns for switching from +2V to -5V. The results show the capability of β-Ga2O3 rectifiers to achieve exceptional performance in both forward and reverse bias conditions.

  18. The interaction between ApoA2 -265T>C polymorphism and dietary fatty acids intake on oxidative stress in patients with type 2 diabetes mellitus.

    Science.gov (United States)

    Zamani, Elham; Sadrzadeh-Yeganeh, Haleh; Sotoudeh, Gity; Keramat, Laleh; Eshraghian, Mohammadreza; Rafiee, Masoumeh; Koohdani, Fariba

    2017-08-01

    Apolipoprotein A2 (APOA2) -265T>C polymorphism has been studied in relation to oxidative stress and various dietary fatty acids. Since the interaction between APOA2 polymorphism and dietary fatty acids on oxidative stress has not yet discussed, we aimed to investigate the interaction on oxidative stress in type 2 diabetes mellitus (T2DM) patients. The subjects were 180 T2DM patients with known APOA2 genotype, either TT, TC or CC. Superoxide dismutase (SOD) activity was determined by colorimetric method. Total antioxidant capacity (TAC) and serum level of 8-isoprostane F2α were measured by spectrophotometry and ELISA, respectively. Dietary intake was collected through a food frequency questionnaire. Based on the median intake, fatty acids intake was dichotomized into high or low groups. The interaction between APOA2 polymorphism and dietary fatty acids intake was analyzed by ANCOVA multivariate interaction model. Higher than median intake of omega-6 polyunsaturated fatty acids (n-6 PUFA) was associated with increased serum level of 8-isoprostane F2α in subjects with TT/TC genotype (p = 0.004), and higher than median intake of omega-3 polyunsaturated fatty acids (n-3 PUFA) was associated with increased serum SOD activity in CC genotype (p fatty acids intake on oxidative stress. More investigations on different populations are required to confirm the interaction.

  19. 40 CFR Appendix 1 to Part 3 - Priority Reports

    Science.gov (United States)

    2010-07-01

    .... Response Plan Cover Sheet Oil Pollution Prevention certification to the truth and accuracy of information... 146.71. Certification of Closure and Post Closure Care, Post-Closure Notices Certification that... post-closure plan 264.115, 264.119, 264.119(b)(2), 264.120, 265.115, 265.119(b)(2), 265.120, 265.19...

  20. Technical complications during veno-venous extracorporeal membrane oxygenation and their relevance predicting a system-exchange--retrospective analysis of 265 cases.

    Directory of Open Access Journals (Sweden)

    Matthias Lubnow

    Full Text Available OBJECTIVES: Technical complications are a known hazard in veno-venous extracorporeal membrane oxygenation (vvECMO. Identifying these complications and predictive factors indicating a developing system-exchange was the goal of the study. METHODS: Retrospective study on prospectively collected data of technical complications including 265 adult patients (Regensburg ECMO Registry, 2009-2013 with acute respiratory failure treated with vvECMO. Alterations in blood flow resistance, gas transfer capability, hemolysis, coagulation and hemostasis parameters were evaluated in conjunction with a system-exchange in all patients with at least one exchange (n = 83. RESULTS: Values presented as median (interquartile range. Patient age was 50(36-60 years, the SOFA score 11(8-14.3 and the Murray lung injury Score 3.33(3.3-3.7. Cumulative ECMO support time 3411 days, 9(6-15 days per patient. Mechanical failure of the blood pump (n = 5, MO (n = 2 or cannula (n = 1 accounted for 10% of the exchanges. Acute clot formation within the pump head (visible clots, increase in plasma free hemoglobin (frHb, serum lactate dehydrogenase (LDH, n = 13 and MO (increase in pressure drop across the MO, n = 16 required an urgent system-exchange, of which nearly 50% could be foreseen by measuring the parameters mentioned below. Reasons for an elective system-exchange were worsening of gas transfer capability (n = 10 and device-related coagulation disorders (n = 32, either local fibrinolysis in the MO due to clot formation (increased D-dimers [DD], decreased platelet count; n = 24, or device-induced hyperfibrinolysis (increased DD, decreased fibrinogen [FG], decreased platelet count, diffuse bleeding tendency; n = 8, which could be reversed after system-exchange. Four MOs were exchanged due to suspicion of infection. CONCLUSIONS: The majority of ECMO system-exchanges could be predicted by regular inspection of the complete ECMO circuit, evaluation of gas exchange, pressure drop

  1. Seasonal and interannual variability in along-slope oceanic properties off the US West Coast: Inferences from a high-resolution regional model

    Science.gov (United States)

    Kurapov, A. L.; Pelland, N. A.; Rudnick, D. L.

    2017-07-01

    A 6 year, 2009-2014 simulation using a 2 km horizontal resolution ocean circulation model of the Northeast Pacific coast is analyzed with focus on seasonal and interannual variability in along-slope subsurface oceanic properties. Specifically, the fields are sampled on the isopycnal surface σ=26.5 kg m-3 that is found between depths of 150 and 300 m below the ocean surface over the continental slope. The fields analyzed include the depth z26.5, temperature T26.5, along-slope current v26.5, and the average potential vorticity PV between σ = 26.5 and 26.25 kg m-3. Each field is averaged in the cross-shore direction over the continental slope and presented as a function of the alongshore coordinate and time. The seasonal cycle in z26.5 shows a coherent upwelling-downwelling pattern from Mexico to Canada propagating to the north with a speed of 0.5 m s-1. The anomalously deep (-20 m) z26.5 displacement in spring-summer 2014 is forced by the southern boundary condition at 24°N as a manifestation of an emerging strong El Niño. The seasonal cycle in T26.5 is most pronounced between 36°N and 53°N indicating that subarctic waters are replaced by warmer Californian waters in summer with the speed close 0.15 m s-1, which is consistent with earlier estimates of the undercurrent speed and also present v26.5 analyses. The seasonal patterns and anomalies in z26.5 and T26.5 find confirmation in available long-term glider and shipborne observations. The PV seasonality over the slope is qualitatively different to the south and north of the southern edge of Heceta Bank (43.9°N).

  2. Apolipoprotein A2 -265 T>C polymorphism interacts with dietary fatty acids intake to modulate inflammation in type 2 diabetes mellitus patients.

    Science.gov (United States)

    Keramat, Laleh; Sadrzadeh-Yeganeh, Haleh; Sotoudeh, Gity; Zamani, Elham; Eshraghian, Mohammadreza; Mansoori, Anahita; Koohdani, Fariba

    2017-05-01

    Several investigations have been conducted regarding the interaction between Apolipoprotein A2 (APOA2) -265 T>C polymorphism and dietary intake of saturated fatty acids (SFAs) on obesity in healthy individuals or type 2 diabetes mellitus (T2 DM) patients. The aim of the present study is to examine the effect of this interaction on inflammatory markers in T2 DM patients. This is a comparative cross-sectional study on 180 T2 DM patients with known APOA2 genotype. Dietary intake was assessed by food-frequency questionnaire and serum levels of inflammatory markers (interleukin [IL]-18, pentraxin 3, and high-sensitivity C-reactive protein [hs-CRP]) were measured. The subjects were dichotomized into "high" and "low" categories, based on the median dietary intake of polyunsaturated fatty acids (PUFAs), monounsaturated fatty acids (MUFAs), and SFAs. The data were analyzed by analysis of covariance multivariate interaction model. In CC genotype, higher median intake of ω-3 PUFAs and MUFAs was associated with decreased serum levels of IL-18 and hs-CRP (P = 0.014 and 0.008, respectively). In T-allele carriers, higher median intake of SFAs was associated with increased serum hs-CRP level (P fatty acids, such as ω-3 PUFAs and MUFAs, could reduce the inflammatory effects associated with the CC genotype. In addition, proinflammatory fatty acids, such as SFAs, could overcome the antiinflammatory effect of the T-allele. Further studies are needed to confirm these findings. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

  4. Cryptococcal transmigration across a model brain blood-barrier: evidence of the Trojan horse mechanism and differences between Cryptococcus neoformans var. grubii strain H99 and Cryptococcus gattii strain R265.

    Science.gov (United States)

    Sorrell, Tania C; Juillard, Pierre-Georges; Djordjevic, Julianne T; Kaufman-Francis, Keren; Dietmann, Anelia; Milonig, Alban; Combes, Valery; Grau, Georges E R

    2016-01-01

    Cryptococcus neoformans (Cn) and Cryptococcus gattii (Cg) cause neurological disease and cross the BBB as free cells or in mononuclear phagocytes via the Trojan horse mechanism, although evidence for the latter is indirect. There is emerging evidence that Cn and the North American outbreak Cg strain (R265) more commonly cause neurological and lung disease, respectively. We have employed a widely validated in vitro model of the BBB, which utilizes the hCMEC/D3 cell line derived from human brain endothelial cells (HBEC) and the human macrophage-like cell line, THP-1, to investigate whether transport of dual fluorescence-labelled Cn and Cg across the BBB occurs within macrophages. We showed that phagocytosis of Cn by non-interferon (IFN)-γ stimulated THP-1 cells was higher than that of Cg. Although Cn and Cg-loaded THP-1 bound similarly to TNF-activated HBECs under shear stress, more Cn-loaded macrophages were transported across an intact HBEC monolayer, consistent with the predilection of Cn for CNS infection. Furthermore, Cn exhibited a higher rate of expulsion from transmigrated THP-1 compared with Cg. Our results therefore provide further evidence for transmigration of both Cn and Cg via the Trojan horse mechanism and a potential explanation for the predilection of Cn to cause CNS infection. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  5. 40 CFR 265.440 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... water run-off to an associated collection system. Existing drip pads are those constructed before... inside or under a structure that provides protection from precipitation so that neither run-off nor run... contingency plan that describes how the owner or operator will respond immediately to the discharge of such...

  6. 40 CFR 265.90 - Applicability.

    Science.gov (United States)

    2010-07-01

    ..., evapotranspiration, runoff, and infiltration; and (ii) Unsaturated zone characteristics (i.e., geologic materials... properties, and rate of ground-water flow); and (ii) The proximity of the facility to water supply wells or... defined in 40 CFR 264.90), with alternative requirements developed for groundwater monitoring set out in...

  7. 40 CFR 265.253 - Containment.

    Science.gov (United States)

    2010-07-01

    ... maintain a run-off management system to collect and control at least the water volume resulting from a 24...: If collected leachate or run-off is discharged through a point source to waters of the United States, it is subject to the requirements of section 402 of the Clean Water Act, as amended.] [45 FR 33232...

  8. 29 CFR 1910.265 - Sawmills.

    Science.gov (United States)

    2010-07-01

    ... lumber. (27) Log haul. The term log haul means a conveyor for transferring logs to mill. (28) Package... be so designed and arranged that from no position on the rim of the chute shall the distance to the... unloading points. Pickup and unloading points and paths for lumber packages on conveyors and transfers and...

  9. 10 CFR 26.5 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... information within 3 business days of the request and the licensee or other entity relies on a secondary... designating and reporting a test result as positive, of questionable validity (referring to validity screening... purity or a solution containing a reference material at a known concentration. Strategic special nuclear...

  10. 40 CFR 265.403 - Inspections.

    Science.gov (United States)

    2010-07-01

    ... must inspect, where present: (1) Discharge control and safety equipment (e.g., waste feed cut-off systems, by-pass systems, drainage systems, and pressure relief systems) at least once each operating day... equipment is being operated according to its design; (3) The construction materials of the treatment process...

  11. 40 CFR 265.1081 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... captured vapors through a closed-vent system to a control device. External floating roof means a pontoon... move with fluctuations in the level of the material managed in the unit. Floating membrane cover means... hazardous waste being managed in a surface impoundment. Floating roof means a cover consisting of a double...

  12. X-ray photoemission studies of Zn doped Cu1-xTl xBa2Ca2Cu 3-yZn yO10-δ (y = 0, 2.65) superconductors

    International Nuclear Information System (INIS)

    Khan, Nawazish A.; Mumtaz, M.; Ahadian, M.M.; Iraji-zad, Azam

    2007-01-01

    The X-ray photoemission (XPS) measurements of Cu 1-x Tl x Ba 2 Ca 2 Cu 3-y Zn y O 10-δ (y = 0, 2.65) superconductors have been performed and compared. These studies revealed that the charge state of thallium in the Cu 0.5 Tl 0.5 Ba 2 O 4-δ charge reservoir layer in Zn doped samples is Tl 1+ , while it is a mix of Tl 1+ and Tl 2+ in Zn free samples. The binding energy of Ba atoms in the Zn doped samples is shifted to higher energy, which when considered along with the presence of Tl 1+ suggested that it more efficiently directed the carriers to ZnO 2 and CuO 2 planes. The evidence of improved inter-plane coupling witnessed in X-ray diffraction is also confirmed by XPS measurements of Ca atoms in the Zn doped samples. The shift of the valance band spectrum in these Zn doped samples to higher energies suggested that the electrons at the top edge of the valance band were tied to a higher binding energy (relative to samples without Zn doping), which most likely resulted in a much lower energy state of the system in the superconducting state. The stronger superconducting state arising out of these effects is witnessed in the form of increased T c (R 0), J c and the extent of diamagnetism in the final compound

  13. The vaccine properties of a Brazilian bovine herpesvirus 1 strain with an induced deletion of the gE gene

    International Nuclear Information System (INIS)

    Franco, A.C.; Spilki, F.R.; Roehe, P.M.; Rijsewijk, F.A.M.

    2005-01-01

    Aiming at the development of a differential vaccine (DIVA) against infectious bovine rhinotracheitis (IBR), a Brazilian strain of bovine herpesvirus type 1 (BHV1) with a deletion of the glycoprotein E (gE) gene was constructed (265gE - ). Here we present the experiments performed with this strain in order to evaluate its safety and efficacy as a vaccine virus in cattle. In the first experiment, a group of calves was inoculated with 265gE - and challenged with wild type virus 21 days post-inoculation. Calves immunized with 265gE - virus and challenged with wild type virus developed very mild clinical disease with a significant reduction in the amount of virus excretion and duration. The safety of the 265gE - during pregnancy was assessed using 22 pregnant cows, at different stages of gestation, that were inoculated with the 265gE - virus intramuscularly, with 15 pregnant cows kept as non-vaccinated controls. No abortions, stillbirths or foetal abnormalities were seen after vaccination. The results show that the 265gE - recombinant is attenuated and able to prevent clinical disease upon challenge. This recombinant will be further evaluated as a candidate virus for a BHV1 differential vaccine. (author)

  14. Natural product antifoulants from the octocorals of Indian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; LimnaMol, V.P.; Parameswaran, P.S.

    stream_size 22497 stream_content_type text/plain stream_name Int_Biodeterior_Biodegrad_65_265a.pdf.txt stream_source_info Int_Biodeterior_Biodegrad_65_265a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8... 1 Author version: International Biodeterioration & Biodegradation, vol.65(1); 2011; 265-268 Natural Product Antifoulants from the Octocorals of Indian waters T.V. Raveendran * , V.P. Limna Mol, P.S. Parameswaran National Institute...

  15. The 26.5 ka Oruanui eruption, New Zealand : a review of the roles of volcanism and climate in the post-eruptive sedimentary response

    International Nuclear Information System (INIS)

    Manville, V.R.; Wilson, C.J.N.

    2004-01-01

    The landscape response to large explosive pyroclastic volcanic eruptions is one of the most dramatic processes in sedimentology and geomorphology. Processes of post-eruptive erosion and resedimentation are maximised by large erupted volumes, abundant unconsolidated ash-sized material, destruction of the vegetation cover (particularly by burial by ignimbrite), and inhibition of vegetation regrowth (e.g., by harsh climatic conditions). The 26.5 ka Oruanui eruption from Taupo volcano in the central North Island of New Zealand created optimal conditions for a large-scale sedimentary response that was influenced and prolonged by the succeeding climatic nadir of the Last Glacial Maximum. About 530 km 3 of rhyolitic magma was erupted as 420 km 3 of fall deposits, 320 km 3 of pyroclastic density current deposits (mostly non-welded ignimbrite), and 430 km 3 of primary intracaldera fill. The eruption, and formation of the Oruanui caldera, destroyed one major lake but created the forerunner to modern Lake Taupo. This lake initially stably overflowed to the northwest before breaking out in a catastrophic flood during establishment of a northeasterly outlet along the line of the modern Waikato River. Suppression of revegetation by the contemporaneous harsh periglacial climate contributed to intense erosion and remobilisation of Oruanui pyroclastic units, triggering massive downstream fluvial aggradation in impacted catchments. In particular, aggradation caused the lower 180 km of the Waikato River to avulse from its long-established route via the Hauraki Plains into the Hamilton Basin where it was subsequently trapped. Aeolian reworking created localised dune fields, while generation of tephric loess formed deposits over much of the central North Island. The initial perturbation to fluvial sedimentary systems created by the eruption was generally sustained by climatic conditions until c. 17 ka. Climatic amelioration eventually stabilised primary sediment sources through the re

  16. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. II. Changes in progression rate and cell sequence between the stage irradiated and nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Portions of embryos of the grasshopper, Chortophaga viridifasciata (DeGeer), were cultured in hanging drops under quartz cover slips. Immediately after exposure to 225, 265, or 280 nm radiation, microscope observations at 38 0 C were begun. The morphologically identified stage and the time after treatment of selected neuroblasts were recorded at short-time intervals until prometaphase was reached. Mitotic retardation induced by irradiation of prereplication stages (metaphase, anaphase, or early telophase) or S phase (middle or late telophase, interphase, or very early prophase) is greatest in postreplication stages (early, middle, and late prophase) and absent or minimal in stages morphologically identified as parts of S phase. Ultraviolet irradiation superimposes on the normal diversity of progression rates an additional variation factor, so that cells do not necessarily reach prometaphase in the order of their sequence at the time of treatment. This suggests the need for caution in ascribing particular radiosensitivities to substages of limited duration on the basis of the order in which they attain a subsequent stage

  17. Gclust Server: 85641 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 85641 CEL_ZK938.5_17535347 Cluster Sequences Related Sequences(265) 498 old-2: Overexpression...ences Related Sequences(265) Sequence length 498 Representative annotation old-2: Overexpression

  18. 43 CFR 26.5 - Administrative requirements.

    Science.gov (United States)

    2010-10-01

    ..., disadvantaged, non-public school youth, and youth having left school before graduation; (2) That selections will... provide for an effective accident control, health, and safety program. As a minimum, grantees shall follow...

  19. 7 CFR 1822.265 - Loan purposes.

    Science.gov (United States)

    2010-01-01

    ... the payment of necessary engineering fees, legal fees, and closing costs. (c) For the payment of actual cash cost of incidental administrative expenses such as postage, telephone, advertising, and temporary secretarial help, if funds to pay these expenses are not otherwise available. The estimated cost...

  20. 40 CFR 265.1083 - Standards: General.

    Science.gov (United States)

    2010-07-01

    ... hazardous waste enters the treatment process, any transfer of the hazardous waste is accomplished through continuous hard-piping or other closed system transfer that does not allow exposure of the waste to the... enclosure by conveyor, vehicles, or other mechanical or electrical equipment; or to direct air flow into the...

  1. 40 CFR 265.1085 - Standards: Tanks.

    Science.gov (United States)

    2010-07-01

    ... access; passage of material into or out of the enclosure by conveyor, vehicles, or other mechanical means... owner or operator shall transfer hazardous waste to a tank subject to this section in accordance with the following requirements: (1) Transfer of hazardous waste, except as provided in paragraph (j)(2) of...

  2. 46 CFR 28.265 - Emergency instructions.

    Science.gov (United States)

    2010-10-01

    ... bilge pump, hand pump, and buckets to dewater. (iii) Align fire pumps to use as bilge pumps, if possible... vessel to minimize the effect of wind on the fire. (vi) If unable to control the fire, immediately notify...

  3. 40 CFR 265.16 - Personnel training.

    Science.gov (United States)

    2010-07-01

    ... hazardous waste man-age-ment procedures (including con-tin-gen-cy plan implementation) rel-e-vant to the... facility employees that receive emergency response training pursuant to Occupational Safety and Health... hazardous waste management, and the name of the employee filling each job; (2) A written job description for...

  4. 40 CFR 265.116 - Survey plat.

    Science.gov (United States)

    2010-07-01

    ... STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Closure... of each hazardous waste disposal unit, an owner or operator must submit to the local zoning authority... plat indicating the location and dimensions of landfill cells or other hazardous waste disposal units...

  5. Publications | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our ... Journal articles ... In March 2004, Kiddhu Makubuya, Uganda's Minister for Education and Sports, and Professor Romain Murenzi, Rwanda's.

  6. 40 CFR 265.1053 - Standards: Compressors.

    Science.gov (United States)

    2010-07-01

    ...) Operated with the barrier fluid at a pressure that is at all times greater than the compressor stuffing box... purges the barrier fluid into a hazardous waste stream with no detectable emissions to atmosphere. (c...

  7. 40 CFR 265.1035 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... waste management units in one recordkeeping system if the system identifies each record by each... data supporting determinations of vent emissions and emission reductions achieved by add-on control... that result in maximum organic emissions, such as when the waste management unit is operating at the...

  8. 40 CFR 265.1064 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... waste management units in one recordkeeping system if the system identifies each record by each...) Design documentation and monitoring, operating, and inspection information for each closed-vent system...) An up-to-date analysis and the supporting information and data used to determine whether or not...

  9. 40 CFR 265.56 - Emergency procedures.

    Science.gov (United States)

    2010-07-01

    ... hazardous surface water run-offs from water or chemical agents used to control fire and heat-induced... injuries, if any; and (vi) The possible hazards to human health, or the environment, outside the facility... quantity of material(s) involved; (5) The extent of injuries, if any; (6) An assessment of actual or...

  10. Present state of the marine environment around India

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.

    stream_size 2 stream_content_type text/plain stream_name Mar_Archaeol_2_65.pdf.txt stream_source_info Mar_Archaeol_2_65.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  11. Marine Chemistry in the People’s Republic of China.

    Science.gov (United States)

    1984-08-01

    organisms LANG Chinese 265 AUTH Wang, Lizhi; Zhang, Xiaoping; Li, Dexin; Zhou, Mingyu AFFI Institute of Atmospheric Physics, Academia Sinica DATE 1983...their transportation trends at the east margin of Lai Zhou Bay Zhou, Mingyu )A e ’: . 265 Preliminary study on the vertical distribution of atmospheric

  12. Globalization, increasing returns in component production, and the pattern of trade

    Czech Academy of Sciences Publication Activity Database

    Kovaříková Arro, Anu

    -, č. 265 (2005), s. 1-52 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : monopolistic competition * external and internal economies of scale * trade across the stages of production Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp265.pdf

  13. Aptychi from the Berriasian/Valanginian (France and Spain): New stratigraphical and morphological details

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Janssen, N. M. M.; Klein, J.

    2016-01-01

    Roč. 86, č. 3 (2016), s. 265-272 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Berriasian/Valanginian * Vocontian Basin * Betic Cordillera Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016 http://www.asgp.pl/sites/default/files/volumes/86_3_265_272.pdf

  14. Identification and typing of Brucella spp. in stranded harbour porpoises (Phocoena phocoena) on the Dutch coast

    NARCIS (Netherlands)

    Maio, Elisa; Begeman, Lineke; Bisselink, Yvette; van Tulden, Peter; Wiersma, Lidewij; Hiemstra, Sjoukje; Ruuls, Robin; Gröne, Andrea; Roest, Hendrik-Ido-Jan; Willemsen, Peter; van der Giessen, Joke

    2014-01-01

    The presence of Brucella (B.) spp. in harbour porpoises stranded between 2008 and 2011 along the Dutch coast was studied. A selection of 265 tissue samples from 112 animals was analysed using conventional and molecular methods. In total, 4.5% (5/112) of the animals corresponding with 2.3% (6/265)

  15. Identification and typing of Brucella spp. in stranded harbour porpoises (Phocoena phocoena) on the Dutch coast.

    NARCIS (Netherlands)

    Maio, E.; Begeman, L.; Bisselink, Y.J.W.M.; Tulden, van P.W.; Wiersma, L.; Hiemstra, S.; Ruuls, R.; Gröne, A.; Roest, H.I.J.; Willemsen, P.T.J.; Giessen, van der J.

    2014-01-01

    The presence of Brucella (B.) spp. in harbour porpoises stranded between 2008 and 2011 along the Dutch coast was studied. A selection of 265 tissue samples from 112 animals was analysed using conventional and molecular methods. In total, 4.5% (5/112) of the animals corresponding with 2.3% (6/265)

  16. AcEST: DK948841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available G265|NETR_SAGLB Neurotrypsin OS=Saguinus labiatus GN=PRSS12... 30 8.6 sp|P20872|ENV_HV2ST Envelope glycoprot...G 187 >sp|Q5G265|NETR_SAGLB Neurotrypsin OS=Saguinus labiatus GN=PRSS12 PE=3 SV=1 Length = 875 Score = 30.4

  17. Comparison of UV-LED and low pressure UV for water disinfection: Photoreactivation and dark repair of Escherichia coli.

    Science.gov (United States)

    Li, Guo-Qiang; Wang, Wen-Long; Huo, Zheng-Yang; Lu, Yun; Hu, Hong-Ying

    2017-12-01

    Studies on ultraviolet light-emitting diode (UV-LED) water disinfection have shown advantages, such as safety, flexible design, and lower starting voltages. However, information about reactivation after UV-LED disinfection is limited, which is an important issue of UV light-based technology. In this study, the photoreactivation and dark repair of Escherichia coli after UV-LEDs and low pressure (LP) UV disinfection were compared. Four UV-LED units, 265 nm, 280 nm, the combination of 265 + 280 (50%), and 265 + 280 (75%) were tested. 265 nm LEDs was more effective than 280 nm LEDs and LP UV lamps for E. coli inactivation. No synergic effect for disinfection was observed from the combination of 265 and 280 nm LEDs. 265 nm LEDs had no different reactivation performances with that of LP UV, while 280 nm LEDs could significantly repress photoreactivation and dark repair at a low irradiation intensity of 6.9 mJ/cm 2 . Furthermore, the UV-induced damage of 280 nm LEDs was less repaired which was determined by endonuclease sensitive site (ESS) assay. The impaired protein activities by 280 nm LEDs might be one of the reasons that inhibited reactivation. A new reactivation rate constant, K max , was introduced into the logistic model to simulate the reactivation data, which showed positive relationship with the maximum survival ratio and was more reasonable to interpret the results of photoreactivation and dark repair. This study revealed the distinct roles of different UV lights in disinfection and reactivation, which is helpful for the future design of UV-LED equipment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. 2009 Tactical Wheeled Vehicles Conference (TWV)

    Science.gov (United States)

    2009-02-03

    fields. 5 ... Spent $265.2 Million in Reset of TWVs … or larger than the entire 2007 revenue of the Los Angeles Dodgers . ... Spent $265.2 Million in...Reset of T Vs or larger than the entire 2007 revenue of the Los Angeles Dodgers . ... Maintains over 29,000 Tactical Wheeled Vehicles in theater … or

  19. Superconductivity, carrier concentration, and the ionic model of Sn/sub 4/P/sub 3/ and Sn/sub 4/As/sub 3/

    Energy Technology Data Exchange (ETDEWEB)

    Van Maaren, M H

    1969-06-01

    Superconductivity is reported for Sn/sub 4/P/sub 2.65/ at T/sub c/ 1.2/sup 0/K. Hall constant and reflectivity measurements indicate a mixed type of conduction for Sn/sub 4/P/sub 2.65/ and Sn/sub 3.80/ As/sub 3/. The ionic model of Geller and Hull is not applicable.

  20. Coat colour and chromosome variation in cetral European populations of the weasel (Mustela nivalis)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Cenevová, E.

    2002-01-01

    Roč. 51, č. 4 (2002), s. 265-274 ISSN 0139-7893 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : weasel * pelage coloration * karyotype Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/4/265-274.pdf

  1. 40 CFR 265.1086 - Standards: Surface impoundments.

    Science.gov (United States)

    2010-07-01

    ... materials of construction and designing the cover and closure devices shall include: Organic vapor... closure device in the closed position, as applicable. (B) To remove accumulated sludge or other residues... construction and designing the cover and closure devices shall include: Organic vapor permeability; the effects...

  2. 40 CFR 265.1084 - Waste determination procedures.

    Science.gov (United States)

    2010-07-01

    ... seal around a rotating shaft that passes through a cover opening, in which case the comparison shall be... potential leak interface is determined to operate with no detectable organic emissions. (9) For the seals around a rotating shaft that passes through a cover opening, the arithmetic difference between the...

  3. 39 CFR 265.9 - Schedule of fees.

    Science.gov (United States)

    2010-07-01

    ... fees chargeable under this section are likely to exceed $250. If the requester has a history of prompt... assurance of full payment before commencing work on the request. If the requester has no history of payment... commencing work on the request. (ii) When a requester has previously failed to pay a fee in a timely fashion...

  4. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... The stimulatory effect of the aqueous extract of G. lucidum, a basidiomycetes class fungus ... activity of GL extract was observed through the inhibition of ...... ides and its effect on antioxidant enzymes and immunity activities in.

  5. 265 Statistical Consulting and the African Universities

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... Statistics is the science and the art of collection, analysis, and presentation of ... statistical methods to a variety of subject areas, such as economics, biology, ... Many economic, social, political, and military decisions cannot be.

  6. 39 CFR 265.6 - Availability of records.

    Science.gov (United States)

    2010-07-01

    ... by the human eye, such as a computer print-out. On request, records will be provided in a different... investigation, or by an agency conducting a lawful national security intelligence investigation, information... authorized user of a postage meter or PC Postage product (postage evidencing systems) printing a specified...

  7. Valor nutritivo da silagem de dez híbridos de milho = Nutritional value of silage from ten corn hybrids

    Directory of Open Access Journals (Sweden)

    Geane Dias Gonçalves Ferreira

    2011-07-01

    Full Text Available Objetivou-se avaliar a composição químico-bromatológica e a digestibilidade aparente de dez híbridos de milho (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistache e Buxxil cultivados no INRA (Unité de Génétique et d’Amélioration des Plantes Fourragères, Lusignan-France, em parcelas de 150 m2, com trêsrepetições. Para o estudo de digestibilidade in vivo, os ovinos foram alimentados com silagem da planta inteira dos híbridos de milho com três repetições. Os híbridos de milho foram avaliados antes de ensilados pelo método NIRS, em que se pode constatar que houve diferença (p The objective of this experiment was to evaluate the chemical-bromatological composition and apparent digestibility of ten hybrids of corn (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistachio and Buxxil planted at INRA (Unité of Génétique Amélioration des Plantes Fourragères, Lusignan-France, in 150 m2 areas with three replications. The digestibility study was conducted using sheep fed corn hybrid whole plant silage with three replications. Corn hybrids were evaluated before ensilage using NIRS, and a significant difference (p < 0.05 was observed among treatments for chemical composition. DK265bm3 showed higher values than other hybrids for digestibility of DM, OM, cellulose, NDF and for IVDMD.

  8. Caracterização morfoanatômica do colmo de híbridos de milho para avaliar a qualidade de silagem = Morphoanatomical characterization of corn hybrids stems, in order to evaluate silage quality

    Directory of Open Access Journals (Sweden)

    Geane Dias Gonçalves Ferreira

    2007-07-01

    Full Text Available O objetivo foi avaliar a caracterização morfoanatômica e suas possíveis correlações com a digestibilidade da parede celular e com a lignina de dez híbridos de milho (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistache e Buxxil, plantados no INRA (Unité de Génétique et d’Amélioration dês Plantes Fourragères, Lusignan-França, em parcelas de 150 m². O delineamento utilizado foi inteiramente casualizado com cinco repetições por tratamento. Comexceção ao comprimento do córtex, verificou-se que os híbridos apresentaram diferenças significativas (p The objective was to evaluate morphoanatomical characteristics andpossible correlations with cell wall digestibility and with lignin of ten corn hybrids (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistachio and Buxxil planted at INRA (Unité of Génétique Amélioration des Plant Fourragères, Lusignan, France in 150 m² areas. A completely randomized experimental design with five replications was used. With exception for cortical length, significant differences were verified as for the evaluated morphoanatomical aspects, with hybrid DK265bm3 being characterized by lower counts of lignified cells in the medullar parenchyma and cortical areas, lower percentage of medullar parenchyma and higherpercentage of cortex in relation to other hybrids. However, DK265bm3 did not differ from other hybrids in regards to vascular bundle surface and cell wall thickness of the vascular bundle. Usingcorrelation analysis a positive correlation was observed between the levels of Klason lignin and lignin in acid detergent with the number of lignified cells in the parenchyma and cortex. IVCNDF showed a negative correlation with the proportion of lignified cells in medullar parenchyma and lignified cells in the cortex.

  9. 1935 15' Quad #265 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  10. 40 CFR 265.1201 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... products, or contaminated run-off, to the soil, ground water, surface water, and atmosphere; (2) Provide a...) Constructed of waterproofed, reinforced concrete or structural steel arches, with steel doors that are kept...

  11. 40 CFR 265.52 - Content of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... hazardous waste constituents to air, soil, or surface water at the facility. (b) If the owner or operator... alarm systems (internal and external), and decontamination equipment), where this equipment is required...

  12. 40 CFR 265.71 - Use of manifest system.

    Science.gov (United States)

    2010-07-01

    ... the manifest; (iv) Within 30 days of delivery, send a copy of the manifest to the generator; and (v... Pennsylvania Avenue, NW., Washington, DC 20460. (b) If a facility receives, from a rail or water (bulk shipment... on the manifest (excluding the EPA identification numbers, generator's certification, and signatures...

  13. 25 CFR 265.1 - Definition of roadless area.

    Science.gov (United States)

    2010-04-01

    ... presently existing roadless area: Name of area—Wind River Reserve. Reservation—Shoshone. State—Wyoming. Approximate acreage—180,387 (a) The boundaries of the Wind River Reserve roadless area are as follows: Wind... the Wind River Indian Reservation, thence north six (6) miles to the NE corner of sec. 28, T. 1 S., R...

  14. Efficient burst image compression using H.265/HEVC

    Science.gov (United States)

    Roodaki-Lavasani, Hoda; Lainema, Jani

    2014-02-01

    New imaging use cases are emerging as more powerful camera hardware is entering consumer markets. One family of such use cases is based on capturing multiple pictures instead of just one when taking a photograph. That kind of a camera operation allows e.g. selecting the most successful shot from a sequence of images, showing what happened right before or after the shot was taken or combining the shots by computational means to improve either visible characteristics of the picture (such as dynamic range or focus) or the artistic aspects of the photo (e.g. by superimposing pictures on top of each other). Considering that photographic images are typically of high resolution and quality and the fact that these kind of image bursts can consist of at least tens of individual pictures, an efficient compression algorithm is desired. However, traditional video coding approaches fail to provide the random access properties these use cases require to achieve near-instantaneous access to the pictures in the coded sequence. That feature is critical to allow users to browse the pictures in an arbitrary order or imaging algorithms to extract desired pictures from the sequence quickly. This paper proposes coding structures that provide such random access properties while achieving coding efficiency superior to existing image coders. The results indicate that using HEVC video codec with a single reference picture fixed for the whole sequence can achieve nearly as good compression as traditional IPPP coding structures. It is also shown that the selection of the reference frame can further improve the coding efficiency.

  15. 40 CFR 265.443 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... standards established by professional organizations generally recognized by industry such as the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM) in judging the structural..., climatic conditions, the stress of installation, and the stress of daily operations, e.g., variable and...

  16. 40 CFR 265.1101 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... industry such as the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM... wastes to which they are exposed; climatic conditions; and the stresses of daily operation, including the...

  17. 40 CFR 265.1034 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ... the calibration gas must be the single organic HAP representing the largest percent by volume of the... factor for molar volume, kg-mol/m3 (@ 293 K and 760 mm Hg); 10−6 = Conversion from ppm (B) For sources...; 0.0416 = Conversion factor for molar volume, kg-mol/m3 (@ 293 K and 760 mm Hg); 10−6 = Conversion...

  18. 29 CFR 1952.265 - Level of Federal enforcement.

    Science.gov (United States)

    2010-07-01

    ... employees, as in the case of temporary emergency standards promulgated under section 6(c) of the Act (29 U.S... Michigan plan under sections 18(e) and (f) of the Act (29 U.S.C. 667(e) and (f)). Federal OSHA will also... engaged in USPS mail operations. The OSHA Regional Administrator will make a prompt recommendation for the...

  19. 7 CFR 2.65 - Administrator, Agricultural Research Service.

    Science.gov (United States)

    2010-01-01

    ... dissemination of information for the promotion of the dairy industry (7 U.S.C. 402). (6) Conduct research and... productivity; development of new food, fiber, and energy sources; agricultural energy use and production; natural resources; promotion of the health and welfare of people; human nutrition; and international food...

  20. Characteristics of ocular temperature elevations after exposure to quasi- and millimeter waves (18-40 GHz)

    Science.gov (United States)

    Kojima, Masami; Suzuki, Yukihisa; Tsai, Cheng-Yu; Sasaki, Kensuke; Wake, Kanako; Watanabe, Soichi; Taki, Masao; Kamimura, Yoshitsugu; Hirata, Akimasa; Sasaki, Kazuyuki; Sasaki, Hiroshi

    2015-04-01

    In order to investigate changes in ocular temperature in rabbit eyes exposed to different frequencies (18 to 40 GHz) of quasi-millimeter waves, and millimeter waves (MMW). Pigmented rabbits were anesthetized with both general and topical anesthesia, and thermometer probes (0.5 mm in diameter) were inserted into their cornea (stroma), lens (nucleus) and vitreous (center of vitreous). The eyes were exposed unilaterally to 200 mW/cm2 by horn antenna for 3 min at 18, 22 and 26.5 GHz using a K band exposure system or 26.5, 35 and 40 GHz using a Ka band exposure system. Changes in temperature of the cornea, lens and vitreous were measured with a fluoroptic thermometer. Since the ocular temperatures after exposure to 26.5 GHz generated by the K band and Ka band systems were similar, we assumed that experimental data from these 2 exposure systems were comparable. The highest ocular temperature was induced by 40 GHz MMW, followed by 35 GHz. The 26.5 and 22 GHz corneal temperatures were almost the same. The lowest temperature was recorded at 18 GHz. The elevation in ocular temperature in response to exposure to 200 mW/cm2 MMW is dependent on MMW frequency. MMW exposure induced heat is conveyed not only to the cornea but also the crystalline lens.

  1. Evaluate and Characterize Mechanisms Controlling Transport, Fate, and Effects of Army Smokes in the Aerosol Wind tunnel

    Science.gov (United States)

    1989-09-01

    coated with a 2.65-iim-thick methyl silicone gum was used for the sampling loop. The volume of this tube was 33 gL. Later, the fused silica loop was...STEM ~I SLCION ANITRAISMLIGVLV ONIURTO A 5-meter HP-1, 0.53-mm-ID column coated with a 2.65-jm-thick methyl silicone gum was used for the...Plants Inc., Sandy, Utah. Age: 2-year-old seedlings. " Ponderosa Pine ( Pinus ponderosa). A large coniferous forest species common to western North

  2. Combining ability for maturity and plant height in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    Nasim, A.; Farhatullah, A.; Khan, N.U.; Azam, S.M.; Nasim, Z.

    2014-01-01

    A 5 * 5 F1 diallel cross hybrids of Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt along with parents were evaluated through combining ability for days to flowering (initiation and completion), days to maturity and plant height. Highly significant differences were recorded for all the traits. Mean squares due to general, specific and reciprocal combining ability were significant for all the traits except plant height for which the latter two components were non-significant. Prevalence of additive (plant height), non-additive (days to flowering completion; days to maturity) and reciprocal effects (days to flowering initiation) were detected. Parental line G-403 was best general combiner for all the traits. The F1 hybrids G-902 * G-265 (days to flowering initiation), G-902 * G-403 (days to flowering completion), G-265 * G-1500 (days to maturity) and G-909 * G-265 (plant height) were superior and may be exploited for future breeding programs. (author)

  3. Observation of enhanced nuclear stability near the 162 neutron shell

    Energy Technology Data Exchange (ETDEWEB)

    Lougheed, R.W.; Moody, K.J.; Wild, J.F.; Hulet, E.K.; McQuaid, J.H. [Lawrence Livermore National Lab., CA (United States); Lazarev, Yu.A.; Lobanov, Yu.V.; Oganessian, Yu.Ts.; Utyonkov, V.K.; Abdullin, F.Sh.; Buklanov, G.V.; Gikal, B.N.; Iliev, S.; Mezentsev, A.N.; Polyakov, A.N.; Sedykh, I.M.; Shirokovsky, I.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Yu.S.; Zhuchko, V.E. [Joint Inst. for Nuclear Research, Dubna (Russian Federation)

    1993-09-22

    In bombardments of {sup 248}Cm with {sup 22}Ne the authors discovered two new isotopes, {sup 265}106 and {sup 266}106, by establishing genetic links between {alpha} decays of the 106 nuclides and SF or {alpha} decays of the daughter (grand-daughter) nuclides. For {sup 266}106 they measured E{sub {alpha}}=8.62{+-}0.06 MeV followed by the SF decay of {sup 262}104 for which they measured a half-life value of 1.2{sup +1.0}{sub {minus}0.5} s. For {sup 265}106 they measured E{sub {alpha}}=8.82{+-}0.06 MeV. They estimated {alpha} half-lives of 10-30 s for {sup 266}106 and 2-30 s for {sup 265}106 with SF branches of {approximately}50% or less. The decay properties of {sup 266}106 indicate a large enhancement in the SF stability of this N=160 nuclide and confirm the existence of the predicted neutron-deformed shell N=162.

  4. Valor nutritivo da silagem de dez híbridos de milho - doi: 10.4025/actascianimsci.v33i3.9890

    Directory of Open Access Journals (Sweden)

    Clóves Cabreira Jobim

    2011-06-01

    Full Text Available Objetivou-se avaliar a composição químico-bromatológica e a digestibilidade aparente de dez híbridos de milho (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistache e Buxxil cultivados no INRA (Unité de Génétique et d’Amélioration des Plantes Fourragères, Lusignan-France, em parcelas de 150 m2, com três repetições. Para o estudo de digestibilidade in vivo, os ovinos foram alimentados com silagem da planta inteira dos híbridos de milho com três repetições. Os híbridos de milho foram avaliados antes de ensilados pelo método NIRS, em que se pode constatar que houve diferença (p in vivo, observou-se que, o DK265bm3 se destacou dos demais híbridos quanto aos valores de MS, MO, celulose, PC e da DIVMS.

  5. Receptor homodimerization plays a critical role in a novel dominant negative P2RY12 variant identified in a family with severe bleeding.

    Science.gov (United States)

    Mundell, S J; Rabbolini, D; Gabrielli, S; Chen, Q; Aungraheeta, R; Hutchinson, J L; Kilo, T; Mackay, J; Ward, C M; Stevenson, W; Morel-Kopp, M-C

    2018-01-01

    Essentials Three dominant variants for the autosomal recessive bleeding disorder type-8 have been described. To date, there has been no phenotype/genotype correlation explaining their dominant transmission. Proline plays an important role in P2Y12R ligand binding and signaling defects. P2Y12R homodimer formation is critical for the receptor function and signaling. Background Although inherited platelet disorders are still underdiagnosed worldwide, advances in molecular techniques are improving disease diagnosis and patient management. Objective To identify and characterize the mechanism underlying the bleeding phenotype in a Caucasian family with an autosomal dominant P2RY12 variant. Methods Full blood counts, platelet aggregometry, flow cytometry and western blotting were performed before next-generation sequencing (NGS). Detailed molecular analysis of the identified variant of the P2Y12 receptor (P2Y12R) was subsequently performed in mammalian cells overexpressing receptor constructs. Results All three referred individuals had markedly impaired ADP-induced platelet aggregation with primary wave only, despite normal total and surface P2Y12R expression. By NGS, a single P2RY12:c.G794C substitution (p.R265P) was identified in all affected individuals, and this was confirmed by Sanger sequencing. Mammalian cell experiments with the R265P-P2Y12R variant showed normal receptor surface expression versus wild-type (WT) P2Y12R. Agonist-stimulated R265P-P2Y12R function (both signaling and surface receptor loss) was reduced versus WT P2Y12R. Critically, R265P-P2Y12R acted in a dominant negative manner, with agonist-stimulated WT P2Y12R activity being reduced by variant coexpression, suggesting dramatic loss of WT homodimers. Importantly, platelet P2RY12 cDNA cloning and sequencing in two affected individuals also revealed three-fold mutant mRNA overexpression, decreasing even further the likelihood of WT homodimer formation. R265 located within extracellular loop 3 (EL3) is

  6. A simulator tool set for evaluating HEVC/SHVC streaming

    Science.gov (United States)

    Al Hadhrami, Tawfik; Nightingale, James; Wang, Qi; Grecos, Christos; Kehtarnavaz, Nasser

    2015-02-01

    Video streaming and other multimedia applications account for an ever increasing proportion of all network traffic. The recent adoption of High Efficiency Video Coding (HEVC) as the H.265 standard provides many opportunities for new and improved services multimedia services and applications in the consumer domain. Since the delivery of version one of H.265, the Joint Collaborative Team on Video Coding have been working towards standardisation of a scalable extension (SHVC) to the H.265 standard and a series of range extensions and new profiles. As these enhancements are added to the standard the range of potential applications and research opportunities will expend. For example the use of video is also growing rapidly in other sectors such as safety, security, defence and health with real-time high quality video transmission playing an important role in areas like critical infrastructure monitoring and disaster management. Each of which may benefit from the application of enhanced HEVC/H.265 and SHVC capabilities. The majority of existing research into HEVC/H.265 transmission has focussed on the consumer domain addressing issues such as broadcast transmission and delivery to mobile devices with the lack of freely available tools widely cited as an obstacle to conducting this type of research. In this paper we present a toolset which facilitates the transmission and evaluation of HEVC/H.265 and SHVC encoded video on the popular open source NCTUns simulator. Our toolset provides researchers with a modular, easy to use platform for evaluating video transmission and adaptation proposals on large scale wired, wireless and hybrid architectures. The toolset consists of pre-processing, transmission, SHVC adaptation and post-processing tools to gather and analyse statistics. It has been implemented using HM15 and SHM5, the latest versions of the HEVC and SHVC reference software implementations to ensure that currently adopted proposals for scalable and range extensions to

  7. Structural organization of the human glucocorticoid receptor determined by one- and two-dimensional gel electrophoresis of proteolytic receptor fragments

    International Nuclear Information System (INIS)

    Smith, A.C.; Harmon, J.M.

    1987-01-01

    The structural organization of the steroid-binding protein of the IM-9 cell glucocorticoid receptor was investigated by using one- and two-dimensional gel electrophoresis of proteolytic receptor fragments. One-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) of receptor fragments isolated after trypsin digestion of immunopurified [ 3 H]dexamethasone 21-mesylate ([ 3 H]DM-) labeled receptor revealed the presence of a stable 26.5-kilodalton (kDa) steroid-containing non-DNA-binding fragment, derived from a larger, less stable, 29-kDa fragment. The 26.5-kDa tryptic fragment appeared to be completely contained within a 41-kDa, steroid-containing, DNA-binding species isolated after chymotrypsin digestion of the intact protein. Two-dimensional electrophoretic analysis of the [ 3 H]DM-labeled tryptic fragments resolved two 26.5-kDa and two 29-kDa components. This was the same number of isoforms seen in the intact protein, indicating that the charge heterogeneity of the steroid-binding protein is the result of modification within the steroid-containing, non-DNA-binding, 26.5-kDa tryptic fragment. Two-dimensional analysis of the 41-kDa [ 3 H]DM-labeled chymotryptic species revealed a pattern of isoforms more complex than that seen either in the intact protein or in the steroid-containing tryptic fragments. These results suggest that the 41-kDa [ 3 H]DM-labeled species resolved by one-dimensional SDS-PAGE after chymotrypsin digestion may be composed of several distinct proteolytic fragments

  8. SU-E-T-131: Artificial Neural Networks Applied to Overall Survival Prediction for Patients with Periampullary Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Gong, Y; Yu, J; Yeung, V; Palmer, J; Yu, Y; Lu, B; Babinsky, L; Burkhart, R; Leiby, B; Siow, V; Lavu, H; Rosato, E; Winter, J; Lewis, N; Sama, A; Mitchell, E; Anne, P; Hurwitz, M; Yeo, C; Bar-Ad, V [Thomas Jefferson University Hospital, Philadelphia, PA (United States); and others

    2015-06-15

    Purpose: Artificial neural networks (ANN) can be used to discover complex relations within datasets to help with medical decision making. This study aimed to develop an ANN method to predict two-year overall survival of patients with peri-ampullary cancer (PAC) following resection. Methods: Data were collected from 334 patients with PAC following resection treated in our institutional pancreatic tumor registry between 2006 and 2012. The dataset contains 14 variables including age, gender, T-stage, tumor differentiation, positive-lymph-node ratio, positive resection margins, chemotherapy, radiation therapy, and tumor histology.After censoring for two-year survival analysis, 309 patients were left, of which 44 patients (∼15%) were randomly selected to form testing set. The remaining 265 cases were randomly divided into training set (211 cases, ∼80% of 265) and validation set (54 cases, ∼20% of 265) for 20 times to build 20 ANN models. Each ANN has one hidden layer with 5 units. The 20 ANN models were ranked according to their concordance index (c-index) of prediction on validation sets. To further improve prediction, the top 10% of ANN models were selected, and their outputs averaged for prediction on testing set. Results: By random division, 44 cases in testing set and the remaining 265 cases have approximately equal two-year survival rates, 36.4% and 35.5% respectively. The 20 ANN models, which were trained and validated on the 265 cases, yielded mean c-indexes as 0.59 and 0.63 on validation sets and the testing set, respectively. C-index was 0.72 when the two best ANN models (top 10%) were used in prediction on testing set. The c-index of Cox regression analysis was 0.63. Conclusion: ANN improved survival prediction for patients with PAC. More patient data and further analysis of additional factors may be needed for a more robust model, which will help guide physicians in providing optimal post-operative care. This project was supported by PA CURE Grant.

  9. SU-E-T-131: Artificial Neural Networks Applied to Overall Survival Prediction for Patients with Periampullary Carcinoma

    International Nuclear Information System (INIS)

    Gong, Y; Yu, J; Yeung, V; Palmer, J; Yu, Y; Lu, B; Babinsky, L; Burkhart, R; Leiby, B; Siow, V; Lavu, H; Rosato, E; Winter, J; Lewis, N; Sama, A; Mitchell, E; Anne, P; Hurwitz, M; Yeo, C; Bar-Ad, V

    2015-01-01

    Purpose: Artificial neural networks (ANN) can be used to discover complex relations within datasets to help with medical decision making. This study aimed to develop an ANN method to predict two-year overall survival of patients with peri-ampullary cancer (PAC) following resection. Methods: Data were collected from 334 patients with PAC following resection treated in our institutional pancreatic tumor registry between 2006 and 2012. The dataset contains 14 variables including age, gender, T-stage, tumor differentiation, positive-lymph-node ratio, positive resection margins, chemotherapy, radiation therapy, and tumor histology.After censoring for two-year survival analysis, 309 patients were left, of which 44 patients (∼15%) were randomly selected to form testing set. The remaining 265 cases were randomly divided into training set (211 cases, ∼80% of 265) and validation set (54 cases, ∼20% of 265) for 20 times to build 20 ANN models. Each ANN has one hidden layer with 5 units. The 20 ANN models were ranked according to their concordance index (c-index) of prediction on validation sets. To further improve prediction, the top 10% of ANN models were selected, and their outputs averaged for prediction on testing set. Results: By random division, 44 cases in testing set and the remaining 265 cases have approximately equal two-year survival rates, 36.4% and 35.5% respectively. The 20 ANN models, which were trained and validated on the 265 cases, yielded mean c-indexes as 0.59 and 0.63 on validation sets and the testing set, respectively. C-index was 0.72 when the two best ANN models (top 10%) were used in prediction on testing set. The c-index of Cox regression analysis was 0.63. Conclusion: ANN improved survival prediction for patients with PAC. More patient data and further analysis of additional factors may be needed for a more robust model, which will help guide physicians in providing optimal post-operative care. This project was supported by PA CURE Grant

  10. The Tensile Strenght Properties Effect Of Rice-Husk Ash As On The Composite Of Plastic Drinking Bottle Waste

    Directory of Open Access Journals (Sweden)

    Maulida

    2015-04-01

    Full Text Available Abstract Rice-husk ash has a potential to be filler in composite. The study on rice-husk ash utilitation as afiller in polyethylene terephthalate PET matrix of plastic drinking bottle waste was conducted in order to find the ratio of rice-husk ask and PET matrix that would result the best tensile strength which was characterized by using scenning electron microscopy SEM. In this study the PET of plastic drinking bottle waste firstly was cut into smaller pieces and was extruded with the temperature of 265 o C. Then it was mixed with rice-husk ash on ratio of PET plastic drinking bottle waste and rice-husk ash of 955 9010 and 8515. After that it was extruded at temperature of 265 o C before it was pressed by hot press at temperature of 265 o C for five minutes. The highest tensile strength was achieved at 3462 MPa with elongation at break a round 14375 and youngs modulus of 34882 MPa for the ratio of 8515.

  11. Assessing evidence for avian-to-human transmission of influenza A/H9N2 virus in rural farming communities in northern Vietnam.

    Science.gov (United States)

    Hoa, Le Nguyen Minh; Tuan, Nguyen Anh; My, Pham Ha; Huong, Tran Thi Kieu; Chi, Nguyen Thi Yen; Hau Thu, Trang Thi; Carrique-Mas, Juan; Duong, Mai Thuy; Tho, Nguyen Dang; Hoang, Nguyen Dang; Thanh, To Long; Diep, Nguyen Thi; Duong, Nguyen van; Toan, Tran Khanh; Tung, Trinh Son; Mai, Le Quynh; Iqbal, Munir; Wertheim, Heiman; van Doorn, H Rogier; Bryant, Juliet E; The Vizions Consortium

    2017-08-01

    Rural farming communities in northern Vietnam do not routinely practice vaccination for influenza A viruses (IAV) for either humans or poultry, which enables us to study transmission intensity via seroepidemiology. Using samples from a longitudinal cohort of farming households, we determined the number of symptomatic and asymptomatic human infections for seasonal IAV and avian A/H9 over 2 years. As expected, we detected virologically confirmed acute cases of seasonal IAV in humans, as well as large numbers of subclinical seroconversions to A/H1pdm [55/265 (21 %)], A/H3 [95/265 (36 %)] and A/H9 [24/265 (9 %)]. Five of the A/H9 human seroconverters likely represented true infections rather than heterosubtypic immunity, because the individuals seroconverted solely to A/H9. Among co-located poultry, we found significantly higher seroprevalance for A/H5 compared to A/H9 in both chickens and ducks [for northern study sites overall, 337/1105 (30.5 %) seropositive for A/H5 and 123/1105 (11.1 %) seropositive for A/H9].

  12. Caracterização morfoanatômica do colmo de híbridos de milho para avaliar a qualidade de silagem - DOI: 10.4025/actascianimsci.v29i3.550 Morphoanatomical characterization of corn hybrids stems, in order to evaluate silage quality - DOI: 10.4025/actascianimsci.v29i3.550

    Directory of Open Access Journals (Sweden)

    Jean-Claude Emile

    2007-12-01

    Full Text Available O objetivo foi avaliar a caracterização morfoanatômica e suas possíveis correlações com a digestibilidade da parede celular e com a lignina de dez híbridos de milho (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistache e Buxxil, plantados no INRA (Unité de Génétique et d’Amélioration dês Plantes Fourragères, Lusignan-França, em parcelas de 150 m². O delineamento utilizado foi inteiramente casualizado com cinco repetições por tratamento. Com exceção ao comprimento do córtex, verificou-se que os híbridos apresentaram diferenças significativas (p bm3 se caracterizou por apresentar menor quantidade de células lignificadas, tanto na região medular quanto na região do córtex, menor porcentagem de parênquima medular e maior porcentagem do córtex em relação aos demais híbridos. Porém, o híbrido DK265bm3 não diferiu dos demais quanto à superfície do feixe vascular e espessura da parede celular do feixe vascular. Por meio de análises de correlação, verificou-se correlação positiva entre os teores de lignina klason e lignina em detergente ácido com as quantidades de células lignificadas no parênquima e córtex. A DIVFDN apresentou correlação negativa com a proporção de células lignificadas no parênquima medular e células lignificadas no córtex.The objective was to evaluate morphoanatomical characteristics and possible correlations with cell wall digestibility and with lignin of ten corn hybrids (DK265bm3, DK265, HS5, HS6, HTV2, HTV27, Anjou285, Mexxal, Pistachio and Buxxil planted at INRA (Unité of Génétique Amélioration des Plant Fourragères, Lusignan, France in 150 m² areas. A completely randomized experimental design with five replications was used. With exception for cortical length, significant differences were verified as for the evaluated morphoanatomical aspects, with hybrid DK265bm3 being characterized by lower counts of lignified cells in the medullar parenchyma and

  13. 40 CFR 265.112 - Closure plan; amendment of plan.

    Science.gov (United States)

    2010-07-01

    ... residues and contaminated containment system components, equipment, structures, and soils during partial... contaminated soils, methods for sampling and testing surrounding soils, and criteria for determining the extent of decontamination necessary to satisfy the closure performance standard; and (5) A detailed...

  14. 40 CFR 421.265 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... day Maximum for monthly average mg/troy ounce of precious metals, including silver, incinerated or... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of precious... Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold produced by cyanide stripping...

  15. All projects related to | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-12-15

    Impacts of Climate Variability and Climate Change on the Mangrove Ecosystem in Tumbes, Peru. Project. The mangrove ecosystem of Tumbes plays a pivotal role in providing protection against tides, winds and storm surges, and habitat for a number of fish species. Start Date: December 15, 2011. End Date: April 30, 2015.

  16. 45 CFR 265.1 - What does this part cover?

    Science.gov (United States)

    2010-10-01

    ... oversight responsibilities. (b) This part describes the information in the quarterly and annual reports that... quarterly Data Report, the quarterly Financial Report, and the Annual Report on State MOE Programs, as well... Caseload Reduction Report described at § 261.41(b) of this chapter. (1) The case record information...

  17. 40 CFR 265.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... to be assessed. Note: The practices described in the American Petroleum Institute (API) Publication... conditions, the stress of installation, and the stress of daily operation (including stresses from nearby... outlined in the Steel Tank Institute's (STI) “Standard for Dual Wall Underground Steel Storage Tank” may be...

  18. 40 CFR Appendix I to Part 265 - Recordkeeping Instructions

    Science.gov (United States)

    2010-07-01

    ... technique(s) used at the facility to treat, store or dispose of each quantity of hazardous waste received. 1... [Reserved] (e)Boilers and Industrial Furnaces T80Boiler T81Cement Kiln T82Lime Kiln T83Aggregate Kiln... T93Other Industrial Furnaces Listed in 40 CFR 260.10 (specify) (f)Other Treatment T94Containment Building...

  19. 33 CFR 106.265 - Security measures for restricted areas.

    Science.gov (United States)

    2010-07-01

    ...) Protect stores and industrial supplies from tampering. (b) Designation of restricted areas. The OCS... stores and industrial supplies; and (vii) Areas containing hazardous materials. (c) The OCS facility...

  20. 24 CFR 203.265 - Mortgagee's late charge and interest.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums...

  1. A highly conserved tyrosine of Tim-3 is phosphorylated upon stimulation by its ligand galectin-9

    International Nuclear Information System (INIS)

    Weyer, Philipp S. van de; Muehlfeit, Michael; Klose, Christoph; Bonventre, Joseph V.; Walz, Gerd; Kuehn, E. Wolfgang

    2006-01-01

    Tim-3 is a member of the TIM family of proteins (T-cell immunoglobulin mucin) involved in the regulation of CD4+ T-cells. Tim-3 is a T H 1-specific type 1 membrane protein and regulates T H 1 proliferation and the development of tolerance. Binding of galectin-9 to the extracellular domain of Tim-3 results in apoptosis of T H 1 cells, but the intracellular pathways involved in the regulatory function of Tim-3 are unknown. Unlike Tim-1, which is expressed in renal epithelia and cancer, Tim-3 has not been described in cells other than neuronal or T-cells. Using RT-PCR we demonstrate that Tim-3 is expressed in malignant and non-malignant epithelial tissues. We have cloned Tim-3 from an immortalized liver cell carcinoma line and identified a highly conserved tyrosine in the intracellular tail of Tim-3 (Y265). We demonstrate that Y265 is specifically phosphorylated in vivo by the interleukin inducible T cell kinase (ITK), a kinase which is located in close proximity of the TIM genes on the allergy susceptibility locus 5q33.3. Stimulation of Tim-3 by its ligand galectin-9 results in increased phosphorylation of Y265, suggesting that this tyrosine residue plays an important role in downstream signalling events regulating T-cell fate. Given the role of TIM proteins in autoimmunity and cancer, the conserved SH2 binding domain surrounding Y265 could represent a possible target site for pharmacological intervention

  2. ORF Alignment: NC_000853 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SRENIEDVKKLIDR Sbjct: 121 ITLDGTEVYHDRYRKARNGAPTFSSIFENIFRAVNKGLFVQIRVNVSRENIEDVKKLIDR 180 ... Query: 325 PRFARC...DAMCKNSFVVDVDGRVYKC 349 ... PRFARCDAMCKNSFVVDVDGRVYKC Sbjct: 241 PRFARCDAMCKNSFVVDVDGRVYKC 265

  3. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VPLEGGDFRVMPAYLSELGVAGVKIVNSHPDNPDRGLPTVMAVMC 70 ... Query: 145 FDLEAVFVYDQAREAARRLAEWVERDLGVDAKVLDNLDFSGLDVDVVCTCTPAT...EPYLGS 204 ... FDLEAVFVYDQAREAARRLAEWVERDLGVDAKVLDNLDFSGLDVDVVCTCTPAT...EPYLGS Sbjct: 131 FDLEAVFVYDQAREAARRLAEWVERDLGVDAKVLDNLDFSGLDVDVVCTCTPATEPYLGS 190 ... Query: 265 IELSDVVRGET

  4. APOA II genotypes frequency and their interaction with saturated fatty acids consumption on lipid profile of patients with type 2 diabetes.

    Science.gov (United States)

    Noorshahi, Neda; Sotoudeh, Gity; Djalali, Mahmoud; Eshraghian, Mohamad Reza; Keramatipour, Mohammad; Basiri, Marjan Ghane; Doostan, Farideh; Koohdani, Fariba

    2016-08-01

    Several studies have suggested that APOA II-265T/C polymorphism affect lipid profile. The aim of this study was to investigate the effect of -265T/C APOA II polymorphism and saturated fatty acids (SFA) intake interaction on lipid profile in diabetic population who are at risk for lipid disorders. In this cross sectional study, 697 type 2 diabetic patients participated. Food consumption data were collected using validated semi-quantitative FFQ during the last year. Realtime-PCR was used to determine APOA II-265T/C genotypes. The interaction between the genotypes and SFA intake with lipid profile was tested using analysis of covariance (ANCOVA). According to APOA II-265T/C (rs5082) genotype distribution results, CC genotype with a frequency of 12.9% and TC with that of 47.7% showed the lowest and highest frequency in our population, respectively. CC genotype subjects had significantly lower total cholesterol, triglyceride, Cholesterol/HDL-c ratio and non-HDL cholesterol than T allele carriers (p = 0.009, p = 0.02, p = 0.02 and p = 0.002, respectively). The interaction between genotype and SFA intake contributed to significant higher levels of LDL-c and LDL/HDL in CCs (p = 0.05 and p = 0.01), suggesting vulnerability of these individuals to high intake of SFA in the diet. APOA II polymorphism may influence the saturated fatty acid intake required to prevent dyslipidemia in the type 2 diabetic population. Copyright © 2015 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.

  5. Assessment of root-associated paenibacillus polymyxa groups on growth promotion and induced systemic resistance in pepper.

    Science.gov (United States)

    Phi, Quyet-Tien; Park, Yu-Mi; Seul, Keyung-Jo; Ryu, Choong-Min; Park, Seung-Hwan; Kim, Jong-Guk; Ghim, Sa-Youl

    2010-12-01

    Twenty-nine P. polymyxa strains isolated from rhizospheres of various crops were clustered into five genotypic groups on the basis of BOX-PCR analysis. The characteristics of several plant growth-promoting factors among the isolates revealed the distinct attributes in each allocated group. Under gnotobiotic conditions, inoculation of pepper roots with P. polymyxa isolates significantly increased the biomass in 17 of total 29 treated plants with untreated plants. Experiments on induced systemic resistance (ISR) against bacterial spot pathogen Xanthomonas axonopodis pv. vesicatoria in pepper by P. polymyxa strains were conducted and only one isolate (KNUC265) was selected. Further studies into ISR mediation by the KNUC265 strain against the soft-rot pathogen Erwinia carotovora subsp. carotovora in tobacco demonstrated that the tobacco seedlings exposed to either bacterial volatiles or diffusible metabolites exhibited a reduction in disease severity. In conclusion, ISR and plant growth promotion triggered by P. polymyxa isolates were systemically investigated on pepper for the first time. The P. polymyxa KNUC265 strain, which elicited both ISR and plant growth promotion, could be potentially used in improving the yield of pepper and possibly of other crops.

  6. The effect of NCS- on the radiation-induced decoloration of azo and anthraquinone dyes in N2O-saturated aqueous solutions

    International Nuclear Information System (INIS)

    Suzuki, Nobutake; Hotta, Hiroshi

    1977-01-01

    The radiation-induced decoloration of azo and anthraquinone dyes was studied in N 2 O-saturated aqueous solutions containing NCS - . In the N 2 O-saturated solutions, the decoloration yield, G(-Dye), increased markedly upon the addition of NCS - , which is an efficient scavenger of the OH radical-that is, from 1.46 up to 2.10 for Acid Red 265 and from 0.51 up to 1.51 for Acid Blue 40 upon the addition of 1 mM NCS - . In the nitrogen-saturated solutions, however, the G(-Dye) decreased upon the addition of NCS - . It is concluded that the increase in the G(-Dye) upon the addition of NCS - in the N 2 O-saturated solutions is mainly attributable to the attack of the radical anion (NCS) 2 - on the ring structure of the dyes. This radical anion is formed through the following path: NCS - +OH → NCS+OH - and NCS+NCS - reversible (NCS) 2 - . At low NCS - concentrations, the G(-Dye) decreased for Acid Red 265 and increased for Acid Blue 40. This may be attributable to the larger reactivity of (NCS) 2 - on Acid Blue 40 than on Acid Red 265. (auth.)

  7. On P-weight and P-distance inequalities

    DEFF Research Database (Denmark)

    Britz, Thomas Johann

    2006-01-01

    Jang and Park asked in [On a MacWilliams type identity and a perfectness for a binary linear (n, n - 1, j)-poset code, Discrete Math. 265 (2003) 85-104] whether, for each poset P = {l...., n}, the P-weights and P-distances satisfy the inequalities w(P)(x) - w(P)(y)......Jang and Park asked in [On a MacWilliams type identity and a perfectness for a binary linear (n, n - 1, j)-poset code, Discrete Math. 265 (2003) 85-104] whether, for each poset P = {l...., n}, the P-weights and P-distances satisfy the inequalities w(P)(x) - w(P)(y)...

  8. Brown-headed cowbirds (Molothrus ater) harbor Sarcocystis neurona and act as intermediate hosts.

    Science.gov (United States)

    Mansfield, L S; Mehler, S; Nelson, K; Elsheikha, H M; Murphy, A J; Knust, B; Tanhauser, S M; Gearhart, P M; Rossano, M G; Bowman, D D; Schott, H C; Patterson, J S

    2008-05-06

    leg muscles had a Sarcocystis that fulfills the first aim of Koch's postulates to produce disease similar to S. neurona. Two molecular assays provided further support that both S. neurona and S. falcatula were present in cowbird leg muscles. In a blinded study, PCR-RFLP of RAPD-derived DNA designed to discriminate between S. neurona and S. falcatula showed that fresh sporocysts from the opossum feeding trial had both Sarcocystis species. Visible, thick-walled sarcocysts from cowbird leg muscle were positive for S. falcatula but not S. neurona; thin-walled sarcocysts typed as S. neurona. In 1999, DNA was extracted from leg muscles of 100 wild caught cowbirds and subjected to a PCR targeting an S. neurona specific sequence of the small subunit ribosomal RNA (SSU rRNA) gene. In control spiking experiments, this assay detected DNA from 10 S. neurona merozoites in 0.5g of muscle. In the 1999 experiment, 23 of 79 (29.1%) individual cowbird leg muscle samples were positive by this S. neurona-specific PCR. Finally, in June of 2000, 265 cowbird leg muscle samples were tested by histopathology for the presence of thick- and thin-walled sarcocysts. Seven percent (18/265) had only thick-walled sarcocysts, 0.8% (2/265) had only thin-walled sarcocysts and 1.9% (5/265) had both. The other half of these leg muscles when tested by PCR-RFLP of RAPD-derived DNA and SSU rRNA PCR showed a good correlation with histopathological results and the two molecular typing methods concurred; 9.8% (26/265) of cowbirds had sarcocysts in muscle, 7.9% (21/265) had S. falcatula sarcocysts, 1.1% (3/265) had S. neurona sarcocysts, and 0.8% (2/265) had both. These results show that some cowbirds have S. neurona as well as S. falcatula in their leg muscles and can act as intermediate hosts for both parasites.

  9. Distinct roles of the DmNav and DSC1 channels in the action of DDT and pyrethroids.

    Science.gov (United States)

    Rinkevich, Frank D; Du, Yuzhe; Tolinski, Josh; Ueda, Atsushi; Wu, Chun-Fang; Zhorov, Boris S; Dong, Ke

    2015-03-01

    Voltage-gated sodium channels (Nav channels) are critical for electrical signaling in the nervous system and are the primary targets of the insecticides DDT and pyrethroids. In Drosophila melanogaster, besides the canonical Nav channel, Para (also called DmNav), there is a sodium channel-like cation channel called DSC1 (Drosophila sodium channel 1). Temperature-sensitive paralytic mutations in DmNav (para(ts)) confer resistance to DDT and pyrethroids, whereas DSC1 knockout flies exhibit enhanced sensitivity to pyrethroids. To further define the roles and interaction of DmNav and DSC1 channels in DDT and pyrethroid neurotoxicology, we generated a DmNav/DSC1 double mutant line by introducing a para(ts1) allele (carrying the I265N mutation) into a DSC1 knockout line. We confirmed that the I265N mutation reduced the sensitivity to two pyrethroids, permethrin and deltamethrin of a DmNav variant expressed in Xenopus oocytes. Computer modeling predicts that the I265N mutation confers pyrethroid resistance by allosterically altering the second pyrethroid receptor site on the DmNav channel. Furthermore, we found that I265N-mediated pyrethroid resistance in para(ts1) mutant flies was almost completely abolished in para(ts1);DSC1(-/-) double mutant flies. Unexpectedly, however, the DSC1 knockout flies were less sensitive to DDT, compared to the control flies (w(1118A)), and the para(ts1);DSC1(-/-) double mutant flies were even more resistant to DDT compared to the DSC1 knockout or para(ts1) mutant. Our findings revealed distinct roles of the DmNav and DSC1 channels in the neurotoxicology of DDT vs. pyrethroids and implicate the exciting possibility of using DSC1 channel blockers or modifiers in the management of pyrethroid resistance. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Latitudinal variation in the symbiotic dinoflagellateSymbiodiniumof the common reef zoantharianPalythoa tuberculosaon the Saudi Arabian coast of the Red Sea

    KAUST Repository

    Reimer, James D.; Herrera Sarrias, Marcela; Gatins, Remy; Roberts, May B.; Parkinson, John E.; Berumen, Michael L.

    2016-01-01

    Main conclusions Multinomial logistic regression analyses established that predictions based on the combination of temperature, chlorophyll-a and salinity accurately reflected symbiont distributions in the central and northern Red Sea. Palythoa tuberculosa host Pt-1-a in the coldest region, the Gulf of Aqaba (annual average SST = 24.5–25.0 °C), while immediately to the south Pt-3-a dominates (SST = 26.0–26.5 °C), with warmest southern sites dominated by Pt-3-b (SST > 26.5 °C). The Gulf of Aqaba is a unique environment, and more research on Symbiodinium outside the Gulf is required to understand symbiont diversity patterns within the Red Sea.

  11. Prioritization and Sensitivity Analysis of the Inhalation/Ocular Hazard of Industrial Chemicals

    Science.gov (United States)

    2011-10-28

    0.00 5.00 3.13 5.00 264 1,1,1,2-Tetrachloro 2,2- difluoroethane #(I) 76-11-9 2000.00 1.00 0.00 5.00 0.00 5.00 5.00 5.00 265 1,1,2,2-Tetrachloro 1,2... difluoroethane #(I) 76-12-0 2000.00 1.00 0.00 5.00 0.00 5.00 5.00 5.00 266 1,3-Dichloro 5,5-dimethylhydantoin #(TEEL3 of hydantoins REV 22) 118-52-5 62.06...264 1,1,1,2-Tetrachloro 2,2- difluoroethane #(I) 265 1,1,2,2-Tetrachloro 1,2- difluoroethane #(I) 266 1,3-Dichloro 5,5-dimethylhydantoin #(TEEL3 of

  12. 12 CFR 265.11 - Functions delegated to Federal Reserve Banks.

    Science.gov (United States)

    2010-01-01

    ... Company Act (12 U.S.C. 1844(c)). (2) Acquisition of going concern—authorization of consummation; early... to acquire a going concern indicate that additional information is required or that the acquisition... acquisition of a going concern before the expiration of the 30-day period referred to in Regulation Y (12 CFR...

  13. 40 CFR 265.118 - Post-closure plan; amendment of plan.

    Science.gov (United States)

    2010-07-01

    ... mail. In addition, for facilities without approved post-closure plans, it must also be provided during... requirements. At the end of the specified period of suspension, the Regional Ad-min-is-tra-tor would then...

  14. 40 CFR 265.1052 - Standards: Pumps in light liquid service.

    Science.gov (United States)

    2010-07-01

    ... pressure that is at all times greater than the pump stuffing box pressure, or (ii) Equipped with a barrier... a hazardous waste stream with no detectable emissions to the atmosphere. (2) The barrier fluid...

  15. 40 CFR Appendix IV to Part 265 - Tests for Significance

    Science.gov (United States)

    2010-07-01

    ... introductory statistics texts. ... student's t-test involves calculation of the value of a t-statistic for each comparison of the mean... parameter with its initial background concentration or value. The calculated value of the t-statistic must...

  16. 42 CFR 423.265 - Submission of bids and related information.

    Science.gov (United States)

    2010-10-01

    ... guidelines based on generally accepted actuarial principles. A qualified actuary must certify the plan's... member of the American Academy of Actuaries to be deemed qualified. Applicants may use qualified outside actuaries to prepare their bids. (d) Specific requirements for bids. The bid and supplemental information...

  17. 76 FR 8403 - Biorefinery Assistance Guaranteed Loans

    Science.gov (United States)

    2011-02-14

    ... provide additional venues, such as webinars and teleconferences, to periodically host collaborative... evaluation scoring (Sec. 4279.265) into a preapplication process. Screening and filtering out ineligible or...

  18. Inactivation kinetics and efficiencies of UV-LEDs against Pseudomonas aeruginosa, Legionella pneumophila, and surrogate microorganisms.

    Science.gov (United States)

    Rattanakul, Surapong; Oguma, Kumiko

    2018-03-01

    To demonstrate the effectiveness of UV light-emitting diodes (UV-LEDs) to disinfect water, UV-LEDs at peak emission wavelengths of 265, 280, and 300 nm were adopted to inactivate pathogenic species, including Pseudomonas aeruginosa and Legionella pneumophila, and surrogate species, including Escherichia coli, Bacillus subtilis spores, and bacteriophage Qβ in water, compared to conventional low-pressure UV lamp emitting at 254 nm. The inactivation profiles of each species showed either a linear or sigmoidal survival curve, which both fit well with the Geeraerd's model. Based on the inactivation rate constant, the 265-nm UV-LED showed most effective fluence, except for with E. coli which showed similar inactivation rates at 265 and 254 nm. Electrical energy consumption required for 3-log 10 inactivation (E E,3 ) was lowest for the 280-nm UV-LED for all microbial species tested. Taken together, the findings of this study determined the inactivation profiles and kinetics of both pathogenic bacteria and surrogate species under UV-LED exposure at different wavelengths. We also demonstrated that not only inactivation rate constants, but also energy efficiency should be considered when selecting an emission wavelength for UV-LEDs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. The influence of the volume phase concentrations of the base material on the corrosion kinetics of Zr-2.5 Nb

    International Nuclear Information System (INIS)

    Olmedo, Ana M.; Bordoni, Roberto A.; Villegas, Marina; Hermida, Jorge D.

    1999-01-01

    The corrosion kinetics in lithiated heavy water at 350 and 265 C degrees of two unirradiated Zr-2.5 Nb pressure tube materials labelled C and J is presented. Both materials have the same behaviour up to 280 days of the exposure time and follow a para linear kinetic at 350 C degrees. At 265 C degrees, material C shows a larger weight gain and the formation of white oxide nuclei on the surface of the samples after 70 days of exposure. The size and coverage of oxide nuclei increase with the exposure time. X-ray diffraction analysis detected a difference of microstructure between the two materials, a larger volume content of the metastable β-Zr phase was found in C material. The lower β-Zr content of material J leads to a better corrosion behaviour than material C at the lower temperature (265 C degrees). At the higher temperature (350 C degrees), the decomposition Zr-β → ω+β Nb-enriq → α+ω+β Nb-enriq → α+β Nb-enriq → Zr-α + Nb-β induced at the corrosion test temperature occurs at a sufficiently fast rate so that no differences in corrosion behaviour are detected between both materials. (author)

  20. First epidemiological analysis of breast cancer incidence and tumor characteristics after implementation of population-based digital mammography screening

    International Nuclear Information System (INIS)

    Weigel, Stefanie; Heindel, Walter; Batzler, W.U.; Decker, T.; Hense, H.W.

    2009-01-01

    Purpose: to epidemiologically evaluate the impact of digital mammography screening on incidence rates and tumor characteristics for breast cancer. Materials and methods: the first German digital screening units in the clinical routine were evaluated during the implementation period by using data from the cancer registry to compare the incidence rate of breast cancers and prognostic characteristics. 74% of women aged 50-69 within the region of Muenster/Coesfeld/Warendorf were invited between 10/2005 and 12/2007 for initial screening; 55% participated (n = 35961). Results: in 2002-2004 the average breast cancer incidence rate (per 100000) was 297.9. During the implementation of screening, the rate rose to 532.9 in 2007. Of the 349 cancers detected with screening, 76% (265/349) were invasive compared to 90% (546/608) of cases not detected with screening during the same period. 37% (97/265) of cancers detected in the screening program had a diameter of ≤ 10 mm and 75% (198/265) were node-negative compared to 15% (79/546) and 64% (322/503), respectively, in cancers detected outside the screening program. The distribution of invasive tumor size (pT categories) and the nodal status differed with statistical significance between cancers detected in and outside the program (p = 0.005 and p = 0.004, respectively). (orig.)

  1. Combining ability and heterosis for yield and yield contributing traits in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    Nasim, A.; Farhatullah, A.; Khan, N.U.; Afzal, M.; Azam, S.M.

    2014-01-01

    Combining ability was studied for yield and yield contributing traits in 5 * 5 diallel cross in Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt. Primary branches plant-1, pods main raceme-1, pod length, 100-seed weight and seed yield plant-1 were significantly different. Heritability and genetic advance estimates were moderate for primary branches plant-1, pods main raceme-1, 100 seed weight whereas were high for seed yield plant-1. Parental line G-909 for primary branches plant-1, pods main raceme-1 and seed yield plant-1, genotype G-902 for pod length and genotype G-403 for 100-seed weight were the best general combiners. Based on combing ability and heterosis, the F1 hybrids G-909 * G-265 (for primary branches plant-1), G-265 * G- 403, G-1500 * G-909 (for pods main raceme-1), G-403 * G-909 (for pod length), G-265 * G-1500 (for 100-seed weight) and G-1500 * G-902, G-909 * G-902 (for seed yield plant-1) can be utilized in future breeding endeavors. Non-additive genetic control, as predominant mechanism, for all the traits necessitates the use of schemes like bi-parental mating design, diallel selective mating followed by recurrent or reciprocal recurrent selection. (author)

  2. Has the Action for Failure to Act in the European Union Lost its Purpose?

    Directory of Open Access Journals (Sweden)

    Daukšienė Inga

    2014-12-01

    Full Text Available This article analyzes the purpose of the action for failure to act under article 265 of the Treaty on the Functioning of the European Union (TFEU. The statements are derived from the analysis of scientific literature, relevant legislation, practice of the European Union Court of Justice (CJEU and the European Union General Court (EUGC. Useful information has also been obtained from the opinions of general advocates of the CJEU. The article of TFEU 265, which governs the action for failure to act, is very abstract. For this reason, a whole procedure under the article 265 TFEU was developed by the EU courts. The original purpose of the action for failure to act was to constitute whether European Union (EU institution properly fulfilled its obligations under the EU legislation. However, in the course of case-law, a mere EU institution’s express refusal to fulfill its duties became sufficient to constitute that the EU institution acted and therefore action for failure to act became devoid of purpose. This article analyzes whether the action for failure to act has lost its purpose and become an ineffective legal remedy in the system of judicial review in the EU. Additionally, the action for failure to act is compared to similar national actions.

  3. StreamCat

    Data.gov (United States)

    U.S. Environmental Protection Agency — The StreamCat Dataset provides summaries of natural and anthropogenic landscape features for ~2.65 million streams, and their associated catchments, within the...

  4. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  5. Headache and Vascular Events with Brain Tumors

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2013-05-01

    Full Text Available Investigators at the Children's Hospital of Philadelphia, PA, performed a retrospective study of 265 children with brain tumors who received cranial irradiation and developed severe recurrent headache.

  6. Phase I Marine Archeological Remote Sensing Survey of the Proposed Mississippi River Sand Borrow Sites for the Louisiana Coastal Area Barrier Shoreline Restoration Project, Plaquemines Parish, Louisiana

    Science.gov (United States)

    2008-09-01

    Map 6) is comprised of sixteen magnetic anomalies, designated Ml08, Ml46, Ml69, Ml86, M205, M250 , M263, M265, M280, M284, M289, M300, M305, M318...high amplitudes that range from 133.6 to 4211.1 nT, except Ml69, Ml86. M205, M250 , M263, and M265 that have amplitudes ranging from 24.1 to 56.8 nT...3845173.32 20 M248 B 32 01:10.1 167.8 -M 320372.02 3846568.45 N/A M249 B 32 01:46.2 84.5 D 319642.84 3848381.28 22 M250 B 33 01:11.2 34.9 D 318099.83

  7. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQ 265 >sp|O70585|DTNB_MOUSE Dystrobr...P + A V + P+ C++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQ

  8. Profilometrie povrchů kompozitních materiálů

    Czech Academy of Sciences Publication Activity Database

    Hrabovský, Miroslav; Kopřiva, Miroslav; Kubínek, R.; Vůjtek, M.; Pírek, P.

    2005-01-01

    Roč. 50, č. 9 (2005), s. 262-265 ISSN 0447-6441 Institutional research plan: CEZ:AV0Z10100522 Keywords : polyglass * surface profilometry * composite materials Subject RIV: BH - Optics, Masers, Lasers

  9. Diversity, distribution and host-species associations of epiphytic orchids in Nepal

    Czech Academy of Sciences Publication Activity Database

    Timsina, B.; Rokaya, Maan Bahadur; Münzbergová, Zuzana; Kindlmann, P.; Shrestha, B.; Bhattarai, B.; Raskoti, B. B.

    2016-01-01

    Roč. 25, č. 13 (2016), s. 2803-2819 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : species richness * host * Nepal Himalaya Subject RIV: EF - Botanics Impact factor: 2.265, year: 2016

  10. Degeneration of biogenic superparamagnetic magnetite.

    Science.gov (United States)

    Li, Y-L; Pfiffner, S M; Dyar, M D; Vali, H; Konhauser, K; Cole, D R; Rondinone, A J; Phelps, T J

    2009-01-01

    Magnetite crystals precipitated as a consequence of Fe(III) reduction by Shewanella algae BrY after 265 h incubation and 5-year anaerobic storage were investigated with transmission electron microscopy, Mössbauer spectroscopy and X-ray diffraction. The magnetite crystals were typically superparamagnetic with an approximate size of 13 nm. The lattice constants of the 265 h and 5-year crystals are 8.4164A and 8.3774A, respectively. The Mössbauer spectra indicated that the 265 h magnetite had excess Fe(II) in its crystal-chemistry (Fe(3+) (1.990)Fe(2+) (1.015)O(4)) but the 5-year magnetite was Fe(II)-deficient in stoichiometry (Fe(3+) (2.388)Fe(2+) (0.419)O(4)). Such crystal-chemical changes may be indicative of the degeneration of superparamagnetic magnetite through the aqueous oxidization of Fe(II) anaerobically, and the concomitant oxidation of the organic phases (fatty acid methyl esters) that were present during the initial formation of the magnetite. The observation of a corona structure on the aged magnetite corroborates the anaerobic oxidation of Fe(II) on the outer layers of magnetite crystals. These results suggest that there may be a possible link between the enzymatic activity of the bacteria and the stability of Fe(II)-excess magnetite, which may help explain why stable nano-magnetite grains are seldom preserved in natural environments.

  11. Degeneration of Biogenic Superparamagnetic Magnetite

    Energy Technology Data Exchange (ETDEWEB)

    Li, Dr. Yi-Liang [University of Tennessee, Knoxville (UTK); Pfiffner, Susan M. [University of Tennessee, Knoxville (UTK); Dyar, Dr. M Darby [Mount Holyoke College; Vali, Dr. Hojatolah [McGill University, Montreal, Quebec; Konhauser, Dr, Kurt [University of Alberta; Cole, David R [ORNL; Rondinone, Adam Justin [ORNL; Phelps, Tommy Joe [ORNL

    2009-01-01

    ABSTRACT. Magnetite crystals precipitated as a consequence of Fe(III) reduction by Shewanella algae BrY after 265 hours incubation and 5-year storage were investigated with transmission electron microscopy, M ssbauer spectroscopy and X-ray diffraction. The magnetite crystals were typically superparamagnetic with an approximate size of 13 nm. The lattice constants of the 265 hour and 5-year crystals are 8.4164 and 8.3774 , respectively. The M ssbauer spectra indicated that the 265 hour magnetite had excess Fe(II) in its crystal-chemistry (Fe3+1.9901Fe2+ 1.0149O4) but the 5-year magnetite was Fe(II)-deficient in stoichiometry (Fe3+2.3875Fe2+0.4188O4). Such crystal-hemical changes may be indicative of the degeneration of superparamagnetic magnetite through the aqueous oxidization of Fe(II) anaerobically, and the concomitant oxidation of the organic phases(fatty acid methyl esters) that were present during the initial formation of the magnetite. The observation of a corona structure on the aged magnetite corroborates the oxidation of Fe(II) on the outer layers of magnetite crystals. These results suggest that there may be a possible link between the enzymatic activity of the bacteria and the stability of Fe(II)-excess magnetite, which may help explain why stable nano-magnetite grains are seldom preserved in natural environments.

  12. Structural, Functional, and Clinical Characterization of a Novel PTPN11 Mutation Cluster Underlying Noonan Syndrome.

    Science.gov (United States)

    Pannone, Luca; Bocchinfuso, Gianfranco; Flex, Elisabetta; Rossi, Cesare; Baldassarre, Giuseppina; Lissewski, Christina; Pantaleoni, Francesca; Consoli, Federica; Lepri, Francesca; Magliozzi, Monia; Anselmi, Massimiliano; Delle Vigne, Silvia; Sorge, Giovanni; Karaer, Kadri; Cuturilo, Goran; Sartorio, Alessandro; Tinschert, Sigrid; Accadia, Maria; Digilio, Maria C; Zampino, Giuseppe; De Luca, Alessandro; Cavé, Hélène; Zenker, Martin; Gelb, Bruce D; Dallapiccola, Bruno; Stella, Lorenzo; Ferrero, Giovanni B; Martinelli, Simone; Tartaglia, Marco

    2017-04-01

    Germline mutations in PTPN11, the gene encoding the Src-homology 2 (SH2) domain-containing protein tyrosine phosphatase (SHP2), cause Noonan syndrome (NS), a relatively common, clinically variable, multisystem disorder. Here, we report on the identification of five different PTPN11 missense changes affecting residues Leu 261 , Leu 262 , and Arg 265 in 16 unrelated individuals with clinical diagnosis of NS or with features suggestive for this disorder, specifying a novel disease-causing mutation cluster. Expression of the mutant proteins in HEK293T cells documented their activating role on MAPK signaling. Structural data predicted a gain-of-function role of substitutions at residues Leu 262 and Arg 265 exerted by disruption of the N-SH2/PTP autoinhibitory interaction. Molecular dynamics simulations suggested a more complex behavior for changes affecting Leu 261 , with possible impact on SHP2's catalytic activity/selectivity and proper interaction of the PTP domain with the regulatory SH2 domains. Consistent with that, biochemical data indicated that substitutions at codons 262 and 265 increased the catalytic activity of the phosphatase, while those affecting codon 261 were only moderately activating but impacted substrate specificity. Remarkably, these mutations underlie a relatively mild form of NS characterized by low prevalence of cardiac defects, short stature, and cognitive and behavioral issues, as well as less evident typical facial features. © 2017 WILEY PERIODICALS, INC.

  13. Abelovu cenu za matematiku získal v roce 2014 Jakov G. Sinaj

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2014-01-01

    Roč. 59, č. 4 (2014), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : billiards * entropy * binary sequences Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144076

  14. 75 FR 79725 - Fall 2010 Semiannual Agenda of Regulations

    Science.gov (United States)

    2010-12-20

    ... Leatherback Sea 0648-AX06 Turtle 265 Critical Habitat Designation for Cook Inlet Beluga Whale Under the... mackerel, Loligo squid, Illex squid, and butterfish (including gear impacts on Loligo squid egg EFH); and...

  15. Behavioral phenotyping of minipigs transgenic for the Huntington gene

    Czech Academy of Sciences Publication Activity Database

    Schramke, S.; Schuldenzucker, V.; Schubert, R.; Frank, F.; Wirsig, M.; Ott, S.; Motlík, Jan; Fels, M.; Kemper, N.; Hölzner, E.; Reilmann, R.

    2016-01-01

    Roč. 265, S1 (2016), s. 34-45 ISSN 0165-0270 Institutional support: RVO:67985904 Keywords : animal models * minipig * phenotyping * behavioral * motor Subject RIV: FH - Neurology Impact factor: 2.554, year: 2016

  16. The Effects of Vitex agnus castus Total Extract on Spermatogenesis of Balb/C Mice

    Directory of Open Access Journals (Sweden)

    M Ramezani

    2008-12-01

    Full Text Available ABSTRACT Introduction & Objective: Vitex agnus castus (Verbenaceae is a phytoestrogeic herb native to the Middle East and southern Europe. It has clinical usage in so many countries. In this research, the effects of Vitex agnus castus extract was investigated on spermatogenesis of male Balb/C mice. Materials & Methods: This is an experimental study in which adult male mice were chosen and divided into 3 groups: control, vehicle, and experimental. Animals were daily injected (i.p. with 65, 165 265, 365, and 465 mg/kg of seed extract for ten consecutive days. Then the animals were weighed and eventually killed by cervical dislocation 2 weeks after the last injection. The caudal part of the right epididymis was used for sperm counting. After macroscopic investigation (weight, diameter and volume of testes tissues were fixed in Buin's fixative. Tissues were cut at 5 µm, stained with Hematoxylin and Eosin (H& E.Ccollected data was analyzed by the SPSS software by using one-way ANOVA. Results: No significant differences in body weight, volume, weight and diameter of testes was seen. Light microscopic studies showed a significant reduction in germinal epithelium in doses of 265 and 365 mg/kg and increased of interstitial tissue area in doses of 265, 365, and 465 mg/kg of extract. There was no significant difference in epithelium thickness and of the diameter of the epididymis. Germinal cells contained pyknotic nuclei and several holes that were found scattered in the tubules. Testis also showed a general disarrangement in various germinal elements of seminiferous tubules. Result of sperms count indicated a significant decreasing of spermatozoa in animals which received 265 and 365 mg/kg of extract. Conclusion: Vitex agnus castus contains essential oils, iridoid glycosides, flavonoids diterpenes, and essential fatty acids. The results suggest that its contraceptive effects is related to its flavonoids and essential fatty acids but further studies is

  17. Burnout among medical students during the first years of undergraduate school: Prevalence and associated factors.

    Science.gov (United States)

    Boni, Robson Aparecido Dos Santos; Paiva, Carlos Eduardo; de Oliveira, Marco Antonio; Lucchetti, Giancarlo; Fregnani, José Humberto Tavares Guerreiro; Paiva, Bianca Sakamoto Ribeiro

    2018-01-01

    To evaluate the prevalence and possible factors associated with the development of burnout among medical students in the first years of undergraduate school. A cross-sectional study was conducted at the Barretos School of Health Sciences, Dr. Paulo Prata. A total of 330 students in the first four years of medical undergraduate school were invited to participate in responding to the sociodemographic and Maslach Burnout Inventory-Student Survey (MBI-SS) questionnaires. The first-year group consisted of 150 students, followed by the second-, third-, and fourth-year groups, with 60 students each. Data from 265 students who answered at least the sociodemographic questionnaire and the MBI-SS were analyzed (response rate = 80.3%). One (n = 1, 0.3%) potential participant viewed the Informed Consent Form but did not agree to participate in the study. A total of 187 students (187/265, 70.6%) presented high levels of emotional exhaustion, 140 (140/265, 52.8%) had high cynicism, and 129 (129/265, 48.7%) had low academic efficacy. The two-dimensional criterion indicated that 119 (44.9%) students experienced burnout. Based on the three-dimensional criterion, 70 students (26.4%) presented with burnout. The year with the highest frequency of affected students for both criteria was the first year (p = 0.001). Personal attributes were able to explain 11% (ΔR = 0.11) of the variability of burnout under the two-dimensional criterion and 14.4% (R2 = 0.144) under the three-dimensional criterion. This study showed a high prevalence of burnout among medical students in a private school using active teaching methodologies. In the first years of graduation, students' personal attributes (optimism and self-perception of health) and school attributes (motivation and routine of the exhaustive study) were associated with higher levels of burnout. These findings reinforce the need to establish preventive measures focused on the personal attributes of first-year students, providing better

  18. Burnout among medical students during the first years of undergraduate school: Prevalence and associated factors

    Science.gov (United States)

    Paiva, Carlos Eduardo; de Oliveira, Marco Antonio; Lucchetti, Giancarlo; Fregnani, José Humberto Tavares Guerreiro; Paiva, Bianca Sakamoto Ribeiro

    2018-01-01

    Objective To evaluate the prevalence and possible factors associated with the development of burnout among medical students in the first years of undergraduate school. Method A cross-sectional study was conducted at the Barretos School of Health Sciences, Dr. Paulo Prata. A total of 330 students in the first four years of medical undergraduate school were invited to participate in responding to the sociodemographic and Maslach Burnout Inventory-Student Survey (MBI-SS) questionnaires. The first-year group consisted of 150 students, followed by the second-, third-, and fourth-year groups, with 60 students each. Results Data from 265 students who answered at least the sociodemographic questionnaire and the MBI-SS were analyzed (response rate = 80.3%). One (n = 1, 0.3%) potential participant viewed the Informed Consent Form but did not agree to participate in the study. A total of 187 students (187/265, 70.6%) presented high levels of emotional exhaustion, 140 (140/265, 52.8%) had high cynicism, and 129 (129/265, 48.7%) had low academic efficacy. The two-dimensional criterion indicated that 119 (44.9%) students experienced burnout. Based on the three-dimensional criterion, 70 students (26.4%) presented with burnout. The year with the highest frequency of affected students for both criteria was the first year (p = 0.001). Personal attributes were able to explain 11% (ΔR = 0.11) of the variability of burnout under the two-dimensional criterion and 14.4% (R2 = 0.144) under the three-dimensional criterion. Conclusion This study showed a high prevalence of burnout among medical students in a private school using active teaching methodologies. In the first years of graduation, students’ personal attributes (optimism and self-perception of health) and school attributes (motivation and routine of the exhaustive study) were associated with higher levels of burnout. These findings reinforce the need to establish preventive measures focused on the personal attributes of first

  19. African Journal of Biotechnology - Vol 3, No 5 (2004)

    African Journals Online (AJOL)

    Improving bambara groundnut productivity using gamma irradiation and in vitro techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Adu-Dapaah, RS Sangwan, 260-265 ...

  20. Large beech (Fagus sylvatica) trees as ‘lifeboats’ for lichen diversity in central European forests

    Czech Academy of Sciences Publication Activity Database

    Hofmeister, J.; Hošek, J.; Malíček, J.; Palice, Zdeněk; Syrovátková, L.; Steinová, J.; Černajová, I.

    2016-01-01

    Roč. 25, č. 6 (2016), s. 1073-1090 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : Fagus * forest management * Red-listed species Subject RIV: EH - Ecology, Behaviour Impact factor: 2.265, year: 2016

  1. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 21. KidsCancerChannel 64,265 views 5:21 Little Stars – Paediatric Palliative Care – Charlie's Story - Duration: 10:35. Little Stars 12,980 views 10:35 LIFE Before Death ...

  2. Quarterly report of RCRA groundwater monitoring data for period January 1, 1993 through March 31, 1993

    Energy Technology Data Exchange (ETDEWEB)

    1993-07-01

    Hanford Site interim-status groundwater monitoring projects are conducted as either background, indicator parameter evaluation, or groundwater quality assessment monitoring programs as defined in the Resource Conservation and Recovery Act of 1976 (RCRA); and Interim Status Standards for Owners and Operators of Hazardous Waste Treatment, Storage, and Disposal Facilities, as amended (40 Code of Federal Regulations [CFR] 265). Compliance with the 40 CFR 265 regulations is required by the Washington Administrative Code (WAC) 173-303. This report contains data from Hanford Site groundwater monitoring projects. This quarterly report contains data received between March 8 and May 24, 1993, which are the cutoff dates for this reporting period. This report may contain not only data from the January through March quarter but also data from earlier sampling events that were not previously reported.

  3. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  4. Waldenström macroglobulinemia: Progress in evidence-based medicine and updates of consensus panel recommendation

    Directory of Open Access Journals (Sweden)

    Jian HOU

    2013-09-01

    Full Text Available Waldenström macroglobulinemia (WM is a distinct B-cell lymphoproliferative disorder primarily characterized by infiltration of lymphoplasmacytic cells into the bone marrow, along with demonstration of monoclonal immunoglobulinemia M(IgM. Recent studies have demonstrated the MYD88 L265P somatic mutation contributes to the pathogenesis of WM. Mutated MYD88 activates NF-κB through a series of signals, which results in abnormal propagation of B cells. Clinical manifestation mainly consisted of tissue injuries attributable to tissue infiltration and monoclonal IgM. WM should be differentiated from lymphomas producing monoclonal IgM, and detection of MYD88 L265P mutation provides a new way to differentiate WM from other similar diseases. At present recommended treatments for WM include alkylating agents, nucleoside analogues, bortezomib, rituximab etc.

  5. Beneficial effect of acupuncture in the management of anxiety related to dental treatment: a set of case series

    DEFF Research Database (Denmark)

    Rosted, P; Bundgaard, M; Gordon, S

    2010-01-01

    BACKGROUND: Anxiety related to dental treatment is a common phenomenon that has a significant impact on the provision of appropriate dental care. The aim of this case series was to examine the effect of acupuncture given prior to dental treatment on the level of anxiety. METHODS: Eight dentists...... a median BAI score of 26.5 at baseline. The BAI score was assessed before and after the acupuncture treatment. All patients received acupuncture treatment for 5 min prior to the planned dental treatment using the points GV20 and EX6. RESULTS: There was a significant reduction in median value of BAI scores...... after treatment with acupuncture (26.5 reduced to 11.5; pacupuncture treatment. Previously this had only been possible in six cases. CONCLUSION: Acupuncture prior to dental treatment has a beneficial effect...

  6. Does the sun ring

    International Nuclear Information System (INIS)

    Isaak, G.R.

    1978-01-01

    The work of various groups, which have been investigating the possibility of measuring the periodicities of solar oscillations in an attempt to test theoretical models of the sun, is reported. In particular the observation of small velocity oscillations of the surface layers of the sun that permits the measurement of the sound waves (or phonons) in the solar atmosphere, is discussed. Oscillations with periods of 2.65 h, 58 and 40 min and amplitudes of 2.7, 0.8 and 0.7 ms -1 respectively are reported. Support for a periodicity at about 2.65 h from a number of other groups using other measuring techniques are considered. It is felt that the most probable interpretation of the observed solar oscillations is that the sun is a resonator which is ringing. (UK)

  7. of GH gene in camel breeds reared in Egypt

    African Journals Online (AJOL)

    Hend

    2015-03-04

    Mar 4, 2015 ... M: 100-bp ladder marker. Lanes 1-6: 613-bp PCR product amplified from camel DNA. ... position 264^265, we can easily differentiate between .... Sustainable Agricultural Development Strategy Towards 2030 (SADS). (2009).

  8. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  9. Neuroimaging of a minipig model of Huntington's disease: Feasibility of volumetric, diffusion-weighted and spectroscopic assessments

    Czech Academy of Sciences Publication Activity Database

    Schubert, R.; Frank, F.; Nagelmann, N.; Liebsch, L.; Schuldenzucker, V.; Schramke, S.; Wirsig, M.; Johnson, H.; Young Kim, E.; Ott, S.; Hölzner, E.; Demokritov, S. O.; Motlík, Jan; Faber, C.; Reilmann, R.

    2016-01-01

    Roč. 265, S1 (2016), s. 46-55 ISSN 0165-0270 Institutional support: RVO:67985904 Keywords : animal models * minipig * MRI * brain atlas * preclinical research Subject RIV: FH - Neurology Impact factor: 2.554, year: 2016

  10. V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Markl, Martin; Somer, L.

    2013-01-01

    Roč. 58, č. 4 (2013), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

  11. Helminth genome projects: all or nothing

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; Horák, Aleš; Scholz, Tomáš

    2005-01-01

    Roč. 21, č. 6 (2005), s. 265-266 ISSN 1471-4922 Institutional research plan: CEZ:AV0Z60220518 Keywords : genome project * helminth * Dracunculus Subject RIV: EG - Zoology Impact factor: 4.526, year: 2005

  12. Chromosomal variation in social voles: a Robertsonian fusion in Günther‘s vole

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Arslan, A.; Benda, P.; Macholán, Miloš; Kryštufek, B.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 255-265 ISSN 0001-7051 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : karyotypes * systematics * C-banding * NOR distribution Subject RIV: EG - Zoology Impact factor: 1.161, year: 2013

  13. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2014-01-01

    Roč. 61, č. 6 (2014), s. 265-271 ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  14. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

  15. Neonatal Malaria in the Gambia

    African Journals Online (AJOL)

    Uche

    Inclusion Criteria. All consecutive ... these, 105 (26.5%) satisfied the inclusion criteria ..... Bulletin de la Societe de Pathologie Exotique 1991; ... Revista do Hospital das Clinicas; Faculdade de. Medicina Da Universidade de Sao Paulo. 1993 ...

  16. 40 CFR 265.1033 - Standards: Closed-vent systems and control devices.

    Science.gov (United States)

    2010-07-01

    ... actual exit velocity of a flare shall be determined by dividing the volumetric flow rate (in units of.... The system shall be equipped with at least one pressure gauge or other pressure measurement device...

  17. Langerhans cell precursors acquire RANK/CD265 in prenatal human skin.

    Science.gov (United States)

    Schöppl, Alice; Botta, Albert; Prior, Marion; Akgün, Johnnie; Schuster, Christopher; Elbe-Bürger, Adelheid

    2015-01-01

    The skin is the first barrier against foreign pathogens and the prenatal formation of a strong network of various innate and adaptive cells is required to protect the newborn from perinatal infections. While many studies about the immune system in healthy and diseased adult human skin exist, our knowledge about the cutaneous prenatal/developing immune system and especially about the phenotype and function of antigen-presenting cells such as epidermal Langerhans cells (LCs) in human skin is still scarce. It has been shown previously that LCs in healthy adult human skin express receptor activator of NF-κB (RANK), an important molecule prolonging their survival. In this study, we investigated at which developmental stage LCs acquire this important molecule. Immunofluorescence double-labeling of cryostat sections revealed that LC precursors in prenatal human skin either do not yet [10-11 weeks of estimated gestational age (EGA)] or only faintly (13-15 weeks EGA) express RANK. LCs express RANK at levels comparable to adult LCs by the end of the second trimester. Comparable with adult skin, dermal antigen-presenting cells at no gestational age express this marker. These findings indicate that epidermal leukocytes gradually acquire RANK during gestation - a phenomenon previously observed also for other markers on LCs in prenatal human skin. Copyright © 2015 The Authors. Published by Elsevier GmbH.. All rights reserved.

  18. Far-infrared spectrophotometry of SN 1987A - Days 265 and 267

    Science.gov (United States)

    Moseley, S. H.; Dwek, E.; Silverberg, R. F.; Glaccum, W.; Graham, J. R.; Loewenstein, R. F.

    1989-01-01

    The paper presents 16-66-micron spectra of SN 1987A taken on days 266 and 268 after core collapse. The spectrum consists of a nearly flat continuum, strong emission lines of hydrogen, and fine-structure lines of Fe II, Fe III, Co II, S I, and possibly Fe I, Ni II, and S III. From the relative strength of three lines which arise from transitions within the ground and excited states of Fe II, the temperature and a lower limit on the density of the line-emitting region are derived. From the line strengths, the abundances of Fe and S I, the end products of explosive nucleosynthesis in the supernova are estimated. An upper limit is also set to the amount of Co II remaining in the mantle. The low measured mass of Fe suggests that the ejecta are clumpy. The flat continuum is most likely free-free emission from the expanding supernova ejecta. About 35 percent of this emission arises from the ionized metals in the mantle; the rest arises from ionized hydrogen. At the time of these observations, there is no evidence for any emission from dust that may have formed in the supernova ejecta or from preexisting dust in the surrounding medium.

  19. 39 CFR 265.7 - Procedure for inspection and copying of records.

    Science.gov (United States)

    2010-07-01

    ... additional time provided by paragraph (b)(5) of this section, in spite of the exercise of due diligence, the... an expedited basis could reasonably be expected to pose an imminent threat to the life or physical...

  20. 12 CFR 265.5 - Functions delegated to Secretary of the Board.

    Science.gov (United States)

    2010-01-01

    ... corporation subsidiaries, provided that: (i) The member bank's total investment, including the retained earnings of the Edge and agreement corporation subsidiaries, does not exceed 20 percent of the bank's...

  1. : tous les projets | Page 265 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: RELIGIOUS MINORITIES, MUSLIMS, NONGOVERNMENTAL ORGANIZATIONS, Civil society, Economic and social development, VOLUNTARY ORGANIZATIONS. Région: India, Central Asia, Far East Asia, South Asia. Financement total : CA$ 91,520.00. Recensement des initiatives de la société civile axées sur le ...

  2. 40 CFR 265.314 - Special requirements for bulk and containerized liquids.

    Science.gov (United States)

    2010-07-01

    ... (volcanic glass); expanded volcanic rock; volcanic ash; cement kiln dust; fly ash; rice hull ash; activated... density polyethylene (HDPE), polypropylene, polystyrene, polyurethane, polyacrylate, polynorborene...

  3. Determination of methylmercury in cryptogams by means of GC-AFS using enzymatic hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Coufalík, Pavel; Meszarosová, N.; Coufalíková, K.; Zvěřina, O.; Komárek, J.

    2018-01-01

    Roč. 140 (2018), s. 8-13 ISSN 0026-265X Institutional support: RVO:68081715 Keywords : methylmercury * cryptogam * GC-AFS Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.034, year: 2016

  4. GenBank blastx search result: AK288311 [KOME

    Lifescience Database Archive (English)

    Full Text Available (UL26), virion scaffolding protein (UL26.5), virion membrane glycoprotein B (gB), DNA cleavage/packaging pro... subunit (pol), nuclear phosphoprotein (UL31), DNA cleavage/packaging (UL32), DNA cleavage/packaging protein

  5. Forest Vegetation with Festuca drymeja in Slovakia – Syntaxonomy and Ecology

    Czech Academy of Sciences Publication Activity Database

    Máliš, František; Jarolímek, I.; Kliment, J.; Slezák, M.

    2013-01-01

    Roč. 53, č. 2 (2013), s. 265-288 ISSN 0079-2047 Institutional support: RVO:67985939 Keywords : Symphyto cordatae-Fagion * Carpathians * temperate deciduous and mixed forests Subject RIV: EF - Botanics Impact factor: 0.388, year: 2013

  6. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Guam.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 22-26 September 2003 (JD 265-269) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Guam Island in...

  7. Movement of the patient and the cone beam computed tomography scanner: objectives and possible solutions

    Czech Academy of Sciences Publication Activity Database

    Hanzelka, T.; Dušek, J.; Ocásek, F.; Kučera, J.; Šedý, Jiří; Beneš, J.; Pavlíková, G.; Foltán, R.

    2013-01-01

    Roč. 116, č. 6 (2013), s. 769-773 ISSN 2212-4403 Institutional support: RVO:67985823 Keywords : cone beam computed tomography * movement artifacts * dry-run scan Subject RIV: ED - Physiology Impact factor: 1.265, year: 2013

  8. A two-sex demographic model with single-dependent divorce rate

    Czech Academy of Sciences Publication Activity Database

    Maxim, D.; Berec, Luděk

    2010-01-01

    Roč. 265, č. 4 (2010), s. 647-656 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : population dynamics * bifurcation * demography Subject RIV: EH - Ecology, Behaviour Impact factor: 2.371, year: 2010

  9. Knowledge and willingness of prenatal women in Enugu ...

    African Journals Online (AJOL)

    pharmacological labour pain reliefs. Methods: Using a descriptive ... The leading four methods identified were breathing exercises (51.8%), massage (36.7), position changes (32.2%), and relaxation techniques (26.5%). Majority (59.6%) of the ...

  10. PRODUKSI ETANOL DARI TETES TEBU OLEH Saccharomyces cerevisiae PEMBENTUK FLOK (NRRL – Y 265 (Ethanol Production from Cane Molasses by Flocculant Saccharomyces cerevisiae (NRRL – Y 265

    Directory of Open Access Journals (Sweden)

    Agustin Krisna Wardani

    2013-08-01

    Full Text Available The potential use of sugar cane molasses by flocculant Saccharomyces cerevisiae in ethanol production was investigated. In order to minimize the negative effect of calcium on yeast growth, pretreated sugar cane molasses with dilute acid was performed. The influence of process parameters such as sugar concentration and inoculum concentration were evaluated for enhancing bioethanol production. Result showed that maximum ethanol concentration of 8,792% (b/v was obtained at the best condition of inoculum concentration 10% (v/v and sugar concentration 15% (b/v. Based on the experimental data, maximum yield of ethanol production of 65% was obtained. This result demonstrated the potential of molasses as promising biomass resources for ethanol production. Keywords: Ethanol, preteated cane molasses, flocculant Saccharomyces cerevisiae, fermentation   ABSTRAK Efisiensi produksi bioetanol diperoleh melalui ketepatan pemilihan jenis mikroorganisme, bahan baku, dan kontrol proses fermentasi. Alternatif proses untuk meminimalisasi biaya produksi etanol adalah dengan mengeliminasi tahap pemisahan sentrifugasi sel dari produk karena memerlukan biaya instalasi dan biaya perawatan yang tinggi. Proses sentrifugasi merupakan tahapan penting untuk memisahkan sel mikroba dari medium fermentasi pada produksi bioetanol. Untuk meminimalisir biaya produksi akibat proses tersebut digunakan inokulum Saccharomyces cerevisiae pembentuk flok dan tetes tebu sebagai sumber gula. Penelitian ini bertujuan untuk mendapatkan konsentrasi penambahan inokulum Saccharomyces cerevisiae pembentuk flok dan konsentrasi sumber gula dalam tetes tebu yang tepat dalam produksi etanol yang maksimum. Saccharomyces cerevisiae sebanyak 5%, 10%, dan 15% (v/v diinokulasikan pada medium tetes tebu hasil pretreatment dengan kandungan gula 15%, 20%, dan 25% (b/v pada pH 5. Fermentasi dilakukan pada suhu 30°C dan agitasi 100 rpm selama 72 jam. Etanol tertinggi didapat pada kondisi konsentrasi inokulum 10% (v/v dan konsentrasi sumber gula 15% (b/v yaitu sebesar 8, 792% (b/v dengan yield etanol sebesar 65%. Kata kunci: Etanol, tetes tebu, Saccharomyces cerevisiae pembentuk flok, fermentasi

  11. Zápis rumunských vlastních jmen s monofunkčním písmenem e v koncové slabice

    Czech Academy of Sciences Publication Activity Database

    Beneš, Martin

    2012-01-01

    Roč. 95, č. 5 (2012), s. 265-271 ISSN 0027-8203 Institutional support: RVO:68378092 Keywords : czech spelling * geographical proper names of Romain origin * orthography * personal proper names of Romain origin * pronunciation Subject RIV: AI - Linguistics

  12. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  13. The collapsed football pla yer

    African Journals Online (AJOL)

    Football is the most popular sport in the world, played by over 265 ... FIFA Medical Officer and Honorary Part-time Lecturer, Wits Centre for Exercise Science and Sports Medicine, Johannesburg .... Management of a collapsed player does not.

  14. Breast Cancer Disparities

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  15. CDC Vital Signs: Breast Cancer

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  16. Hypolipidemic effect of beer proteins in experiment on rats

    Czech Academy of Sciences Publication Activity Database

    Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.

    2002-01-01

    Roč. 35, č. 3 (2002), s. 265-271 ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

  17. Interventions to promote psychiatric patients' compliance to mental ...

    African Journals Online (AJOL)

    2014-11-21

    Nov 21, 2014 ... Such a synthesis may be considered by mental health .... Cochrane: n = 104. Manual. Reference list: n = 13. Total: n = 1365. FIGURE 1: ..... antidepressant treatment', Nordic Journal of Psychiatry 64(4), 265−267. http://.

  18. MreB drives de novo rod morphogenesis in Caulobacter crescentus via remodeling of the cell wall.

    Science.gov (United States)

    Takacs, Constantin N; Poggio, Sebastian; Charbon, Godefroid; Pucheault, Mathieu; Vollmer, Waldemar; Jacobs-Wagner, Christine

    2010-03-01

    MreB, the bacterial actin-like cytoskeleton, is required for the rod morphology of many bacterial species. Disruption of MreB function results in loss of rod morphology and cell rounding. Here, we show that the widely used MreB inhibitor A22 causes MreB-independent growth inhibition that varies with the drug concentration, culture medium conditions, and bacterial species tested. MP265, an A22 structural analog, is less toxic than A22 for growth yet equally efficient for disrupting the MreB cytoskeleton. The action of A22 and MP265 is enhanced by basic pH of the culture medium. Using this knowledge and the rapid reversibility of drug action, we examined the restoration of rod shape in lemon-shaped Caulobacter crescentus cells pretreated with MP265 or A22 under nontoxic conditions. We found that reversible restoration of MreB function after drug removal causes extensive morphological changes including a remarkable cell thinning accompanied with elongation, cell branching, and shedding of outer membrane vesicles. We also thoroughly characterized the composition of C. crescentus peptidoglycan by high-performance liquid chromatography and mass spectrometry and showed that MreB disruption and recovery of rod shape following restoration of MreB function are accompanied by considerable changes in composition. Our results provide insight into MreB function in peptidoglycan remodeling and rod shape morphogenesis and suggest that MreB promotes the transglycosylase activity of penicillin-binding proteins.

  19. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  20. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-04-18

    Apr 18, 2018 ... This research aims to improve the properties of silicone rubber ... respectively and the rest of the compound oxide types are approximately 0.265% [5]. The ... E. Contact Angle & Scanning Electron Microscope (SEM). We have ...

  1. Data of evolutionary structure change: 1BTZA-2OQUA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available A 2OQUA ence>SLQYRSGSSWAHTCG... A 2OQUA ence>PLHCLVNGQYAVHGence> ...A 265 2OQU A 2OQUA ... A 2OQUA ence>MVCAG-GDGVR...1BTZA-2OQUA 1BTZ 2OQU A A IVGGYTCGANTVPYQVSLNSG-----YHFCGGSLINSQW

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    Administrator

    Red luminescence from hydrothermally synthesized. Eu-doped ZnO .... 265. Joshi Bhavana N. Growth and characterization of MMA/SiO2 hybrid low-k thin films for ..... perovskites from simple in situ sol–gel derived carbon templating process.

  3. original article assessment of effective coverage of voluntary ...

    African Journals Online (AJOL)

    Abrham

    Within a single generation, it has .... Sex. Male. Female. 2959. 2698. 52.3. 47.7. Residence. Urban. Rural. 4328. 1329. 76.5. 26.5 ..... biological, social and economic disadvantages. (8). ... Rural. AIDS and development program, school of ...

  4. The Importance of Subtextual Impression Management and Business Faculty.

    Science.gov (United States)

    Chaney, Lillian H.; Lyden, Julie A.

    1998-01-01

    College students (n=265) reported their impressions of business faculty's personal appearance, body language, behavior, and office appearance. Findings indicate that impression management is useful for professors who want to convey credibility, authority, and interest in students. (JOW)

  5. Dry friction damping couple at high frequencies

    Czech Academy of Sciences Publication Activity Database

    Půst, Ladislav; Pešek, Luděk; Košina, Jan; Radolfová, Alena

    2014-01-01

    Roč. 8, č. 1 (2014), s. 91-100 ISSN 1802-680X Institutional support: RVO:61388998 Keywords : dry friction * damping * high frequencies Subject RIV: BI - Acoustics http://www.kme.zcu.cz/acm/acm/article/view/239/265

  6. Qualitative study on maternal referrals in rural Tanzania: Decision ...

    African Journals Online (AJOL)

    Administrator

    discussions (FGDs) with health workers and community members, stratified by age and ..... health facilities and not listening carefully ..... Projects. Int J Gynaecol Obstet. 1997(59). S259-S265. 22. Campbell O, Koblinsky M, Taylor P. Off to.

  7. Effect of Maltodextrins on the Rheological Properties of Potato Starch Pastes and Gels

    Directory of Open Access Journals (Sweden)

    Lesław Juszczak

    2013-01-01

    Full Text Available The study examines the effects of maltodextrins saccharified to various degrees on some rheological properties of potato starch dispersions. Pasting characteristics, flow curves, and mechanical spectra were determined for native potato starch and for its blends with potato maltodextrins having dextrose equivalents (DE of 10.5, 18.4, and 26.5. The results showed that medium-saccharified maltodextrin (DE = 18.4 gave the strongest effect, manifesting itself as a considerable reduction in the viscosity at pasting, a decrease in apparent viscosity during flow, and a decrease in the storage and loss moduli. Addition of high-(DE = 26.5 or low-(DE = 10.5 saccharified maltodextrins had a markedly smaller effect on the rheological properties of starch. The differences in the effects produced by the maltodextrins are closely connected to the degree of polymerisation of the maltooligosaccharides in the systems.

  8. Fast Rate Estimation for RDO Mode Decision in HEVC

    Directory of Open Access Journals (Sweden)

    Maxim P. Sharabayko

    2014-12-01

    Full Text Available The latter-day H.265/HEVC video compression standard is able to provide two-times higher compression efficiency compared to the current industrial standard, H.264/AVC. However, coding complexity also increased. The main bottleneck of the compression process is the rate-distortion optimization (RDO stage, as it involves numerous sequential syntax-based binary arithmetic coding (SBAC loops. In this paper, we present an entropy-based RDO estimation technique for H.265/HEVC compression, instead of the common approach based on the SBAC. Our RDO implementation reduces RDO complexity, providing an average bit rate overhead of 1.54%. At the same time, elimination of the SBAC from the RDO estimation reduces block interdependencies, thus providing an opportunity for the development of the compression system with parallel processing of multiple blocks of a video frame.

  9. Crystallization and initial X-ray data of abscisic acid receptor PYL3 in the presence of (−)-ABA

    International Nuclear Information System (INIS)

    Zhang, Xingliang; Zhang, Qi; Wang, Guoqiang

    2013-01-01

    The complex of the abscisic acid receptor PYL3 with (−)-ABA was crystallized and refined to obtain high-quality diffraction data. Diffraction data were collected and processed at 2.65 Å resolution. Abscisic acid (ABA) modulates many complicated developmental processes and responses to environmental stimuli. Recently, several (+)-ABA signalling mechanisms by the RCAR/PYR1/PYL family of proteins (PYLs) have been proposed. However, the mechanism of the recognition and binding of the unnatural ligand (−)-ABA by PYLs has not yet been elucidated. In the present study, the expression, purification and crystallization of PYL3 in complex with (−)-ABA are reported. Diffraction data were refined to 2.65 Å resolution for this complex in space group P6 5 . These findings will help to explain the stereospecificity of PYLs for (−)-ABA and to explore the selective ABA agonists

  10. First thermochemical property of Seaborgium determined

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration

    1997-09-01

    The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.

  11. Spin-trapping and ESR studies of the direct photolysis of aromatic amino acids, dipeptides, tripeptides and polypeptides in aqueous solutions-II. Tyrosine and related compounds

    Energy Technology Data Exchange (ETDEWEB)

    Lion, Y; Kuwabara, M; Riesz, P [National Cancer Inst., Bethesda, MD (USA)

    1982-01-01

    The UV-photolysis of peptides containing tyrosine (Tyr) was investigated in aqueous solutions at room temperature at 220 and 265 nm. The short-lived free radicals formed during photolysis were spin-trapped by t-nitrosobutane and identified by electron spin resonance. For N-acetyl-and N-formyl-L-Tyr and for peptides containing L-Tyr as the middle residue, photolysis at 265 nm under neutral conditions produced mainly spin-adducts due to the scission between the alpha carbon and the methylene group attached to the aromatic ring, while at 220 nm decarboxylation radicals were spin-trapped. Photolysis of di- and tripeptides at 275 nm in alkaline solutions predominantly generated deamination radicals. The radicals produced in the photolysis of the oxidized A chain of insulin were tentatively characterized by comparison with the results for di- and tripeptides.

  12. Kvitovat

    Czech Academy of Sciences Publication Activity Database

    Šimandl, Josef

    2005-01-01

    Roč. 88, č. 5 (2005), s. 265-268 ISSN 0027-8203 R&D Projects: GA ČR GA405/03/0377 Institutional research plan: CEZ:AV0Z90610518 Keywords : meaning * etymology * loan word Subject RIV: AI - Linguistics

  13. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... University (NEOMED) 26,879 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  14. Vliv pivovarského procesu na profil proteinů ječmene

    Czech Academy of Sciences Publication Activity Database

    Benkovská, Dagmar; Flodrová, Dana; Psota, V.; Bobálová, Janette

    2011-01-01

    Roč. 57, 7-8 (2011), 260-265 ISSN 0023-5830 R&D Projects: GA MŠk 1M0570 Institutional research plan: CEZ:AV0Z40310501 Keywords : barley * proteins * brewing process Subject RIV: CB - Analytical Chemistry, Separation

  15. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Little Stars 13,224 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  16. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 13:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... University (NEOMED) 27,094 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  17. Analysis of protein folds using protein contact networks

    Indian Academy of Sciences (India)

    is a well-recognized classification system of proteins, which is based on manual in- ... can easily correspond to the information in the 2D matrix. ..... [7] U K Muppirala and Zhijun Li, Protein Engineering, Design & Selection 19, 265 (2006).

  18. REVIEWS OF BOOKS : BOEKRFSENSIES

    African Journals Online (AJOL)

    Ill. Examination and Diagnosis. IV. Methods of Treatment. V. Techniques of Treatment. VI. ... C. drugs, y tematicaUy pr nted under indi idual tit! , ..... 265), wrong vowels in residuum and vitamin (pages 268 and 279), .... Cancer of the Stomach.

  19. Geochemical and biotic factors influencing the diversity and distribution of soil microfauna across ice-free coastal habitats in Victoria Land, Antarctica

    Czech Academy of Sciences Publication Activity Database

    Smykla, J.; Porazinska, D. L.; Iakovenko, Nataliia; Devetter, Miloslav; Drewnik, M.; Siang Hii, Y.; Emslie, S.D.

    2018-01-01

    Roč. 116, č. 1 (2018), s. 265-276 ISSN 0038-0717 Institutional support: RVO:67985904 ; RVO:60077344 Keywords : habitat suitability * soil biodiversity * Nematodes Subject RIV: DF - Soil Science OBOR OECD: Soil science Impact factor: 4.857, year: 2016

  20. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:39 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Before Death 17,437 views 5:27 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  1. Introduction to special issue on the ecology of clonal plants

    Czech Academy of Sciences Publication Activity Database

    Gross, K. L.; Herben, T.; Klimešová, Jitka

    2017-01-01

    Roč. 52, 3-4 (2017), s. 265-267 ISSN 1211-9520 Institutional support: RVO:67985939 Keywords : Introduction to special issue * clonal plants * clonal meeting Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.017, year: 2016

  2. Density-functional study of the CO adsorption on the ferromagnetic fcc Co(001) film surface

    Czech Academy of Sciences Publication Activity Database

    Pick, Štěpán

    2010-01-01

    Roč. 604, 3-4 (2010), s. 265-268 ISSN 0039-6028 Institutional research plan: CEZ:AV0Z40400503 Keywords : Density functional calculations * chemisorption * magnetic films Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.010, year: 2010

  3. Mariusz Kaḿinski

    African Journals Online (AJOL)

    user

    entries compared with Head's list of 265 in the Canting Academy, the new ... Etymological English Dictionary (1737), but it was also used by Grose in the com- ... Other terms which acquired more general currency, may have formed part of.

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 265 ... Vol 35, No 4 (2008), A preliminary inventory of hazardous medical waste disposal systems ... Outbreak: The Case of Sierra Leone during Ebola Outbreak 2015 ... Vol 37, No 4 (2010), Antimycobacterial immune responses in ...

  5. South African Journal of Animal Science - Vol 34, No 4 (2004)

    African Journals Online (AJOL)

    A genetic analysis of epistaxis as associated with EIPH in the Southern African Thoroughbred · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Weideman, SJ Schoeman, GF Jordaan, 265-273 ...

  6. Growth in labour productivity of forestry and regional development : a study based on Finnish experience / Seppo Vehkamäki

    Index Scriptorium Estoniae

    Vehkamäki, Seppo

    2003-01-01

    Regionaaltasandil mõjutab metsandussektori töö tootlikkus nii puidutoodete konkurentsivõimet, metsanduse konkurentsivõimelisust tööjõu ja teiste tootmissisendite osas, majanduslikku mitmekesistumist ja arengut kui ka demograafilist ja sotsiaalset arengut. Tabelid. Lisad lk. 265-266

  7. beyond the border war: new perspectives on southern africa's late ...

    African Journals Online (AJOL)

    hennie

    Price: R 265.00 (SA): R273.00 ; Euros: 34.00 ; (R578.00 through Kalahari.net) ... they viewed as necessary cross-border-, deep penetration and/or pre-emptive .... transgressions with long term consequences which will evoke international law.

  8. Molecular and biochemical toxicology

    National Research Council Canada - National Science Library

    Smart, Robert C; Hodgson, Ernest

    2008-01-01

    ... Expression and Regulation 2.6.1 Northern Analysis 2.6.2 Nuclear Run-On 2.6.3 Promoter Deletion Analysis/Reporter Gene Assays 2.6.4 Microarrays 2.6.5 Reverse Transcriptase-PCR (RT-PCR) and Real-Time P...

  9. 78 FR 64933 - Pepperell Hydro Company, LLC; Notice of Application Tendered for Filing With the Commission and...

    Science.gov (United States)

    2013-10-30

    ... structure that includes a 1.5-foot-diameter gate with low level drain pipe and a 4.25-foot-wide, 3.5-foot...-foot-long turbine draft tubes; (9) three 265-foot-long, 600- volt transmission lines; and (10...

  10. TiO2 Nanotubes Supported NiW Hydrodesulphurization Catalysts: Characterization and Activity

    Czech Academy of Sciences Publication Activity Database

    Palcheva, R.; Dimitrov, L.; Tyuliev, G.; Spojakina, A.; Jirátová, Květa

    2013-01-01

    Roč. 265, JAN 15 (2013), s. 309-313 ISSN 0169-4332 Institutional support: RVO:67985858 Keywords : nano-structured TiO2 * NiW catalysts * XPS Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.538, year: 2013

  11. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:27 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Health - Meriter 253,329 views 13:34 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  12. DMSO-free cryopreservation of adipose-derived mesenchymal stromal cells: expansion medium affects post-thaw survival

    Czech Academy of Sciences Publication Activity Database

    Rogulska, O.; Petrenko, Yuriy; Petrenko, A.

    2017-01-01

    Roč. 69, č. 2 (2017), s. 265-276 ISSN 0920-9069 Institutional support: RVO:68378041 Keywords : human adiposederived mesenchymalstromal cells * DMSO-free cryopreservation * plateletlysate Subject RIV: FP - Other Medical Disciplines OBOR OECD: Cell biology Impact factor: 1.857, year: 2016

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 265 ... Vol 42, No 2 (2015), Mothers' Perception of Infant Feeding ... Beliefs of University and College Students Towards Male Circumcision in Lusaka, Abstract PDF ... Vol 43, No 1 (2016), Prevalence of Basal-like Breast Cancer ...

  14. Mõõtmise probleem 18. sajandi psühholoogias / Konstantin Ramul ; tõlk. Kenn Konstabel

    Index Scriptorium Estoniae

    Ramul, Konstantin, 1879-1975

    2004-01-01

    Mentaalsete mõõtmiste tähtsusest 18. sajandil teadusliku psühholoogia arengule 19. sajandil. 18. sajandi erinevate autorite arvamustest psühholoogiliste mõõtmiste võimalustest ja meetoditest. Varem ilmunud: American Psychologist, 1960, nr. 15, lk. 256-265

  15. A Military Guide to Terrorism in the Twenty-First Century

    Science.gov (United States)

    2004-10-12

    Width: 52mm Weight: 265g Filler: Composition B Characteristics Color: Black or varnished brown Length: 102mm Width: 61mm Weight: 773g Filler...Nitrogen dioxide Ethylene oxide Carbon monoxide Phosphine Fluorine Carbonyl sulfide Phosphorus oxychloride Formaldehyde Chloroacetone Phosphorus

  16. Enhanced leishmanicidal activity of cryptopeptide chimeras from the active N1 domain of bovine lactoferrin

    NARCIS (Netherlands)

    Silva, T.; Abengózar, M.A.; Fernández-Reyes, M.; Andreu, D.; Nazmi, K.; Bolscher, J.G.M.; Bastos, M.; Rivas, L.

    2012-01-01

    wo antimicrobial cryptopeptides from the N1 domain of bovine lactoferrin, lactoferricin (LFcin17-30) and lactoferrampin (LFampin265-284), together with a hybrid version (LFchimera), were tested against the protozoan parasite Leishmania. All peptides were leishmanicidal against Leishmania donovani

  17. Cloning and functional analysis in transgenic tobacco of a tapetum ...

    African Journals Online (AJOL)

    Jane

    2010-10-11

    Oct 11, 2010 ... “anther-box”, have been already used for genetic engineering of ... tabacum var. NC89) was used for transformation in Murashige and ..... 265-272. Koltunow AM, Truettner T, Cox KH, Wallroth M, Goldberg RB (1990). Different ...

  18. Data of evolutionary structure change: 1BTZA-2FOCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BTZA-2FOCA 1BTZ 2FOC A A IVGGYTCGANTVPYQVSLNSG-----YHFCGGSLINSQW...entryChain> 2FOC A 2FOCA HCVDRELT...> A 2FOCA PLHCLVNGQYAVHG LYS CA 265 2FOC A 2FOCA...n>A 2FOCA TRTNG-QLAQT - <

  19. Effects of anisotonicity on pentose-phosphate pathway, oxidized ...

    Indian Academy of Sciences (India)

    Unknown

    ammonia, desiccation and alkalinity stresses etc. in dif- ferent seasons of ... chus was found to be 265 mOsmol/l (determined by the freezing ... in the bile and in perfusate was measured enzymatically ... method of Stoll and Häussinger (1989).

  20. Pramana Volume 7

    Indian Academy of Sciences (India)

    chloro 3-nitrobenzoic acid -- V S S Sastry and J Ramakrishna. 146-151. The x-ray anomalous ... On the formation of silver specks in silver halide crystals -- Mahendra Singh and A P Sharma, 255-265. Critical point phenomena in the ...

  1. Geophysical study of a seamount located on the continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Bhattacharya, G.C.; Subrahmanyam, V.

    Bathymetric, magnetic, and gravity data obtained over a 2,464 m high seamount located in the Arabian Sea indicate that the seamount (inferred mean density = 2.65 gm/cc) extends for 1 km beneath the seafloor and is locally isostatically compensated...

  2. The Stream-Catchment (StreamCat) Dataset: A database of watershed metrics for the conterminous USA

    Science.gov (United States)

    We developed an extensive database of landscape metrics for ~2.65 million streams, and their associated catchments, within the conterminous USA: The Stream-Catchment (StreamCat) Dataset. These data are publically available and greatly reduce the specialized geospatial expertise n...

  3. Contribution of different livestock species as sources of meat in Bauchi

    African Journals Online (AJOL)

    , 169, 119 and 7 were White Fulani, Red Bororo, Sokoto Gudali and Kuri breeds ... Of the 28,321 goats slaughtered, the contributions of Sokoto Red, Kano brown, Sahel and West African Dwarf were 20,265; 7,469; 575 and 12 respectively.

  4. Personality and Dutch emigrants' reactions to acculturation strategies

    NARCIS (Netherlands)

    Bakker, Winny; Van der Zee, Karen; Van Oudenhoven, Jan Pieter

    2006-01-01

    This experimental questionnaire study examined individual differences in affective and normative reactions to acculturation strategies. A sample of 265 Dutch emigrants with a dual cultural background read scenarios describing the experiences of an emigrant. Eight (4 x 2) different scenario versions

  5. Construction of intersubspecific molecular genetic map of lentil ...

    Indian Academy of Sciences (India)

    it helps in the management of soil fertility. India ranks sec- ond after Canada in lentil production, whereas Canada and. Turkey are the world's ...... Plant Breed. 40, 265–304. Duke J. A. 1981 Handbook of legumes of world economic impor-.

  6. Ethnic Conflicts and Minority Interests in Nigeria | Badru | Journal of ...

    African Journals Online (AJOL)

    The Journal of Cultural Studies: 2000 2(1): 256-265). Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  7. Renal ischemia-reperfusion injury in the rat is prevented by a novel immune modulation therapy

    Czech Academy of Sciences Publication Activity Database

    Tremblay, J.; Chen, H.; Peng, J.; Kuneš, Jaroslav; Vu, M. D.; Der Sarkissian, S.; deBlois, D.; Bolton, A. E.; Gaboury, L.; Marshansky, V.; Gouadon, E.; Hamet, P.

    2002-01-01

    Roč. 74, č. 10 (2002), s. 1425-1433 ISSN 0041-1337 Grant - others:Vasogen Inc.(CA) - Institutional research plan: CEZ:AV0Z5011922 Keywords : renal ischemia * immune therapy * rat Subject RIV: ED - Physiology Impact factor: 3.265, year: 2002

  8. Classification of Spectra of Emission Line Stars Using Machine Learning Techniques

    Czech Academy of Sciences Publication Activity Database

    Bromová, P.; Škoda, Petr; Vážný, Jaroslav

    2014-01-01

    Roč. 11, č. 3 (2014), s. 265-273 ISSN 1476-8186 R&D Projects: GA ČR GA13-08195S Institutional support: RVO:67985815 Keywords : Be star * stellar spectrum * feature extraction Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  9. Membrane-active mechanism of LFchimera against Burkholderia pseudomallei and Burkholderia thailandensis

    NARCIS (Netherlands)

    Kanthawong, S.; Puknun, A.; Bolscher, J.G.M.; Nazmi, K.; van Marle, J.; de Soet, J.J.; Veerman, E.C.I.; Wongratanacheewin, S.; Taweechaisupapong, S.

    2014-01-01

    LFchimera, a construct combining two antimicrobial domains of bovine lactoferrin, lactoferrampin265-284 and lactoferricin17-30, possesses strong bactericidal activity. As yet, no experimental evidence was presented to evaluate the mechanisms of LFchimera against Burkholderia isolates. In this study

  10. Advanced Space Power Systems (ASPS): High Specific Energy Li-ion Battery Cells

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of this project element is to increase the specific energy of Li-ion battery cells to 265 Wh/kg and the energy density to 500 Wh/L at 10oC while maintaining...

  11. African Research Review - Vol 2, No 2 (2008)

    African Journals Online (AJOL)

    Alternative Dispute Resolution in Ethiopia- A Legal Framework · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S M Gowak, 265-285. http://dx.doi.org/10.4314/afrrev.v2i2.41054 ...

  12. LAW DEMOCRACY & DEVELOPMENT

    African Journals Online (AJOL)

    HP27975994114

    on the one hand, and achieve an adequate standard of living, on the other. .... clothing.51 Social security measures must therefore permit persons in receipt .... and dignity of persons with disabilities (a/ac.265/crp.13) submitted at the second.

  13. Dissolved petroleum hydrocarbon concentrations in some regions of the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.; Qasim, S.Z.; Fondekar, S.P.; Topgi, R.S.

    Dissolved petroleum hydrocarbons were measured in some parts of the Northern Indian Ocean using UV bsorbance technique with a clean up step. The concentration of oil ranged from 0.6 to 26.5 mu gl. Higher values were recorded along the oil tanker...

  14. Seasonal changes in suspended particulate component in Bombay High oil field (Arabian Sea)

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L.; Verlecar, X.N.; Venkat, K.

    of phytoplankton biomass. Ratio of silicate and nitrate to phosphate was 16:16:1 for monsoon and postmonsoon periods. Annual values of particulate carbohydrates, particulate proteins and particulate lipids in surface waters ranged from 40 to 265 mu g l sup(-1), 21...

  15. 32 CFR 231.10 - Financial institutions on DoD installations.

    Science.gov (United States)

    2010-07-01

    ... statutory authority that is separate from State or Federal laws that govern commercial banking. Section 265... forces agreements, other intergovernmental agreements, or host-country law. (ii) Financial services at... a geographic franchise and, where applicable, as authorized by the pertinent status of forces...

  16. 41 CFR 101-26.508-2 - Requisitioning data processing tape not available from Federal Supply Schedule contracts.

    Science.gov (United States)

    2010-07-01

    ... Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Requisitioning data...

  17. 41 CFR 101-26.508 - Electronic data processing (EDP) tape and instrumentation tape (wide and intermediate band).

    Science.gov (United States)

    2010-07-01

    ... Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Electronic data...

  18. 41 CFR 109-26.501-50 - Authority and allocations for the acquisition of passenger motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Authority and...

  19. Data of evolutionary structure change: 1DDJB-2FODA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DDJB-2FODA 1DDJ 2FOD B A SFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTR-...in>A 2FODA SLQYRSGSSWAHT E...line> 2FOD A 2FODA...A 347 ARG CA 265 2FOD A 2FODA... A 2FODA HCVDR---ELTFR

  20. Maďarský matematik Endre Szemerédi získal Abelovu cenu za rok 2012

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Pudlák, Pavel; Somer, L.

    2012-01-01

    Roč. 57, č. 4 (2012), s. 265-273 ISSN 0032-2423 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : Szemeredi theorem * chaos * upper asymptotic density Subject RIV: BA - General Mathematics http://dml.cz/dmlcz/402233

  1. Homo- and Copolycyclotrimerization of Aromatic Internal Diynes Catalyzed with Co-2(CO)(8): A Facile Route to Microporous Photoluminescent Polyphenylenes with Hyperbranched or Crosslinked Architecture

    Czech Academy of Sciences Publication Activity Database

    Sedláček, J.; Sokol, J.; Zedník, J.; Faukner, T.; Kubů, Martin; Brus, Jiří; Trhlíková, Olga

    2018-01-01

    Roč. 39, č. 4 (2018), č. článku 1700518. ISSN 1022-1336 Institutional support: RVO:61388955 ; RVO:61389013 Keywords : microporous polymers * photoluminescence * polycyclotrimerization * polyphenylenes Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.265, year: 2016

  2. Interaction of the Adenine-Thymine Watson-Crick and Adenine-Adenine Reverse-Hoogsteen DNA Base Pairs with Hydrated Group IIa (Mg .sup.2+./sup., Ca .sup.2+./sup., Sr .sup.2+./sup., Ba .sup.2+./sup.) and IIb (Zn .sup.2+./sup., Cd .sup.2+./sup., Hg .sup.2+./sup.) Metal Cations: Absence of the Base Pair Stabilization by Metal-Induced Polarization Effects

    Czech Academy of Sciences Publication Activity Database

    Šponer, Jiří; Sabat, M.; Burda, J. V.; Leszczynski, J.; Hobza, Pavel

    1999-01-01

    Roč. 103, č. 13 (1999), s. 2528-2534 ISSN 1089-5647 R&D Projects: GA ČR GA203/97/0029 Grant - others:NSF(US) EHR108767; NIH(US) GM08047 Subject RIV: BO - Biophysics Impact factor: 3.265, year: 1999

  3. Registro preliminar de Basidiomycetes del Páramo De Ocetá (Monguí-Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Helbert David Siabatto F.

    2005-07-01

    órdenes: Agaricales, Afiloforales, Lycoperdales y Russulales. Se realizó un análisis de acuerdo al gradiente altitudinal muestreado (3.265 a 3.455 msnm y su incidencia en la morfología, indicando posibles adaptaciones en contraste a colecciones consultadas.

  4. Low-dimensional compounds containing cyanido groups. XXVIII. Crystal structure, spectroscopic and magnetic properties of two copper(II) tetracyanidoplatinate complexes with 1,2-diaminopropane

    Czech Academy of Sciences Publication Activity Database

    Vavra, M.; Potočňák, I.; Dušek, Michal; Čižmár, E.; Ozerov, M.; Zvyagin, S.A.

    2015-01-01

    Roč. 225, May (2015), s. 202-208 ISSN 0022-4596 Institutional support: RVO:68378271 Keywords : spectroscopic studies * magnetic properties * crystal structure * [Pt(CN) ]2- anion * 1,2-diaminopropane Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.265, year: 2015

  5. Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 263-265 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-53.pdf

  6. Integrating AR services for the masses: geotagged POI transformation platform

    Czech Academy of Sciences Publication Activity Database

    Trojan, Jakub

    2016-01-01

    Roč. 7, č. 3 (2016), s. 254-265 ISSN 1757-9880 Institutional support: RVO:68145535 Keywords : augmented reality * location-based services * geotagging * points of interest Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://dx.doi.org/10.1108/JHTT-07-2015-0028

  7. Activity of Transition Metal Sulfides Supported on Al2O3,

    Czech Academy of Sciences Publication Activity Database

    Kaluža, Luděk

    2015-01-01

    Roč. 114, č. 2 (2015), s. 781-794 ISSN 1878-5190 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : hydrodesulfurization * hydrogenation * support effect Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.265, year: 2015

  8. O modálních predikativech slovesného původu typu To přende, (se) patří... zbórat

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena

    2017-01-01

    Roč. 100, č. 4 (2017), s. 265-271 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA16-04648S Keywords : dialect * verbal modal predicatives * modal verbs * modalization * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  9. The Impact of Racial Integration on the Combat Effectiveness of Eighth (US) Army during the Korean War

    Science.gov (United States)

    2011-12-01

    voting.”265 Integration combatted this cognitive dissonance , creating a sense of equality and pride in many African-American soldiers. Many found...180 Both Generals Bradley and Hodges expressed satisfaction with the African-American infantry soldiers. The 78th Infantry Division commanding

  10. Genome comparison and physiological characterization of eight Streptococcus thermophilus strains isolated from Italian dairy products

    DEFF Research Database (Denmark)

    Vendramin, Veronica; Treu, Laura; Campanaro, Stefano

    2017-01-01

    to identify the core and the variable genes, which vary among strains from 196 to 265. Additionally, correlation between the isolation site and the genetic distance was investigated at genomic level. Results highlight that the phylogenetic reconstruction differs from the geographical strain distribution...

  11. Division File of Extension Research Materials; Additions During 1968.

    Science.gov (United States)

    Byrn, Darcie, Comp.

    In this annotated bibliography of acquisitions during 1968 appear 265 Extension studies on administrative organization and management; training and staff development; mobilizing participation in Extension work; local leadership; program content and planning procedures; general effectiveness and progress in Extension; teaching methods, techniques,…

  12. Description of larva, redescription of adults and biology of Mortogenesia mesopotamica (Morton, 1921) (Ephemeroptera: Palingeniidae)

    Czech Academy of Sciences Publication Activity Database

    Soldán, Tomáš; Godunko, Roman J.

    2013-01-01

    Roč. 3741, č. 2 (2013), s. 265-278 ISSN 1175-5326 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : morphology * differential diagnosis * metamorphic stages Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  13. The role of appraisal and coping style in relation with societal participation in fatigued patients with multiple sclerosis: a cross-sectional multiple mediator analysis

    NARCIS (Netherlands)

    Akker, L.E. van den; Beckerman, H.; Collette, E.H.; Bleijenberg, G.; Dekker, J.; Knoop, H.; Groot, V. de; Jong, B.A. de; et al.,

    2016-01-01

    To determine the relationship between appraisal and societal participation in fatigued patients with Multiple Sclerosis (MS), and whether this relation is mediated by coping styles. 265 severely-fatigued MS patients. Appraisal, a latent construct, was created from the General Self-Efficacy Scale and

  14. The role of appraisal and coping style in relation with societal participation in fatigued patients with multiple sclerosis : a cross-sectional multiple mediator analysis

    NARCIS (Netherlands)

    van den Akker, Lizanne Eva; Beckerman, Heleen; Collette, Emma Hubertine; Bleijenberg, Gijs; Dekker, Joost; Knoop, Hans; de Groot, Vincent; TREFAMS-ACE study group, study group; de Groot, V.; Beckerman, H.; Malekzadeh, A.; van den Akker, L. E.; Looijmans, M.; Sanches, S. A.; Dekker, J.; Collette, E. H.; van Oosten, B. W.; Teunissen, C. E.; Blankenstein, M. A.; Eijssen, I. C J M; Rietberg, M.; Heine, M.; Verschuren, O.; Kwakkel, G.; Visser-Meily, J. M A; van de Port, I. G L; Lindeman, E.; Blikman, L. J M; van Meeteren, J.; Bussmann, J. B J; Stam, H. J.; Hintzen, R. Q.; Hacking, H. G A; Hoogervorst, E. L.; Frequin, S. T F M; Knoop, H.; de Jong, B. A.; de Laat, F. A J; Verhulsdonck, M. C.; van Munster, E. T H; Oosterwijk, C. J.; Aarts, G. J.

    2016-01-01

    To determine the relationship between appraisal and societal participation in fatigued patients with Multiple Sclerosis (MS), and whether this relation is mediated by coping styles. 265 severely-fatigued MS patients. Appraisal, a latent construct, was created from the General Self-Efficacy Scale and

  15. Börsitöötajad teevad aktsiad rahaks / Virge Lahe

    Index Scriptorium Estoniae

    Lahe, Virge

    2008-01-01

    Dubai börsi aktsiate ülevõtmispakkumise hind OMX-le on 265 Rootsi krooni aktsia eest. Pakkumine puudutab ka tütarfirma Tallinna börsi töötajaid, kes said emafirmalt OMX AB aktsiad kingituseks. Diagramm: OMX-i aktsia hind

  16. Simplicial Finite Elements in Higher Dimensions

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Korotov, S.; Křížek, Michal

    2007-01-01

    Roč. 52, č. 3 (2007), s. 251-265 ISSN 0862-7940 R&D Projects: GA ČR GA201/04/1503 Institutional research plan: CEZ:AV0Z10190503 Keywords : n-simplex * finite element method * superconvergence Subject RIV: BA - General Mathematics

  17. Tubenose goby Proterorhinus marmoratus (Pallas, 1814) has joined three other Ponto-Caspian gobies in the Vistula River (Poland)

    Czech Academy of Sciences Publication Activity Database

    Grabowska, J.; Pietraszewski, D.; Ondračková, Markéta

    2008-01-01

    Roč. 3, č. 2 (2008), s. 261-265 ISSN 1818-5487 Institutional research plan: CEZ:AV0Z60930519 Keywords : gobiids * invasive species * invasion corridor Subject RIV: EH - Ecology, Behaviour http://www.aquaticinvasions.ru/2008/AI_2008_3_2_Grabowska_etal.pdf

  18. The growth of juvenile jaguar guapote (Cichlasoma managuense fed diets with different carbohydrate levels (ESP

    Directory of Open Access Journals (Sweden)

    Juan B Ulloa R.

    2016-03-01

    Full Text Available The experiment was conducted in a 16 45 L aquaria recirculation system. The objective was to evaluate the growth of jaguar guapote (Cichlasoma managuense when fed isocaloric diets with increasing carbohydrate levels from 11 to 36 percent. Relative metabolic growth rate and feed conversion were similar with diets containing 11.5%, 18.8% and 26.5% carbohydrate (P > 0.05 . The highest protein efficiency ratio (PER and apparent net protein utilization (NPUa values were found with the 18.8% carbohydrate diet. Growth performance, feed utilization parameters and the survival were the lowest with fish fed the highest carbohydrate level (35.6%. Fish body protein increased and body fat decreased with increasing dietary carbohydrate levels. The body ash showed a trend similar to the body protein. It is concluded that juvenile C. managuense can grow well when fed 40% protein diets containing up to 26.5% carbohydrate.

  19. Prediction of enthalpy of fusion of pure compounds using an Artificial Neural Network-Group Contribution method

    International Nuclear Information System (INIS)

    Gharagheizi, Farhad; Salehi, Gholam Reza

    2011-01-01

    Highlights: → An Artificial Neural Network-Group Contribution method is presented for prediction of enthalpy of fusion of pure compounds at their normal melting point. → Validity of the model is confirmed using a large evaluated data set containing 4157 pure compounds. → The average percent error of the model is equal to 2.65% in comparison with the experimental data. - Abstract: In this work, the Artificial Neural Network-Group Contribution (ANN-GC) method is applied to estimate the enthalpy of fusion of pure chemical compounds at their normal melting point. 4157 pure compounds from various chemical families are investigated to propose a comprehensive and predictive model. The obtained results show the Squared Correlation Coefficient (R 2 ) of 0.999, Root Mean Square Error of 0.82 kJ/mol, and average absolute deviation lower than 2.65% for the estimated properties from existing experimental values.

  20. Temperature-dependent sex determination modulates cardiovascular maturation in embryonic snapping turtles Chelydra serpentina.

    Science.gov (United States)

    Alvine, Travis; Rhen, Turk; Crossley, Dane A

    2013-03-01

    We investigated sex differences in cardiovascular maturation in embryos of the snapping turtle Chelydra serpentina, a species with temperature-dependent sex determination. One group of eggs was incubated at 26.5°C to produce males. Another group of eggs was incubated at 26.5°C until embryos reached stage 17; eggs were then shifted to 31°C for 6 days to produce females, and returned to 26.5°C for the rest of embryogenesis. Thus, males and females were at the same temperature when autonomic tone was determined and for most of development. Cholinergic blockade increased resting blood pressure (P(m)) and heart rate (f(H)) in both sexes at 75% and 90% of incubation. However, the magnitude of the f(H) response was enhanced in males compared with females at 90% of incubation. β-adrenergic blockade increased P(m) at 75% of incubation in both sexes but had no effect at 90% of incubation. β-adrenergic blockade reduced f(H) at both time points but produced a stronger response at 90% versus 75% of incubation. We found that α-adrenergic blockade decreased P(m) in both sexes at 75% and 90% of incubation and decreased f(H) at 75% of incubation in both sexes. At 90% of incubation, f(H) decreased in females but not males. Although these data clearly demonstrate sexual dimorphism in the autonomic regulation of cardiovascular physiology in embryos, further studies are needed to test whether differences are caused by endocrine signals from gonads or by a hormone-independent temperature effect.

  1. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.

    2003-01-01

    Roč. 27, - (2003), 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  2. Processing of spruce and larch resins to obtain balsam for the confection industry

    Energy Technology Data Exchange (ETDEWEB)

    Buinova, E.F.; Yaremchenko, N.G.; Izotova, L.V.; Lepeiko, A.G.; Meteshkina, L.P.; Zhuravlev, P.I.; Chumakov, V. A.; Nikiforova, V.N.; Krylova, E.N.

    1981-01-01

    Modified balsam was prepared by esterification of purified and precipitated larch or spruce oleoresins with glycerol at 255-265 degrees for 4-6 hours. The modified balsams, which were obtained in 55-65% yield, can be used as a base for chewing gum manufacture.

  3. 41 CFR 101-26.508-1 - Requisitioning data processing tape available through Federal Supply Schedule contracts.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Requisitioning data... Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26...

  4. 41 CFR 101-26.503 - Multiple award schedule purchases made by GSA supply distribution facilities.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Multiple award schedule... Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.503...

  5. profile of the coloured Cape Peninsula Anthropometric population of ...

    African Journals Online (AJOL)

    1990-07-21

    Jul 21, 1990 ... tension and cigarene smoking. The extent to which this .... When asked if they perceived them- selves to be ... Durban, and Asians living in Durban (Professor F. G. H.. 95% Cl. 2,1·26,5 ... Self-reported HT. HT corrected for.

  6. Predicting soil particle density from clay and soil organic matter contents

    DEFF Research Database (Denmark)

    Schjønning, Per; McBride, R.A.; Keller, T.

    2017-01-01

    Soil particle density (Dp) is an important soil property for calculating soil porosity expressions. However, many studies assume a constant value, typically 2.65Mgm−3 for arable, mineral soils. Fewmodels exist for the prediction of Dp from soil organic matter (SOM) content. We hypothesized...

  7. Age-dependent remodelling of ionotropic signalling in cortical astroglia

    Czech Academy of Sciences Publication Activity Database

    Lalo, U.; Palygin, O.; North, R. A.; Verkhratsky, Alexei; Pankratov, Y.

    2011-01-01

    Roč. 10, č. 3 (2011), s. 392-402 ISSN 1474-9718 R&D Projects: GA ČR GA305/08/1384 Institutional research plan: CEZ:AV0Z50390703 Keywords : astrocytes * aging * synaptic transmission Subject RIV: FH - Neurology Impact factor: 6.265, year: 2011

  8. Multi-component titanium–copper–cobalt- and niobium nanostructured oxides as catalysts for ethyl acetate oxidation

    Czech Academy of Sciences Publication Activity Database

    Tsoncheva, T.; Henych, Jiří; Ivanova, R.; Kovacheva, D.; Štengl, Václav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 397-408 ISSN 1878-5190 Institutional support: RVO:61388980 Keywords : Copper and cobalt oxides * Effect of support * Ethyl acetate combustion * Multicomponent oxides * Titania doped with niobium Subject RIV: CA - Inorganic Chemistry Impact factor: 1.265, year: 2015

  9. Effects of somatic cell count on the gross composition, protein ...

    African Journals Online (AJOL)

    and >265,000 cells/ml) on ewe milk composition, protein fractions and ... 6.38, true protein, true whey protein, fat, lactose, dry matter, ash, phosphorus, ... management practices, and representative of the typical ewe herd .... pasteurised before being analysed. .... Mastitis detection: current trends and future perspectives.

  10. Science and Technology Text Mining: Hypersonic and Supersonic Flow

    Science.gov (United States)

    2003-11-17

    Saussure , 1949]. A summary of co-word origins, and evolution of co-word into computational linguistics, can be found in Kostoff [1993b]. Co-word...Global Thesauri. Information Processing and Management. 26:5. 1990. De Saussure , F. (1949). Cours de Linguistique Generale. 4eme Edition

  11. Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

    2013-01-01

    Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

  12. The accurate computer simulation of phase equilibrium for complex fluid mixtures. Application to binaries involving isobutene, methanol, MTBE, and n-butane

    Czech Academy of Sciences Publication Activity Database

    Lísal, Martin; Smith, W. R.; Nezbeda, Ivo

    1999-01-01

    Roč. 103, č. 47 (1999), s. 10496-10505 ISSN 1089-5647 R&D Projects: GA ČR GA203/98/1446; GA AV ČR IAA4072712 Grant - others:OGP(CA) 1041 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.265, year: 1999

  13. Lexicografía hispanofrancesa de los siglos XVI y XVII

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas

    2014-04-01

    Full Text Available Sobre la obra, de Luis Pablo Núñez, El arte de las palabras. Diccionarios e imprenta en el Siglo de Oro(Mérida, Editora Regional de Extremadura, 2010, 2 volúmenes, 569 y 465 p. ISBN: 978-84-9852-265-5.

  14. Stepped care for depression and anxiety in visually impaired older adults: multicentre randomised controlled trial

    NARCIS (Netherlands)

    van der Aa, H.P.A.; van Rens, G.H.M.B.; Comijs, H.C.; Margrain, T.H.; Galindo Garre, F.; Twisk, J.W.R.; van Nispen, R.M.A.

    2015-01-01

    Study question Is stepped care compared with usual care effective in preventing the onset of major depressive, dysthymic, and anxiety disorders in older people with visual impairment (caused mainly by age related eye disease) and subthreshold depression and/or anxiety? Methods 265 people aged ?50

  15. Characterization and crystal structure of a 17-membered macrocyclic Schiff base compound MeO-sal-pn-bn

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Ghoran, S.H.; Rohlíček, Jan; Dušek, Michal

    2015-01-01

    Roč. 56, č. 2 (2015), s. 259-265 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : macrocyclic * Schiff base * spectroscopy * powder diffraction * orthorhombic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015

  16. How are inflation targets set?

    Czech Academy of Sciences Publication Activity Database

    Horváth, R.; Matějů, Jakub

    2011-01-01

    Roč. 14, č. 2 (2011), s. 265-300 ISSN 1367-0271 R&D Projects: GA MŠk SVV 263801/2011 Institutional research plan: CEZ:MSM0021620846 Keywords : central bank independence * imperfect credibility * macroeconomic policy Subject RIV: AH - Economics Impact factor: 0.500, year: 2011

  17. Quantitative angiographic follow-up of the coronary wallstent in native vessels and bypass grafts (European experience - March 1986 to March 1990)

    NARCIS (Netherlands)

    B.H. Strauss (Bradley); P.W.J.C. Serruys (Patrick); M.E. Bertrand (Michel); J. Puel (Jacques); B. Meier (Bernard); J-J. Goy (Jean-Jacques); L. Kappenberger (Lukas); A.F. Rickards (Anthony); U. Sigwart (Ulrich); M-A.M. Morel (Marie-Angèle); E.W.J. Montauban van Swijndregt (Eline)

    1992-01-01

    textabstractThe coronary stent has been investigated as an adjunct to percutaneous transluminal coronary angioplasty to obviate the problems of early occlusion and late restenosis. From March 1986 to March 1990, 265 patients (308 lesions) were implanted with the coronary Wallstent in 6 European

  18. Mikroskopie velmi pomalými elektrony v ultrazvukovém vakuu

    Czech Academy of Sciences Publication Activity Database

    Piňos, Jakub; Mikmeková, Eliška; Mikmeková, Šárka; Müllerová, Ilona; Frank, Luděk

    2017-01-01

    Roč. 62, č. 10 (2017), s. 264-265 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning microscopy * slow electrons * ultrahigh vacuum * graphene Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Materials engineering

  19. Seasonal and diel changes in photosynthetic activity of the snow algae Chlamydomonas nivalis (Chlorophyceae) from Svalbard determined by PAM fluorometry

    Czech Academy of Sciences Publication Activity Database

    Stibal, Marek; Elster, Josef; Šabacká, Marie; Kaštovská, Klára

    2007-01-01

    Roč. 59, - (2007), s. 265-273 ISSN 0168-6496 R&D Projects: GA AV ČR KJB6005409 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlamydomonas nivalis * photosynthetic activity * PAM fluorometry Subject RIV: EF - Botanics Impact factor: 3.039, year: 2007

  20. Small molecules and targeted therapies in distant metastatic disease

    DEFF Research Database (Denmark)

    Hersey, P; Bastholt, L; Chiarion-Sileni, V

    2009-01-01

    with chemotherapy. Agents targeting mutant B-Raf (RAF265 and PLX4032), MEK (PD0325901, AZD6244), heat-shock protein 90 (tanespimycin), mTOR (everolimus, deforolimus, temsirolimus) and VEGFR (axitinib) showed some promise in earlier stages of clinical development. Receptor tyrosine-kinase inhibitors (imatinib...

  1. 77 FR 16209 - Proposed Information Collection; Comment Request; Permitting, Vessel Identification, and...

    Science.gov (United States)

    2012-03-20

    ... the stocks, assess the effectiveness of management measures, evaluate the benefits and costs of...: Individuals; Business or other for-profit organizations. Estimated Number of Respondents: 30. Estimated Time... identification, 45 minutes. Estimated Total Annual Burden Hours: 265 hours. Estimated Total Annual Cost to Public...

  2. 78 FR 36784 - Survey of Nanomaterial Risk Management Practices

    Science.gov (United States)

    2013-06-19

    ...-0010, Docket Number NIOSH-265] Survey of Nanomaterial Risk Management Practices AGENCY: National...), Department of Health and Human Services (HHS). ACTION: Proposed NIOSH Survey of Nanomaterial Risk Management... questions addressing risk management practices for ENMs? (5) What should be the maximum amount of time...

  3. 75 FR 27028 - Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues

    Science.gov (United States)

    2010-05-13

    ... regulatory issues and their potential impact on investors and the securities markets. The Committee will lend... SECURITIES AND EXCHANGE COMMISSION [Release No. 33-9123; File No. 265-26] COMMODITY FUTURES TRADING COMMISSION Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues AGENCY: Securities and...

  4. 40 CFR 265.141 - Definitions of terms as used in this subpart.

    Science.gov (United States)

    2010-07-01

    ... cash or sold or consumed during the normal operating cycle of the business. Current liabilities means... nature. (h) Substantial business relationship means the extent of a business relationship necessary under.... A “substantial business relationship” must arise from a pattern of recent or ongoing business...

  5. 39 CFR 265.8 - Business information; procedures for predisclosure notification to submitters.

    Science.gov (United States)

    2010-07-01

    ... containing the business information. In the case of an administrative appeal, the General Counsel shall be... the time of its submission. (1) Submitters of business information shall use good-faith efforts to... 39 Postal Service 1 2010-07-01 2010-07-01 false Business information; procedures for predisclosure...

  6. 40 CFR Appendix V to Part 265 - Examples of Potentially Incompatible Waste

    Science.gov (United States)

    2010-07-01

    ... Calcium Lithium Magnesium Potassium Sodium Zinc powder Other reactive metals and metal hydrides Potential... concentrated waste in Groups 1-A or 1-B Water Calcium Lithium Metal hydrides Potassium SO2Cl2, SOCl2, PCl3...: Generation of toxic hydrogen cyanide or hydrogen sulfide gas. Group 6-A Group 6-B Chlorates Acetic acid and...

  7. Role of traditions in tourism development in the Czech part of the Bohemian Forest

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2002-01-01

    Roč. 8, - (2002), s. 265-274 ISSN 1211-7420 Grant - others:GA-(EU) QLK5-CT-2000-01211-SPRITE; 960 72(US) RSS 358/1999 Institutional research plan: CEZ:AV0Z3042911 Keywords : rural tourism * Šumava Mts. region * traditions Subject RIV: AO - Sociology, Demography

  8. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. ZAKI ABU RABI. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 265-274 Article. Interleukin 8 in progression of hormone-dependent early breast cancer · JELENA MILOVANOVIĆ NATAŠA TODOROVIĆ-RAKOVIĆ TIJANA VUJASINOVIĆ ZAKI ABU RABI.

  9. MULTIMEDIA CONCENTRATIONS OF PAH IN SEVERAL DAY CARE CENTERS

    Science.gov (United States)

    Concentrations of polycyclic aromatic hydrocarbons were measured in nine day care centers in the spring of 1997. Indoor and outdoor air, food and beverages, indoor dust, and outdoor play area soil were sampled. The mean sums of 20 target PAH concentrations were 265 and 199 ng...

  10. Pharmacogenetic Analysis of Captopril Effects on Blood Pressure: Possible Role of the Ednrb (Endothelin Receptor Type B) Candidate Gene

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef; Dobešová, Zdenka; Zídek, Václav; Šilhavý, Jan; Šimáková, Miroslava; Mlejnek, Petr; Vaněčková, Ivana; Kuneš, Jaroslav; Pravenec, Michal

    2014-01-01

    Roč. 63, č. 2 (2014), s. 263-265 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LH11049 Institutional support: RVO:67985823 Keywords : captopril * blood pressure * QTL * Ednrb gene * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.293, year: 2014

  11. Studies on asymptomatic malaria, prevention and treatment seeking ...

    African Journals Online (AJOL)

    Studies on asymptomatic malaria, prevention and treatment seeking behaviours in Abeokuta, south-west Nigeria. ... Self-diagnosis for the disease was more common (60.8%) among the participants, compared to other measures; seeking laboratory test (26.5%) and clinical diagnosis (9.1%). A good proportion of the ...

  12. Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Kopanica, M.; Krista, J.

    2003-01-01

    Roč. 48, č. 2 (2003), s. 265-272 ISSN 0009-2223 Grant - others:GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003

  13. Monte Carlo modeling of Standard Model multi-boson production processes for $\\sqrt{s} = 13$ TeV ATLAS analyses

    CERN Document Server

    Li, Shu; The ATLAS collaboration

    2017-01-01

    Proceeding for the poster presentation at LHCP2017, Shanghai, China on the topic of "Monte Carlo modeling of Standard Model multi-boson production processes for $\\sqrt{s} = 13$ TeV ATLAS analyses" (ATL-PHYS-SLIDE-2017-265 https://cds.cern.ch/record/2265389) Deadline: 01/09/2017

  14. Metalografie železných předmětů ze semonické tvrze ve světle studovaných výkovků ze středověkých tvrzí, vesnic a měst

    Czech Academy of Sciences Publication Activity Database

    Hošek, Jiří

    2006-01-01

    Roč. 97, - (2006), s. 265-320 ISSN 0031-0506 R&D Projects: GA ČR GP404/02/P033 Institutional research plan: CEZ:AV0Z80020508 Keywords : Semonice * metallographic examinations * medieval tool-making * medieval town * village * stronghold * castle Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Evaluation de la surdite professionnelle dans un departement du ...

    African Journals Online (AJOL)

    Of all ONIHL patients, 26,5% had tinnitus and 3,5% had complaints related to balance disorders. ONIHL was sensorineural, bilateral and symmetrical in 93% of cases. Univariate analysis showed no significant association between hearing loss, age, occupational exposure to noise and occupational group. Conclusion : To ...

  16. 41 CFR 101-26.505-3 - Requests to procure similar items from sources other than GSA supply sources.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Requests to procure... Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26...

  17. 41 CFR 101-26.504 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true [Reserved] 101-26.504 Section 101-26.504 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA...

  18. 41 CFR 101-26.507-3 - Purchase of security equipment from Federal Supply Schedules.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Purchase of security... Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.507-3 Purchase of...

  19. Question-answer sequences in survey interviews

    NARCIS (Netherlands)

    Dijkstra, W.; Ongena, Y.P.

    2006-01-01

    Interaction analysis was used to analyze a total of 14,265 question-answer sequences of (Q-A Sequences) 80 questions that originated from two face-to-face and three telephone surveys. The analysis was directed towards the causes and effects of particular interactional problems. Our results showed

  20. 75 FR 14491 - Listing of Color Additives Exempt From Certification; Bismuth Citrate

    Science.gov (United States)

    2010-03-26

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 [Docket No... Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint Branch Pkwy., College... results from a 90-day oral toxicity study on bismuth citrate in rats, genotoxicity studies, dermal...

  1. Effect of an oil spill from MV Sea Transporter on intertidal meiofauna at Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Ansari, Z.A.; Ingole, B.S.

    –163. Sanders, H.L., Grassle, J.F., Hampson, G.R., Morse, L.S., Garner- Price, S., Jones, C.C., 1980. Anatomyof an oil spill: long-term effects from the grounding of the barge Florida off west Falmouth, Massachusetts. Journal of Marine Research 38, 265...

  2. Interim-status groundwater monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1995-02-09

    This document outlines the groundwater monitoring plan, under RCRA regulations in 40 CFR 265 Subpart F and WAC173-300-400, for the 216-B-63 Trench. This interim status facility is being sampled under detection monitoring criteria and this plan provides current program conditions and requirements.

  3. 77 FR 36251 - Intermountain Region, Boise National Forest; Emmett Ranger District, Idaho; Scriver Creek...

    Science.gov (United States)

    2012-06-18

    ... composition to accelerate development of large tree and old forest habitat dominated by early seral tree... noncommercial trees would occur on approximately 3,265 acres following commercial timber harvest activities; and, noncommercial thinning of small diameter trees would also occur on an additional 839 acres of existing...

  4. 76 FR 28192 - Petition for Rulemaking Submitted by the Nuclear Energy Institute

    Science.gov (United States)

    2011-05-16

    ... NUCLEAR REGULATORY COMMISSION 10 CFR Part 26 [Docket No. PRM-26-5; NRC-2010-0304] Petition for Rulemaking Submitted by the Nuclear Energy Institute AGENCY: Nuclear Regulatory Commission. ACTION: Petition... Anthony R. Pietrangelo, on behalf of the Nuclear Energy Institute (NEI), the petitioner, in the planned...

  5. The EuroSIDA study: Regional differences in the HIV-1 epidemic and treatment response to antiretroviral therapy among HIV-infected patients across Europe--a review of published results

    DEFF Research Database (Denmark)

    Podlekareva, Daria; Bannister, Wendy; Mocroft, Amanda

    2008-01-01

    EuroSIDA is a pan-European observational study that follows 14,265 HIV-infected patients from 31 European countries, Israel and Argentina, of which 2,560 are patients from eastern Europe (EE). The study group has performed several analyses addressing regional differences in the HIV-epidemic across...

  6. Pattern of surgical admissions to Tikur Anbessa Hospital, Addis ...

    African Journals Online (AJOL)

    developing countries is mainly performed on acute and curable conditions('). ... 550. 2. Gastric outlet obstruction (PUD). 265. 3. Appendicitis. 258. 4. Intestinal obstruction. 229. 5. Oesophageal carcinoma. 114. 6. Abdominal trauma. 102. 7. Other GI diseases ... managing special referred cases, the majority of admission were ...

  7. Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004

  8. Role of salinity in structuring the intertidal meiofauna of a tropical estuarine beach: Field evidence

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S.; Parulekar, A.H.

    Community structure of meiofauna was studied for 12 months (July 1991-June 1992) on an estuarine intertidal beach at Siridao, Goa (India). The temperature of the surf zone water ranged from 26.5 degrees to 30.7 degrees C; salinity from 8.3 to 34.4 x...

  9. Gluconeogenesis continues in premature infants receiving total parenteral nutrition

    Science.gov (United States)

    To determine the contribution of total gluconeogenesis, to glucose production in preterm infants receiving total parenteral nutrition (TPN) providing glucose exceeding normal infant glucose turnover rate, eight infants (0.955 +/- 0.066 kg, 26.5 - 0.5 wks, 4-1 d) were studied while receiving routine ...

  10. The immune response to corneal allograft requires a site-specific draininglymph node

    Czech Academy of Sciences Publication Activity Database

    Plšková, Jarmila; Duncan, L.; Holáň, Vladimír; Filipec, M.; Kraal, G.; Forrester, J. V.

    2002-01-01

    Roč. 73, č. 2 (2002), s. 210-215 ISSN 0041-1337 R&D Projects: GA MZd NI6019 Grant - others:NATO CRG(GB) LG972853 Institutional research plan: CEZ:MSM 111100005 Keywords : corneal allograft * lymph nodes Subject RIV: EC - Immunology Impact factor: 3.265, year: 2002

  11. Extending Fluspect to simulate xanthophyll driven leaf reflectance dynamics

    Czech Academy of Sciences Publication Activity Database

    Vilfan, N.; Van der Tol, C.; Yang, P.; Wyber, R.; Malenovský, Zbyněk; Robinson, S. A.; Verhoef, A.

    2018-01-01

    Roč. 211, Jun (2018), s. 345-356 ISSN 0034-4257 Institutional support: RVO:86652079 Keywords : Fluspect * Leaf chlorophyll fluorescence * pri * Reflectance * scope * Xanthophyll cycle Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 6.265, year: 2016

  12. Diagnosis of aphasia using neural and fuzzy techniques

    DEFF Research Database (Denmark)

    Jantzen, Jan; Axer, H.; Keyserlingk, D. Graf von

    2000-01-01

    The language disability Aphasia has several sub-diagnoses such as Amnestic, Broca, Global, and Wernicke. Data concerning 265 patients is available in the form of test scores and diagnoses, made by physicians according to the Aachen Aphasia Test. A neural network model has been built, which...

  13. Red & black or black & white? Phylogeny of the Araschnia butterflies (Lepidoptera : Nymphalidae) and evolution of seasonal polyphenism

    Czech Academy of Sciences Publication Activity Database

    Fric, Zdeněk; Konvička, Martin; Zrzavý, Jan

    2004-01-01

    Roč. 17, č. 2 (2004), s. 265-278 ISSN 1010-061X R&D Projects: GA AV ČR IAA6141102 Institutional research plan: CEZ:AV0Z5007907 Keywords : Biogeography * butterfly wing pattern Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.893, year: 2004

  14. The Anthropogenic "Greenhouse Effect": Greek Prospective Primary Teachers' Ideas about Causes, Consequences and Cures

    Science.gov (United States)

    Ikonomidis, Simos; Papanastasiou, Dimitris; Melas, Dimitris; Avgoloupis, Stavros

    2012-01-01

    This study explores the ideas of Greek prospective primary teachers about the anthropogenic greenhouse effect, particularly about its causes, consequences and cures. For this purpose, a survey was conducted: 265 prospective teachers completed a closed-form questionnaire. The results showed serious misconceptions in all areas (causes, consequences…

  15. Advantages and risks in increasing cyclone separator length

    NARCIS (Netherlands)

    Hoffmann, AC; de Groot, M; Peng, W; Dries, HWA; Kater, J

    The effect of cyclone length on separation efficiency and pressure drop has been investigated experimentally and theoretically by varying the length of the cylindrical segment of a cylinder-on-cone cyclone. Experimental results based on cyclone lengths from 2.65 to 6.15 cyclone diameters showed a

  16. EST Table: FY739373 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY739373 E_FL_famL_08J15_F_0 11/11/04 59 %/223 aa ref|NP_001156252.1| hypothetical ...protein LOC100166903 [Acyrthosiphon pisum] dbj|BAH71348.1| ACYPI007741 [Acyrthosiphon pisum] 11/11/04 49 %/265 aa FBpp022473

  17. African Journal of Biotechnology - Vol 4, No 3 (2005)

    African Journals Online (AJOL)

    Increase of nisin production by Lactococcus lactis in different media · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Angela Faustino Jozala, Letícia Célia de Lencastre Novaes, Olivia Cholewa, Thereza Christina Vessoni Penna, 262-265 ...

  18. Attitudes and Perceptions of Healthcare Providers and Medical ...

    African Journals Online (AJOL)

    Purpose: To explore healthcare providers' (HCPs) and medical students' attitudes to, and perceptions of the pharmaceutical services that clinical pharmacists can provide in United Arab Emirates. Methods: A total of 535 participants (265 HCPs and 270 medical students) were asked to complete a questionnaire over a ...

  19. In 3+-doped TiO 2 and TiO 2/In 2S 3 Nanocomposite for photocatalytic and stoichiometric degradations

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Opluštil, F.; Němec, T.

    2012-01-01

    Roč. 88, č. 2 (2012), s. 265-276 ISSN 0031-8655 R&D Projects: GA MPO FI-IM5/231 Institutional research plan: CEZ:AV0Z40320502 Keywords : WARFARE AGENTS * HOMOGENEOUS HYDROLYSIS * OPTICAL-PROPERTIES Subject RIV: CA - Inorganic Chemistry Impact factor: 2.287, year: 2012

  20. Peer Assessment of Personality Traits and Pathology in Female College Students.

    Science.gov (United States)

    Oltmanns, Thomas F.; Turkheimer, Eric; Strauss, Milton E.

    1998-01-01

    Characteristic features that define narcissistic, dependent, and obsessive-compulsive personality disorders were studied using information collected for 265 targeted female college students and evaluations of self and others by 162 peers. Areas of agreement and disagreement between self-reports and reports of others are discussed. (SLD)

  1. Restoration of hay meadows on ex-arable land: commercial seed mixtures vs. spontaneous succession

    Czech Academy of Sciences Publication Activity Database

    Lencová, K.; Prach, Karel

    2011-01-01

    Roč. 66, č. 2 (2011), s. 265-271 ISSN 0142-5242 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60050516 Keywords : grassland * rate of succession * species pool Subject RIV: EF - Botanics Impact factor: 1.099, year: 2011

  2. nifor

    African Journals Online (AJOL)

    PALM RESEARCH (NIFOR) TECHNOLOGIES BY FARMERS IN. OWAN-WEST ... 4.49) and lack of interest in disseminated technologies ( x = 4.37). .... Gender. Male. 61. 73.5. Female. 22. 26.5. Total. 83. 100. Marital Status .... Information about disseminated technologies are inadequate ... The oil palm industry in Nigeria:.

  3. Diagnosis Of Aphasia Using Neural And Fuzzy Techniques

    DEFF Research Database (Denmark)

    Jantzen, Jan; Axer, Hubertus; Keyserlingk, Diedrich Graf von

    2002-01-01

    The language disability aphasia has several sub-diagnoses such as Amnestic, Broca, Global, and Wernicke. Data concerning 265 patients is available in the form of test scores and diagnoses, made by physicians according to the Aachen Aphasia Test. A neural network model has been built, which...

  4. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  5. Gain characterization of all-optical gain-clamped PDFFA for WDM networks using the feedback theory

    Czech Academy of Sciences Publication Activity Database

    Hotoleanu, M.; Karásek, Miroslav

    2000-01-01

    Roč. 19, č. 1 (2000), s. 9-18 ISSN 0146-8030 Grant - others:EU COST(XE) OC 265.10 Institutional research plan: CEZ:AV0Z2067918 Keywords : amplifiers * wavelength division multiplexing * transient response Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.300, year: 2000

  6. 75 FR 25198 - Intermountain Region, Boise National Forest, Emmett Ranger District; Idaho Scriver Creek...

    Science.gov (United States)

    2010-05-07

    ... structure, density, and species composition in order to accelerate development of larger tree size class... acres), and helicopter (1,215 acres) logging systems. In addition, all acres treated by commercial timber activities (about 3,265 acres) would be followed by thinning of submerchantable trees. About 839...

  7. Quarterly report of RCRA groundwater monitoring data for period October 1, 1992--December 31, 1992

    International Nuclear Information System (INIS)

    1993-04-01

    Hanford Site interim-status groundwater monitoring projects are conducted as either background, indicator parameter evaluation, or groundwater quality assessment monitoring programs as defined in the Resource Conservation and Recovery Act of 1976 (RCRA); and Interim Status Standards for Owners and Operators of Hazardous Waste Treatment, Storage, and Disposal Facilities, as amended (40 CFR 265). Compliance with the 40 CFR 265 regulations is required by the Washington Administrative Code (WAC) 173-303. Long-term laboratory contracts were approved on October 22, 1991. DataChem Laboratories of Salt Lake City, Utah, performs the hazardous chemicals analyses for the Hanford Site. Analyses for coliform bacteria are performed by Columbia/Biomedical Laboratories and for dioxin by TMS Analytical Services, Inc. International Technology Analytical Services Richland, Washington performs the radiochemical analyses. This quarterly report contains data that were received prior to March 8, 1993. This report may contain not only data from the October through December quarter but also data from earlier sampling events that were not previously reported

  8. Perceived Quality of Full HD Video - Subjective Quality Assessment

    Directory of Open Access Journals (Sweden)

    Juraj Bienik

    2016-01-01

    Full Text Available In recent years, an interest in multimedia services has become a global trend and this trend is still rising. The video quality is a very significant part from the bundle of multimedia services, which leads to a requirement for quality assessment in the video domain. Video quality of a streamed video across IP networks is generally influenced by two factors “transmission link imperfection and efficiency of compression standards. This paper deals with subjective video quality assessment and the impact of the compression standards H.264, H.265 and VP9 on perceived video quality of these compression standards. The evaluation is done for four full HD sequences, the difference of scenes is in the content“ distinction is based on Spatial (SI and Temporal (TI Index of test sequences. Finally, experimental results follow up to 30% bitrate reducing of H.265 and VP9 compared with the reference H.264.

  9. Dating stalagmite from Caverna do Diabo (Devil´S Cave by TL and EPR techniques

    Directory of Open Access Journals (Sweden)

    SHIGUEO WATANABE

    Full Text Available ABSTRACT A cylindrical fragment of stalagmite from Caverna do Diabo, State of São Paulo, Brazil, has been studied and dated by thermoluminescence and electron paramagnetic resonance techniques. The thermoluminescence glow curves of stalagmite samples and subsequently gamma irradiated, have shown rise of three peaks at 135, 180 and 265 °C. From electron paramagnetic resonance spectra of stalagmite was possible to clearly identify three paramagnetic centers in the g = 2.0 region: Centers I, II and III are due to , and , respectively. The additive method was applied to calculate the accumulated dose using thermoluminescence peak at 265 °C and the electron paramagnetic resonance signal at g = 1.9973 of CO- 2 radical. The ages of the different slices of stalagmite were determined from the Dac- values and Dan- value, obtaining an average of 86410 for central slice, 53421 for second slice, 31490 for third slice and 46390 years B.P. for the central region of upper end.

  10. Effect of Aqueous Ammonia Soaking on the methane yield and composition of digested manure fibers applying different ammonia concentrations and treatment durations

    DEFF Research Database (Denmark)

    Mirtsou-Xanthopoulou, Chrysoula; Jurado, Esperanza; Skiadas, Ioannis

    2014-01-01

    , their economical profitable operation relies on increasing the methane yield from manure, and especially of its solid fraction which is not so easily degradable. In the present study, Aqueous Ammonia Soaking (AAS) in six different concentrations in ammonia (5%, 10%, 15%, 20%, 25% and 32%) and for 1, 3 and 5 days...... at 22°C was applied on digested fibers separated from the effluent of a manure-fed, full-scale anaerobic digester. A methane yield increase from 76% to 104% was achieved during the first series of experiments, while the difference in reagent concentration did not considerably affect the methane yield...... is a very promising treatment resulting to an overall increase of the methane yield of digested manure fibers from 76 to 265% depending on the conditions and the batch of digested fibers used (an even higher increase of 190-265% was achieved during the 2nd series of experiments, where different AAS...

  11. Role of direct funduscopy in screening for diabetic retinopathy in communities

    Directory of Open Access Journals (Sweden)

    Li-Hua Guo

    2016-03-01

    Full Text Available AIM:To observe the application of direct funduscopy in screening for diabetic retinopathy in communities. METHODS:After mydriasis, 265 patients with diabetes mellitus(DMin communities were examined for fundus by direct funduscopy. The patients with diabetic retinopathy(DRwere further received fluorescence fundus angiography(FFAafter referral to superior hospitals.RESULTS:Within the 265 patients with DM, 79 patients were diagnosed as DR and the positive rate of DR was 29.8%. Among the patients with DR, there were 46 patients with non- proliferative diabetic retinopathy(NPDRand 33 patients with proliferative diabetic retinopathy(PDR; the positive rate was respectively 17.4% and 12.5%. All patients with DR were further diagnosed by FFA after referral. Three patients with NPDR were diagnosed with PDR, and 22 patients received laser treatment.CONCLUSION:Ordinary application of direct funduscopy in patients with DM in communities would early detect the DR. It is very necessary to master direct funduscopy for general practitioners.

  12. Condom negotiation and use among female sex workers in Phnom Penh, Cambodia.

    Science.gov (United States)

    Bui, Thanh Cong; Markham, Christine M; Tran, Ly T H; Beasley, R Palmer; Ross, Michael W

    2013-02-01

    We examined condom-use negotiation strategies and condom use among 81 female sex workers (FSWs) in Phnom Penh, Cambodia. Percentages of FSWs who did not negotiate condom use or could not describe a negotiation strategy with native clients, foreign clients, and non-paying partners were 15.0, 29.0 and 67.6 %, respectively. The most common negotiation strategy used was "provision of risk information" for native clients (43.8 %) and non-paying partners (26.5 %), and "direct request" for foreign clients (39.5 %). About half could not describe more than one negotiation strategy. Consistent condom use was high with native clients (98.8 %), yet comparatively lower with foreign clients (86.9 %) and non-paying partners (26.5 %). FSWs who did not negotiate or did not know how to negotiate condom use were less likely to report condom use with non-paying regular partners. Future interventions should enhance condom negotiation strategies between FSWs and all partner types.

  13. THE EFFECT OF A CULTURALLY TAILORED SUBSTANCE ABUSE PREVENTION INTERVENTION WITH PLAINS INDIAN ADOLESCENTS.

    Science.gov (United States)

    Patchell, Beverly A; Robbins, Leslie K; Lowe, John A; Hoke, Mary M

    2015-01-01

    To examine the effects of incorporating tribal specific cultural beliefs into a tailored substance abuse prevention intervention for at risk rural Oklahoma Native American Indian (NAI) Plains adolescents. The 10 hour Native American Talking Circle Intervention, a school-based, group substance abuse prevention program, was implemented over a 8.5 week period and evaluated using a one group, pretest-posttest design. Measurements were from the Native Self-Reliance Questionnaire and the Substance Problems Scale from Global Appraisal of Individual Needs-Quick (GAIN-Q). One-tailed, paired sample t-tests demonstrated significant increase in self-reliance, from 86.227 to 92.204 (t (43) = -2.580, p = .007) and a decrease in substance abuse/use, from 2.265 to 1.265 (t (33) = 1.844, p = .007). The Native Talking Circle Intervention based on tribal-specific values and beliefs was shown to be effective with substance abuse/use at-risk NAI Plains tribal adolescents.

  14. Expression, purification, crystallization and preliminary X-ray diffraction analysis of the VP8* sialic acid-binding domain of porcine rotavirus strain OSU

    International Nuclear Information System (INIS)

    Zhang, Yang-De; Li, Hao; Liu, Hui; Pan, Yi-Feng

    2007-01-01

    Porcine rotavirus strain OSU VP8* domain has been expressed, purified and crystallized. X-ray diffraction data from different crystal forms of the VP8* domain have been collected to 2.65 and 2.2 Å resolution, respectively. The rotavirus outer capsid spike protein VP4 is utilized in the process of rotavirus attachment to and membrane penetration of host cells. VP4 is cleaved by trypsin into two domains: VP8* and VP5*. The VP8* domain is implicated in initial interaction with sialic acid-containing cell-surface carbohydrates and triggers subsequent virus invasion. The VP8* domain from porcine OSU rotavirus was cloned and expressed in Escherichia coli. Different crystal forms (orthorhombic P2 1 2 1 2 1 and tetragonal P4 1 2 1 2) were harvested from two distinct crystallization conditions. Diffraction data have been collected to 2.65 and 2.2 Å resolution and the VP8* 65–224 structure was determined by molecular replacement

  15. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.

    2003-01-01

    Roč. 27, - (2003), s. 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910; CEZ:MSM 113100003 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  16. Design of wideband hybrid amplifiers for local area networks

    Czech Academy of Sciences Publication Activity Database

    Karásek, Miroslav; Menif, M.; Bellemare, A.

    2001-01-01

    Roč. 148, č. 3 (2001), s. 150-155 ISSN 1350-2433 Grant - others:EU COST(XE) OC 265.10 Institutional research plan: CEZ:AV0Z2067918 Keywords : optical fibre amplifiers * wavelength division multiplexing * Raman spectra Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.611, year: 2001

  17. Predicting Eating Disorders in Women: A Preliminary Measurement Study.

    Science.gov (United States)

    Lundholm, Jean K; And Others

    1989-01-01

    Identified items from Millon Clinical Multiaxial Inventory (MCMI) that differentiated eating-disordered women (n=173) currently receiving treatment for bulimia from non-eating-disordered university women (n=265). Results identified a list of statements related to social withdrawal and depression that may be appropriate for use in assessing a…

  18. 77 FR 27586 - Irradiation in the Production, Processing and Handling of Food

    Science.gov (United States)

    2012-05-11

    ..., Center for Food Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint Branch... sprouts, that nutrition data was submitted for irradiation doses of 6 kGy and not the petitioned maximum... Citizen also contends that FDA's statement that the ``petitioner submitted published articles and other...

  19. determination of morphological features and molecular interactions

    African Journals Online (AJOL)

    User

    INTRODUCTION. Bentonite is a rock formed of highly colloidal and ... is classified as sodium bentonite or calcium bentonite, depending on the ... fine clay particles and the top supernatant water layer. ... Mohshardness scale and density of 2.65 g / cm-3,. (Muhammad ... Carbonate. .... New York, American Institute of Mining ...

  20. Additive manufacturing of Ka-band antennas for wireless communications

    DEFF Research Database (Denmark)

    Armendariz, Unai; Rommel, Simon; Rodríguez Páez, Juan Sebastián

    2016-01-01

    This paper presents the design and fabrication of WR-28 waveguide horn antennas operating in the Ka-band frequency range between 26.5 GHz and 40 GHz through 3D printing. Three different antennas are fabricated from polylactide acid filaments in conductive and non-conductive variants; the latter i...

  1. Evaluation and Performance Analysis of 3D Printing Technique for Ka-Band Antenna Production

    DEFF Research Database (Denmark)

    Armendariz, Unai; Rommel, Simon; Rodríguez Páez, Juan Sebastián

    2016-01-01

    This paper presents the design and fabrication of 3D printed WR-28 waveguide horn antennas operating in the Ka-band frequency range between 26.5GHz and 40GHz. Three antennas are fabricated from polylactide acid filaments in conductive and non-conductive variants; the latter is covered...

  2. Estimating Cost and Quality Implications of an Online Solution for the Army ROTC Military History Requirement

    Science.gov (United States)

    2010-06-11

    some campuses. At some schools, the global economic downturn has resulted in a reduction of both the number of courses and sections offered at...International Journal on ELearning 5, no. 2: 265-274. 77 Welsh, Elizabeth T., Connie R. Wanberg, Kenneth G. Brown, and Marcia J. Simmering. 2003. E

  3. Mexican American Adolescent Couples Communicating about Conflict: An Integrated Developmental and Cultural Perspective

    Science.gov (United States)

    Rueda, Heidi Adams; Williams, Lela Rankin

    2016-01-01

    Using observational methods on a small sample of committed Mexican American couples (N = 10, ages 15-17, M length of relationship = 26.5 months), we describe and categorize developmental and cultural communication patterns concerning the negotiation of conflict issues. Videotaped dyadic interactions were transcribed and qualitatively coded using…

  4. Mesoscale Ionospheric Phenomena -- Lower Hybrid Collapse, Caviton Turbulence, and Charged Particle Energization in the Topside Ionosphere and Magnetosphere

    Science.gov (United States)

    1993-03-28

    Signature) BAMANDAS BASU DAVID N. ANDERSON Contract Manager Branch Chief (Signature) WILLIAM K. VICKERT Division Director This report has been revieved by...Fluids, 20, 1525 (1977). 18. S.L. Musher and B. Sturman, JETP Lett., English Translation, 22, 265 (1976). 19. R. McWilliams, R. Koslover, H. Boehmer

  5. An Authorization Logic with Explicit Time

    Science.gov (United States)

    2008-02-02

    that η-logic can be used in specifying the behavior of systems with time-dependent authorization policies. In such cases, the logic can be used to...10(4):265– 310, November 1992. [26] Christopher Lesniewski-Laas, Bryan Ford, Jacob Strauss, M. Frans Kaashoek, and Robert Morris. Alpaca : extensible

  6. 41 CFR 101-26.507-4 - Quantities in excess of the maximum order limitation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Quantities in excess of... Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.507-4 Quantities in...

  7. Students' Perceived Understanding: An Alternative Measure and Its Associations with Perceived Teacher Confirmation, Verbal Aggressiveness, and Credibility

    Science.gov (United States)

    Schrodt, Paul; Finn, Amber N.

    2011-01-01

    Given recent questions regarding the construct validity of Cahn and Shulman's Feelings of Understanding/Misunderstanding scale, two studies were conducted to develop a low-inference, behavioral measure of students' perceived understanding in the college classroom. In Study One (N = 265), a pilot inventory was developed to measure students'…

  8. Extraction of mRNA from coagulated horse blood and analysis of inflammation-related cytokine responses to coagulation

    DEFF Research Database (Denmark)

    Bovbjerg, Kirsten Katrine Lindegaard; Heegaard, Peter M. H.; Skovgaard, Kerstin

    2010-01-01

    the peripheral blood mononuclear cells present in the blood clot, homogenizing the clot by rotating knife homogenization (GentleMACS, Miltenyi Biotec) in the presence of QIAzol extraction buffer (Qiagen). The RNA extracted yielded high concentrations of total RNA (50-265 ng/μl) and quality measures (RIN=8...

  9. Helminth parasites of the tropical gar, Atractosteus tropicus Gill, from Tabasco, Mexico

    Czech Academy of Sciences Publication Activity Database

    Salgado-Maldonado, G.; Moravec, František; Cabanas-Carranza, G.; Aguilar-Aguilar, R.; Sánchez-Nava, P.; Báez-Valé, R.; Scholz, Tomáš

    2004-01-01

    Roč. 90, č. 2 (2004), s. 260-265 ISSN 0022-3395 Grant - others:Consejo Nacional de Ciencia y Tecnología (MX) 27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Helminths * fish parasites * communities Subject RIV: EG - Zoology Impact factor: 1.439, year: 2004

  10. Can centrifugation affect the morphology of polyethylene wear debris ?

    Czech Academy of Sciences Publication Activity Database

    Zolotarevova, E.; Fejfarková, Z.; Entlicher, G.; Lapčíková, Monika; Šlouf, Miroslav; Pokorný, D.; Sosna, A.

    2008-01-01

    Roč. 265, 11-12 (2008), s. 1914-1917 ISSN 0043-1648 R&D Projects: GA MŠk 2B06096 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyethyelene wear particles * total joint replacement * centrifugation Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.509, year: 2008

  11. callus induction from epicotyl and hypocotyl explants of

    African Journals Online (AJOL)

    AMO0+ and B.E. AYISIRE. Department of Botany, Obafemi Awolowo University, Ile-Ife. Nigeria. (Submitted: 31 May 2004; Accepted: 31 October 2004). Abstract ..... of Nigeria: Implications for food security. pp. 265-. 283. University of Agriculture, Abeokuta, Conference. Proceedings Series No. 3. Ayisire, B.E., Obembe, 0.0.

  12. The Roman mortars used in the construction of the Ponte di Augusto (Narni, Italy)

    Czech Academy of Sciences Publication Activity Database

    Drdácký, Miloš; Fratini, F.; Frankeová, Dita; Slížková, Zuzana

    2013-01-01

    Roč. 38, č. 1 (2013), s. 1117-1128 ISSN 0950-0618 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : historic mortar * roman mortar * Narni bridge Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.265, year: 2013

  13. Abelovu cenu v roce 2005 získal Peter Lax

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2005-01-01

    Roč. 50, č. 4 (2005), s. 265-269 ISSN 0032-2423 R&D Projects: GA MŠk(CZ) 1P05ME749 Institutional research plan: CEZ:AV0Z10190503 Keywords : Lax-Milgram lemma * Lax-Wendroff theorem * Korteweg-de Vries equation Subject RIV: BA - General Mathematics

  14. IMIDACLOPRID PRODUCES MINIMAL CHANGES IN THE EEG OF LONG-EVANS RATS

    Science.gov (United States)

    We have reported that the non-stimulus driven EEG is differentially altered by deltamethrin or permethrin (Lyke and Herr, Toxicologist, 114(S-1) :265, 2010) as well as fipronil (Lyke and Herr, Toxicologist, 120(S-2) :290, 2011). In the current study, we examined the ability to de...

  15. Video and photographic spectroscopy of 1998 and 2001 Leonid persistent trains from 300 to 930 nm

    Czech Academy of Sciences Publication Activity Database

    Abe, S.; Ebizuka, N.; Murayama, H.; Ohtsuka, K.; Sugimoto, S.; Yamamoto, M.; Yano, H.; Watanabe, J.; Borovička, Jiří

    2005-01-01

    Roč. 95, 1-4 (2005), s. 265-277 ISSN 0167-9295. [Meteoroids 2004. London, Ontario, 16.08.2004-20.08.2004] Institutional research plan: CEZ:AV0Z1003909 Keywords : airglow * Leonid meteor * shower Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.975, year: 2005

  16. Adsorption of 1,2,4-Triazine Pesticides Metamitron and Metribuzin on Lignin

    Czech Academy of Sciences Publication Activity Database

    Ludvík, Jiří; Zuman, P.

    2000-01-01

    Roč. 64, č. 1 (2000), s. 15-20 ISSN 0026-265X Grant - others:US Science and Technology Program(US) 94033 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 0.884, year: 2000

  17. 77 FR 34212 - Irradiation in the Production, Processing, and Handling of Food

    Science.gov (United States)

    2012-06-11

    ...: Celeste Johnston, Center for Food Safety and Applied Nutrition (HFS-265), Food and Drug Administration... Salmonella growth. According to the study's results, the recovery of viable Salmonella bacteria from the... recovery of Salmonella from control oranges that were not etched by the carbon dioxide laser. The amount of...

  18. Assessment of Native Languages for Food Safety Training Programs for Meat Industry Employees

    Science.gov (United States)

    Olsen, Sherrlyn S.; Cordray, Joseph C.; Sapp, Stephen; Sebranek, Joseph G.; Anderson, Barbara; Wenger, Matt

    2012-01-01

    Challenges arise when teaching food safety to culturally diverse employees working in meatpacking and food manufacturing industries. A food safety training program was developed in English, translated into Spanish, and administered to 1,265 adult learners. Assessments were conducted by comparing scores before and immediately following training.…

  19. Domain Modeling: NP_064572.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available theast Structural Genomics Consortium Target BoR24. c2bdva_ chr3/NP_064572.2/NP_064572.2_apo_2-265.pdb psi-blast 0 ... ...NP_064572.2 chr3 X-Ray Crystal Structure of Phage-related Protein BB2244 from Bordetella bronchiseptica. Nor

  20. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

    2015-01-01

    Roč. 747, JUL (2015), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.787, year: 2015

  1. Spatial and temporal diversity of smlaa shallow waters in river Lužnice floodplain

    Czech Academy of Sciences Publication Activity Database

    Pithart, David; Pichlová, R.; Bílý, M.; Hrbáček, J.; Novotná, K.; Pechar, Libor

    2007-01-01

    Roč. 584, - (2007), s. 265-275 ISSN 0018-8158 R&D Projects: GA MŽP(CZ) SL/1/6/04 Institutional research plan: CEZ:AV0Z60870520 Keywords : floodplain * terrestrial-aquatic interactions * phytoplankton * zooplankton * shading * flooding Subject RIV: EH - Ecology, Behaviour Impact factor: 1.201, year: 2007

  2. INCIDENCE OF DERMATOPHYTE INFECTIONS AMONGST SOME ...

    African Journals Online (AJOL)

    Fifty-nine Agro farm workers, 265 inmates from Jos main prison, 60 hair weavers and 40 car washers were examined in Jos for dermatophyte infections. Dermatophyte isolates included Trichophyton and Microsporum species. The highest infection rate of 75% was recorded among the farm workers with toeweb infections ...

  3. 76 FR 24467 - Fire Mountain Lodge; Notice of Application Accepted for Filing, Soliciting Motions To Intervene...

    Science.gov (United States)

    2011-05-02

    .... The existing Fire Mountain Lodge project consists of: (1) A 265- foot-long earth and concrete filled... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 1992-003] Fire Mountain.... Date filed: April 25, 2008. d. Applicant: Mr. Ken Willis. e. Name of Project: Fire Mountain Lodge. f...

  4. Structural versus behavioral remedies in the deregulation of electricity markets: an experimental investigation motivated by policy concerns

    Czech Academy of Sciences Publication Activity Database

    van Koten, Silvester; Ortmann, A.

    2013-01-01

    Roč. 64, November (2013), s. 256-265 ISSN 0014-2921 R&D Projects: GA MŠk LC542; GA ČR(CZ) GAP402/11/0364 Institutional support: RVO:67985998 Keywords : European electricity markets * economics experiments * forward markets Subject RIV: AH - Economics Impact factor: 1.364, year: 2013

  5. The management of fire-adapted ecosystems in an urban setting: the case of Table Mountain National Park, South Africa

    CSIR Research Space (South Africa)

    Van Wilgen, BW

    2012-03-01

    Full Text Available The Table Mountain National Park is a 265-km² conservation area embedded within a city of 3.5 million people. The highly diverse and unique vegetation of the park is both fire prone and fire adapted, and the use of fire forms an integral part...

  6. One Pot or Two Pot Strategies? Income Pooling in Married and Unmarried Households in Comparative Perspective

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana; Le Bourdais, C.

    2009-01-01

    Roč. 40, č. 3 (2009), s. 355-385 ISSN 0047-2328 R&D Projects: GA AV ČR(CZ) KJB700280802 Institutional research plan: CEZ:AV0Z70280505 Keywords : economic behavior * money management marriage * cohabitation Subject RIV: AO - Sociology, Demography Impact factor: 0.265, year: 2009

  7. Taxonomic revision of true morels (Morchella) in Canada and the United States

    Science.gov (United States)

    Recent molecular phylogenetic studies by Taskin et al. (Fungal Genet. Biol. 47:672-682. 2010; Mycologia [in press]) and O'Donnell et al. (Fungal Genet. Biol. 48:252-265. 2011) revealed the existence of at least 50 species of Morchella worldwide and demonstrated a high degree of continental endemism ...

  8. Three-dimensional structures of two heavily N-glycosylated Aspergillus sp family GH3 beta-D-glucosidases

    Czech Academy of Sciences Publication Activity Database

    Agirre, J.; Ariza, A.; Offen, W. A.; Turkenburg, J. P.; Roberts, S. M.; McNicholas, S.; Harris, P. V.; McBrayer, B.; Dohnálek, Jan; Cowtan, K. D.; Davies, G. J.; Wilson, K. S.

    2016-01-01

    Roč. 72, č. 2 (2016), s. 254-265 ISSN 2059-7983 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : cellulose degradation * N-glycan * biofuels * glycoblocks Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.114, year: 2016

  9. 2016-2017 Travel Expense Reports for John McArthur, Governor

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    Purpose: Board meetings. Date(s):. 2016-11-21 to 2016-11-23. Destination(s):. Ottawa. Airfare: $707.13. Other. Transportation: $88.55. Accommodation: $393.40. Meals and. Incidentals: $76.79. Other: $0.00. Total: $1,265.87. Comments: 2016-2017 Travel Expense Reports for John. McArthur, Governor.

  10. Acetylated deoxycholic (DCA) and cholic (CA) acids are potent ligands of pregnane X (PXR) receptor

    Czech Academy of Sciences Publication Activity Database

    Carazo, A.; Hyršová, L.; Dušek, J.; Chodounská, Hana; Horvátová, A.; Berka, K.; Bazgier, V.; Gan-Schreier, H.; Chamulitrat, W.; Kudová, Eva; Pávek, P.

    2017-01-01

    Roč. 265, Jan 4 (2017), s. 86-96 ISSN 0378-4274 R&D Projects: GA TA ČR(CZ) TE01020028 Institutional support: RVO:61388963 Keywords : PXR * metabolism * bile acids * nuclear receptors * FXR Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 3.858, year: 2016

  11. Genetic variation of contact dermatitis in broilers

    DEFF Research Database (Denmark)

    Ask, Birgitte

    2010-01-01

    This study aimed to investigate the presence of genetic variation in footpad dermatitis (FPD) and hock burns (HB) and the possibility to genetically select against these. A field trial including 10 commercial broiler lines (n = 102 to 265) was carried out at 2 Dutch farms. Footpad dermatitis and HB...

  12. Application of capillary electrochromatography using macroporous polyacrylamide columns for the analysis of lignans from seeds of Schisandra chinensis

    Czech Academy of Sciences Publication Activity Database

    Kvasničková, L.; Glatz, O.; Štěrbová, H.; Kahle, Vladislav; Slanina, J.; Musil, P.

    2001-01-01

    Roč. 916, 1-2 (2001), s. 265-271 ISSN 0021-9673 R&D Projects: GA ČR GA303/00/D062 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrochromatography * Schisandra chinensis * plant materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.793, year: 2001

  13. The HIV Airway

    African Journals Online (AJOL)

    Adele

    dren living with HIV/AIDS. Annual national antenatal surveil- lance shows an HIV prevalence of 26.5% among pregnant women. Anaesthetists are confronted with an increasing number of HIV infected patients, presenting for both emergency and elective sur- gery. They range from having asymptomatic infection to end stage.

  14. 78 FR 54173 - Approval and Promulgation of Air Quality Implementation Plans; Indiana; Maintenance Plan Update...

    Science.gov (United States)

    2013-09-03

    ...-2011 (ppm) 24 hour max (NAAQS 3 hour max (NAAQS Annual average Site Year = 0.14) = 0.5) (NAAQS = 0.03..., 265 F.3d 426 (6th Cir. 2001), Sierra Club v. EPA, 375 F. 3d 537 (7th Cir. 2004). See also 66 FR 53094...

  15. Doubly-doped BaY.sub.2./sub.F.sub.8./sub.:Er,Nd VUV scintillator

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Nikl, Martin; Fukuda, K.; Kawaguchi, N.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Babin, V.

    2010-01-01

    Roč. 45, 3-6 (2010), s. 265-267 ISSN 1350-4487 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : energy transfer * luminescence * rare-earth fluorides * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.019, year: 2010

  16. Self-Explanation and Reading Strategy Training (SERT) Improves Low-Knowledge Students' Science Course Performance

    Science.gov (United States)

    McNamara, Danielle S.

    2017-01-01

    This study demonstrates the generalization of previous laboratory results showing the benefits of Self-Explanation Reading Training (SERT) to college students' course exam performance. The participants were 265 students enrolled in an Introductory Biology course, 59 of whom were provided with SERT. The results showed that SERT benefited students…

  17. Temperament Constructs Related to Betrayal of Trust

    Science.gov (United States)

    1991-12-01

    disintegrate. The interrelatedness between system trust and interpersonal trust has been noted by Durkheim (1933), who predicted a loss of trust in others...and suspicion. Journal of Conflict Resolution, 2, 265-279. Durkheim , E. (1933). The division of labor in societ’. New York: Free Press of Glencoe

  18. May - August 2014 correct2

    African Journals Online (AJOL)

    Four patients (2.5%) presented with multiple dermatological diagnoses. Atopic eczema (11.1%) was the commonest skin disease diagnosed in the clinic. Acne vulgaris was the commonest skin disease among adults (18 years and above). Eczema (26.5%) was the commonest group of skin diseases diagnosed in the clinic.

  19. Development and optimization of ultra-high performance supercritical fluid chromatography mass spectrometry method for high-throughput determination of tocopherols and tocotrienols in human serum

    Czech Academy of Sciences Publication Activity Database

    Pilařová, V.; Gottvald, T.; Svoboda, P.; Novák, Ondřej; Benešová, K.; Běláková, S.; Nováková, L.

    2016-01-01

    Roč. 934, AUG 31 (2016), s. 252-265 ISSN 0003-2670 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Ultra-high performance supercritical fluid chromatography * Mass spectrometry * Liquid liquid extraction Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.950, year: 2016

  20. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 24. RileyKidsVideo 217,733 views 4:24 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society 4,455 views 3:29 Portraits of ... views 5:39 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ...

  1. Factors Affecting Recruitment into Child and Adolescent Psychiatry Training

    Science.gov (United States)

    Shaw, Jon A.; Lewis, John E.; Katyal, Shalini

    2010-01-01

    Objective: The authors studied the factors affecting the recruitment into child and adolescent psychiatry training in the United States. Methods: Medical students (n = 154) and general and child and adolescent psychiatry residents (n = 111) completed a questionnaire to evaluate career choice in child psychiatry (n = 265). Results: Compared with…

  2. Evaluation and Comparison of the Principal Component Analysis ...

    African Journals Online (AJOL)

    ... nearest neighbour classification, and 26.5% error rate with M-fold cross validation. Results indicate that PCA is more effective in analyzing the GTE data set, giving the best classification for fault diagnosis. This enhances the reliability of the turbine engine during wear out phase, through predictive maintenance strategies.

  3. Functional Validation of an Alpha-Actinin-4 Mutation as a Potential Cause of an Aggressive Presentation of Adolescent Focal Segmental Glomerulosclerosis: Implications for Genetic Testing.

    Directory of Open Access Journals (Sweden)

    Di Feng

    Full Text Available Genetic testing in the clinic and research lab is becoming more routinely used to identify rare genetic variants. However, attributing these rare variants as the cause of disease in an individual patient remains challenging. Here, we report a patient who presented with nephrotic syndrome and focal segmental glomerulosclerosis (FSGS with collapsing features at age 14. Despite treatment, her kidney disease progressed to end-stage within a year of diagnosis. Through genetic testing, an Y265H variant with unknown clinical significance in alpha-actinin-4 gene (ACTN4 was identified. This variant has not been seen previously in FSGS patients nor is it present in genetic databases. Her clinical presentation is different from previous descriptions of ACTN4 mediated FSGS, which is characterized by sub-nephrotic proteinuria and slow progression to end stage kidney disease. We performed in vitro and cellular assays to characterize this novel ACTN4 variant before attributing causation. We found that ACTN4 with either Y265H or K255E (a known disease-causing mutation increased the actin bundling activity of ACTN4 in vitro, was associated with the formation of intracellular aggregates, and increased podocyte contractile force. Despite the absence of a familial pattern of inheritance, these similar biological changes caused by the Y265H and K255E amino acid substitutions suggest that this new variant is potentially the cause of FSGS in this patient. Our studies highlight that functional validation in complement with genetic testing may be required to confirm the etiology of rare disease, especially in the setting of unusual clinical presentations.

  4. Assessing the initiation and completion of adjuvant chemotherapy in a large nationwide and population-based cohort of elderly patients with stage-III colon cancer.

    Science.gov (United States)

    Hu, Chung-Yuan; Delclos, George L; Chan, Wenyaw; Du, Xianglin L

    2011-12-01

    Randomized trials conducted in the 1980s have established the effectiveness of 5-fluorouracil-based adjuvant chemotherapy in treating stage-III colon cancer. However, the initiation of adjuvant chemotherapy is just the first step for survival improvement. Little is known about the actual completion rate of such a therapy in the community. The objectives of this study were to measure the initiation and completion rate of adjuvant chemotherapy and to identify the associated factors. We studied 12,265 patients aged 65+ diagnosed with stage-III colon cancer between 1991 and 2005 who were identified from the Surveillance, Epidemiology, and End Results-Medicare linked database. Chemotherapy initiation was defined as at least one claim indicating the use of chemotherapy. The first and last claims were used to measure the length of chemotherapy. A complete course of chemotherapy was defined as 8-13 months for 1991-1995 cohort and 5-7 months for 1996-2005 cohort according to clinical guideline. Of the 12,265 patients, 64.4% received adjuvant chemotherapy within 3 months after tumor resection. Among those who had chemotherapy initiated, 62.2% (or 38.0% of 12,265 patients) received a complete course of chemotherapy. Patient's age at diagnosis, marital status, and comorbidity score were the significant predictors for chemotherapy initiation. These variables remained significant in predicting chemotherapy completion after adjusting for year of diagnosis and other factors. In conclusion, initiation and completion of chemotherapy was largely influenced by patient's age, marital status and comorbidity. Further investigation is needed to explore the cause of these differences in adherence to standard treatment that is essential for better quality of cancer care.

  5. Crescimento e desenvolvimento da cultura do melão sob diferentes lâminas de irrigação e salinidade da água Growth and development of the melon crop under different irrigation depths and water salinity

    Directory of Open Access Journals (Sweden)

    Carlos H. de A. Farias

    2003-12-01

    Full Text Available Avaliar o crescimento, o desenvolvimento foliar e o acúmulo de matéria seca da cultura de melão ‘Gold mine’, submetido a diferentes lâminas de irrigação, utilizando-se água com dois níveis de salinidade, foi o objetivo deste trabalho. O experimento foi conduzido em condições de campo, na Fazenda São João, município de Mossoró, RN, cujo delineamento experimental adotado foi o de blocos casualizados, em esquema fatorial 6 x 2. Os tratamentos consistiram na introdução de seis lâminas de irrigação (0,55; 0,70; 0,85; 1,00; 1,15 e 1,30 da evapotranspiração máxima da cultura e dois níveis de salinidade da água de irrigação 0,55 e 2,65 dS m-1. A falta de água no período crítico afetou significativamente o restante do ciclo da cultura, causando decréscimo, no peso da fitomassa seca, para lâminas abaixo do tratamento da lâmina padrão (266 mm. O acúmulo de fitomassa foi afetado pela água de maior salinidade (2,65 dS m-1 ao longo de todo ciclo.The aim of this study was to evaluate the growth, vegetative development and accumulation of dry matter of the "Gold mine" melon submitted to different depths of irrigation using two levels of salinity. The experiment was conducted under field conditions at Fazenda São João, Mossoró, RN, in random blocks and 6 x 2 factorial experimental design. The treatments consisted of 6 depths of irrigation (0.55; 0.70; 0.85; 1.00; 1.15; 1.3 of the maximum crop evapotranspiration and two levels of salinity of the irrigation water (0.55 and 2.65 dS m-1. The absence of water in the critical period significantly affected the rest of the cycle, causing decrease in the dry weight in the treatment of irrigation depth considered as of the most appropriate depth (266 mm. The water of higher salinity (2.65 dS m-1 affected the accumulation of dry matter in the cycle.

  6. High bit depth infrared image compression via low bit depth codecs

    DEFF Research Database (Denmark)

    Belyaev, Evgeny; Mantel, Claire; Forchhammer, Søren

    .264/AVC codecs, which are usually available in efficient implementations, and compare their rate-distortion performance with JPEG2000, JPEG-XT and H.265/HEVC codecs supporting direct compression of infrared images in 16 bit depth format. A preliminary result shows that two 8 bit H.264/AVC codecs can...

  7. 21 CFR 524.402 - Chlorhexidine.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS.... See Nos. 000856 and 058829 in § 510.600(c) of this chapter. (c) Conditions of use in dogs, cats, and...) Limitations. Do not use in horses intended for human consumption. [72 FR 265, Jan. 4, 2007] ...

  8. Learning Random Numbers: A Matlab Anomaly

    Czech Academy of Sciences Publication Activity Database

    Savický, Petr; Robnik-Šikonja, M.

    2008-01-01

    Roč. 22, č. 3 (2008), s. 254-265 ISSN 0883-9514 R&D Projects: GA AV ČR 1ET100300517 Institutional research plan: CEZ:AV0Z10300504 Keywords : random number s * machine learning * classification * attribute evaluation * regression Subject RIV: BA - General Mathematics Impact factor: 0.795, year: 2008

  9. 41 CFR 101-26.502 - U.S. Government National Credit Card.

    Science.gov (United States)

    2010-07-01

    ... Credit Card. 101-26.502 Section 101-26.502 Public Contracts and Property Management Federal Property... SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.502 U.S. Government National Credit Card. A... Standard Form 149, U.S. Government National Credit Card. [60 FR 19674, Apr. 20, 1995] ...

  10. Relantionship between vestibular lamina, dental lamina, and the developing oral vestibule in the upper jaw of the field vole (Microtus agrestis, Rodentia)

    Czech Academy of Sciences Publication Activity Database

    Witter, K.; Pavlíková, H.; Matulová, Petra; Míšek, Ivan

    2005-01-01

    Roč. 265, - (2005), s. 264-270 ISSN 0362-2525 R&D Projects: GA ČR GA304/02/0448; GA MŠk OC B23.001 Institutional research plan: CEZ:AV0Z50450515 Keywords : mouth * dentition * tooth Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.421, year: 2005

  11. 76 FR 11283 - Agency Information Collection Activities; Submission for OMB Review; Comment Request...

    Science.gov (United States)

    2011-03-01

    ... shall be paid in all compensable death cases. The OWCP has developed Form LS-265 for use in submitting... currently valid OMB Control Number. In addition, notwithstanding any other provisions of law, no person shall generally be subject to penalty for failing to comply with a collection of information if the...

  12. 78 FR 27260 - Southern California Edison, San Onofre Nuclear Generating Station, Units 2 and 3 Request for Action

    Science.gov (United States)

    2013-05-09

    ... (NRC) is giving notice that by petition dated June 18, 2012, Friends of the Earth (FOE, the petitioner... 12, 2013 (ADAMS Accession No. ML13116A265), FOE requested that Mitsubishi Heavy Industries' Report... this petition within a reasonable time. Further, FOE submitted on April 4, 2013, a cover letter and...

  13. Influence of Active Immunization Against Angiotensin AT1 or AT2 Receptor on Hypertension Development in Young and Adult SHR

    Czech Academy of Sciences Publication Activity Database

    Železná, Blanka; Veselský, Leopold; Velek, Jiří; Dobešová, Zdenka; Zicha, Josef; Kuneš, Jaroslav

    1999-01-01

    Roč. 48, č. 4 (1999), s. 259-265 ISSN 0862-8408 R&D Projects: GA MŠk OK 170; GA AV ČR IAA7011711; GA AV ČR IPP2020702 Grant - others:Coperincus(FR) CT94-0239 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.521, year: 1999

  14. Prevalence and Correlates of Spouse Violence Among Women in a ...

    African Journals Online (AJOL)

    Method: Three hundred and twenty one participants, who were patients and/or mothers of (children) patients, were selected through a systematic sampling method; 265 of them eventually participated in the study (82.5% response rate). A questionnaire on domestic violence was used to collect data. The data were analyzed ...

  15. Fine Needle Aspiration Cytology in Pediatric Age Group with Special ...

    African Journals Online (AJOL)

    hanumantp

    the commonest diagnosis among all mass lesions 38.8% (103/265), whereas Fibroadenoma. 20.8% (10/49) was commonest diagnosis among benign lesions and among malignant lesions there were two cases 15.3% (2/13) each of Hodgkins and non‑Hodgkins lymphoma and one case of chondrosarcoma. The positive ...

  16. Gorstian palaeoposition and geotectonic setting of Suchomasty Volcanic Centre (Silurian, Prague Basin, Teplá-Barrandian Unit, Bohemian Massif)

    Czech Academy of Sciences Publication Activity Database

    Tasáryová, Z.; Schnabl, Petr; Čížková, Kristýna; Pruner, Petr; Janoušek, V.; Rapprich, V.; Štorch, Petr; Manda, Š.; Frýda, J.; Trubač, J.

    2014-01-01

    Roč. 136, č. 1 (2014), s. 262-265 ISSN 1103-5897 R&D Projects: GA ČR GAP210/10/2351 Institutional support: RVO:67985831 Keywords : basalt geochemistry * Gorstian * palaeolatitude * Prague Basin * Silurian * Suchomasty Volcanic Centre Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.309, year: 2014

  17. South African Journal of Higher Education - Vol 18, No 1 (2004)

    African Journals Online (AJOL)

    Selection for the Science Foundation Programme (University of Natal): the development of a selection instrument · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Grussendorff, M Liebenberg, J Houston, 265-272. http://dx.doi.org/10.4314/sajhe.v18i1.25442 ...

  18. Double spin asymmetry in exclusive rho(0) muoproduction at COMPASS

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Arbuzov, A.; Badelek, B.; Balestra, F.; Ball, J.; Baum, G.; Barth, J.; Bedfer, Y.; Bernet, C.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chapiro, A.; Chiosso, M.; Cicuttin, A.; Colantoni, M.; Costa, S.; Crespo, M.; d'Hose, N.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; De Masi, R.; Dedek, N.; Denisov, O.; Dhara, L.; Diaz, V.; Dinkelbach, A.; Donskov, S.; Dorofeev, V.; Doshita, N.; Duic, V.; Dünnweber, W.; Eversheim, P.; Eyrich, W.; Fabro, M.; Faessler, M.; Falaleev, V.; Ferrero, A.; Ferrero, L.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Franz, J.; Friedrich, J.; Frolov, V.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gobbo, B.; Goertz, S.; Gorin, A. M.; Grabmüller, S.; Grajek, O.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; Hannappel, J.; von Harrach, D.; Hasegawa, T.; Heckmann, J.; Hedicke, S.; Heinsius, F.; Hermann, R.; Hess, C.; Hinterberger, F.; von Hodenberg, M.; Horikawa, N.; Horikawa, S.; Ilgner, C.; Ioukaev, A.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Janata, A.; Jasinski, P.; Joosten, R.; Jouravlev, N. I.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Komissarov, E.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V.; Korentchenko, A.; Korzenev, A.; Kotzinian, A.; Koutchinski, N.; Kouznetsov, O.; Kravchuk, N.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Ladygin, M.; Lamanna, M.; Le Goff, J.; Lednev, A.; Lehmann, A.; Lichtenstadt, J.; Liska, T.; Ludwig, I.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Maximov, A.; Meyer, W.; Mielech, A.; Mikhailov, Y.; Moinester, M.; Mutter, M.; Nähle, O.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Neliba, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nikolaev, K.; Olshevsky, A.; Ostrick, M.; Padee, A.; Pagano, P.; Panebianco, S.; Panknin, R.; Panzieri, D.; Paul, S.; Pawlukiewicz-Kaminska, B.; Peshekhonov, D.; Peshekhonov, V.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pretz, J.; Procureur, S.; Quintans, C.; Rajotte, J.; Rapatsky, V.; Ramos, S.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Rozhdestvensky, A.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Schiavon, P.; Schill, C.; Schmitt, L.; Schönmeier, P.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Sugonyaev, V.; Srnka, Aleš; Stinzing, F.; Stolarski, M.; Sulc, M.; Sulej, R.; Takabayashi, N.; Tchalishev, V.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Venugopal, G.; Virius, M.; Vlassov, N.; Vossen, A.; Webb, R.; Weise, E.; Weitzel, Q.; Windmolders, R.; Wirth, S.; Wislicki, W.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Zhao, J.; Ziegler, R.; Zvyagin, A.

    2007-01-01

    Roč. 52, č. 2 (2007), s. 255-265 ISSN 1434-6044 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : double spin asymmetry * polarized deuterons * scattering * COMPASS Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.255, year: 2007

  19. Download this PDF file

    African Journals Online (AJOL)

    metallic guld, gold oxide and gold(III) solutions in hydrochloric and sulphuric acids. Moreover ... incorporation of a solid sample of the element in a carbon paste electrode. ... closed cell containing hydrochloric or sulphuric acid as electrolyte. .... Near 265 mV is observed a quasi-reversible electrochemical system linked to the.

  20. 41 CFR 101-26.506 - Interior planning and design services.

    Science.gov (United States)

    2010-07-01

    ... SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.506 Interior planning and design services. In... various phases of interior planning and design. These services will be provided either directly or through... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Interior planning and...