WorldWideScience

Sample records for meditsiinidoktor piret kll

  1. KLL resonant Auger transitions in metallic Cu and Ni

    International Nuclear Information System (INIS)

    Koever, L.; Berenyi, Z.; Cserny, I.

    2004-01-01

    Complete text of publication follows. KLL Auger spectra of 3d transition metals contain important information on the effects of the solid environment on deep core Auger transitions. Following the changes in the spectra when fine tuning the exciting photon energy across the K-shell ionization threshold with high energy resolution is informative concerning the possible resonant processes, expected to indicate the single-step nature of threshold Auger emission. The satellite structures in these spectra are strongly related to the unoccupied local electronic states above the Fermi level, as well as to the excitation, relaxation and screening processes associated with core hole ionization. In spite of the fundamental significance of the phenomena mentioned above, even non resonant high energy resolution studies of KLL Auger spectra of 3d transition metals (using laboratory X-ray sources) are very scarce due to the demanding experimental conditions requested. A very efficient tool for studying these phenomena is the Tunable High Energy XPS developed at HASYLAB which provides unique conditions, photon x and energy resolution for deep core Auger spectroscopy. Using the THE-XPS instrument at the BW2 beamline the high energy resolution (ΔE = 0.2 eV) KL 2,3 L 2,3 Auger spectra of polycrystalline Cu and Ni foils were measured with the Scienta SES-200 hemispherical analyzer. In the high energy range Cu 2p photo-electron peaks appearing in the Cu KLL Auger spectra due to the excitation by internal Cu K X-rays and trusted value for the Cu 2p3/2 binding energy were used for energy calibration. The exciting photon energy range was tuned up to about 50 eV above the K absorption edge and for the resonant energy region to 5 eV (Cu KLL) and 4 eV (Ni KLL) below threshold ensuring a photon beam with an energy width of about 1.1 eV. The evolution of the satellite structure as a function of excitation energy above threshold indicates di rent behaviour for particular satellites, making

  2. Piret Raud avaldas iPadi-raamatu

    Index Scriptorium Estoniae

    2010-01-01

    Arvustus: Raud, Piret. Emma roosad asjad. Tallinn : Tammerraamat, 2010 ; Raud, Piret. Emma roosad asjad : [digitaalne pildiraamat lastele. Suurbritannia] : WingedChariot, 2010. Teost on võimalik kasutada Apple´i elektroonikatoodetes iPad, iPhone ja iPod (eesti, inglise ja jaapani keeles)

  3. Separation of extrinsic and intrinsic plasmon excitations in Ge KLL Auger spectra

    International Nuclear Information System (INIS)

    Berenyi, Z.; Aszalos-Kiss, B.; Csik, A.; Toth, J.; Koever, L.; Varga, D.

    2002-01-01

    The nature of the Ge satellite structure and the contributions from extrinsic and intrinsic processes were investigated using the ESA-31 electron spectrometer. These measurements are providing the first high energy resolution Ge KLL data. The intensity ratio of the plasmon peaks induced by intrinsic and extrinsic excitation processes is found. (R.P.)

  4. Raamatud Piret Raualt ja Leelo Tunglalt

    Index Scriptorium Estoniae

    2004-01-01

    Raud, Piret. Ernesto küülikud / autori illustratsioonid. Tallinn : Tänapäev, 2004 ; Tungal, Leelo. Väike jõulusoov : jõulusalme väikestele ja suurtele / joonistanud Viive Noor. Tallinn : Tänapäev, 2004

  5. Kodumaine ja nooruslik / Piret Veigel, Irene Roos

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2003-01-01

    Arhitekt Vahur Sova projekteeritud ökomaja eeskujul kujundatud elutuba. Värvivalik on inspireeritud looduse sügistalvistest toonidest ja naturaalsetest materjalidest. Stilistid Piret Veigel ja Irene Roos. Vineerkapi on kujundanud Tarmo Luisk, laua Jan J. Graps, sirmi Igor Volkov

  6. Mustamäe metamorfoosid / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2004-01-01

    Mustamäe Arvo Valtoni ja Mati Undi loomingus. Artikli ingliskeelne versioon on ilmunud kogumikus "Koht ja paik = Place and location. III" (Tallinn, 2003). Vt. ka: Viires, Piret. Postmodernism Eesti kirjanduskultuuris : doktoritöö artiklid ; III. Tartu : Tartu Ülikooli Kirjastus, 2006

  7. Mustamäe metamorphoses / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2003-01-01

    Mustamäe Arvo Valtoni ja Mati Undi loomingus. Lühendatult on artikkel ilmunud: Elm : Estonian Literary Magazine (2005, sügis) nr. 21, lk. 28-33. Vt. ka: Viires, Piret. Postmodernism Eesti kirjanduskultuuris : doktoritöö artiklid ; III. Tartu : Tartu Ülikooli Kirjastus, 2006

  8. Influence of host matrices on krypton electron binding energies and KLL Auger transition energies

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Perevoshchikov, L. L.; Kovalík, Alojz; Filosofov, D. V.; Yushkevich, Yu. V.; Ryšavý, Miloš; Lee, B. Q.; Kibédi, T.; Stuchbery, A. E.; Zhdanov, V. S.

    2014-01-01

    Roč. 197, DEC (2014), s. 64-71 ISSN 0368-2048 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : Kr-83 * Rb-83 * Sr-83 * electron binding energy * KLL transitions * natural atomic level width * multiconfiguration Dirac-Fock calculations Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.436, year: 2014

  9. Search for environmental effects on the KLL Auger spectrum of rubidium generated in radioactive decay

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Perevoshchikov, L. L.; Kovalík, Alojz; Filosofov, D. V.; Yushkevich, Y. V.; Ryšavý, Miloš; Lee, B. Q.; Kibédi, T.; Stuchbery, A. E.; Zhdanov, V. S.

    2015-01-01

    Roč. 90, č. 2 (2015), 025402 ISSN 0031-8949 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : Rb-83 * Rb-85 * Sr-83 * Sr-85 * KLL transitions * natural atomic level width * multi configuration Dirac-Fock calculations Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.194, year: 2015

  10. Piret Raua raamatud Saksamaal ja iPhone´is

    Index Scriptorium Estoniae

    2010-01-01

    Piret Raua lasteraamat "Härra Linnu lugu" ilmus saksa keeles ; Piret Raua digitaalset pildiraamatut lastele "Emma roosad asjad" on võimalik kasutada Apple´i elektroonikatoodetes iPad, iPhone ja iPod (eesti, inglise ja jaapani keeles). Esitlus toimus 24. mail Lastekirjanduse Teabekeskuses

  11. Resonant Ni and Fe KLL Auger spectra photoexcited from NiFe alloys

    International Nuclear Information System (INIS)

    Koever, L.; Cserny, I.; Berenyi, Z.; Egri, S.; Novak, M.

    2005-01-01

    Complete text of publication follows. KLL Auger spectra of 3d transition metal atoms in solid environment, measured using high energy resolution, give an insight into the details of the local electronic structure surrounding the particular atoms emitting the signal Auger electrons. Fine tuning the energy of the exciting monochromatic photons across the K-absorption edge, features characteristic to resonant phenomena can be identified in the spectra. The shapes of the resonantly photoexcited KLL Auger spectra induced from 3d transition metals and alloys are well interpreted by the single step model of the Auger process, based on the resonant scattering theory. The peak shapes are strongly influenced by the 4p partial density of unoccupied electronic states around the excited atom. High energy resolution studies of KLL Auger spectra of 3d transition metals using laboratory X-ray sources, however, request very demanding experiments and yield spectra of limited statistical quality making the evaluation of the fine details in the spectra difficult. The Tunable High Energy XPS (THE- XPS) instrument at BW2 offers optimum photon x and energy resolution for spectroscopy of deep core Auger transitions. For the present measurements high purity polycrystalline Ni and Fe sheets as well as NiFe alloy samples of different compositions (Ni 80 Fe 20 , Ni 50 Fe 50 , Ni 20 Fe 80 ) were used. The surfaces of the samples were cleaned by in-situ argon ion sputtering. The measurements of the Ni and Fe KL 23 L 23 Auger spectra of the metal and alloy samples were performed with the THE-XPS instrument using high electron energy resolution (0.2 eV). In Fig.1, the measured Fe KL 23 L 23 spectrum, photoexcited at the Fe K absorption edge from Fe metal, is compared with the respective spectrum excited from a Ni 50 Fe 50 alloy. A significant broadening of the 1 D 2 peak and an enhancement of the spectral intensity at the low energy loss part of this peak observed in the alloy sample, while the

  12. Õpiloos on oma iva / Piret Viil, Mariliis Lazarev

    Index Scriptorium Estoniae

    Viil, Piret, 1957-

    2015-01-01

    "Innovaatilised õpilood" koolituse muljeid jagavad Rõuge Põhikooli õpetajad, kelle mõtted kogusid kokku Piret Viil, ning Mariliis Lazarev. Õpilugu on teadmiste omandamine erinevate õpimeetodite kaudu, hõlmates mitmeid õppeaineid

  13. Kirjanduse kohandumisi 1990. aastatel ehk kauboikapitalismi kultuuriloogika / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2002-01-01

    Summary: Conformity in the literature of the 1990s, or the cultural logic of cowboy capitalism. Lk. 365; Eesti kultuurisituatsioonist 1990-ndatel vastavalt F. Jamesoni postmodernismi käsitlusele, kus postmodernism oli eesti kirjanduses valitsev diskursus. Vt. ka: Viires, Piret. Postmodernism Eesti kirjanduskultuuris : doktoritöö artiklid ; I. Tartu : Tartu Ülikooli Kirjastus, 2006

  14. Presidendivastuvõtul tudengina - see oli õnn! / Piret Hartman, Aigar Aab

    Index Scriptorium Estoniae

    Hartman, Piret

    2002-01-01

    Põllumajandusülikooli majandusteaduskonna kolmanda kursuse ettevõtluse tudengid Piret Hartman ja Aigar Aab olid vabariigi ajaloos esimesed tudengid, kes said presidendi vastuvõtul esindada üliõpilasi

  15. Meditsiinidoktor Lea Pehme / Alan Altraja

    Index Scriptorium Estoniae

    Altraja, Alan, 1965-

    2008-01-01

    7. sept. 2007 kaitses Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tuberkuloosi epidemioloogiline olukord Eestis 1991-2003 rõhuasetusega kopsuvälisele tuberkuloosile ja kopsutuberkuloosi diagnoosimise viivitust mõjutavatele teguritele" Lea Pehme

  16. Meditsiinidoktor Tiia Voor / Kaja Julge

    Index Scriptorium Estoniae

    Julge, Kaja, 1957-

    2006-01-01

    Tartu ÜlikooliKliinikumi lastekliiniku resident Tiia Voor kaitses 2. dets. 2005 Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Allergiahaiguste kujunemise sõltuvus Eesti ja Rootsi laste kokkupuutest mikroorganismidega varajases eas"

  17. Püssi tüdruk Piret Hartman - Eesti tudengite esivõitleja / Piret Hartman ; interv. Sirle Sommer-Kalda

    Index Scriptorium Estoniae

    Hartman, Piret

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 2. aug lk. 5. Eesti Üliõpilaskondade Liidu (EÜL) juhatuse esimees Piret Hartman: tahame, et see raha, mis läheb praegu üliõpilastele nii õppelaenude, toimetulekutoetuste, stipendiumide kui sõidusoodustuste näol, jagataks efektiivsemalt ümber

  18. Analytical solution of Luedeking-Piret equation for a batch fermentation obeying Monod growth kinetics.

    Science.gov (United States)

    Garnier, Alain; Gaillet, Bruno

    2015-12-01

    Not so many fermentation mathematical models allow analytical solutions of batch process dynamics. The most widely used is the combination of the logistic microbial growth kinetics with Luedeking-Piret bioproduct synthesis relation. However, the logistic equation is principally based on formalistic similarities and only fits a limited range of fermentation types. In this article, we have developed an analytical solution for the combination of Monod growth kinetics with Luedeking-Piret relation, which can be identified by linear regression and used to simulate batch fermentation evolution. Two classical examples are used to show the quality of fit and the simplicity of the method proposed. A solution for the combination of Haldane substrate-limited growth model combined with Luedeking-Piret relation is also provided. These models could prove useful for the analysis of fermentation data in industry as well as academia. © 2015 Wiley Periodicals, Inc.

  19. Viking Line pakub mugavat reisimisvõimalust / kommenteerinud Inno Borodenko, Piret Pääsik

    Index Scriptorium Estoniae

    2009-01-01

    1. juunil 2009 täitus 50 aastat laevakompanii Viking Line asutamisest ja 15 aastat Viking Line tulekust Eestisse. Viking Line Eesti OÜ tegevjuht Inno Borodenko ja turundusjuht Piret Pääsik tutvustavad laevafirma saamislugu, eesmärke ning tegevust.

  20. Ei sinistele esmaspäevadele!!! / Piret Jamnes, Marju Unt, Mare Teichmann, Eva Palu

    Index Scriptorium Estoniae

    2010-01-01

    Personaliotsingufirma Fontes partner ja konsultant Piret Jamnes, Estonian Euromanagement Institute'i direktor Marju Unt, kommunikatsioonibüroo JLS PR-konsultant Eva Palu ja TTÜ psühholoogiaprofessor Mare Teichmann ideedest, mis aitavad tööst rohkem rõõmu tunda

  1. Soomes kolleeg, Eestis kollanokk / Krister Kivi, Kristina Fogel, Piret Tilk...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Tartu Ülikooli arstiteaduskonna lõpetajaid ajab välismaale tunne, et nende oskusi väärtustatakse seal enam. Vestlusest kuuenda kursuse üliõpilaste Kristina Fogeli, Piret Tilga ja Pille Pärgmäega

  2. Pildikesi koolipõlvest Tallinna ülikoolis / Krista Sillar, Piret Suidt, Ester Barkala ; [üles kirjutanud] Kristi Helme

    Index Scriptorium Estoniae

    Sillar, Krista

    2009-01-01

    Ülikooliaega meenutavad Müncheni eesti koolis ja Müncheni Euroopa koolis eesti keelt õpetav Piret Suidt, Tallinna 32. keskkooli õppealajuhataja Krista Sillar ning Tallinna 21. kooli ajalooõpetaja Ester Barkala

  3. Accurate atom-solid kinetic energy shifts from the simultaneous measurement of the KLL Auger spectra for Na, Mg, Al and Si

    International Nuclear Information System (INIS)

    Aksela, S; Turunen, P; Kantia, T; Aksela, H

    2011-01-01

    KLL Auger-energy shifts between free atoms and their solid surfaces were determined from spectra measured simultaneously in identical experimental conditions. Essentially, the shift values obtained for Na, Mg, Al and Si were more accurate than those achieved by combining the results from separate vapour and solid measurements. Using atomic Auger energies and determined shifts, reliable absolute solid state Auger energies with respect to the vacuum level were also obtained. Experimental shift values were also compared with calculations obtained with the excited atom model. 2s and 2p binding energy shifts were estimated from recent high resolution and due to open shell strongly split vapour phase spectra and corresponding published solid state results. Also, the question of the extent to which the 2s and 2p shifts deviate has been discussed here. (paper)

  4. Many-electron effect in the Si K-LL resonant Auger-electron spectroscopy spectra of the Si delta layer in GaAs

    International Nuclear Information System (INIS)

    Ohno, Masahide

    2006-01-01

    The Si K-LL resonant Auger-electron spectroscopy (RAES) spectra of silicon delta dopped layers in GaAs with very thin capping layers show both normal Auger decay and resonant Auger decay, when the core-level electron is excited to the conduction band. The resonant Auger peak kinetic energy (KE) shows no dispersion with photon energy, except when excited by the highest energy photons [M.D. Jackson, J.M.C. Thornton, D. Lewis, A. Robinson, M. Fahy, A. Aviary, P. Weightman, Phys. Rev. B71 (2005) 075313]. The RAES spectra are analyzed using a many-body theory. The presence of resonant Auger decay and no dispersion of resonant Auger peak KE with photon energy is explained in terms of the relaxation of a metastable excited core-hole state to a stable one on the time scale of core-hole decay. The excited electron in the conduction band either delocalizes rapidly leaving the ionized Si to decay by a normal Auger decay or drops to a state localized in the Si delta layer before the core-hole decays so that the RAES spectrum has both normal Auger decay and resonant Auger decay. As a result of the relaxation, the resonant Auger peak KE does not show any dispersion with photon energy. The variations with photon energy of the normal or resonant Auger peak intensity, KE, and width are explained in a consistent manner by a many-body theory

  5. Wiedemanni fond 10 / Jüri Valge, Piret Järvela, Liivi Heinla, Aili Kiin ; intervjueerinud Külliki Kask

    Index Scriptorium Estoniae

    2015-01-01

    Eraalgatuslik Wiedemanni fond toetab nii eesti keele õpilasuurimusi kui ka ülikooliõpinguid, sh magistri- ja doktoriõpet. Küsimustele vastavad Wiedemanni fondi 2015. aasta stipendiaadid, eesti keele ja kirjanduse õpetajad Piret Järvela Tallinna reaalkoolist, Liivi Heinla Kadrina keskkoolist ja Aili Kiin Viljandi gümnaasiumist. Küsitles Külliki Kask

  6. Infotankistid ja Puhas Rõõm esitlevad : R.A.I.S.K. / Piret Räni

    Index Scriptorium Estoniae

    Räni, Piret

    2007-01-01

    Rühmitustest Infotankistid ja Puhas Rõõm. Näitusel R.A.I.S.K. (Radikaalne Agiteeriv Intrigeeriv Sotsiaalne Kunst) eksponeeritud töödest, autorid Mart Viljus, Katrin Tees, Ivika Kivi, Sulo Kallas, Piret Räni, Erki Kannus, Anu Vahtra, Maris Suits, Taavi Suits

  7. Kergplokkidest Jämera tüüpmaja Merirahu eramurajoonis / Ivi-Els Schneider, Piret Anier

    Index Scriptorium Estoniae

    Schneider, Ivi-Els, 1945-

    2005-01-01

    I ja II korruse plaan, välisvaade, 10 sisevaadet, värv.; ümberprojekteerimine: arhitekt Piret Anier, AB Zokkel, sisearhitekt Ivi-Els Schneideri jooniste järgi on valmistatud ka enamik mööblist; fotod: Kaido Haagen

  8. Meditsiinidoktor Marje Oona / Heidi-Ingrid Maaroos

    Index Scriptorium Estoniae

    Maaroos, Heidi-Ingrid, 1942-

    2005-01-01

    Tartu Ülikooli polikliiniku ja perearstiteaduse õppetooli assistendi ja teaduri Marje Oona doktoritöö "Helicobacter pylori infektsioon lastel : epidemioloogilisi ja ravi aspekte" kaitsmisest Tartu Ülikoolis 12. jaanuaril 2005

  9. Magistritööd : [Piret Jamnes jt.] / Maia Kööts

    Index Scriptorium Estoniae

    Kööts, Maia

    2001-01-01

    20.12.2000 kaitses TPÜ organisatsioonikäitumise magistritööde kaitsmisnõukogu koosolekul Piret Jamnes magistritöö "Trends in Estonian career Counselling in the Light of Societal Transformation and Constructive Framework"; 21.12 TPÜ kasvatusteaduste ja pedagoogika magistritööde kaitsmisnõukogu koosolekul Olesja Šigajeva "Mõningate psühholoogiliste aspektide kasutamine innovatsiooniliste tehnoloogiate õpetamisel"; Sirje Priks "Kutsekooliõpilaste sotsiaalse valmiduse arendamise võimalusi eesti keele ja kirjanduse tundide kaudu". 9.01.2001 TPÜ demograafia magistritööde kaitsmisnõukogu koosolekul Enel Pungas "Siserändevoogude vanuskäsitlus : Eesti Pere- ja sündimusuuringu andmetel". 11.01 TPÜ sotsioloogia magistritööde kaitsmisnõukogu koosolekul Virve-Ines Laidmäe "Muutused eestimaalaste tervisehinnangutes ja -käitumises 1990. aastatel"

  10. Huviharidus ei ole ainult soe bussipeatus / Piret Hartman, Ardo Rohtla, Annely Köster ... [jt.] ; intervjueerinud Maris Hellrand

    Index Scriptorium Estoniae

    2016-01-01

    Noorte huvitegevuse toetussüsteemi kontseptsioon toob järgmisel sügisel valdkonda lisaraha. Vestlusringis huvihariduse probleemide üle osalesid kultuuriministri nõunik Piret Hartman, haridus- ja teadusministeeriumi noorteosakonna asejuhataja Ardo Rohtla, Sally Stuudio juhataja Annely Köster, Eesti Muusikakoolide Liidu juhatuse esimees Kadri Leivategija, Rakvere abilinnapea Kairit Pihlak, Eesti Teadushuvihariduse Liidu juhatuse liige Heilo Altin ja MTÜ Loovkirjutamise Keskus juhatuse liige Katriin Fisch-Uibopuu

  11. Mil viisil olete puutunud kokku küberkiusamisega? / Piret Paadimeister, Ivika Aman, Lemme-Liis Aruväli ... [jt.

    Index Scriptorium Estoniae

    2011-01-01

    Küsimusele vastasid Paldiski gümnaasiumi õpetaja Piret Paadimeister, lapsevanem Ivika Aman, tudeng Lemme-Liis Aruväli, Tallinna Männiku lasteaia õpetaja Hedvig Kabonen, Nõmme põhikooli psühholoog Katri Viitpoom

  12. Heinrich Stahlist värske pilguga / Piret Lotman, Kristiina Ross, Aivar Põldvee, Annika Viht ; intervjueerinud Külli Habicht, Külli Prillop

    Index Scriptorium Estoniae

    2014-01-01

    Heinrich Stahli keelelise ja kultuurilise panuse ning tema rolli väärtustamise teemadel vahetasid mõtteid Eesti Rahvusraamatukogu vanemteadur, teose "Heinrich Stahli elu ja looming" autor Piret Lotman, EKI vanemteadur Kristiina Ross, EKI ja TLÜ ajaloo instituudi vanemteadur Aivar Põldvee, TLÜ lektor Annika Viht ning Stahli teoste "Hand- und Hauszbuch" ja "Leyen-Spiegel" sõnastiku koostajad Külli Prillop ja Külli Habicht

  13. Measurements of the Rare Decays B -> Kl+l- and B ->K*l+l-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-07-06

    The authors present measurements of the flavor-changing neutral current decays B {yields} K{ell}{sup +}{ell}{sup -} and B {yields} K*{ell}{sup +}{ell}{sup -}, where {ell}{sup +}{ell}{sup -} is either an e{sup +}e{sup -} or {mu}{sup +}{mu}{sup -} pair. The data sample comprises 229 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring.

  14. Sekulariseeruv sakraalarhitektuur / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

  15. Bittides raamatud / Piret Lotman

    Index Scriptorium Estoniae

    Lotman, Piret, 1950-

    2014-01-01

    Põhja- ja Baltimaade ning Venemaa raamatu, raamatukogude ja lugemise ajaloo koostöövõrgustiku HIBOLIRE suveseminarist ja digitaalhumanitaaria õpitoast „Books in Bits: Using Digital Tools in Book History“ 7.-8. aug. 2014

  16. Piret Raud IBBY aunimekirjas

    Index Scriptorium Estoniae

    2011-01-01

    IBBY aunimekiri (IBBY Honour) on iga kahe aasta tagant ilmuv trükis, kuhu kantakse IBBY (International Board on Books for Young People) liikmesmaade parimad lastekirjanikud, lasteraamatute illustraatorid ja tõlkijad

  17. Arhitektuuriaasta parimad / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2003-01-01

    EK arhitektuuri sihtkapitali aastapreemiad 2002: suur preemia: Eesti arhitektuuripoliitika töögrupp (13 nime), objektipreemia: Jüri Okas (Mardi talu), sisekujunduspreemia: Tiiu Truus (Neiseri kontor), restaureerimispreemia: Juta Lember (EV Presidendi kantselei esindusruumid), urbanistikapreemia: Villem Tomiste, tegevuspreemia: Jüri Kermik ("A. M. Luther 1877-1940"), Andres Kurg ja Mari Laanemets ("Tallinna juht")

  18. Midigraafika Linnagaleriis / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2001-01-01

    Pärnu Linnagaleriis 28. juulini avatud rahvusvahelise väikegraafika näitusest "Midigrafik II". Leedu kunstniku Mikolajus Vilutise, Anu Kalmu, Helje Eelma-Saare, Sirje Eelma, Ülle Marksi ja Jüri Kassi tööde valjapanekust

  19. Mehatroonik / Piret Jaaks

    Index Scriptorium Estoniae

    Jaaks, Piret, 1980-

    2005-01-01

    AS-i Overall Eesti juhi ja asutaja Andres Haameri elukäigust ning firma loomisest. Töökogemus, õppimine, usk iseendasse ja teistesse on need, mis aitasid realiseerida oma firma loomise ning tuua ettevõte tühjale turule. Lisa: Kuidas firma arenes

  20. Voz do cantor lírico e coordenação motora: uma intervenção baseada em Piret e Béziers Lyric singer voice and motor coordination: an intervention based on Piret and Béziers

    Directory of Open Access Journals (Sweden)

    Enio Lopes Mello

    2009-01-01

    Full Text Available OBJETIVO: Investigar os efeitos da aplicação de um Programa de Desenvolvimento da Coordenação Motora, baseado em Piret e Béziers, na voz do cantor lírico. MÉTODOS: Cinco cantores líricos profissionais executaram uma ária de ópera, de livre escolha, que foi filmada. Em seguida responderam a uma questão sobre a propriocepção ao cantar. Durante um mês submeteram-se ao Programa de Desenvolvimento da Coordenação Motora e ao final gravaram novamente a mesma ária e responderam a mesma questão. As filmagens foram enviadas para nove juizes profissionais (três fonoaudiólogos, três fisioterapeutas e três professores de canto que avaliaram a integração corpo e voz dos cantores por meio de análise perceptivo-auditiva e visual. Os cantores, após assistirem às duas filmagens, fizeram outra auto-avaliação. RESULTADOS: Na avaliação dos juízes: as duas sopranos, a mezzo-soprano e o baixo melhoraram a projeção da voz; o tenor melhorou a ressonância e o baixo melhorou também a respiração; com exceção do baixo todos ficaram com os gestos mais livres. Segundo relato dos cantores, os exercícios garantiram maior percepção da tensão muscular durante o canto e isso possibilitou melhor controle dos gestos. CONCLUSÃO: De acordo com a avaliação subjetiva os ajustes posturais, oriundos da execução dos exercícios da coordenação motora, provavelmente garantiram abertura da caixa torácica e melhoraram as condições da respiração dos cantores, durante o canto; este fato pode ter favorecido a verticalização da ressonância e a projeção da voz.PURPOSE: To investigate the effects of the application of a Motor Coordination Development Program, based on Piret and Béziers, on the voice of lyric singers. METHODS: Five professional lyric singers performed an opera aria of their choice, which was filmed. Next, they answered a question regarding their proprioception when singing. They were submitted to the Motor Coordination

  1. DVD. Piret Tamm soovitab : "Mootorrattapäevikud" / Piret Tamm

    Index Scriptorium Estoniae

    Tamm, Piret, 1966-

    2006-01-01

    Mängufilm Che Guevarast "Mootorratta päevikud" ("Diarios de motocicleta") : režissöör Walter Salles : Ameerika Ühendriigid - Saksamaa - Suurbritannia - Argentiina - Tšiili - Peruu 2004. Kriitikat ka firma V&K Holding DVD kvaliteedi kohta

  2. Soome, soojade soovitustega / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Soome disainiga tutvumise võimalustest Helsingis. Uudiseid soome tootedisaini alalt: uued kangad Marimekkole kujundas Erja Hirvi, tekstiilikunstnik Ritva Puotila rajatud Woodnotes valmistab pabernöörist tooteid, Harri Koskineni k Chair pälvis auhinna 2004. a. Kölni messil, Anna Katariina Tilli ja Mari Relanderi klaaslauast, Mikko Paakkaneni toolist Nietos, Alfredo Häberli lasteasjadest Kid's Stuff Iittalale

  3. IBBY kongressist Londonis / Piret Raud

    Index Scriptorium Estoniae

    Raud, Piret, 1971-

    2012-01-01

    Rahvusvahelisest Noorsookirjanduse Nõukogu kongressist Londonis, mis kandis pealkirja "Ületades piire: tõlked ja ränded". Kongressil anti üle ka Hans Christian Anderseni auhinnad. Kirjanikupreemia sai María Teresa Andruetto ja parima illustraatori tiitli Peter Sís.

  4. Literature awards 1999 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2000-01-01

    Riigi kultuuripreemia - Jaan (Johnny B.) Isotamm. Eesti Kultuurkapitali peaauhind ka Ilmar Talvele. B. Alveri kirjandusauhind - Kalju Kruusa. A. H. Tammsaare preemia - Maimu Berg. F. Tuglase novelliauhind - Mehis Heinsaar ja Andres Vanapa. Kirjanduse aastapreemia : Proosa: Jaan Kaplinski, Mari Saat; Luulepreemia jäi välja andmata; Lastekirjandus: Ellen Niit; Esseistika: Mihkel Mutt; Näitekirjandus: Jaan Undusk; Tõlked: Paul-Eerik Rummo, Elviira Mihhailova ja Svetlan Semenenko.

  5. Literary awards 2001 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2002-01-01

    Riigi kultuuripreemia - Ain Kaalep (elutööpreemia) ; Haljand Udam (artiklikogu "Orienditeekond") ; Mati Unt (lavastuste eest Vanemuises, Eesti Draamateatris ja Rakvere Teatris). Eesti Kultuurkapitali aastapreemia - Ene Mihkelson (romaan "Ahasveeruse uni"). Kultuurkapitali kirjanduse aastapreemiad: proosa - Mehis Heinsaar ("Härra Pauli kroonikad"), luule - Hasso Krull ("Kornukoopia"), esseistika - Jaan Puhvel ("Ulgvel ja umbes"), näitekirjandus - Jaan Kruusvall (näidend "Hullumeelne professor" kogumikust "Olen öösse eksind karjus"), lastekirjandus - Aino Pervik (Paula-sari), tõlge eesti keelde - Udo Uibo, tõlge eesti keelest - Guntars Godinsh, artiklipreemia - Toomas Haug, venekeelsete autorite kirjandusauhind - Larissa Vanejeva ("Liki"). B. Alveri kirjandusauhind - Mehis Heinsaar (jutukogu "Vanameeste näppaja"). F. Tuglase novelliauhind - Mehis Heinsaar ("Ilus Armin") ja Mats Traat ("Kohtupeegel")

  6. Literary awards 2003 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2004-01-01

    Riigi kultuuripreemia - Vello Salo (elutööpreemia) ; Eesti Kultuurkapitali aastapreemia - Toomas Liiv ("Luuletused 1968-2002") ; Kultuurkapitali kirjanduse aastapreemiad: proosa - Nikolai Baturin ("Kentaur"), luule - Asko Künnap ("Ja sisalikud vastasid (kolmes kirjas)"), esseistika - Toomas Raudam ("Teie"), näitekirjandus - Mati Unt ("Vend Antigone, ema Oidipus", "Stiil, ehk, Mis on maailma nimi", "Kärbeste saar"), lastekirjandus - Katrin Reimus ("Haldjatants"), tõlge eesti keelde - Jaak Rähesoo (J. Joyce'i "Kunstniku noorpõlve portree" ja "Pagulaste" tõlked), tõlge eesti keelest - Eric Dickens (J. Krossi "Paigallennu" tõlge), artiklipreemia - Arne Merilai (järelsõna antoloogiale "Eesti ballaad"), venekeelsete autorite kirjandusauhind - Marina Tervonen (luulekogu "Ületamine") ; B. Alveri kirjandusauhind - Erkki Luuk ("Ornitoloogi pealehakkamine") ; F. Tuglase novelliauhind - Lauri Pilter ("Teisik"), Ilmar Jaks (novell "Armer Adolf" ja novellikogu "Pimedus") ; A. H. Tammsaare nim. kirjanduspreemia - Rein Veidemann ("Lastekodu") ; E. Vilde nim. kirjandusauhind - Eeva Park ("Lõks lõpmatuses") ; Nukitsa auhind - Janno Põldma ja Heiki Ernits ("Lepatriinude jõulud") ; K. E. Söödi nim. lasteluulepreemia - Jaanus Vaiksoo (luulekogu "Kellassepaproua") ; Eesti Raudtee ja Sirbi kirjandusauhind - Andres Vanapa ("Päti vile") ja Kristiina Ehin ("Simunapäev")

  7. Virmaliste valge kuma / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Kirsi ja Marko Ekströmi valge modernne ridaelamukorter (73 mø) Helsingis. Köögimööbel valmistati Eesti firmas Idema, projekti autor Peep Savason. Idemas tehti ka tualettruumi sisustus. K. Ekströmi kommentaarid. 13 ill

  8. Bisazza uued disainmustrid / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Sise- ja välistingimustesse sobiva klaasmosaiigi valmistaja Bisazza esitles Bologna messil Cersaie nelja disaineri - Marco Braga, Carlo Dal Bianco, Terri Pecora ja Marcel Wandersi 2005. aastaks loodud uusi mustreid. 4 ill

  9. Draamaviisik anno 2004 / Piret Kruuspere

    Index Scriptorium Estoniae

    Kruuspere, Piret, 1961-

    2005-01-01

    2004. a. pärjatuks peetavate eelvalikusse on jõudnud viie mehe - U. Lennuki, U. Vadi, M. Kivastiku, M. Muti ja M. Kõivu näidendid : "Boob teab", "Kohtume trompetis", "Külmetava kunstniku portree", "Kõik roosid ma kingiksin" ja "Finis nihili"

  10. Dekooridiiva Tricia Guild / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Briti tekstiilikunstniku Tricia Guildi viimasest kollektsioonist, kus vastanduvad suureõielised ja triibulised mustrid, tema poolt avaldatud raamatuid. Tricia Guild juhib sisustuskangaid, tapeete ja mööblit tootvat firmat Designer's Guild. 5 ill

  11. Valimisaktiivsus viib sihile / Piret Hartman

    Index Scriptorium Estoniae

    Hartman, Piret

    2002-01-01

    Sotsiaalhoolekande seadusesse on sisse viidud muudatused, millest tulenevalt arvestatakse abiraha saamisel tudengid vanematega ühte leibkonda. Antud tingimuse tõttu kaob pea 10000 üliõpilasel võimalus majanduslikku abi saada

  12. Kolm maja Davosis / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    1997-01-01

    Šveitsi arhitektuuris järjepidevale modernismi traditsioonile toetuvast arhitektidepaarist Annette Gigonist (1959, Šveits) ja Mike Guyerist (1958, USA, Ohio osariik). Lõpetanud Zürichi arhitektuurikooli ETH, omavad 1989. aastast ühist bürood Zürichis. Gigoni ja Guyeri loomingust. Nende projekteeritud E. L. Kirchneri muuseumist (projekt 1989, ehitatud 1991-92), "Vinikuse" restoranist ja veinikeldrist (projekt 1991, ehitatud 1992) ning spordihoonest (ehitatud 1996) Davosis

  13. Maailma turism 2006 / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2007-01-01

    2006. aastal tehti kogu maailmas 842 miljonit ööbimisega välisreisi, mis on 4,5 protsenti enam kui 2005. aastal. Maailma turismitrendid 2006-2007, prognoos 2007. aastaks. Euroopa turismi arengust 2006. aastal. Allikas: UNWTO World Tourism Barometer, jaan. 2007

  14. Literary awards 2002 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2003-01-01

    Riigi kultuuripreemia - Hando Runnel (elutööpreemia) ; Balti Assamblee kirjandusauhind - Jaan Tätte ("Sild" ja "Palju õnne argipäevaks") ; A. H. Tammsaare nim. romaaniauhind - Andrus Kivirähk ("Rehepapp") ; Eesti Kultuurkapitali aastapreemia - Aleksander Suuman ("Tondihobu tõugud vetikatega") ; Kultuurkapitali kirjanduse aastapreemiad: proosa - Jüri Ehlvest ("Hobune eikusagilt"), luule - Karl Martin Sinijärv ("Artutart & 39"), esseistika - Peeter Mudist ("Ratsukäik"), näitekirjandus - Vaino Vahing ("Mängud ja kõnelused"), lastekirjandus - Heino Kiik ("Kuresaapad"), tõlge eesti keelde - Mati Sirkel (Franz Kafka "Hiina müüri ehitamisel" tõlge), tõlge eesti keelest - Antoine Chalvin (Jaan Kaplinski "Le désir de la pousicre" tõlge), artiklipreemia - Tõnu Õnnepalu ("Kui... Küpsemine. Aleksander Suumani kaks luuletust ja üks raamat ("Meil siin Hüperboreas")", ilmus Loomingus, nr. 5-6), venekeelsete autorite kirjandusauhind - Mihhail Veller (viimase 10 aasta proosaloomingu eest) ; B. Alveri kirjandusauhind - Leo Kunnas ("Sõdurjumala teener") ja Ülar Ploom ("Üks ja kogu"); 2002. a. romaanivõistluse võitja - Nikolai Baturin ("Kentaur") ; A. H. Tammsaare nim. kirjanduspreemia - Elem Treier ("Tammsaare elu härra Hansenina") ; E. Vilde nim. kirjandusauhind - Doris Kareva ("Mandragora") ; F. Tuglase novelliauhind - Jüri Ehlvest ("Hobune eikusagilt", Looming, 2002, nr. 1) ja Jaan Undusk ("Armastus raamatu vastu", ilmus kogumikus "Puudutus"); Juhan Liivi luuleauhind - Andres Ehin (luuletus "sügaval maa all elavad...", Looming, 2002, nr. 4)

  15. AABS-i konverents Washingtonis / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2006-01-01

    20. Balti uuringute konverentsist George Washingtoni Ülikoolis 15.-17.6.2006, teemaks "Balti regiooni taaskujundamine: mineviku-, oleviku- ja tulevikuperspektiivid". Teiste hulgas pidasid ettekande ka Ilse Lehiste lingvistikast, Kristin Kuutma etnilisest identiteedist ning Toivo Raun ja Jüri Kivimäe ajaloost

  16. Pop on alati pop / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2005-01-01

    Ingridi avatud köögi ja rõduga pop-stiilis 2-toaline korter uuselamus Tallinnas. Sisekujundaja Annela Anger, valgustid konstrueeris Tarmo Luisk. Magamistoas on seinal Epp-Maria Kokamäe maal. Ingridi vastused 15 küsimusele. Ill.: korteri plaan, 9 vaadet

  17. Minimalismist nostalgiaga / Varje Talivee, Piret Veigel

    Index Scriptorium Estoniae

    Talivee, Varje

    2004-01-01

    Heledate seintega avaras ruumis on värvitud üks sein šokolaadipruuniks, seinale on tõmmatud lai hele triip efektvärviga. Toas on kirju eebenipuu-spooniga laud, punasest siidist lühter, põrandal pärsia vaip jm. 12 ill

  18. Reliikvia 33 aastat hiljem / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2002-01-01

    Soomes restaureeritud eesti menufilmi "Viimne reliikvia" (1969) taas Eestis ekraanile jõudmise eel korraldatud pressikonverentsilt Coca-Cola Plazas, kus kohal filmis osalenud näitlejad Ingrida Andrina, Aleksandr Goloborodko, Eve Kivi ja Uldis Vazdik, stsenarist Arvo Valton ja kunstnik Rein Raamat

  19. Pangad koorivad kaks nahka / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 21. mai lk. 10. Kohustusliku pensionisamba kliendid maksavad pankadele topelt teenustasusid, sest mitu panka investeerivad pensionifondide vara iseenda teistesse fondidesse. Vt. samas: Kolme suurema panga investeeringud oma fondidesse; Kuidas kujuneb topelttasu; Hansa ja SEB klientide arvult pikalt ees. Kommenteerivad Mihkel Oja ja Aku Sorainen. Vastuseks vt. ka Sven Kunsingi art. 21. mai lk. 26

  20. Põhimõttekindel kodu / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2011-01-01

    Merle Kauberi korterist Tehnika tänaval, kus kogu sisustus ja planeering on lähtunud feng shui põhimõtetest ning mis pälvis konkursil "Kodu Kauniks 2010" finalistidiplomi. Lk. 31-33 feng shui lähtepunktidest ja ba qua tsoonidest. Sisekujundajaks oli Kristiina Eljand ja feng shui eksperdiks Janno Seeder

  1. Tunnetest tulvil linna-aed / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2011-01-01

    Baltisaksa arhitekt Erwin Bernhardi 20. sajandi esimestel aastatel projekteeritud puitpitsiline maja Tallinnas Allika t. 8. Majaga ühtse terviku moodustavast linnaaiast, mille Ivika Keik ja Alar Pikkorainen lõid feng-shui põhimõtete järgi võssakasvanud läbikäiguhoovist ja mis pälvis konkursil "Kodu Kauniks 2010" finalistipreemia

  2. Esmalt saab raha Gildi fond / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2009-01-01

    Gild Arbitrage on Bulgaaria kinnisvaraprojektidesse investeerinud üle 100 miljoni krooni investorite ja võlausaldajate raha, kuid sealsete projektide realiseerimisel saab esimesena raha tagasi Gildi enda kinnisvarafond EEREIF

  3. Puitarhitektuur ja puit arhitektuuris / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    1999-01-01

    Näitus "Eesti puitarhitektuur" Rotermanni soolalaos 12. septembrini. Koostajad Karin Hallas (stiiliajalugu) ja Epi Tohvri (väikelinnad). Kujundaja Ralf Tamm. Puitarhitektuuri säilitamisest Tallinnas ja väikelinnades. Puidu arhitektuuris kasutamise näide ئ 1998. a. valminud Linnamäe kool Läänemaal (arhitekt Tiit Trummal).

  4. Õitsev suvetuba / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2003-01-01

    Haapsalu lähistel talumaja ärklikorrusel asuva käsitööõpetaja Villu Baumanni suvekodust, mis 2001. a. pälvis võistlusel "Kodu kauniks" I eripreemia. Suvetuba on sisustatud 70-ndate stiilis, kontrastses musta-kollase-valge kombinatsioonis. 8 ill

  5. Ester Tuiksoo / Ester Tuiksoo ; interv. Piret Tali

    Index Scriptorium Estoniae

    Tuiksoo, Ester, 1965-

    2007-01-01

    Juhan Partsi valitsuse (05.04.2004-13.04.2005) ja Andrus Ansipi valitsuse (13.04.2005-) põllumajandusminister Ester Tuiksoo oma lapsepõlvest ja elukutsevalikust, poliitilise karjääri algusest ja erakonna valikust, ministritöö kogemustest, naistest poliitikas

  6. Hoolekandeasutustele ei sobi reorganiseerimiskava / Piret Hartman

    Index Scriptorium Estoniae

    Hartman, Piret

    2005-01-01

    Ilmunud ka Põhjarannik 23. märts lk. 2, Severnoje Poberezhje 23. märts lk. 2, Meie Maa 7. apr, lk. 2, Nädaline 7. apr. lk. 5, Teataja : Eestimaa Rahvaliidu Ajaleht Apr nr. 4 lk. 3. Riigikogu Rahvaliidu fraktsiooni nõunik sotsiaalfoorumist, kus osalesid hoolekandeasutuste ja kohalike omavalitsuste esindajad, Eesti Maaomavalitsuste Liidu juhatuse liikmed ning Riigikogu liikmed

  7. Veebi kasv edestab lehti / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Samal ajal, kui USA meediafirmad kurdavad tulu vähenemise üle, kasvas otsingumootori Google esimese kvartali kasum ligi 70%. Interneti-meedia käive kasvab jõudsalt ka Eestis. Vt. samas: Eesti veebi käibed kosuvad

  8. Peeter Paani peidupaik / Peter Broeng, Piret Veigel

    Index Scriptorium Estoniae

    Broeng, Peter

    2005-01-01

    Shabby chic stiilis sisustatud norra kunstniku ja stilisti Tor Halvorseni Bjornslokkeni talust, kus T. Halvorsen korraldab isiksust ja loovust arendavaid seminare. Elamuks on ümberehitatud ait. Looduslike viimistlusmaterjalide kõrval näeb barokseid küünlajalgu, siidkangaid, modernse joonega disainiklassikat. 12 värv. ill

  9. Kultuurkapitali arhitektuuri sihtkapitali aastapreemiad 2002 / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Aastapreemia: Eesti arhitektuuripoliitika töögrupp (13 nime), objektipreemia: Jüri Okas (Mardi talu), sisekujunduspreemia: Tiiu Truus (Neiseri kontor), restaureerimispreemia: Juta Lember (EV Presidendi Kantselei esindusruumid), urbanistikapreemia: Villem Tomiste, tegevuspreemia: Jüri Kermik ("A. M. Luther 1877-1940"), Andres Kurg ja Mari Laanemets ("Tallinna juht").

  10. Majandusõpetus algkoolis / Piret Põldre

    Index Scriptorium Estoniae

    Põldre, Piret

    1998-01-01

    Artiklis käsitletakse Eesti õpilastele väljatöötatud majandusõpetuse programmi, mis toetub Junior Achievementi algkooliastmele suunatud õppeprogrammi K-6 põhimõtetele. Ülevaade õpetajate ja õpilaste tagasisidest programmi kahe esimese teema edukuse kohta ning kokkuvõte võrdlevast uurimusest, mis viidi läbi algkooli majandusõpetuse programmi järgi õppinud klasside ja kontrollklasside vahel

  11. Maailma turism 2005. aastal / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2006-01-01

    Maailma Turismiorganisatsiooni andmetel kasvas maailma turism 2005. aastal 5,5 protsenti. Prognoos 2006.aastaks. Allikas: UNWTO World Tourism Barometer, jaanuar 2006. Tabel: Ööbimisega välisreisid kogu maailmas, 2003-2005

  12. Arengud maailma turismis 2003 / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2004-01-01

    2003. aasta statistilised andmed turismi ja reisimise kohta. Tabelid: Ööbimisega reisid maailmas regiooniti, 1990-2003; Väliskülastajate saabumised Eestisse, 1996-2003; Väliskülastajate saabumised Eestisse transpordiliikide lõikes, 2001-2003; Eesti majandusettevõtetes majutatud turistid ja nende ööbimised, 2001-2003

  13. Eramu Nõmmel = House in Nõmme / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Vabaduse puiesteel 2000. a. valminud eramu projekteeris arhitekt Jaan Ollik. Kujunduskonsultant Tiit Jürna kavandas CD-riiulid, lauad jm. Lihtsa musta maja väljapaistvaim osa on läbi kahe korruse ulatuv klaasist raamatukogu. 7 ill.: plaanid, vaated

  14. Disainijuhtimise "Oscari" võitjad / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret

    2011-01-01

    23. septembril kuulutati Kumu Kunstimuuseumis välja Design Management Awardi (DME) võitjad. Auhinna pälvisid Türgi firma Vestel, Hispaania firmad Lékué ja Nanimarquina. Eesti meediaettevõte Velvet Creative Alliance pälvis aukirja märkimisväärsete saavutuste eest

  15. Sadolini värvid / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    11. III korraldas Akzo Nobel Taagepera lossis arhitektide õppepäeva. Esinesid Leonhard Lapin ja Rootsi esteetikakeskuse juht Per Nimer, kes tutvustas esteetikakeskuse värvusspetsialistide poolt 2003. a. väljatöötatud trendikaid värvikombinatsioone

  16. DVD. Piret Tamm soovitab : "Rütm kisub kaasa" / Piret Tamm

    Index Scriptorium Estoniae

    Tamm, Piret, 1966-

    2007-01-01

    Mängufilm "Rütm kisub kaasa" ("Take the Lead") : režissöör Liz Friedlander : peaosas Antonio Banderas : Ameerika Ühendriigid 2006. Film põhineb tantsuõpetaja Pierre Dulaine'i tantsuteraapia tegevusel

  17. Natural widths of atomic K and L levels, Kα X-ray lines and several KLL Auger lines

    International Nuclear Information System (INIS)

    Krause, M.O.; Oliver, J.H.

    1979-01-01

    Semi-empirical values of the natural widths of K, L 1 , L 2 , and L 3 levels, Kα 1 and Kα 2 x-ray lines, and KL 1 L 1 , KL 1 L 2 and KL 2 L 3 Auger lines for the elements 10 1 ,L 2 , L 3 ) is obtained from the relation GAMMA/sub i/=GAMMA/sub R/,i/ω/sub i/, using the theoretical radiative rate GAMMA/sub R/,i from Scofield's relativistic, relaxed Hartree-Fock calculation and the fluorescence yield ω/sub i/ from Krause's evaluation. X-ray and Auger lines widths are calculated as the sums of pertinent level widths. This tabulation of natural level and line widths is internally consistent, and is compatible with all relevant experimental and theoretical information. Present semi-empirical widths, especially those of Kα 1 and Kα 2 x-rays, are compared with measured widths. Uncertainties of semi-empirical values are estimated

  18. Rocca al Mare kool = Rocca al Mare School / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2000-01-01

    Projekteerija Arhitektuuribüroo Urbel ja Peil. Arhitektid Emil Urbel, Indrek Erm, sisekujundaja Taso Mähar. Peatöövõtt: KMG Ehitus AS. Projekt 1999, hoone valmis 2000. 23 ill. Asendiplaan, korruste plaanid, pikilõiked, sise- ja välisvaated

  19. 20 miljoni eest põnevust / Piret Tibbo-Hudgins

    Index Scriptorium Estoniae

    Tibbo-Hudgins, Piret

    2009-01-01

    Produtsent Eesti-Saksa-Soome-Iirimaa koostööfilmist "Vasha", kus osalevad Eesti näitlejad ning filmitegijad Saksamaalt, Soomest ja Iirimaalt. Filmi režissöör on Hannu Salonen, peategelased Mart Müürisepp ja Mehmet Kurtulus

  20. Briti hotell Dunkri tänavas / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2005-01-01

    Liisi Murula ja Raili Nõlvaku kujundatud hotell Merchants House, restoran KN Cayenne, baar Ice Bar ja kohvik Cafe Time Tallinnas. Kasutatud ka tekstiilikunstnik Ülle Raadiku ja klaasikunstnik Rait Partsi töid. Valgustite autor ehtekunstnik Katrin Sipelgas

  1. Segadus ravimite hinna ümber / Piret Sell

    Index Scriptorium Estoniae

    Sell, Piret

    2005-01-01

    Oma vastulauses 12. detsembri Eesti Päevalehes ilmunud Kai Kalamehe artiklile "Mitmete ravimite hind tõuseb" selgitab autor ravimite hinnatõusu ning seda, miks on originaalravimid kallimad kui koopiaravimid

  2. Alfredo Häberli ja Iittala : Senta / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Jaanuaris Pariisi messil Maison & Objet aasta disaineriks kuulutatud Alfredo Häberli esitles veebruaris Frankfurdi messil Ambiente oma neljandat ühisprojekti Soome Iittalaga: Senta-nimelisi valge, punase ja vahuveini klaase

  3. Isiksus ja täppisteaduslik tulemus / Piret Kuusk

    Index Scriptorium Estoniae

    Kuusk, Piret, 1947-

    1998-01-01

    Matemaatika keele kasutamine füüsika eri harudes ei ole tulemuselt alati loogilis-ratsionaalne, vaid sõltub ka kasutaja isiklikest hoiakutest. Filosoofiaseminar "Teadus, pseudoteadus, ebateadus" (29.02. - 2.03.1996.a. Võrumaal Kütiorus).

  4. Eesti ettevõtteid dollar ei heiduta / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Kuigi dollar on aastate jooksul läbi teinud tugeva languse, on Eesti ettevõtted USA turu suhtes optimistlikud ning kasvatavad ka ekspordimahtusid. Kommenteerivad Ülo Kaasik ja Hardo Pajula. Diagramm: Euro on eelmise aasta oktoobrist sammhaaval dollari suhtes tugevnenud. Vt. samas: Kertu Ruus. USA ettevõtja näeb dollarit kui äri

  5. Swedbank ei pikenda Rumeenia fondi võlakirju / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2010-01-01

    Swedbank ei pikendanud IPC Investment Groupi poolt hallatava Rumeenia kinnisvarafondi Nord Hill Land Portfolio tähtaega ning fond peab vara müüki panema. IPC Investment Groupi omanikud on Indrek Elhi ja rumeenlane Ciprian Lopata

  6. Riigi eelarvepoliitika peab olema neutraalne / Joaquin Almunia ; interv. Piret Reiljan

    Index Scriptorium Estoniae

    Almunia, Joaquin, 1948-

    2008-01-01

    Euroopa Komisjoni rahandusvoliniku Joaquin Almunia sõnul peaks Eesti vältima järeleandmisi eelarvepoliitikas, samuti tuleks prioriteediks seada investeeringud, mis toetavad majanduskasvu ning kasutada ära maksimaalselt Euroopa Liidu struktuurifonde

  7. Kaubamaja Lemon : Estonia pst. 1/3, Tallinn / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2003-01-01

    1953. a. projekteeritud ja 1958. a. valminud Eesti Energia peahoone (arhitektid P. Tarvas, U. Tölpus) ümberehitus Lemoni kaubamajaks (arhitekt Martin Aunin). 3.-5. korrusel paiknevad büroopinnad. Fassaadi täienduseks on projekteeritud mettallkonstruktsioonil punktkinnitusega eenduv klaasvitriin. 4 välis- ja 3 sisevaadet

  8. Raha ja maa asemel uurimine ning pankrot / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2010-01-01

    Aserbaidžaani kinnisvaraprojekti investeerinud ärimehed kahtlustavad Tõnis Haavelit investeerimiskelmuses, ärimehed esitasid projektiks võlakirju emiteerinud Seaside Residence Baku vastu pankrotiavalduse

  9. GDA sinu abimees pakendil / Piret Jaaks ; kommenteerinud Elena Burm

    Index Scriptorium Estoniae

    Jaaks, Piret, 1980-

    2010-01-01

    Euroopa Komisjoni kokku kutsutud toitumisteadlaste komisjoni Eurodiet poolt koostatud GDA toitumisjuhist toiduainepakenditel, mis aitab jälgida toote- või joogiportsjoni osatähtsust päevasest soovitatavast kalorite ning olulisemate toitainete kogusest

  10. Luubi all : www.lilly.com / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret

    2009-01-01

    Ravimifirma Eli Lilly & Company kogemusi, kuidas uusimate teadusuuringute tulemusi ravimitööstuses kasutades on võimalik arendada jätkusuutlikku tootmist ning laiendada tooteportfelli koostöövõrgustiku kujundamise teel

  11. Vanast heast kaadriosakonna juhatajast moodsas firmas ei piisa / Piret Põldre

    Index Scriptorium Estoniae

    Põldre, Piret

    2004-01-01

    Personalijuhid peavad olema võimelised esitama oma seisukoha selle kohta, kuidas ettevõte võiks saavutada oma ärilisi eesmärke, ning võtma koos teiste juhtidega vastutuse ettevõtte tuleviku eest, ütleb autor

  12. Selgelt sõnastatud ootused aitavad suurendada tulemuslikkust / Piret Laur

    Index Scriptorium Estoniae

    Laur, Piret

    2006-01-01

    KPMG-s on jõutud äratundmisele, et töötaja lojaalsuse võitmiseks peab sõnastama ootused töökohal nõutud käitumisele ning andma selle kohta tagasisidet. Kommenteerib Andris Jegers. Vt. samas: Dialoog juhib tulemuseni

  13. Londoni ja Küprose kaudu Eesti turuliidriks / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Eestis registreeritud Vene kapitaliga investeerimisühing KIT Finance Europe peakontor asub Tallinnas, kuid äri ajab hoopis Londonis ja Küprosel. Vt. samas: KIT Finance Europe; Kontor kuninganna endises magamistoas. Diagrammid: Investeerimisühingute turuosad Eestis; Eesti investeerimisühingute kasum

  14. Jens Haug keelab oma lastel majandust õppida / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2006-01-01

    Endine ärimees Jens Haug õpib ülikoolis semiootikat ja töötab majandus- ja kommunikatsiooniministeeriumis kriisireguleerimise osakonnas. Vt. samas: Kolleeg hindab Jens Haugi teravat mõistust; Karjäär

  15. USA väärtus orkaanis / Piret Loone

    Index Scriptorium Estoniae

    Loone, Piret

    2005-01-01

    Seoses New Orleansi tabanud orkaan Katrina katastroofiga süüdistab autor president Bushi riigi halvas ettevalmistamises olukorraga toime tulemiseks. Autor peab föderaalse hädaolukordade agentuuri juhti Michael Browni ebakompetentseks oma ametikohale, viidates ka president Bushi ja Michael Browni omavahelisele seotusele

  16. Regional information portal - www.peipsi.org / Piret Uus

    Index Scriptorium Estoniae

    Uus, Piret

    2004-01-01

    Piirkondlik infoportaal - www.peipsi.org - pakub mitmekülgset teavet Peipsi Koostöö Keskuse tegevuse, projektide, teadusuuringute tulemuste, aruannete kohta, samuti on kättesaadav info Peipsi järve keskkonnaseisundist, ajaloost, kultuurist, geograafiast jne

  17. Maailma turismi kasv on veidi aeglustumas / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2008-01-01

    Eesti ja maailma turism 2008. aasta I poolaastal. Kui perioodil 2004-2007 kasvas maailma turism keskmiselt 7% aastas, siis 2008. aastaks prognoosib UNWTO kasvu aeglustumist, eeldatav kasv on 3-4%. 2008. a. I poolaastal ööbis Eesti majutusettevõtetes 628 787 välisturisti, mis on 5% enam kui 2007. a. I poolaastal, ning 431 685 siseturisti, mis on 1,8% rohkem kui mullu samal perioodil. Tabel: Eesti majutusettevõtetes majutatud turistid elukohariikide lõikes, I poolaasta 2004-2008. Diagrammid: Sise- ja välisturistide ööbimised Eesti majutusettevõtetes. I poolaaasta; Siseturistide ööbimised Eesti majutusettevõtetes.

  18. Kõige eest siin elus tuleb maksta / Piret Hartman

    Index Scriptorium Estoniae

    Hartman, Piret

    2006-01-01

    ERL-i fraktsiooni nõunik käsitleb rahvastikuteadlase Kalev Katuse loengut Eesti rahvastikuarengust Euroopa kontekstis. Rahvastiku juurdekasv tuleb seada kõigis valdkondades esmatähtsaks, vaja on terviklikku toetussüsteemi kuni lapse täiskasvanuks saamiseni

  19. Rahvusvaheline erialabibliograafia sündis Eestis / Piret Voolaid

    Index Scriptorium Estoniae

    Voolaid, Piret, 1971-

    2005-01-01

    Rets. rmt.: Internationale volkskundliche Bibliographie = International Folklore Bibliographie = Bibliographie internationale d'Ethnologie: Für das Jahr 1993 : mit Nachträgen für die vorausgehenden / herausgegeben von Karin Maria Rooleid. Bonn : Dr. Rudolf Habelt GMBH, 2004

  20. Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill

  1. Salzburgis heliseva muusika jälgedes / Piret Mae

    Index Scriptorium Estoniae

    Mae, Piret

    2004-01-01

    1965.a. esilinastus film "Helisev muusika" : režissöör Robert Wise : Ameerika Ühendriigid. Filmi aluseks olnud Margaretha von Trappi eluloost, filmivõtetest, mis sai filmis osalenud näitlejatest edasi

  2. Ostame maja! / Kersti Pikk, Aet Piel, Piret Tali

    Index Scriptorium Estoniae

    Pikk, Kersti

    2007-01-01

    Võrreldakse kolme eramut - Pirital, Viimsis (Arhitektuuriagentuur OÜ - arhitektid Inga Raukas, Toomas Tammis, Karli Luik ja Renee Puusepp) ja Harku vallas Vatslas. Lk. Oberhausi kinnisvaraspetsialisti Ene Arro kommentaar

  3. Huvi Eesti kui puhkusesihtkoha vastu Hollandi elanikkonna hulgas / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2011-01-01

    EASi tellimusel 2011. aasta veebruaris Hollandi uuringufirma Right Marktonderzoek en Advies B. V korraldusel toimunud 18-74-aastaste Hollandi elanike online-arvamusuuringust Eestist kui puhkusesihtkohast

  4. Sajandilõpu noori autoreid : Kruoganist Urduni / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    1999-01-01

    Arvustus: Kruogan / koost. Hedda Maurer. Tallinn : Vares, 1998 ; Hea raamat / NAK ; toim. Indrek Särg. Tartu : Eesti Kostabi Selts, 1998 ; Harakkiri. Tallinn : Erakkond, 1999 ; Urdu : [kirjanduslik kogumik]. Rewal, 1999

  5. EMT kasvatab rate.ee-ga uusi kliente / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Suhtlusportaal rate.ee on olnud EMT jaoks edukas projekt ning ettevõtte juht Valdo Kalm peab tõstatatud eetikaküsimusi ebaõiglaselt esitatuks, sest rate.ee on tema sõnul teiste veebikanalitega võrreldes üks filtreeritumaid. Vt. samas: Mis on rate.ee; EMT loodud rate-mobiili teenused ja hinnakiri

  6. Tallinna suveniirivõistluse esikoha noppis nahast raamat / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2005-01-01

    Tallinna iseloomustava suveniiri leidmiseks korraldatud konkursist. Esikoha võitis nahakunstnike Alain ja Evgenya Auna nahkkaantega raeraamat vildist vutlaris. Teise koha sai disainer Leonardo Meigase Pühavaimu kiriku kella numbrilaua kujutisega kell. Teisi paremaid suveniiriloojaid. Tunnustatud suveniiride näitus juulis Tallinna turismiinfopunktis

  7. Sisustust Viru tänavalt / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2003-01-01

    Tallinnas Viru t. avatud uues sisustussalongis Rest Art pakutavast. Kaupluse esimene osa on pühendatud elutoale, tagumine ruum on sisustatud magamistoana. Pakutavad kodutekstiilid on kujundanud Külli Salum

  8. Linnakeskkond peab olema sõbralik / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret

    2011-01-01

    Eesti Disainerite Liidu 2010. a. algatatud elukeskkonna parandamisele suunatud projektist "Cities For All - Tallinn For All", mille lõpptulemusi näeb Euroopa innovatsioonifestivali IF... ja Disainiöö raames Rotermanni kaubamajas 16.-25. sept.-ni avatud näitusel. Koostöös Tallinn Fashion Week'iga Rotermanni kvartalis 16. sept.-l avatavast näitusest "Fashion Empowerment", inimese eripära arvestavast moeprojektist

  9. Börsifirma vajunud käpuli / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Kinnisvarafirma Q Vara maksuvõlg on kasvanud 7,3 miljoni kroonini. Diagrammid. Vt. samas: Audiitor noomis Q Vara; Q Vara võlausaldajatele pinnuks silmas; Q Varale üle 100 mln laenanud pank vaikib; Lillepea: Terminali tehingu rikkus Äripäev; Tasub teada

  10. Q Vara võlakirjainvestorid saavad kergemalt hingata / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Kinnisvarakontsern Q Vara müüs omakapitali probleemide lahendamiseks Terminali laopargi ning teine suurtehing Riia kesklinnas on samuti lõpusirgel. Küsimustele vastab Q Vara omanik ja nõukogu liige Alo Lillepea. Vt. samas: Omanikud. Diagramm: Omakapital, kohustused

  11. Hakkaks maja värvima / Piret Meier

    Index Scriptorium Estoniae

    Meier, Piret, 1962-

    2004-01-01

    Ehitushoolde spetsialist Lea Täheväli-Stroh majade välimusest ja värvilahenduse valikutest. Lisaks Mirjam Peili kommentaar küsimusele, miks on Eestis saanud moeks värvida maamajad nn. Rootsi punaseks.

  12. Milano rohelised võrsed / Piret Veigel, Varje Talivee

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2005-01-01

    13.-19. IV 2005 toimunud Milano mööblimessist. Noorte talentide konkursil Design Report Award 2005 võitis peapreemia jaapani büroo Yoneya, Kimizuka & Masuko valgusskulptuur Shadow Game. 20 värv. ill

  13. SDE võttis vastu valimisprogrammi / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Peeter Kreitzbergi sõnul on sotsiaaldemokraatidele oluline võitlus korruptsiooni, sundparteistamise ja raha võimuga. SDE esimees Ivari Padar nimetas SDE eesmärgina hooliva ja elamisväärse Eesti. Valdkondadest, millele keskendub SDE valimisprogramm

  14. Repsil on aeg hakata haridusega tegelema / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Sotsiaaldemokraatide hinnangul ei valda haridus- ja teadusminister Mailis Reps hariduseelnõude sisu, keeldub arutamast kõiki opositsiooni eelnõusid ega ilmu Riigikogu kultuurikomisjoni eelnõude arutamisele

  15. SDE seisab uute põlevkivikaevanduste vastu / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    SDE tutvustas pressikonverentsil oma keskkonnapoliitilisi seisukohti. Sotsiaaldemokraadid on vastu uute põlevkivikaevanduste avamisele enne olemasolevate ammendumist, SDE eelnõu kohaselt tuleks uute kaevanduste avamiste kava kinnitamisele Riigikogus

  16. Presidendi kingitud auto seisab lageda taeva all / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2002-01-01

    President Meri vana ametiauto, mis kingiti Kaitseliidule, seisab teist nädalat lageda taeva all, sest seda pole uue omaniku nimele ümber registreeritud. Kommenteerivad Kaitseliidu pressiesindaja Merle Ott ja president Arnold Rüütli pressinõunik Ester Shank

  17. Madalaid palku tõstaks palgalepe / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    SDE aseesimehe Eiki Nestori sõnul peaks valitsus sõlmima konkreetsed palgalepped politseinike, päästetöötajate ja kõigi riigiametnike palkade kohta, see tõstaks tegelikult töötajate sissetulekuid. Riigikogu liikme Kadi Pärnitsa arvamus

  18. Laekeni indikaatorid = Laeken indicators / Piia-Piret Eomois

    Index Scriptorium Estoniae

    Eomois, Piia-Piret

    2005-01-01

    Riikidevahelise sotsiaalse heaolu erinevuste võrdlemiseks Euroopa Liidu statistikaameti (Eurostat) poolt väljatöötatud meetodist ja sellega hõlmatavatest Laekeni indikaatoritest ning vaesusriski määrast Eestis aastatel 2000-2003. Tabelid. Diagrammid

  19. Klaasist, betoonist ja üllast ideest / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2003-01-01

    Sisearhitektide Argo ja Katrin Vaikla kodu. Looduslähedusest, ruumilahendusest ja materjalikasutusest. Puituksed, köögi aknaalune kapp ja söögilaud valmistati A. ja K. Vaikla jooniste järgi firmas Disekt. Välisvaade, 13 sisevaadet

  20. Simulatsioonid küberruumis : varjud seintel / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2006-01-01

    Tegelikkuse ja illusioonide vahekorrast globaalses küberruumis. Toetutakse Jean Baudrillard'i hüperreaalsuse- ja simulatsiooniteooriale. Otsitakse vastust küsimusele, kas arvutitehnoloogia on andnud midagi juurde igavesele probleemile tõe ja kujutluse vahekorrast

  1. Milline on edukas teatri ja lavastuste kommunikatsioon? / Piret Jaaks

    Index Scriptorium Estoniae

    Jaaks, Piret, 1980-

    2015-01-01

    Kommunikatsioonist Eesti teatrites. Kogemusi jagavad Kristo Kruusman Rakvere teatrist, Kätlin Sumberg Teatrist NO99, Ruudu Raudsepp Linnateatrist, Eveli Loorents Endla teatrist, Hannele Känd Nukuteatrist, Herkko Labi Von Krahli teatrist ja väiketeater Cabaret Rhizome

  2. Euroopa majanduste andunud vikatimees Lars Christensen / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Danske Banki vanemanalüütik Lars Christensen on kahtluse alla seadnud Eesti valuutakomitee süsteemi püsimise. Vt. samas: Lars Christensen; Valik Lars Christenseni tänavusi hävitavaid hinnanguid Euroopa murelastele; Islandile kuulutatud häving kukutas otsemaid aktsiaid ja valuutat. Kommenteerivad Lars Rasmussen, Flemming Christensen ja Hanna Strandgaard

  3. "Leonardo da Vinci" projekt kutsehariduses / Piret Kärtner

    Index Scriptorium Estoniae

    Kärtner, Piret

    2001-01-01

    14.-25. mainì2001 viibisid seitse Eesti kutsekoolide inglise keele õpetajat ja kaks Riikliku Eksami- ja Kvalifikatsioonikeskuse esindajat Leonardo da Vinci projekti raames Rootsis Malmös, et tutvuda rootslaste ja hollandlaste koostöös välja töötatud programmi TENTEC - Teaching English for Technical Purposes rakendusvõimalustega, innovatiivsete võõrkeeleõppemeetoditega, eriala- ja keeleõppe integreeritud õpetusega, õppematerjalidega, mis põhinevad IT võimalustel

  4. Estonian Memory Theatre : the 1970s-1990s / Piret Kruuspere

    Index Scriptorium Estoniae

    Kruuspere, Piret, 1961-

    2007-01-01

    Eesti teatrikunstis - nii näidendites kui lavastustes - 1970-1990. aastatel peegelduv ajalooteadvus ja rahvuslik identiteet. Vaadeldakse Rein Saluri näidendeid "Külalised" (Eesti Draamateater 1974, lav. Kaarin Raid) ja "Minek" (Eesti Draamateater 1988, lav. Mikk Mikiver ja Pärnu Endla 1988, lav. Priit Pedajas), Madis Kõivu näidendeid "Tagasitulek isa juurde" (Eesti Draamateater 1993, lav. Priit Pedajas) ja "Stseene saja-aastasest sõjast" (Eesti Draamateater 1998, lav. Mikk Mikiver), Jaan Kruusvalli näidendit "Pilvede värvid" (Eesti Draamateater 1983, lav. Mikk Mikiver) ja Merle Karusoo dokumentaalteatrit. Viited lk. 174-176

  5. 212ʻ Fahrenheiti : eesti luule 2006 / Piret Bristol

    Index Scriptorium Estoniae

    Bristol, Piret, 1968-

    2008-01-01

    Järgmistest 2006. a. ilmunud luulekogudest: Ryytle, Indrek. Inglid rokijaamas. Puhja : I. Rüütle ; Runnel, Hando. Viru veri ei värise. Tartu : Ilmamaa ; Vabat, Martin. Mina olengi kirjandusklassik. Tartu : Eesti Kirjanduse Selts ; Korts, Eliina. Lööklaused murravad metsi. Tartu : Eesti Kirjanduse Selts ; Koff, Indrek. Vana laul. Luige : Verb ; Teede, Andra. Takso Tallinna taevas. Luige : Verb ; Vusser, Kaspar. Vusserduste võnked. Tallinn : P. Kukk ; Elbing, Andrus. Siin Beebilõust, tere! : häired pimelinna tänavalt = Ciao, it's Babyface : trouble from the streets of a blind city. Tallinn : Epifanio ; Hint, Miina. Vabaduse vang, ehk, Põrandaalune kirjandus. Tallinn : MR ; Jüriado, Tiiu. Luule on ime. Habaja : Kentaur ; Ligi, Katre. Naabrivalve. Tartu : Ilmamaa ; Krull, Hasso. Talv. Tallinn : Tuum ; Mets, Mae. Pühapäeval on reede. Tartu : Ilmamaa ; Ploom, Ülar. Porr ja sorry. Tallinn : Tuum ; Hirv, Indrek, Surmapõletaja. Tallinn : Tuum ; Piir, Milvi Martina. Kõrkjavaas. Tartu : Fantaasia ; Soomets, Triin. Väljas. Tallinn : Tuum ; Mathura. Kohalolu. Rapla : Allikäärne ; Afanasjev, Vahur. Katedraal Emajões. Tartu ; Brüssel : ID Salong//Sild, Ivar. Spermaga ja puha. Pärnu : Jumalikud Ilmutused ; Meiel, Kaupo. Polügrafisti käsiraamat. Pärnu : Jumalikud Ilmutused ; Kivisildnik, Sven. Vägistatud jäämägi. Pärnu : Jumalikud Ilmutused ; Arder, Ott. Luule sünnib kus sünnib kui sünnib / koost. Leelo Tungal. Tallinn : Tänapäev ; Kompus, Marko. Vallaliste jõgede tõkkejooksja. Tartu : M. Kompus

  6. Mirtel Pohla esimene põlemine / Piret Kooli

    Index Scriptorium Estoniae

    Kooli, Piret

    2007-01-01

    Pirita kloostri varemetes etendus Arthur Honeggeri/Paul Claudeli oratoorium "Jeanne d'Arc tuleriidal", lavastaja Üllar Saaremäe. Nimiosas mängiv Mirtel Pohla kirjeldab esmakogemust. Lisaks dirigent Anu Tali ja lavastaja Üllar Saaremäe kommentaarid Mirtel Pohlast

  7. Värske investeerija Eestis varakaim / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Vene kapitalil põhinev investeerimisühing KIT Finance Europe edestab varade mahult kõiki siinseid investeerimisühinguid ning keskendub suurklientidele. Vt. samas: KITi teenus kohalikele investeerijatele; Diagramm: Majandusnäitajad; Turuosad. Kommenteerib Rein Rätsep

  8. Measurements of Branching Fractions, Rate Asymmetries, and Angular Distributions in the Rare Decays B -> Kl+l- and B -> K*l+ l-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-04-07

    We present measurements of the flavor-changing neutral current decays B {yields} K{ell}{sup +}{ell}{sup -} and B {yields} K*{ell}{sup +}{ell}{sup -}, where {ell}{sup +}{ell}{sup -} is either an e{sup +}e{sup -} or {mu}{sup +}{mu}{sup -} pair. The data sample comprises 229 x 10{sup 6} {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II e{sup +}e{sup -} storage ring. Flavor-changing neutral current decays are highly suppressed in the Standard Model and their predicted properties could be significantly modified by new physics at the electroweak scale. We measure the branching fractions {Beta}(B {yields} K{ell}{sup +}{ell}{sup -}) = (0.34 {+-} 0.07 {+-} 0.02) x 10{sup -6}, {Beta}(B {yields} K*{ell}{sup +}{ell}{sup -}) = (0.78{sub -0.17}{sup +0.19} {+-} 0.11) x 10{sup -6}, the direct CP asymmetries of these decays, and the relative abundances of decays to electrons and muons. For two regions in {ell}{sup +}{ell}{sup -} mass, above and below m{sub J/{psi}}, we measure partial branching fractions and the forward-backward angular asymmetry of the lepton pair. In these same regions we also measure the K* longitudinal polarization in B {yields} K*{ell}{sup +}{ell}{sup -} decays. Upper limits are obtained for the lepton flavor-violating decays B {yields} Ke{mu} and B {yields} K*e{mu}. All measurements are consistent with Standard Model expectations.

  9. The first experimental investigation of the KLL Auger spectrum of Ni generated in the electron capture decay of radioactive Cu-64 in a solid state matrix

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Perevoshchikov, L. L.; Kovalík, Alojz; Filosofov, D. V.; Gorozhankin, V. M.; Ryšavý, Miloš

    2012-01-01

    Roč. 66, č. 234 (2012), s. 1-5 ISSN 1434-6060 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LA08002 Institutional support: RVO:61389005 Keywords : atomic-structure * ec decay * relativity Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.513, year: 2012

  10. Sotsiaaltöötaja ja lastepsühhiaatri kohtumine / Piret Visnapuu

    Index Scriptorium Estoniae

    Visnapuu, Piret

    2008-01-01

    Missugused tunnused (käitumisviisid, raskused vms) lapsel võiksid olla need, mille puhul sotsiaaltöötaja peaks vanematele soovitama psühhiaatri konsultatsiooni või adekvaatsete vanemate puudumisel ise katsuma lapsega psühhiaatri konsultatsiooni otsida?

  11. Linnastumist hakatakse uurima kosmosest = Urbanisation will be studied from space / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2014-01-01

    Tartu Ülikooli füüsikud Kaupo Voormansik ja Karlis Zalite ning geograaf Kalev Koppel on loonud veebikaardi, mis aitab uurida linnastumist. Andmeid hakkab koguma Euroopa Komisjoni satelliit Sentinel-1

  12. Tule paistel : kaminast ahjuni, lõõrist korstnani / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2005-01-01

    Priit Hamer firmast Agabus, Endjärv & Truverk Arhitektid vastuseks lugejate küsimustele kamina ja küttesüsteemi valikust, tõmbeprobleemidest, avatud, disain- ja küttekaminast, ahjudest, valmiskaminatest, küttepuudest, tuleohutusest. 6 värv. ill.: Andrus Tuisu projekteeritud kamin loft-korteris jm.

  13. Aasta parimad interjöörid muutsid vana trendikaks / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2001-01-01

    Eesti Sisearhitektide Liidu aastapreemiad: eramu sisekujunduse preemia - Tüüne-Kristin Vaikla ja Urmas Vaikla, meelelahutusliku interjööri preemia - kohvik "Pegasus" (Gert Sarv, Margus Tammik, Tarvo H. Varres osaühisusest Front Arhitektid), ajaloolise interjööri preemia - Tallinna Reaalkooli renoveerimisprojekt Tiina Lõhmuse juhtimisel, unikaaleseme preemia - Leila Pärtelpoja kujundatud riigikogu esimehe puhkeruumi mööbel Toompeal. Nimetatud žürii koosseis

  14. "Kõrini" filmist ei saa poolteise tunni jooksul kõrini / Piret Linnamägi

    Index Scriptorium Estoniae

    Linnamägi, Piret

    2006-01-01

    Esilinastus Eesti-Saksa koostööfilm "Kõrini" : režissöör Peeter Simm : osades Maarja Jakobson, Rasmus Kaljujärv, Heio von Stetten, Thomas Schmauser : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005. Filmist rääkisid režissöör, produtsent Artur Talvik. Filmi sisust

  15. About applying the principles of sustainable development to tourism industry / Piret Ilver, Juta Sikk

    Index Scriptorium Estoniae

    Ilver, Piret

    2006-01-01

    Eesti säästva arengu seadusele tuginedes on välja töötatud riiklik turismi arengukava ning säästev areng on muutunud turismipoliitikas prioriteetseks seisukohaks, põhimõtteks, et turism saab areneda ainult siis, kui austatakse looduslikke ja kultuurilisi tingimusi

  16. Iga maastik on hingeseisund = Every landscape is a condition of the spirit / Piret Karro

    Index Scriptorium Estoniae

    Karro, Piret, 1991-

    2016-01-01

    Laura Põllu isiknäitus "Sada ulma keset merd" Tartu Kunstimuuseumis (Tartmusis). Ruumiinstallatsioonis on kombineeritud maali-, video-, skulptuuri- ja tekstilahendusi. Helikujunduse autor on Juhan Vihterpal, kuraator Peeter Talvistu

  17. Analüütikud soovitavad Eesti Energia börsile viia / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Kohalikud analüütikud soovitavad viia Eesti Energia börsile, kuna see elavdaks aktsiaturgu ja tõmbaks ligi välisinvestoreid. Vt. samas: Raivo Vare: raske aeg töötab Eesti Energia börsiletoomise kasuks; Analüüs ootab pääsu valitsuskabinetti; Juhid ei püsi enam Eesti Energias. Diagrammid: Majandusnäitajad; Varade maht

  18. Tööstusarhitektuuri metamorfoos : tööstushoonetest uunikumid / Piret Lindpere, Tõnu Halberg

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    1999-01-01

    Tallinna tööstusarhitektuuri päritolust, tööstushoonete ümberkohandamisest. Ilmarise renoveerimine hotelliks Ilmarine Residence (Nord Projekt). Rotermanni kvartalis toimunud muutustest. Rotermanni elevaatori riigile tagasiostmisest. Lagunevast Tselluloosivabrikust Tartu mnt. Alalhoidlikkuse näitena elektrijaamast Linnahalli kõrval.

  19. Tondi Sõjakoolist laia maailma / Piret Kuusik ; juhendajad Merike Jürjo, Reet Viikholm

    Index Scriptorium Estoniae

    Kuusik, Piret

    2011-01-01

    Uurimistöö käsitleb Tondi Sõjakooliga seonduvat ning tolleaegseid etiketi- ja käitumisnorme. Töö annab ülevaate aspirant Arvid Tarsi ning temaga koos õppinud nelja kursuslase isikutest ja nende saatusest

  20. Rohelise joonega kodu / Piret Veigel ; kommenteerinud Anu Hännikäinen

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2012-01-01

    Perekond Rüüsaki modernselt funktsionaalne kodu pälvis konkursil "Kodu kauniks 2011" stiilseima kodu preemia. Maja projekteeris Andri Kirsima, sisearhitekt oli Pille Tael, kes koostöös skulptor Kalle Pruudeniga projekteerisid ja teostasid eritellimusel valgustid

  1. "Neiseri" büroohoone = The Neiser Office Building / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2003-01-01

    2002. a. valminud kontori sisekujundusest. Sisearhitekt Tiiu Truus. Hoone arhitekt Indrek Näkk. Kontorimööbli ja lükanduksed valmistas Võru firma "Private Project". Bürooseintel Rein Kelpmani maalid. Ill.: kontori planeering, 6 vaadet

  2. Loomaaed tähistab homset 65. sünnipäeva vaoshoitult / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2004-01-01

    Loomaaia sünnipäeval lõpetatakse IV Läänemeremaade animalistliku skulptuuri festival ja selgitatakse võitjad. Osavõtjate loetelu. Žürii koosseis. Eestist osalevad Aleksander Litvinov ja Rafael Danieljants

  3. Doktoritöö sloveeni lühifolkloori esteetilisest struktuurist / Piret Voolaid

    Index Scriptorium Estoniae

    Voolaid, Piret, 1971-

    2013-01-01

    18. dets. 2012. a. kaitses Saša Babič Ljubljana ülikoolis doktoritööd "Estetska struktura slovenskih folklornih obrazcev v preseku časa z vidika slovstvene folkloristike " ("Sloveeni rahvaluule lühivormide esteetilise struktuuri ajaline läbilõige rahvaluuleteaduse vaatepunktist")

  4. Estonian literature and a brave new world : a postmodern turn? / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2006-01-01

    Ilm. ka väljaandes: Different inputs - same output? : autonomy and dependence of the arts under different social-economic conditions / ed C. D. Hasselblatt - Maastricht : Shaker, 2006. (Studia Fenno-Ugrica Groningana ; 3)

  5. Normal hiigelsääst Autolivi sukasääres / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Selle asemel, et üleliigne raha tootmisse investeerida või investorile dividendidena välja maksta, on Norma oma teenitud puhaskasumi emafirmale Autoliv välja laenanud. Vt. samas: Väikeinvestorid on Norma käitumises pettunud; Investeeringud vähenevad, vaba raha hulk kasvab. Kommenteerivad Peeter Koppel ja Erki Kert

  6. Dionysos agonistes / Mardi Valgemäe ; tõlk. Piret Kruuspere

    Index Scriptorium Estoniae

    Valgemäe, Mardi, 1935-

    2002-01-01

    W. Shakespeare'i "Hamleti" tõlgetest ja erinevatest lavatõlgendustest - näidendi esmalavastuse 400. aastapäeva tähistanud etendus uues "Globuses" (2000), Ingmar Bergmani versioon Stockholmi Kuninglikus Draamateatris (1988) ja Peter Brooki lavastus Pariisis (2001)

  7. Kliendi tunnustus ettevõtte mainele tekitab töötajas uhkust / Piret Laur

    Index Scriptorium Estoniae

    Laur, Piret

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 26. juuli 2006 lk. 6. KPMG-s läbi viidud motivatsiooniuuring kinnitas, et kõikide töötajate gruppide esindajad hindasid ühe olulisema motivaatorina oma tööandja mainet

  8. Võsast võrsub kultuur = Sowing the seeds of Estonian culture / Piret Õunapuu

    Index Scriptorium Estoniae

    Õunapuu, Piret, 1955-

    2014-01-01

    Läbilõige Eesti Rahva Muuseumi ajaloost, uue muuseumihoone ehitamisest Raadile (arhitektuurivõistluse võidutöö nimega "Memory Field", autoriteks rahvusvaheline arhitektide kolmik Pariisist: Dan Dorell, Lina Ghotmeh ja Tsuyoshi Tane) ning selles 2016.a. avatavatest püsinäitustest

  9. Abilinnapea Ratas pidas uputust paratamatuseks / Jüri Ratas ; interv. Piret Reiljan

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2004-01-01

    Tallinna abilinnapea Jüri Ratas kommenteerib olukorda linnas, kus kahe päevaga sadas maha rohkem kui juulikuu sademete norm ette näeb. Vt. samas Meelis Eldermann. Miks veevärk vihmaga toime ei tulnud?

  10. Thomas Hiärne - nimi Rootsi Läänemereprovintside varasest ajalookirjutusest / Piret Lotman

    Index Scriptorium Estoniae

    Lotman, Piret, 1950-

    2008-01-01

    Thomase isa Erlandi karjäärist. Thomas Hiärne headest suhetest Eestimaa kindralkuberneri Bengt Horniga. Thomas Hiärne kandideerimisest Ingerimaa rüütelkonna sekretäri kohale. Tema tegevusest Virtsu mõisa inspektorina. Hiärne kroonikast ja ajalookäsitlusest

  11. Nelipühilased renoveerivad 100-aastase Harjuoru võimla / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2006-01-01

    Eesti Kristlik Nelipühi Kirik saab uued ruumid renoveeritavasse Harjuoru võimlasse Tallinnas Toompea tänav 3. Töid teostab TH Roof OÜ, sisekujundus Maple Wood OÜ. Juugendstiilis Toomkooli võimla projekteeris 1907. a. Arthur von Hoyningen-Huene

  12. Õppekava tööversioon sai tagasisidet / Piret Arendi

    Index Scriptorium Estoniae

    Arendi, Piret

    2006-01-01

    Koolieelse lasteasutuse riikliku õppekava projekti tööversioonile andsid tagasisidet Tartumaa, Harjumaa, Jõgevamaa, Pärnumaa, Põlva, Räpina, Pärnu; Tartu ja Tallinna lasteaednikud ning Eesti Alushariduse Juhtide Ühendus ja Eesti Lasteaednike Liit

  13. Paris Photo 2015 / Kristel Schwede, Annika Haas, Laura Põld, Piret Frey

    Index Scriptorium Estoniae

    2015-01-01

    Rahvusvaheline fotomess "Paris Photo 2015" 12. kuni 15. novembrini Pariisi messihallis Grand Palais. Eestit esindasid messil oma loominguga Jaanus Samma, Sigrid Viir, Krista Mölder (Temnikova & Kasela galerii)

  14. Pro Kapitali ärikeskuse taha kerkivad ärid ja korterid / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2007-01-01

    Tallinnas Pro Kapitali ärikvartalisse Jõe ja Aedvilja tänaval kavandatakse seitsmekorruselist kortermaja ja kuuekorruselist ärihoonet. Arhitekt Tiit Trummal, detailplaneeringu koostas EA Rengi arhitekt Reino Rass

  15. Romaanivõistluse võitsid uued sõnameistrid / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2001-01-01

    I koht (Aarne Ruben ""Volta" annab kaeblikku vilet"); II koht (Leo Kunnas "Sõdurjumala teener"); III koht (Maimu Veske "Continental" ja Lehte Hainsalu "Kellakuuljad"); Ulmekirjanduse eripreemia Varrakult (Indrek Hargla "Baiita needus")

  16. Carl von Linné jälgedes / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2007-01-01

    Alanud aastal tähistatakse Carl von Linné, taimede ülemaailmselt käibiva teadusliku klassifitseerimise süsteemi rajaja 300. sünniaastapäeva. Loodusteadlase majast ja aiast Uppsalas, tema suvekodust Hammarby's ja Fredriksdali vabaõhumuuseumist Helsingborgis, kus leiab Linné-aegset maaharimist

  17. Marek Strandberg : Rändjutlustaja või hull leiutaja? / Marek Strandberg ; interv. Piret Tali

    Index Scriptorium Estoniae

    Strandberg, Marek, 1965-

    2005-01-01

    Marek Strandberg vastab küsimustele oma praeguse tegevuse, europarlamendi valimistel kandideerimise, rohelise liikumise, Eesti Looduse Fondi toimimise kohta. Vt. samas: Strandberg joonistab ideed selgeks

  18. Kas Eesti kool on valmis õpilaste sülearvutite kasutuseks? / Piret Luik

    Index Scriptorium Estoniae

    Luik, Piret, 1967-

    2010-01-01

    2008/2009. õppeaastal said Eesti viie kooli 8. klassi õpilased pooleks aastaks enda käsutusse sülearvutid. Projektiga kaasnev uurimus püüdis välja selgitada, milliseid muutusi see õppimises kaasa toob

  19. Valitsuse 100 päeva üllatused / Kadri Jakobson, Piret Reiljan

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 18. juuli lk. 2. Aprillirahutuste ohjamine on toonud valitsusele toetuse, aktsiisi- ja hinnatõus aga ennustavad majandusraskusi. Tabel: Valitsuskoalitsiooni lubadused, teod ja peaministri kommentaarid. Vt. samas: Silmapaistvamad 100 päeva ministrid; Valitsuse 100 päeva positiivsed otsused. Vt. samas: Andrus Saar: valitsuse otsused on pannud käima inflatsiooniralli

  20. Ester Tuiksoo. Proua Suhkru kibedad päevad / Ester Tuiksoo ; interv. Piret Tali

    Index Scriptorium Estoniae

    Tuiksoo, Ester, 1965-

    2005-01-01

    Põllumajandusminister Ester Tuiksoo, kellel peagi täitub ministri ametis aasta Euroopa Liidu suhkrutrahvist, maaettevõtlusest, põllumajandusest, Euroopa Liidu toetustest, ministri elu- ja teenistuskäigust. Lisa: Ester Tuiksoo

  1. Kas õpetajate professionaalne areng saab toimuda e-toel? / Piret Luik

    Index Scriptorium Estoniae

    Luik, Piret, 1967-

    2015-01-01

    Õpetajate professionaalne areng on tõusnud päevakorda kogu Euroopas ja viinud õpetajakoolituse reformimiseni. Tartu ülikooli haridusteaduste instituut koostöös partneritega Euroopa ülikoolidest kutsus personaalsemate e-kursuste loomiseks 2013. aastal ellu Lifelong Learningi projekti „Social Networks in Teacher Education” (SoNetTE)

  2. Eesti ja poola huumoriuurijate koostöö päädis artiklikogumikuga / Piret Voolaid

    Index Scriptorium Estoniae

    Voolaid, Piret, 1971-

    2013-01-01

    Arvustus: Estonia and Poland: creativity and tradition in cultural communication. Volume 1, Jokes and their relations / editors Liisi Laineste ... et al. Tartu : Eesti Kirjandusmuuseumi Teaduskirjastus, 2012

  3. Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2003-01-01

    TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem

  4. Ettevõtlik ülikool / Piret Hartman, Roomet Sõrmus, Aigar Aab

    Index Scriptorium Estoniae

    Hartman, Piret

    2006-01-01

    Eesti Maaülikooli üliõpilaskonna sihtasutus viis läbi projekti "Maamajandusettevõtete kaasamine EMÜ üliõpilaste õppetöösse". Kaheksateistkümnest ettevõtetesse läbi viidud ekskursioonist võttis osa neli- ja poolsada üliõpilast

  5. Korduvkuritegevuse riskide hindamise lähtealused ja praktika Eesti vanglasüsteemis / Piret Liba

    Index Scriptorium Estoniae

    Liba, Piret

    2011-01-01

    Korduvkuritegevuse vähendamise efektiivsetest meetmetest, retsidiivsusriski hindamise metoodikast, väljatöötatud riskihindamisvahenditest ning Eesti kriminaaljustiitssüsteemi praktikast retsidiivsusriski hindamisel

  6. Diplomaatiline puutumatus : [bakalaureusetöö] / Piret Tamm ; Õigusinstituut ; juhendaja: Heiki Lindpere

    Index Scriptorium Estoniae

    Tamm, Piret

    2001-01-01

    Diplomaatia ja rahvusvahelise õiguse vahekorrast, diplomaatiliseks suhtlemiseks vajalikud õigused ja kohustused, diplomaatilise personali immuniteet asukohariigi jurisdiktsioonist, Eesti praktika 1920-1940 ja hilisem taastamine

  7. Swedbank tüürib Väätsa Agro pankrotti? / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2010-01-01

    Kevadel kinnitas Pärnu maakohus hoolimata Swedbanki vastuseisust Väätsa Agro saneerimiskava, mis tegi Swedbankis piimatööstuse suuromaniku. Pank osalust ei soovinud ning tal õnnestus ringkonnakohtu määrusega saneerimiskava peatada. Väätsa Agro pöördus riigikohtusse

  8. Viga võib tekitada liigse süükoorma / Piret Bristol

    Index Scriptorium Estoniae

    Bristol, Piret, 1961-

    2006-01-01

    Õppivas organisatsioonis ei peaks ruumi olema õpitud abitusel, süüdistamisel ja häbistamisel. Vt. samas: Eksinud ja murest murtud töökaaslasel saab aidata auru välja lasta; Tänitamine tekitab tõrke; Õpitud optimism lubab eksida

  9. Ettevõtjate optimism kadus mõne kuuga / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Ettevõtjad on tuleviku osas muutunud pessimistlikumaks, ennustades käibe vähenemist. Vt. samas: Pronksiöö mõju peeti tühiseks. Diagramm: Rahandusministeeriumi prognoosid. Kommenteerivad Erki Lõhmuste ja Andres Saarniit

  10. Vaiklate ühine käejoon / Piret Veigel-Sepman

    Index Scriptorium Estoniae

    Veigel-Sepman, Piret

    1999-01-01

    Eesti sisearhitektidest Tüüne-Kristin ja Urmo Vaiklast. 1992. a. lõid Vaikla Stuudio, mis tegutseb interjööridisaini ja graafilise disaini alal. Viimasest suurest tööst: Raivo Puusepa projekteeritud Al Mare tervise- ja vaba aja keskuses asuva tervisespordiklubi Status Clubi sisekujundusest. Kujunduse läbiv idee on laev. 4 illustratsiooni

  11. LHV advokaadid uurivad koos ameeriklastega tehingute tagamaid / Piret Loone ; interv. Neeme Raud

    Index Scriptorium Estoniae

    Loone, Piret

    2005-01-01

    Investeerimispanka Lõhmus, Haavel & Viisemann USA kohtuvaidluses esindav advokaadifirma Shearman & Sterling LLP advokaat vastab küsimustele, mis puudutavad kohtuprotsessi USA-s, USA väärtpaberituru järelevalveasutuse SEC poolt esitatud hagi ning SEC-iga saavutatud kokkuleppet

  12. Kawe Plaza. Pärnu mnt. 15/Tatari 2, Tallinn / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    1998-01-01

    Kawe Plaza arhitektist Henno Sillastest. Sisekujundus: H. Sillaste, Kristiina Voolaid, ARS Interjöörprojekt. Peatöövõtt: AS EMV. Projekt 1993-1997, valmis 1998. Lainja klaasfasaadiga pika ja kitsa ärihoone lahenduse tingis krundi kolmnurkne kuju. Maja on sobitatud teiste väljakut moodustavate hoonetega. Tagafassaad on graniidist.

  13. Rimis maksab nüüd Rootsi kontserni sõna / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2006-01-01

    Rootsi kaubandusfirma ICA AB ostis Soome firmalt Kesko Food Ltd 50% osaluse Rimi Balticus, saades ettevõtte ainuomanikuks. Vt. samas: ICA maksis ligi 3 miljardit krooni; ICA sai oma käsutusse ligi 200 Baltimaade kauplust

  14. Q Vara omanikud tõstavad vara abikaasade nimele / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Raskustes Q Vara omanikud ja juhatuse liikmed Ivo ja Alo Lillepea, kes vastutavad oma varaga ettevõtte võlakirjade eest, on asunud enda nimel olevat kinnisvara abikaasade nimele kirjutama. Diagramm: Q Vara võlakirjade käendajal 5 omanikku

  15. Lugemisoskuse ja -motivatsiooni seosed õpetajate kasvatusstiilidega esimeses klassis / Piret Soodla, Eve Kikas

    Index Scriptorium Estoniae

    Soodla, Piret, 1973-

    2014-01-01

    Esimeste klasside õpilaste ja nende õpetajate seas läbi viidud pikiuuringust, mille eesmärgiks oli analüüsida, kas ja kuidas erinevad õpilaste lugemisoskus ja motivatsioon kolme tüüpi kasvatusstiiliga õpetajate klassides

  16. Värske uuring: tulumaksutagastus aitab igapäevakulusid kanda / Piret Suitsu

    Index Scriptorium Estoniae

    Suitsu, Piret

    2010-01-01

    Swedbanki Eraisikute Rahaasjade Teabekeskuse uuringust selgus, et Eesti elanikud vajavad toimetulekuks tulumaksutagastust. Teabekeskus korraldas ümarlaua, millest võtsid osa ka Eiki Nestor ja Taavi Rõivas. Diagrammid, tabel

  17. Sääste hoitakse üha enam valuutas / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 18. juuli lk. 3. Üha enam eraisikuid on oma tähtajalisi ja säästuhoiuseid paigutanud valuutasse, kuna välisraha puhul on valuutarisk väiksem. Kommenteerivad Mart Sõrg, Sven Meimer. Diagramm: Valuutahoiuste maht tõusuteel; Üle aasta kestvatest eraisikute hoiustest 75% valuutas. Tabel: Kroonihoius intressi poolest kuldne kesktee. Lisa: Number

  18. Euro kasutuselevõtuks ametnikel töö tehtud / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Eesti eurole üleminekut ette valmistanud ametnike koostatud infomaterjalid ja tegevuskavad on valmis, ent euro saabumise aeg pole veel teada. Diagramm: Inflatsioonimäär. Kommenteerivad Jan Linden ja Klas Eklund

  19. Vene püstolid lähevad sulatusahju / Raivo Tamm ; interv. Piret Tali

    Index Scriptorium Estoniae

    Tamm, Raivo

    2004-01-01

    Eesti loobub Makarov-püstolitest, sest meie relvastus peab vastama NATO-s kehtivatele kaliibritele. Nende asemel kaalutakse Walteri, Sig-Saueri, Heckler & Kochi ja Glocki relvade ostu. Lisa: Walter P99 QA, Sig Sauer P226, Heckler & Koch USP, Glock

  20. Swedbank laseb eestlastel Sportlandi päästa / Piret Reiljan, Kadri Bank

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2010-01-01

    Swedbank sõlmis spordiketiga Sportland International Group (SIG) restruktureerimiskokkuleppe. Ettevõte sai endale viis aastat pikendust laenude tasumiseks. Sportlandi omanikud ettevõtte arengust, tehtud vigadest ja tulevikuootustest. Diagramm

  1. Bush vs Kerry ookeanitaguses trükisõnas / Piret Pernik

    Index Scriptorium Estoniae

    Pernik, Piret

    2004-01-01

    USA juhtivate ajalehtede Financial Times, New York Times ja Washington Post hinnanguid Ameerika Ühendriikide presidendikandidaatide esinemisstiilile, hoiakutele, poliitilistele veendumustele ning suhtele religiooni

  2. Dunker jäi Lätis pika ninaga / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 15. aug. lk. 9. Dunkri Kaubanduse AS pidi loobuma Läti importalkoholi hulgimüüja Lion ostmisest, kuna pooled ei jõudnud tehingu maksumuses kokkuleppele. Kommenteerib Alexander Bondarev. Tabel: Dunkri käive kasvas mullu üle 40%. Lisa: Lion. Vt. samas: Tehingu katkemine pidurdab laienemist

  3. President Ilves: Rootsi avas eestlastest paadipõgenikele vabaduse värava / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2011-01-01

    President Toomas Hendrik Ilves külastas Stockholmis mälestusmärki "Vabaduse värav", mis sümboliseerib eestlastest paadipõgenike tänu Rootsile ja rootslastele, kes nad enam kui 65 aastat tagasi vastu võtsid. Riigivisiit Rootsi 17.01.2011 - 20.01.2011

  4. Võrdsed võimalused - mida see tegelikult tähendab? / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2005-01-01

    Ilmunud ka: Lõunaleht 17. nov. lk. 2, Vali Uudised 18. nov. lk. 2, Põhjarannik, Severnoje Poberezhje, Lääne Elu 19. nov. lk. 2, Sõnumitooja 23. nov. lk. 2, Virumaa Teataja 24. nov., lk. 4, Vooremaa 24. nov. lk. 2, Sakala 30. nov. lk. 2, Koit 1. dets. lk. 6. Noorte Sotsiaaldemokraatide peasekretär diskrimineerimisilminguist Eesti ühiskonnas ning kuidas tagada võrdseid võimalusi

  5. Eesti majandust ei saa rajada võõrtööjõule / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Eesti Ametiühingute Keskliidu, Teenistujate Ametiliitude Organisatsiooni ja Sotsiaaldemokraatliku Erakonna juhtide kohtumisel leiti, et võõrtööjõud ei ole Eestile lahendus. Harri Taliga, Eiki Nestori ja Kadi Pärnitsa seisukohtadest

  6. Riigitöötajatel peab olema õigus streikida / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Riigikogu hääletas menetlusest välja seaduseelnõu, mis oleks andnud riigitöötajatele õiguse streikida. Eelnõu esitanud Kadi Pärnits põhjendab streigiõiguse andmise vajadust. Riigi- ja Omavalitsuste Töötajate Ametiühingu liidu esimehe Kalle Liivamägi, õiguskantsler Allar Jõksi hinnanguid

  7. Keila vabrikuala ideevõistluse võitsid noored Leedu arhitektid / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2007-01-01

    Keila endise riidevabriku kinnistu planeerimise võistluse võitsid Leedu arhitektid Andrius Uogintas, Margarita Podagelyte ja Matas Cirtautas ("Active edge"), teise koha sai PiKaSch Architecture Studio Zoltan Schrammeli juhtimisel Ungarist ("Keila 14") ja kolmanda koha Hannes Koppel ja Sander Aas ("Kegel") arhitektuuribüroost Asum Arhitektid

  8. Baltic Heritage Network : die Pflege des exilbaltischen Kulturerbes - Zwischenbilanz und Zukunftsperspektiven / Piret Noorhani

    Index Scriptorium Estoniae

    Noorhani, Piret, 1960-

    2008-01-01

    Välisbalti kultuuripärandi portaal Baltic Heritage Network, mis on mitmekeelne portaal koondamaks informatsiooni Balti diasporaa kultuuripärandi leidumuse ja sellealase tegevuse kohta. Rahvusvahelise ja siseriikliku koostöö laiendamiseks ja tegevuste koordineerimiseks loodi jaanuaris 2008 mittetulundusühing Baltic Heritage Network, kuhu kuulub praegu liikmeid kõigist kolmest Balti riigist.

  9. Rämpsvõlakirjad panevad pensionisambad roostetama / Piret Reiljan, Raivo Sormunen

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 28. mai lk. 8-9. Fondijuhid on paigutanud ligi 400 miljonit krooni II samba pensioniklientide raha kohalike kinnisvara- ja kiirlaenuäride kõrge riskiga rämpsvõlakirjadesse. Vt. samas: Rämpsvõlakiri; Igal kinnisvaraarendajal rohkem või vähem probleeme; Pensionifondide portfellides kuni 17% tootlusega võlakirjad; Pensionifondid ostnud ka kõrge tootlusega Kasahstani võlakirju; Soome kiirlaenuvõtjaid rahastajate hulgas ka Eesti pensionikogujad. Küsimustele vastavad SEB Ida-Euroopa investeeringute juht Sven Kunsing, SEB Varahalduse juht Rein Rätsep ja II samba pensionifondide juht Endriko Võrklaev

  10. Soo soomlaste südames ja soo lugudes / Piret Paal

    Index Scriptorium Estoniae

    Paal, Piret, 1977-

    2011-01-01

    Tutvustus: Laurén, Kirsi. Suo - sisulla ja sydämellä : suomalaisten suokokemukset ja -kertomukset kulttuurisen luontosuhteen ilmentäjinä. Helsinki : Suomalaisen Kirjallisuuden Seura, 2006 (doktoritöö)

  11. Kommivabriku aura jääb Tondile. Ideid Kalevi kvartali tulevikuks / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2003-01-01

    Tallinnas Järvevana tee ja Pärnu maantee vahelise ala ruumilise planeerimise ideeprojekti avalik arhitektuurikonkurss, võitjad Nikolai Volkov ja Liis Sagadi, 2. koht - Irina Raud, Toomas Tammis, Tarmo Teedumäe, Karl Luik, Renee Puusepp, 3. koht - Veronika Valk. Laste Maailma Galeriis võistlusprojektide näitus "Magus urbanism". Fakte kommivabriku "Kalev" ajaloost. Vabrik jätkab tööd Rae vallas Põrguväljal

  12. Nüganen räägib "Marmortahvli" sünniloo / Piret Jaaks

    Index Scriptorium Estoniae

    Jaaks, Piret, 1980-

    2003-01-01

    Mängufilm "Nimed marmortahvlil" jõuab nii VHS-kasseti kui DVD-plaadina müügile. Lisaks filmile ilmub DVDl lavastaja Elmo Nüganeni ja mõnede näitlejate poolt kommenteeritud filmiversioon ning Anu Auna dokumentaalfilm filmi tegemisest

  13. Inimeste petlik rahulolu ja kasulik pühendumus / Piret Jamnes, Mariann Märtsin

    Index Scriptorium Estoniae

    Jamnes, Piret

    2004-01-01

    Rahvusvahelise konsultatsioonifirma Hewitt Associates poolt läbi viidud uuringutest, mille tulemustest lähtuvalt on töötajate pühendumus otseselt seotud ettevõtte eesmärkide, majandustulemuste ja isegi mainega. Tabelid ja diagramm: Pühendumuse ja oluliste majandusnäitajate seos; Töötajate pühendumuse ja ettevõtte majandusliku edukuse vahelised seosed. Lisa: 12 pühendumuse tegurit

  14. Büroohoone-elamu. Tallinn, J. Vilmsi 5/Raua 36 / Piret Lindpere, Andres Kurg

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    1997-01-01

    Kuuekorruselise hoone I korrusel on äriruumid, II-III korrusel kontorid, IV-VI korrusel korterid. Välisviimistlusest. Peatöövõtja : AS FCM. Projekt : Arhitektibüroo R. Puusepp, 1996. Arhitekt Raivo Puusepp. Konstruktsioon : Neoprojekt. Eriosad : Projektkeskus. Välisseinte kattematerjal : Avesta Sheffield Eesti OÜ. Valmis 1997

  15. Portfolio Café oli abiks eneseväljendamisel ja raha teenimisel / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret

    2011-01-01

    VI Disainifestivali Disainiöö ja Euroopa Innovatsioonifestivali IF... programmi kuulus sel aastal esimest korda Eesti Kunstiakadeemia poolt läbi viidud disainimagistrantide ja noorte disainerite Portfolio Café

  16. Narratiivsed piltmõistatused - mitme folkloorižanri piirnähtus / Piret Voolaid

    Index Scriptorium Estoniae

    Voolaid, Piret, 1971-

    2009-01-01

    Omapärasest folkloorižanrist, narratiivsetest piltmõistatustest eesti arhiivimaterjali hulgas - otsitakse nende ühisjooni jutužanriga, uuritakse nende tegevustikku ja -kohti, samuti tegelasi ning analüüsitakse struktuuri

  17. Compton polarimetry of 6-35 keV X-rays. Influence of Breit interaction on the linear polarisation of KLL dielectronic recombination transitions in highly charged ions

    Energy Technology Data Exchange (ETDEWEB)

    Joerg, Holger Eric

    2016-12-21

    The polarisation of X-rays emitted during K shell dielectronic recombination (DR) into highly charged ions was studied using electron beam ion traps. In the first experiment, the degree of linear polarisation of X-rays due to K shell DR transitions of highly charged krypton ions was measured with a newly developed Compton polarimeter based on SiPIN diodes. Such polarisation measurements allow a study of the population mechanism of magnetic sublevels in collisions between electrons and ions. In a second experiment, the influence of Breit interaction between electrons on the polarisation of X-rays emitted during K shell DR into highly charged xenon ions was studied. Here, polarisation measurements provide an access to the finer details of the electron-electron interaction in electron-ion collisions. Furthermore, a second Compton polarimeter based on silicon drift detectors has been developed for polarisation measurements at synchrotrons. It has been developed for X-ray polarimetry with a high energy resolution for energies between 6 keV and 35 keV. It was tested in the course of polarisation measurements at an electron beam ion trap and at a synchrotron radiation source.

  18. Rahvusvaheline Töötervishoiu Organisatsioon - tänapäeva töötervishoiu ajutrust / Milvi Moks

    Index Scriptorium Estoniae

    Moks, Milvi

    2007-01-01

    17.-18. juunil 2006. a. Milaanos toimunud Rahvusvahelise Töötervishoiu Organisatsiooni (International Commission on Occupational Health, ICOH) 28. kongressist. ICOHi eesmärkidest ja liikmeks saamise tingimustest. Konverentsil valiti ICOHi auliikmeks OÜ Preventme juhatuse esimees, meditsiinidoktor Hubert Kahn

  19. Eluviisi mõjust haigusele / Lilian Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Lilian

    2004-01-01

    Raamatu "Vähi vastu aitab see, kui me ei anna talle võimalust tekkidagi" autorid meditsiinidoktor Hari Sharma, ayurveda arst Rama Mishra ja dr. James Meade'i annavad nõu haigusvaenuliku pinnase loomises ja inimese organismi tugevdamises. Järgneb 19.,26. okt., 2., 9.,16.,23.,30. nov., 7.,14.,21. dets.

  20. Peterburis pakutakse valgeid öid täis muusikat ning Neeme Järvit / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2005-01-01

    Peterburis toimuvast 7 nädalat kestvast süvamuusikafestivalist "Valgete ööde tähed/Stars of the White Nights", kontsertidel esinejatest. 25. juunil toimuvast Neeme, Paavo ja Kristjan Järvi ühiskontserdist

  1. Oliver Kruuda müüb salaja Kalevi ja Tere / Piret Reiljan, Kristina Traks, Virge Lahe

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 26. sept. lk. 9. Suuromanikud Oliver Kruuda, Heino Priimägi ja Aare Annus otsustasid müüa kondiitritööstuse Kalev ja piimatööstuse Tere investeerimisettevõttele Alta Capital ning keskenduda meediale ja kinnisvarale. Vt. samas: Kalevi aktsionäre oli koosolekul vaid käputäis; Finantsinspektsiooni kommentaar; Alta Capital; Diagramm: Kalev AS-i tütarfirmade käibed. Kommenteerivad Alari Purju, Heldur Meerits ja Toomas Kivimägi

  2. I kvartalis vähenes turism Eestis ja kõigis lähiriikides / Piret Kallas

    Index Scriptorium Estoniae

    Kallas, Piret

    2009-01-01

    Eesti majutusettevõtetes I kvartalis 2006-2009 majutatud turistid ja nende ööbimised ning turistide ööbimiste arvu muutus 2009 I kvartalis võrreldes 2008. aasta I kvartaliga Eestis, Põhjamaades ning Baltimaades.

  3. Ehtekunsti kõrgmäestik Münchenis / Kadri Mälk, Piret Hirv, Tanel Veenre

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    2009-01-01

    Ehtekunsti suurüritusest "Schmuckszene" ("Ehtepaik"). Arnoldsche Art Publishers esitles viit aasta paremaks ehtekunstiraamatuks tituleeritut, nende seas Eestis trükikojas Pakett trükitud raamatut "Just must" (kujundaja Aadam Kaarma, fotod: Tanel Veenre). Darling Publications'i poolt esitletud raamatust "The Compendium Finale of Contemporary Jewellery Makes", kus tutvustatakse kümmet eesti ehtekunstnikku, tekstide autorid on Kadri Mälk, Harry Liivrand ja Tamara Luuk

  4. Vastutustundlik ettevõtlus pöörab rohkem tähelepanu juhi rollile / Piret Potisepp

    Index Scriptorium Estoniae

    Potisepp, Piret, 1984-

    2016-01-01

    Riigi rollist vastutustundliku ettevõtluse arendamisel. Küsitlusest ja analüüsist vastutustundliku ettevõtluse arendamise võimaluste kohta Eestis. OECD suunistest rahvusvahelistele ettevõtetele, mille järgimine peaks tagama ettevõtete panuse kasvu jätkusuutlikku arengusse

  5. Nigel Thorne: maastikuarhitekt peab oskama oma töö kasu näidata / intervjueerinud Piret Potisepp

    Index Scriptorium Estoniae

    Thorne, Nigel

    2011-01-01

    Tallinnas toimub 2.-4. nov. Euroopa Maastikuarhitektuuri Liidu (EFLA) kongress "Märka tühimikku. Uue ajastu maastikud" ("Mind the Gap. Landscapes for a New Era"). EFLA president Nigel Thorne räägib intervjuus kongressist, maasikuarhitektide rollist, ülesannetest, haridusest, Euroopa ja Eesti maastikuarhitektuurist, maastikuarhitekti elukutse arengust

  6. SEB võis päästa oma raha investorite arvel / Piret Reiljan ; kommenteerinud Ahti Asmann

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2009-01-01

    SEB otsus maksta Toomas Rüütmanni TR Majade võlakirjainvestoritele hüvitist võib olla põhjustatud asjaolust, et SEB päästis Rüütmannile kuulunud Kommest Autost oma laenude katteks kümneid miljoneid kroone, mistõttu venitas TR Majade probleemidest teatamisega investoritele

  7. Tallinna-Tartu maantee ehitamine jälle kännu taga kinni / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Riigikogu lükkas tagasi SDE fraktsiooni esitatud otsuse eelnõu, milles nähti ette Tallinna-Tartu maantee ehitamine neljarealise eraldatud sõidusuundadega maanteena. Jarno Laur, Ivari Padar maantee väljaehitamise vajalikkusest

  8. Lahendite Tele2 Sverige ja Digital Rights Ireland mõju sideandmete mugavkasutusele Eestis / Piret Schasmin, Carri Ginter

    Index Scriptorium Estoniae

    Schasmin, Piret, 1987-

    2017-01-01

    Euroopa Kohtu Tele2 Sverige ja Digital Rights Ireland kohtulahendi mõjust Eesti õiguse seaduslikkusele, Eesti kohtutele ja uurimisasutustele. Puudustest Eesti kehtivas õiguses, elektroonilise side andmete säilitamisest, kasutamisest ja hävitamisest

  9. Tallinna 21. kool : Tallinn, Raua tn. 6 = Tallinn School No. 21 : Raua Street 6, Tallinn / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2003-01-01

    1923. a. valminud koolihoone renoveerimine ja juurdeehitus.Vana ja uut maja ühendab klaaskatusega läbi korruste paiknev aatrium. Projekteerija: Raul Järg, AS Kommunaalprojekt. Autor Raul Järg. Sisekujundaja Toomas Korb (Pink). Konstruktsioonid: AS Kommunaalprojekt, OÜ Civen. Projekt 2002, valmis 2003. Uue osa I ja II korruse plaan, 7 vaadet

  10. Helsingis kerkib jääst kirik : Euroopa kultuuripealinn 2000 Helsingi võlub sauna ja maailmakultuuriga / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2000-01-01

    Helsingisse püstitatavatest lume- ja jääskulptuuridest, valgusinstallatsioonidest (Kide, Vahemere sosin). Arhitektid Kari Leppänen, Peter Ch. Butter, Dusan Janovich, Jyrki Sandell. Ürituste loetelu

  11. Sügiskonverents "Kunst paguluses"...

    Index Scriptorium Estoniae

    2008-01-01

    28. VIII Kumu Kunstimuuseumi auditooriumis toimuva konverentsi kava. Esinevad Jaan Undusk, Piret Kruuspere, Avo Hirvesoo, Mara Lace, Osvaldas Daugelis, Piret Noorhani, Irja Bergström, Tiiu Talvistu ja Kersti Koll

  12. Sündinud kunstnikuks - kahe Eestis kasvanud juudi lugu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Arvustus: Tali, Piret. Eino Baskin. Naer läbi pisarate / kirja pannud Piret Tali. [Tallinn] : Fookus Meedia, [2009] ; Tammer, Enno. Simon Levin : sündinud advokaadiks. [Tallinn] : Tammerraamat, 2009

  13. [Raamat] / Andra Teede

    Index Scriptorium Estoniae

    Teede, Andra, 1988-

    2007-01-01

    Tutvustus: Pervik, Aino. Paula lõpetab lasteaia / illustreerinud Piret Raud. Tallinn : Tiritamm, 2007. (Tähenärija Raamatukogu) ; Pervik, Aino. Paula esimene koolipäev / illustreerinud Piret Raud. Tallinn : Tiritamm, 2007. (Tähenärija Raamatukogu)

  14. Sünoptiliste kaartide digiteerimine = Digitization of synoptic maps : I koht magistritööde kategoorias / Piret Pärnpuu

    Index Scriptorium Estoniae

    Pärnpuu, Piret

    2009-01-01

    Uurimistöö, mis põhines digiteerimisprojektil, mille eesmärk oli digiteerida meteoroloogilist ja hüdroloogilist infot kandvad Eesti Meteoroloogia ja Hüdroloogia Instituudi Eesti Meteoroloogia ja Hüdroloogia sünoptilise fondi kaarte

  15. Vene teatri interjööride restaureerimine ja sisekujundus. Vabaduse väljak 5, Tallinn / Aivar Oja, Riin Luuk, Piret Bender...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    5 värv. sisevaadet; sisekujundajad: A. Oja, R. Luuk (ajalooline osa), P. Bender (uus osa); siseviimistluse, maalingute ja valgustite restaureerimine: KAR Grupp; 1926. a. valminud hoone arhitekt: F. Skujinsh

  16. Ülevõtmispakkumiste direktiiv : kas töövõit või tööõnnetus? / Piret Jesse

    Index Scriptorium Estoniae

    Jesse, Piret, 1978-

    2010-01-01

    Euroopa Parlamendi ja nõukogu direktiivist 2004/25/EÜ ülevõtmispakkumiste kohta. Eesti õiguses kohaldati direktiiv 19. nov. 2007 jõustunud väärtpaberituru seaduse muudatustega (RT I 2007, 58, 380)

  17. Wŏ shuō hànyŭ, nĭne? ehk Mina räägin hiina keelt, aga sina? / Piret Lakson

    Index Scriptorium Estoniae

    Lakson, Piret, 1989-

    2012-01-01

    Hiina keele õpetamisest Eestis ja Mustamäe gümnaasiumi noorest hiina keele õpetajast Wang Weist. Eesti koolidesse hiina keele õpetajate hankimine käib Tallinna ülikooli juurde loodud Konfutsiuse instituudi kaudu

  18. Uuring: kulude kärpimine jätkub / Urve Vilk ; kommenteerinud Jaan Rosenthal, Jaan Meikup, Piret Uudeküll ... [jt.

    Index Scriptorium Estoniae

    Vilk, Urve

    2009-01-01

    KPMG korraldatud ülemaailmne finantsjuhtide küsitlus näitas, et vaatamata juba tehtud kärbetele plaanivad organisatsioonid lähiaastatel kulusid veel kuni 25 protsendi ulatuses vähendada. Juba tehtud ja plaanitavaid kulude kärpeid kommenteerivad Eesti ettevõtete juhid

  19. Hetkehitt : Rihanna feat. Jay-Z "Umbrella". Mikk Saar rootslaste lahjendatud versioonis. Kilehäälne Stelle trummari tehtud meigiga / Piret Järvis

    Index Scriptorium Estoniae

    Järvis, Piret, 1984-

    2007-01-01

    Laulust. Heliplaadist "See on see". Psühhedeelset power-poppi viljelevast ansamblist Stella, debüütplaadi "First Kiss" esitluskontserdist 18. mail Tallinnas üritusel Mutant Disco (bändi lugusid saab kuulata: www.myspace.com/stellatallinn)

  20. Praegust mälubuumi iseloomustab utoopiliste tulevikuvisioonide puudumine : intervjuu Jeffrey Olickuga / Jeffrey Olick ; küsitles Siobhan Kattago, inglise k. tõlkinud Piret Peiker

    Index Scriptorium Estoniae

    Olick, Jeffrey

    2007-01-01

    Virginia Ülikooli sotsioloogia- ja ajalooprofessor Jeffrey K. Olick on kollektiivse mälu uurimise vallas kujunemas üheks tänapäeva kõige tuntumaks ja viljakamaks autoriks. Jeffrey Olick osales ettekandega Tallinna Ülikooli teadussümpoosionil "Kellele kuulub mälu?" ja TLÜ suvekoolis "Kuidas kollektiivid mäletavad?" Temaga vestles kollektiivsest mälust sotsioloogiadoktor ja TLÜ Eesti Humanitaarinstituudi dotsent Siobhan Kattago

  1. Kohus elab meis endis edasi, kõik elab meis edasi / Pärt Uusberg ; interv. Piret Linnamägi

    Index Scriptorium Estoniae

    Uusberg, Pärt

    2008-01-01

    Coca-Cola Plazas kuulutati välja uue filmiauhinna "Hää film 2007" laureaadid. Nominentide hulgas oli ka Raplamaa noormees Pärt Uusberg, kes mängis filmis "Klass" üht peaosalist. Endast, filmist, koolielust, filmi püstitatud teemadest

  2. Järelevalveorgan avatud ja suletud aktsiaseltsis : [bakalaureusetöö] / Piret Eelmets ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Eelmets, Piret

    2006-01-01

    Juhtorgan aktsionäride esindajana ja äriühingu eesmärkide täitjana, äriühingu juhtimise struktuurid, järelevalveorgani pädevusala kujundamine äriseadustiku põhjal, avatud äriühingu nõuete sobivus suletud aktsiaseltsile

  3. Sometimes we'll have to prove that we're not crocodiles : evangelical Christians' stigmatisation as sectarians in a Komi village / Piret Koosa

    Index Scriptorium Estoniae

    Koosa, Piret

    2015-01-01

    Artiklis käsitletakse teatud sotsiaalseid pingeid mis on kaasnenud religioosse pluralismiga Venemaa postsotsialistlikus ühiskonnas. Täpsemalt uuritakse Komi näitel evangeelsete kristlaste katseid end kehtestada traditsiooniliselt ortodoksses keskkonnas

  4. Kadi Pärnits : tööõnnetuste hüppeline kasv Eestis on tingitud ministri saamatusest / Piret Pert

    Index Scriptorium Estoniae

    Pert, Piret

    2006-01-01

    Riigikogu sotsiaalkomisjoni aseesimees Kadi Pärnits peab vajalikuks tööõnnetus- ja kutsehaiguskindlustuse eelnõu toomist Riigikokku. Tema sõnul ei võimalda nõukogude ajast pärit süsteem tööõnnetuse ohvritele elementaarset kaitset, normaalset ravi ega tööõnnetushüvitist

  5. Soomes kolleeg, Eestis kollanokk / Fogel, Kristina; Tilk, Piret; Pärgmäe, Pille; Kiivet, Raul-Allan ; intervjueerija Krister Kivi

    Index Scriptorium Estoniae

    2004-01-01

    Tartu Ülikooli arstiteaduskonna üliõpilased põhjendavad, miks nad ei soovi Eestis residentuuri astuda, vaid hoopis Soome tööle lähevad. Residentuurisüsteemi prodekaan professor Raul-Allan Kivet selgitab, miks noored arstid peavad pärast ülikooli lõpetamist mitmeid aastaid pisikese palga eest praktiseerima

  6. Dicty_cDB: CHF347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AATTAAAAAAATTAAATTAAATTAAATAGTTAAAAATAAA sequence update 2002.10.25 Translated Amino Acid sequence nikekes*r...kll*nlvnsslwlvinn*vyiynkkkn*kn*iklns*k* Frame B: nikekes*rg*hctinq*YSLIIKYLIKFNFIYIYKKMKTIKSLFLLSLLIVNLLISST

  7. Kuidas me Fontesega mulle arenguplaani tegime / Viktoria Korpan

    Index Scriptorium Estoniae

    Korpan, Viktoria, 1976-

    2005-01-01

    Ajakirja Director ja konsultatsioonifirma Fontese koostöös läbiviidud eksperimendist, mille käigus ajakirja tegevtoimetaja Viktoria Korpan pöördus firma inimresursside ja organisatsioonikonsultatsioonide ärisuuna juhi Piret Jamnese kui nõustaja poole konsultatsiooni saamiseks, et teha õige valik edasiõppimises osas. Kommenteerib Piret Jamnes

  8. Eesti sotsiaaluuringu palgaandmete ühilduvus Maksu- ja Tolliameti andmetega = Compatibility of the wages and salaries data recorded in the Estonian Social Survey and Estonian Tax and Customs Board database / Piia-Piret Eomois

    Index Scriptorium Estoniae

    Eomois, Piia-Piret

    2007-01-01

    Eesti sotsiaaluuring (ESU) on Euroopas rahvusvaheliselt harmoneeritud uuring sissetuleku ja vaesuse mõõtmiseks. Analüüs uurib võimalikku üleminekut Maksu- ja Tolliameti andmebaasi sissetulekuandmete kasutamisele ESU-s. Tabelid. Diagrammid

  9. Isikuandmete kaitse nõuete rikkumise sanktsioneerimine enne ja pärast Euroopa Liidu andmekaitsereformi valguses : magistritöö / Piret Muinast ; juhendaja: Julia Antonova, kaasjuhendaja: Jaan Sootak ; Tartu Ülikool, õigusteaduskond, karistusõi

    Index Scriptorium Estoniae

    Muinast, Piret

    2018-01-01

    Isikuandmete kaitse õiguslikust regulatsioonist tulenevalt Euroopa Liidu ja Eesti õiguskorrast, vastutusest isikuandmete nõuete rikkumisel Eestis, andmekaitse üldmäärusest tulenevatest sanktsioonidest ja jõustamismeetmetest

  10. Kes tahab elada raudtee ääres? : kortermajad Õie tn. 2 Nõmmel = WhoWants to Live Next to the Railway? : apartment buildings Õie St. 2 in Nõmme / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2005-01-01

    Kolm viie korteriga kolmekorruselist korterelamut. Projekteerija: Arhitektuuribüroo Pluss. Autor Indrek Allmann. Konstruktsioonid: E-Inseneribüroo. Detailplaneering: Koot & Koot. Projekt: 2003, valmis: 2005. Ill.: katusekorruse ja tüüpkorruse plaan, 5 värv. välisvaadet

  11. Koolipärimuse kogumisest Noarootsis ja Vormsis 2006. aasta kevadel : Rootsi-Eesti lastenaljade kogumik Det var en ko och det var poängen / Piret Voolaid

    Index Scriptorium Estoniae

    Voolaid, Piret, 1971-

    2007-01-01

    Autor käsitleb artiklis Ahvenamaa Põhjamaade Instituudi (Nordens Institut på Åland) eestvedamisel korraldatud lastepärimuse projekti, mille käigus koguti koolipärimust Soomest Ahvenamaalt ja Rootsist Gotlandilt ning Eestist endistelt rannarootsi aladelt. Kogutu põhjal ilmus rootsikeelne antoloogiline naljakogumik Det var en ko och det var poängen. Artiklis keskendutakse välitööde kogumismetoodikale ja tulemustele Eestis. Välitööd toimusid Noarootsi Koolis ja Vormsi Põhikoolis

  12. 14. VII avati Rael Arteli galerii fotoruumis...

    Index Scriptorium Estoniae

    2004-01-01

    Anu Allase kureeritud näitus "Juhitud reisid/Guided Tours". Näitusel osalevad Liisi Peets, Katrin Tees, Piret Räni, Anu Vahtra, Daisy Lappard, Tiit Sokk (Ulvi Tiit & Marili Sokk), Raivo Hool ja Rataplan

  13. Cozy up to a winter of reading

    Index Scriptorium Estoniae

    2005-01-01

    Tutvustus: Pumpurs, Andrejs. Bearslayer. Hamburg : A. Cropley, 2005 ; Mason, P. M. Puppet maker. P. M. Mason, 2005 ; Estonian folktales : the heavenly wedding / koost. Piret Päär & Anne Türnpu. Tallinn : Varrak, 2005

  14. Kahest nüüdismuusika neljapäevast : Anti Marguste, võeti tunnike tähelepanu / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    15. septembril Estonia kontserdisaalis sarjas "Lõunamuusika" toimunud kontserdist "Antimees, Anti Marguste 80", kus esinesid Pärnu Linnaorkester, RAM, Piret Aidulo (orel), Raivo Tafenau (saksofon), Jüri Alperteni ja Ants Sootsi dirigeerimisel

  15. Advendikontsert. Maria Listra jõulukontsert. Bachi "Jõuluoratoorium"kõlab Tartus ja Tallinnas

    Index Scriptorium Estoniae

    2008-01-01

    Vanemuise ooperikoori kontserdist (juhatab Piret Talts, orelil Aaro Tetsmann) 20. dets. Tartu Jaani kirikus. Maria Listra kontserdist 26. dets. Tallinnas Jaani kirikus. J.S. Bachi "Jõuluoratooriumi" ettekandest 28. dets. Tartu Jaani kirikus ja 29. dets. Tallinna Jaani kirikus

  16. Vene teatri interjööride restaureerimine ja sisekujundus : Vabaduse väljak 5, Tallinn = Renovation and redesign of the Russian Theatre interiors : Vabaduse väljak 5, Tallinn

    Index Scriptorium Estoniae

    2007-01-01

    Sisekujundajad Aivar Oja, Riin Luuk (ajalooline osa) ja Piret Bender (uus osa). Siseviimistluse, maalingute ja valgustite restaureerimine ja konserveerimine: KAR GruppS. Juurdeehitise arhitekt Ra Luhse. 5 värv. vaadet

  17. Keskkonnaministril pole plaani naftareostusega seoses tagasi astuda / Martin Hanson, Kadi Heinsalu

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2006-01-01

    Ministrite kommentaare naftareostust puudutava info edastamise kohta. Vt. samas: Piret Reiljan: Top Tankers Inc. polnud midagi kuulnud oma laevaga juhtunud õnnetusest. Lisa: Õnnetusest laeval tuli teade reedel. Sündmuste kronoloogia

  18. Reklaamitööstus teeb naise kehast universaalse märgi / Veljo Sepp

    Index Scriptorium Estoniae

    Sepp, Veljo

    2005-01-01

    Piret Räni ühiskonnakriitiline näitus "Hello friend, are you impotent?" Eesti Kunstiakadeemia galeriis. Näha digitrükis kollaazhipannood ning fotouurimus naise keha kasutamisest ruumis ja meedias

  19. Dom Stenboka ishtshet dlja sebja novõi obraz / Eva Kübar

    Index Scriptorium Estoniae

    Kübar, Eva

    2006-01-01

    Stenbocki majas asuva Riigikantselei stiiliraamatu koostamiseks ja visuaalse identiteedi loomiseks korraldatud konkursi võitis disainibüroo Identity. Visuaali aluseks on Stenbocki maja kui sümbol. Kommenteerib projektijuht Piret Rääk

  20. Vaimse tervise ümarlaud - ühisüritus vaimse tervise heaks / Lauraliisa Heidmets, Merike Sisask

    Index Scriptorium Estoniae

    Heidmets, Lauraliisa

    2009-01-01

    Ülevaade Eesti-Rootsi Vaimse Tervise ja Suitsidoloogia Instituudi (ERSI), sotsiaalministeeriumi ja Tervise Arengu Instituudi (TAI) korraldatud ümarlauast. Ettekannetega esinesid ka TLÜ sotsioloogia doktorandid Merike Sisask, Jing Wu, Piret Visnapuu ning prof. Airi Värnik

  1. Kallis müügitrikk laste arvel / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2010-01-01

    Piret Raua digitaalsest pildiraamatust lastele "Emma roosad asjad" (Suurbritannia : WingedChariot, 2010), mida on võimalik kasutada Apple´i elektroonikatoodetes iPad, iPhone ja iPod (eesti, inglise ja jaapani keeles)

  2. Killustatud toetusvõimalused panevad ettevõtja eri asutuste vahet jooksma / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2004-01-01

    Ettevõtluse Arendamise Sihtasutus, Põllumajanduse Registrite ja Informatsiooni Amet, konsultatsioonifirma BDA Estonia ning maakondlikud arenduskeskused jagavad toetusvõimaluste kohta erinevat informatsiooni. Kommenteerivad Kadri Ugand, Piret Arusaar, Heli Raamets ja Tiina Tarma

  3. Director murrab pead : Kuidas peatada firma allakäik? / Mari Kooskora

    Index Scriptorium Estoniae

    Kooskora, Mari, 1969-

    2008-01-01

    Küsimusele, kuidas majandusliku languse ajal, mitmete tipptegijate lahkumise ja ajakirjanduse tekitatud negatiivse fooni tõttu peatada ettevõtte allakäik, vastavad MarkIT tegevjuht Andres Agasild ja Personalipunkt Extra tegevdirektor Piret Korol

  4. Kümme kohtuotsust, mis on kõige enam mõjutanud Eesti majandust / Risto Vahimets

    Index Scriptorium Estoniae

    Vahimets, Risto, 1974-

    2007-01-01

    Sissejuhatus artikliseeriasse, mis annab ülevaate kümnest Eesti kohtuotsusest, mis on kõige enam mõjutanud Eesti majandust. Vt. samas: Luiga, Piret. Suurfirmad peavad maksma. // Director 2007 nr 1, lk. 47

  5. In Manhattan, the Roof of the World / Riho Lumi

    Index Scriptorium Estoniae

    Lumi, Riho

    2002-01-01

    Piret Loone töötab New Yorgis Manhattanil Sherman & Sterlingi õigusbüroos juristina; omab bakalaureusekraadi majandus- ja poliitikateadustes, magistrikraadi poliitikateadustes (Columbia ülikool) ja doktorikraadi äriõiguses (Harvardi ülikool)

  6. Snegurotshkad, plast ja punalipud ERKI moeshõul / Triin Thalheim

    Index Scriptorium Estoniae

    Thalheim, Triin, 1982-

    2005-01-01

    Sõna ja pildiga tutvustatakse Vene Kultuurikeskuses ERKI moeshõul esitatud Vassilissa, Kirill Safonovi, Kati Ilvese, Anna Roometi, Marte Kisandi, Pille Jürisoo, Karen Milistveri, Piret Paali, Erikka Bahnseni, Mikko Seppä, Hao Zhangi kollektsioone

  7. Inimnäoline ajalugu : medievist Marek Tamm tutvustab eesti keelde jõudnud inimesekeskseid mikroajalookäsitlusi / Marek Tamm

    Index Scriptorium Estoniae

    Tamm, Marek, 1973-

    2001-01-01

    Arvustus: Ginzburg, Carlo. Juust ja vaglad : ühe 16. sajandi möldri maailm /tlk. Viivika Atkin. Tln. : Varrak, 2000; Barokiajastu inimene / koost. Rosario Villari; tlk. Heete Sahkal, Heigo Sooman, Piret Peiker. Tln. : Avita, 2000

  8. 13. III avati Tartu lastekunstikooli galeriis basonautide...

    Index Scriptorium Estoniae

    2004-01-01

    Graafilise disaineri Lauri Järvlepa, fotograafide Lauri Kulpsoo ja Rena Puusepa, Mammuti (kodanikunimi Martin Rästa), kunstniku Mari Ainso, moekunstniku ja disaineri Piret Sootla ja õmbluskunstniku Trisaki näitus "Leaving Earth 2010". Rühmitus "Baas"

  9. Kliendikeskne innovatsioonikaart / Lance A. Bettencourt, Anthony W Ulwick

    Index Scriptorium Estoniae

    Bettencourt, Lance A.

    2008-01-01

    Autorid selgitavad, miks on klienditöö kaardistamine kliendiküsitlustest tähtsam. Lisad: Näide klienditöö kaardistamise kohta; Innovatsioonivõimaluste paljastamine. Kommenteerib innovatsioonikeskuse InnoEurope tegevjuht Piret Potisepp

  10. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  11. Aitame Väikemõisa lapsi!

    Index Scriptorium Estoniae

    2005-01-01

    Ajakiri Kroonika, reisifirma Horizon Travel ja popbändi Vanilla Ninja liider Piret Järvis kutsuvad üles aitama Viljandi lähedal asuvat Väikemõisa lastekodu, kus kasvab 36 pisikest vanemliku hoolitsuseta last

  12. Aitame Väikemõisa lastekodu!

    Index Scriptorium Estoniae

    2005-01-01

    Kroonika, Horizon Traveli ja Piret Järvise heategevusprojektist "Aitame lapsed muusika juurde" (jõulupeol 20. dets. Viljandi Kultuuriakademia muusikamajas teevad kaasa Dave Benton ja JZ Belle, esitusel Ülo Kriguli muusikaga jõulumuinasjutt "Uskumatu seiklus")

  13. Redhaus Piiteris

    Index Scriptorium Estoniae

    2009-01-01

    Kunstnike rühmitus Redhaus (Piret Peil, Kalle Aasamäe, Jane Remm) osaleb projektiga "Kangelased ja kaunitarid" 24. oktoobrist 8. novembrini Peterburis toimuval rahvusvahelisel näitusel "Sea level" Maneeži galeriis

  14. Mina-pilt ja kirjutamisoskus : põhikooli I aste / Anne Uusen

    Index Scriptorium Estoniae

    Uusen, Anne

    2001-01-01

    Minakontseptsioon, minakontseptsioon ja enesehinnang, meetodid minakontseptsiooni hindamisel. TPÜ algõpetuse õppetooli üliõpilane Piret Laup uuris oma bakalaureusetöös "Kuidas lapsed tunnetavad ennast kirjutajatena" 3. klasside õpilaste enesehinnangut ja mina-kontseptsiooni kirjutajatena

  15. Ehe seep Eesti moodi / Anneli Aasmäe

    Index Scriptorium Estoniae

    Aasmäe, Anneli, 1973-

    2008-01-01

    Produtsent Kristian Taska Kalev Spordis näidatav Venezuela seebiseriaali Eesti oludele mugandatud variant "Kalevi naised" : lavastaja Ingomar Vihman : osades Andrus Vaarik, Anne Reemann, Piret Kalda, Ken Saan jt.

  16. "OUT" elab edasi / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-

    1998-01-01

    "OUT'98". Kuraatorid Eve Kiiler, Piret Räni. Otsingutest videovallas (I. Helander, A. Nali, K. Sukmit, M. Laanemets, J. Zoova). Näidati ka Tokio vodeofestivalil hõbepreemia saanud R. Kelomehe videot "House". [þmobil]-galerii saatusest.

  17. Ilmar Külveti mälestusteose esitlus Tartus / Riina Kindlam

    Index Scriptorium Estoniae

    Kindlam, Riina, 1969-

    2005-01-01

    7. novembril 2005 Eesti Kirjandusmuuseumis. Kogumik pealkirjaga "Vana arm ei roosteta" ilmus ajakirjaniku 85. sünnipäevaks. Raamatuesitlusel esinesid Anne Valmas, Janika Kronberg, Vaike Külvet, Piret Noorhani

  18. DOCOMOMO cream. Modernismi valitud palad / Tiina Tammet

    Index Scriptorium Estoniae

    Tammet, Tiina, 1971-

    2000-01-01

    Raamatust:The modern movement in architecture : selections from the DOCOMOMO registers. Toimetajad Dennis Sharp ja Chaterine Cooke. Rotterdam : Publishers, 2000. Eesti funktsionalismist on teinud kokkuvõtte Piret Lindpere ja Mart Kalm

  19. Bud tvortsom v muzeje KUMU / Jelena Levtshenkova ; interv. Tatjana Lavrova

    Index Scriptorium Estoniae

    Levtshenkova, Jelena

    2006-01-01

    KUMU integratsiooniprogrammide kuraatoriga muuseumi haridusprojektidest. Muuseum pakub ligi 20 kunstiharidusprogrammi, meistriklasse, kursusi ja õpetust KUMU kunstikoolis. Hariduskeskust juhib Piret Kruusandi, haridusprogrammide kuraator on Anu Lüsi, kunstnik-metoodik Anu Purre ja assistent Kätlin Tischler

  20. 3D-animatsii na stroitelnom rõnke - eto elitnõi tovar / Priit Rum

    Index Scriptorium Estoniae

    Rum, Priit

    2006-01-01

    Praegu on 3D-visualisatsioonide põhilisteks tellijateks kinnisvaraarendajad ja arhitektuuribürood. Kommenteerivad Agor Eiskop, Indrek Tiigi, Margus Triibmann, Piret Piirsoo, Merle Väli. Ill.: Fahle maja, Allika t. 12 korterelamu ja Merirahu elamurajoon Tallinnas

  1. Viin, Hitler ja Oskar Luts / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2007-01-01

    Tutvustus: Saarikoski, Pentti. On või ei ole ; Euroopa serval ; Bretagne'i päevik / soome keelest tõlkinud Piret Saluri. Tallinn : Varrak, 2007 ; Kull, Aivar. Oskar Luts : pildikesi kirjanikupõlvest. Tartu : Ilmamaa, 2007

  2. [Marge Rennit. Eesti muuseumid / Estonian museums] / Tapio Mäkeläinen

    Index Scriptorium Estoniae

    Mäkeläinen, Tapio

    2009-01-01

    Tutvustus: Eesti muuseumid = Estonian museums / [Eesti Muuseumiühing ; koostaja Marge Rennit ; tõlkija Tiina Mällo ; toimetaja Ivi Tammaru ; eessõna: Piret Õunapuu ; kujundaja Marek Allvee]. Tallinn : Oomen, 2008

  3. Kirjutamise kergus / Toomas Raudam

    Index Scriptorium Estoniae

    Raudam, Toomas, 1947-

    1998-01-01

    Varem ilmunud: Postimees, 1997, 5. apr. Arvustus: Calvino, Italo. Ameerika loengud / tlk. Ülar Ploom. Tallinn : Varrak, 1996 ; Dinesen, Isak. Babette'i pidusöök / tlk. Piret Peiker. Tallinn : Varrak, 1996

  4. Study of growth kinetic and modeling of ethanol production by ...

    African Journals Online (AJOL)

    ... coefficient (0.96299). Based on Leudking-Piret model, it could be concluded that ethanol batch fermentation is a non-growth associated process. Key words: Kinetic parameters, simulation, cell growth, ethanol, Saccharomyces cerevisiae.

  5. Eesti Lastekirjanduse Keskuse hoone sisekujundus. Tallinn, Pikk 73 / Malle Jürgenson, Krista Lepland, Tea Tammelaan...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    3 korruse plaani, värv. välisvaade, 9 sisevaadet; fotod: Velvet Stuudiod; muinasjututoa aknaluuke kaunistavad Jüri Mildebergi loodud fantastilised tüübid, pööningukorrust kujundas Piret Mildeberg

  6. ERKI moesõu toob lavale beebid

    Index Scriptorium Estoniae

    2007-01-01

    13.01.2007 toimub Tallinnas Salme kultuurikeskuses moeetendus "Beebibissness ruulib!". Osaleb rootslane Daniel Ivarsson. Londonis tegutsev Piret Paal ja taanlane Anders Henk näitavad second hand riietest disainitud kollektsiooni

  7. Ka Eesti vajab oma pildiraamatuid / Anu Kalm

    Index Scriptorium Estoniae

    Kalm, Anu, 1960-

    2007-01-01

    Bologna lasteraamatumessist. IBBY (The International Board on Books for Young People) Eesti esindajatena olid messil Piret Raud ja Anu Kalm. Piret Raua tööd olid valitud rahvusvahelisele illustraatorite näitusele, mille aukülaline oli saksa illustraator Wolf Erlbruch. Eestit esindasid kolm raamatut IBBY rahvusvahelisel stendil. Kümme parimat raamatut ja viimase 40 aasta parimad raamatud olid eksponeeritud Bologna Ragazzi Award'i ülikooli raamatukogus

  8. 10.-14. II on Puhta Rõõmu alaliiduna tuntud...

    Index Scriptorium Estoniae

    2004-01-01

    Lõkerdus- ja tegevuskunstikollektiiv Naeruorgesster ehk Laffing ahkestra - dirigent Erki Kannus, lõkerdajad Ivika Kivi, Piret Räni, Merle Kannus, Maris Mändel, Marge Monko, Aino Sepp, Annika Kaljurand, Anya Ronacher - esines 11. II Stockholmis Moderna Museeti taasavamispidustuste raames, 12. II osaleti tegevuskunstiprogrammis "Source Live 2004". Aprillis oodatakse kollektiivi Varssavisse Zacheta galerii näitusele "Poisid ja tüdrukud" (16. II-4. IV), kus esitatakse Piret Räni ja Anu Vahtra videot "Punk.Fem.Collection"

  9. Electron emission during interactions of multicharged N and Ar ions with Au(110) and Cu(001) surfaces

    International Nuclear Information System (INIS)

    Meyer, F.W.; Overbury, S.H.; Havener, C.C.; Zeijlmans van Emmichoven, P.A.; Burgdoerfer, J.; Zehner, D.M.

    1991-01-01

    We report measurements of energy distributions of electrons emitted during interactions 10q-keV N 6+ , and Ar q+ (q=7,8,9) ions with Au(110) and Cu(001) surfaces at grazing angles. The electron energy distributions have been measured as a function of angle of incidence, observation angle, and target-crystal azimuth. For both Au and Cu targets, the projectile KLL Auger peak observed for the case of the N 6+ projectiles is seen to consist of two components whose intensities have strikingly different dependences on incident perpendicular velocity. The main component of the KLL peak is attributed to subsurface electron emission and is modeled using a Monte Carlo simulation of the projectile trajectories in the bulk. The second component, observed only for the smallest incident perpendicular velocities, is attributed to above-surface KLL Auger electron emission and is modeled using computer simulations of the resonance neutralization-autoionization cascade that occurs prior to projectile penetration of the surface. In the case of the Au target, NNV and NVV transitions, attributed to vacancy transfer from the projectile K shell to the N shell of Au, are also observed. The Monte Carlo simulation of the subsurface contribution to the electron emission is able to reproduce the observed angle-of-incidence dependence of both the projectile and the target Auger electron intensities. In addition, it shows reasonable agreement with the observed dependences of the projectile KLL intensity on observation angle and crystal azimuth

  10. On the formation of hollow atoms in front of an insulating LiF surface

    NARCIS (Netherlands)

    Limburg, J; Hoekstra, R; Morgenstern, R; Kurz, H; Vana, M; Aumayr, F; Winter, HP

    KLL Auger spectra of hydrogenic (Is) N, O and Ne ions impinging on an insulating LiF(100) single crystal are presented. Beam energy and incident angle have been varied such that the lowest possible velocity towards the target is achieved, at the same time varying the velocity parallel to the target

  11. The K Auger spectrum of krypton from the 83Rb decay

    International Nuclear Information System (INIS)

    Kovalik, A.; Gorozhankin, V.M.; Novgorodov, A.F.

    1990-01-01

    The K Auger spectrum of krypton was analyzed at the instrumental resolution of 6.5 eV using the evaporated 83 Rb source. The energies and relative intensities of the KLL-, KLX-, and KMX- Auger transitions were determined as well as the natural energy widths some of them. The results were compared with the theoretical predictions. 31 refs.; 3 figs.; 6 tabs

  12. Electron spectroscopy studies of argon K-shell excitation and vacancy cascades

    International Nuclear Information System (INIS)

    Southworth, S.H.; MacDonald, M.A.; LeBrun, T.; Azuma, Y.; Cooper, J.W.

    1995-01-01

    Electron spectroscopy combined with tunable synchrotron radiation has been used for studies of Ar K-shell excitation and vacancy decay processes. In addition, electrons and fluorescent X-rays have been recorded in coincidence to select subsets of the ejected electron spectra. Examples are presented for Ar 1s photoelectrons and KLL and LMM Auger spectra

  13. TÜ, TPÜ ja EHI uusi magistreid / Eda Tursk, Hille Roots, Heidi Meier

    Index Scriptorium Estoniae

    Tursk, Eda

    2004-01-01

    Tartu ülikooli eesti ja soome-ugri keeleteaduse osakonnas ning kirjanduse ja rahvaluule osakonnas kaitsesid 2003.a. magistritööd Niina Aasmäe, Piret Voll, Larissa Degel, Reet Hendrikson, Tiina Pai, Petar Kehayov, Anna Baidullina, Katrin Ennus, Kristi Jõesaar, Ell Vahtramäe, Lauri Sommer, Andreas Kalkun, Mirjam Hinrikus, Kristel Nõlvak. Tallinna Pedagoogikaülikoolis kaitsesid 2003.a. magistritööd Sirje Nootre, Merike Mägedi, Tiiu Koovit, Heidi Meier, Jaanika Stackhouse, Lilian Ossi, Annika Vamper, Marika Mikkor, Piret Õunapuu, Helin Puksand, Taimi Rosenberg. Eesti Humanitaarinstituudis kaitses 2003.a. magistritööd Merilin Miljan

  14. Elulähedus enne ja nüüd / Marin Roose

    Index Scriptorium Estoniae

    Roose, Marin

    1991-01-01

    Kirjandusmuuseumi kevadsessioon 24. ja 25. mail Nüplis. Ülevaade ettekannetest: Piret Noorhani "Tagasi maailma lõpust", Mihkel Volt "Romantiline kunstnikumüüt ja orbiitlus", Marin Laak "Eesti kirjanikud eluläheduse kaevikuis", Pekka Erelt "Sõda A. Kivikase loomingus", Toomas Muru "Marginaale arbujate elulähedasest vaimulähedusest", Arne Merilai "Lähemale elulähedusele", Peeter Olesk "Vaimulähedus 1960. aastatel. Aga elu?", Piret Viires "Haiguste ravi, kontrollitud, Eesti noor proosa ja elulähedus"

  15. Quantitative Auger depth profiling of LPCVD and PECVD silicon nitride films

    International Nuclear Information System (INIS)

    Keim, E.G.; Aite, K.

    1989-01-01

    Thin silicon nitride films (100-210 nm) with refractive indices varying from 1.90 to 2.10 were deposited on silicon substrates by low pressure chemical vapour deposition (LPCVD) and plasma enhanced chemical vapour deposition (PECVD). Rutherford backscattering spectrometry (RBS), ellipsometry, surface profiling measurements and Auger electron spectroscopy (AES) in combination with Ar + sputtering were used to characterize these films. We have found that the use of (p-p)heights of the Si LVV and N KLL Auger transitions in the first derivative of the energy distribution (dN(E)/dE) leads to an accurate determination of the silicon nitride composition in Auger depth profiles over a wide range of atomic Si/N ratios. Moreover, we have shown that the Si KLL Auger transition, generally considered to be a better probe than the low energy Si LVV Auger transition in determining the chemical composition of silicon nitride layers, leads to deviating results. (orig.)

  16. Molecular effects in carbon K-shell Auger-electron production by 0.6-2.0 MeV protons and extraction of an atomic cross section

    International Nuclear Information System (INIS)

    McDaniel, F.D.; Lapicki, G.

    1987-01-01

    Carbon K-shell Auger-electron production cross sections are reported for 0.6-2.0 MeV protons incident on CH 4 (methane), C 2 H 2 (acetylene), C 2 H 4 (ethylene), C 2 H 6 (ethane), n-C 4 H 10 (normal butane), i-C 4 H 10 (isobutane), C 6 H 6 (benzene), CO (carbon monoxide), and CO 2 (carbon dioxide). A constant-energy mode 45 0 parallel-plate electrostatic analyzer was used for detection of Auger electrons. The carbon KLL Auger-electron cross sections for all molecules were found to be lower than that found for CH 4 by 9-23%. All carbon KLL Auger-electron data could be brought into agreement when corrected for the chemical shift of the carbon K-shell binding energy in molecules and for intramolecular scattering. KLL Auger-electron production cross sections are compared to first Born and ECPSSR theories and show good agreement with both after the chemical shift of the carbon K-shell binding energy in molecules and the effects of intramolecular scattering are considered. (orig.)

  17. Suur rahvusvaheline välisbalti arhiivide konverents südasuvises Tartus / Mai Raud-Pähn ; fotod Madis Laas

    Index Scriptorium Estoniae

    Raud-Pähn, Mai, 1920-

    2006-01-01

    Ettekannetega esinesid: Tiiu Kravtsev, Riina Reinvelt, Juta Kivimäe, Piret Noorhani, Merike Kiipus, Anu Korb, Anne Valmas, Mihkel Volt, Mare Rand, Inga Kuljus, Enn Mainla, Roland Weiler, Teas Tanner, Tiina Kirss, Jüri Kivimäe, Enda-Mai Michelson-Holland, Andrae, Carl Göran, Katrin Meerits ja Maie Barrow

  18. Parimatest parimad selguvad Tartus / Mariann Märtsin

    Index Scriptorium Estoniae

    Märtsin, Mariann

    2004-01-01

    Rahvusvahelise konsultatsioonifirma Hewitt Associates uuringust "Parimad tööandjad - parimad tulemused" (Best Employers - Best Results). Lisa: Uuring. Raivo Hellerma, Piret Põldre, Milvi Tepp vastavad küsimusele, miks nad osalesid tööandjate uuringus. Vt. samas: Uuringus osalesid

  19. Two Close Ones / Tiina Sarapu

    Index Scriptorium Estoniae

    Sarapu, Tiina

    2006-01-01

    Tallinna IV tarbekunstitriennaalist "Kaks lähedast" Eesti Tarbekunsti- ja Disainimuuseumis 18.03-21.05.2006. Esimese preemia said Kersti Laanmaa ja Tiit Rammul rühmitusest MUKI, teise preemia Caro Bärtling ja Piret Valk. Aukülaliseks inglise ehtekunstnik Wendy Ramshaw oma ehtesarjaga "Picasso's Ladies". Näituse kujundas 3+1 Arhitektid

  20. Fermentative production and kinetics of cellulase protein on ...

    African Journals Online (AJOL)

    AJB SERVER

    2006-10-16

    Oct 16, 2006 ... various carbon sources on the production of cellulase using strains of T. reesei QM 9414, 97.177 and Tm3. Pretreatment of sugarcane ... of cellulose chains; endo-1,4-β-D-glucanses which cleave internal glucosidic bonds ..... production, the Leudeking piret model (Rakshit and Sahai, 1991) was developed.

  1. Eesti kunstimaailm... / Ivika Kivi ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Kivi, Ivika

    2007-01-01

    Uus kuraator Ivika Kivi Grazi meediakunsti laborist, kus 3. IV avati Mare Tralla näitus "Her. Space", kuraatori võimalustest ja labori tulevikuplaanidest. Kavas on Piret Räni näitus "Hello Friend, Are You Impotent" (avamisel naiskunstnike seltsi Puhas Rõõm performance) ja Eve Kiileri näitus "Everyman Time Machine"

  2. Küülikud jooksus ja jumal surnud : eesti lasteproosa tipud on "kuldaja" autoritega võrdväärsed / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2005-01-01

    Arvustus: Raud, Piret. Ernesto küülikud. Tallinn : Tänapäev, 2004 ; Soans, Kerttu. Kruubi-Ruudi ja tema inimesed. Puhja : Väike Vanker, 2004 ; Kivirähk, Andrus. Limpa ja mereröövlid. Tallinn : Varrak, 2004 ; Sauter, Peeter. Laste raamat / Rull ja Ekke ja Pipa ja Peeter Sauter. Tallinn : Huma, 2004

  3. Igal puul oma õunad ehk Kõnekäände mitmel teemal : [uusi raamatuid rahvapärastest ütlustest] / Asta Õim

    Index Scriptorium Estoniae

    Õim, Asta, 1943-

    2002-01-01

    Arvustus: Tere, tere, teid ma tunnen ...: Soove, tervitusi, tänamisi / koost. Anne Hussar. Tallinn, 2002 ; Elevant voodi all, voodi lae all : keerdküsimusi loomadest / koost. Piret Voolaid. Tallinn, 2002 ; Mis sa soiud, võta soodat! : Sajatusi, osatusi, parastamisi / koost. Anneli Baran. Tallinn, 2002

  4. Kinoteater tuleb tagasi / Harry Liivrand, Karin Paulus

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2006-01-01

    Tallinnas Vabaduse väljaku ääres asuvast renoveeritud kino Gloria Palace'i ehk Vene Teatri hoonest (arhitekt Fridrihs Skujinsh, fassaadireljeefide autor Jaan Koort). Renoveerimist juhtisid arhitekt Ra Luhse, sisearhitektid Aivar Oja, Riin Luuk ja Piret Bender ning sisekujundaja Margus Sulengo

  5. Maakondliku Liivide etluskonkursi võitis gümnasist Marian Heinat / Ene Kallas

    Index Scriptorium Estoniae

    Kallas, Ene

    2008-01-01

    Maakondliku Juhan ja Jakob Liivi etluskonkursi žüriisse kuulusid Ott Aardam, Käthe Pihlak, Piret Rauk, Vaido Luks ja Marili Pärtel. Grand prix' võitis Marian Heimat, laureaatideks tulid Liisa Saaremäel, Maria Pihlak ja Laura Oolup. Eripreemiad said Marii Metsmaa, Ermo Loik, Sander Aavik, Kaimar Nuut ja Priidu Aardam

  6. Vanilla Ninjast saab vene bänd / Viktoria Ladõnskaja

    Index Scriptorium Estoniae

    Ladõnskaja, Viktoria, 1981-

    2007-01-01

    Plaadifirmalt Topten Vanilla Ninja lepingu ära ostnud jurist Aleksander Simakov kuulutab välja konkursi bändi uute tüdrukute leidmiseks, bänd koosseisus Piret Järvis, Lenna Kuurmaa ja Katrin Siska kavatsevad ka Vanilla Ninja nime all jätkata

  7. Ilmus esimene mahukam eestikeelne teatriajaloo ülevaade / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2007-01-01

    25. jaan. esitleti Eesti Teatriliidus "Oxfordi illustreeritud teatriajaloo" eestikeelset versiooni. Tõlkeraamatu aluseks on 1995. aastal kirjastuses Oxford University Press ilmunud samanimeline raamat, mille koostajaks on John Russell Brown. Teose on tõlkinud Anne Lange, Ilona Kolberg, Piret Kruuspere, Kristjan Jaak Kangur

  8. Eesti Maanteemuuseumi välialad : avalik maastikuarhitektuuri ideekonkurss = Public Landscape Architectural Idea Competition "Outdoor Spaces of the Estonian Highway Museum" / Toomas Muru

    Index Scriptorium Estoniae

    Muru, Toomas, 1970-

    2004-01-01

    Põlvamaal, endises Varbuse hobupostijaamas avatava Eesti Maanteemuuseumi välialade konkursi eesmärgist, tingimustest, žürii koosseisust, premeeritud töödest. Preemiad: I - Margit Kärner, II - Karli Luik, Ralf Lõoke ja Maarja Kask, III - Taavi Kuningas, Andrus Padu ja Martin Prommik, ergutuspreemiad - Piret Looveer ja Remi Kübar ning Maria Pukk ja Ivar Lubjak

  9. Noortest, tööst ja Ida-Virumaast / Aldis Alus

    Index Scriptorium Estoniae

    Alus, Aldis, 1967-

    2012-01-01

    Sisekaitseakadeemia politsei- ja piirivalvekolledži lõpetanu Julia Vesjolkina lõputööst: "Sisekaitseakadeemia lõpetanud kadettide valmisolek asuda tööle Ida-Virumaale" (2012); juhendaja Piret Teppan. Politsei- ja Piirivalveameti Ida prefekti selgitused prefektuuri personalipoliitika kohta

  10. Uue mängufilmi võtted / E. K.

    Index Scriptorium Estoniae

    E. K.

    2008-01-01

    Allfilm koos Saksa, Soome ja Iiri partneritega alustas Tallinnas action-mängufilmi "Kid & Killer" võtteid (režissöör Hannu Salonen, stsenaristid Mart Kivastik ja Katrin Laur, operaator Rein Kotov, produtsent Piret Tibbo-Hudgins)

  11. Varem olin ma mänginud kooliteatris vaid puud / Jaanus Kulli

    Index Scriptorium Estoniae

    Kulli, Jaanus, 1955-

    2008-01-01

    Allfilm koos Saksa, Soome ja Iiri partneritega alustas Tallinnas action-mängufilmi "Kid & Killer" võtteid (režissöör ja üks stsenariste Hannu Salonen, stsenaristid Mart Kivastik ja Katrin Laur, operaator Rein Kotov, peaprodutsent Piret Tibbo-Hudgins). Ühte peaossa valiti Westholmi gümnaasiumi õpilane Mart Müürisepp

  12. Viru keskuses plahvatab mitu päeva järjest / Ants Vill

    Index Scriptorium Estoniae

    Vill, Ants, 1955-

    2008-01-01

    Allfilm koos Saksa, Soome ja Iiri partneritega alustas Tallinnas action-mängufilmi "Kid & Killer" võtteid (režissöör Hannu Salonen, stsenaristid Mart Kivastik ja Katrin Laur, operaator Rein Kotov, produtsent Piret Tibbo-Hudgins). 24-25. märtsil filmitakse Viru Keskuses

  13. Kosmosest maa peale / Alina Kurvits

    Index Scriptorium Estoniae

    Kurvits, Alina

    2004-01-01

    Eesti noorte moeloojate võistlusest "Supernoova 2004". Üksikute finalistide kollektsioonide iseloomustus - Heleliis Hõim, Kati Ilves, Lemmiki Ehatamm, Triin Kaiv, Kaisa Reimand, Marin Sild, Maria Ossadtsaja, Kris Lemsalu, Ingel Undusk, Mari Hiietamm, Kaspar Paas, Maarja Metspalu, Kätlin Kaljuvee, Marje Mõttus, Julia Korovina, Külli-Kerttu Siplane,Piret Paal, Raili Nõlvak, Oksana Tandit, Vassilissa Shehovtsova

  14. Eesti lastefilm räägib üksikutest lastest ja üksikutest vanematest / Jürgen Rooste, Marko Martinson

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2006-01-01

    Lastefilm "Ruudi" : stsenaristid Katrin Laur, Aare Toikka, Aarne Mägi : režissöör Katrin Laur : nimiosas lapsnäitleja Paul Oskar Soe : produtsent Piret Tibbo-Hudgins : operaator Rein Kotov : kunstnik Toomas Hõrak : Allfilm - MRP Matila Röhr Productions - Schmidtz Katze Filmkollektiv 2006

  15. Offshore-müüja Raivo Karu pääses rahapesusüüdistustest / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2005-01-01

    Riigiprokuratuur lõpetas offshore-kontorit pidanud, riskifondides raha keerutanud ja kahte võltspassi kasutanud mehe kriminaalasja kuna maksukuriteod olid aegunud ja rahapesujuhtumeid ei leitud. Vt. samas: Riigiprokurör Piret Paukshtys: valenimesid võib edasi kasutada; Suurim rahapesu-uurimine Eesti maksuajaloos

  16. Eesti ehted Firenzes

    Index Scriptorium Estoniae

    2005-01-01

    Galeriis Le Arti Orafe on avatud kuue nimeka Euroopa ehtekoolkonna näitus "Chroma". Eestist on töödega esindatud Andrus Rumm, Eve Margus-Villems, Julia-Maria Pihlak, Kertu Tuberg, Kristiina Laurits, Kärt Maran, Maarja Niinemägi, Merle Kasonen, Piret Hirv, Tanel Veenre

  17. Eesti ehe Hollandis

    Index Scriptorium Estoniae

    1999-01-01

    12. dets.-ni Hollandis, Nijmegeni linnas Galeerie Marzees noorte eesti ehtekunstnike näitus 'Õhu lossid', mida on spondeerinud ka Charon Kransen New Yorgist. Esinevad Tanel Veenre, Katrin Sipelgas, Villu Plink, Kristiina Laurits, Piret Hirv, Eve Margus ning õppejõud Kadri Mälk

  18. Kunstirühmitus tegi esiknäituse

    Index Scriptorium Estoniae

    2004-01-01

    Aasta koos töötanud rühmitus "Baas" avas näituse "Leaving Earth 2010" Tartu Lastekunstikooli galeriis, eksponeeritud graafika, fotograafia, maalikunst ja rõivadisain. Rühmitusse kuuluvad Lauri Kulpsoo, Piret Sootla, Lauri Järvlepp, Rena Puusepp, Triin Isak (Trisak), Martin Rästa (Mammut), Mari Ainso

  19. Eilne, tänane ja homne ehtekunst Marzees / Eilve Manglus

    Index Scriptorium Estoniae

    Manglus, Eilve, 1977-

    2004-01-01

    Euroopa ehtekunstikoolide lõputööde väljapanek Marzee galeriis kuni 6. X. Kuraator Manuel Vilhena. Eestit esindanud Kertu Tubergi, Maarja Niinemäe ja Epp Perteli ning Bas Boumani, Jantine Bindelsi (Holland) ja Andrew Lambi (London) töödest. Marzee kollektsiooni kuuluvad EKA lõpetanud ehtekunstnike Villu Plingi, Piret Hirve ja Kristiina Lauritsa ehted

  20. Möllavad (nais)hormoonid / Margus Kiis

    Index Scriptorium Estoniae

    Kiis, Margus

    2004-01-01

    Fideelia (Signe-Fideelia Roots) maalinäitus "Kurjaloomakobrikas" (5.-16. IV), Anna Kainulaineni maalinäitus "Keha, tants ja mäng" (6.-16. IV), Piret Räni fotonäitus "Punk.Fem" ja Die (Diana Ostrat) fotoinstallatsioon "Müsteerium 35 aktis" (kuni 2. V) Y-galeriis

  1. Eestlased võtsid aktiivselt osa uue linnapargi avamisest / fotod: Michael Dulics, Madis Alvre

    Index Scriptorium Estoniae

    2006-01-01

    Sydney Eesti Maja lähedal avati 18. novembril Harmony nimeline linnapark. Avamisele olid kutsutud kohalikud rahvusgrupid, sealhulgas Eesti Arhiiv Austraalias ning eesti lauljad, tantsijad. Eestlased esinesid kolme rahvatantsuga Piret Hinrikus Sage juhtimisel, lauluansambel "Lõke" esitas rahvaviise ja rahvatantsurühm "Virmalised" tantse.

  2. Valge villa / Karen Jagodin ; kommenteerinud Krista Aren, Emil Urbel

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2009-01-01

    Villa (623 m² + kelder) Merirahu elamurajoonis Tallinnas. Arhitektid: Emil Urbel, Andrus Mark (AB Emil Urbel OÜ). Sisearhitektid: Krista Aren, Mati Veermets. Inseneriosad: AS Meistri Projekt. Haljastaja: Piret Kukk. Projekt: 2005-2008, valmis: 2009. Villa madalamat osa katab murtud pinnaga graniit, kõrgemat valge krohv

  3. München 2006 : Ehe / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    2006-01-01

    Münchenis igal kevadel toimuvast ehtesündmusest "Schmuckszene" ehk "Ehtelava". 2006. aastal said preemiad Annamaria Zanella Itaaliast, Annelies Planteijdt Hollandist ja Bernhard Schobinger Šveitsist. Eestit esindasid Piret Hirve ja Tanel Veenre tööd

  4. Ehe 2007, stseen Münchenist / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    2007-01-01

    Saksamaal Münchenis toimunud ehtekunsti suursündmusest "Schmuckszene". Eestit esindas ehtekunstnik Piret Hirv. Lühidalt hollandi ehtekunstnike Gijs Bakkeri ja Iris Nieuwenburgi, jaapani-austraalia ehtekunstniku Mari Funaki ja saksa ehtekunstniku Karl Fritschi loomingust. Rühmituse FFFF väljapanekust "Luba kasvada suureks"

  5. Mentor riietab hinge lahti

    Index Scriptorium Estoniae

    2008-01-01

    Küsimusele, mida ootavad mentorid neilt, kellele nad toeks astuvad, vastavad Nelli Sudnitsõna, Jaan Allem, Anti Orav, Erkki Susi, Margus Rink, Aavo Kokk, Janeck Uibo. Lisa: Fontese mentoriprogramm - esimene omalaadne Eestis. Kommenteerivad Tiiu Allikvee ja Piret Jamnes. Vt samas: Mida arvavad asjast menteed? Kommenteerivad Kaidi Kuusmaa ja Gristel Tali

  6. Küsimus koostööpartneritele : Mis seostub teile juhtimiskonverentsi sloganiga "Everything is possible"?

    Index Scriptorium Estoniae

    2006-01-01

    Küsimusele vastavad: A. Le Coq Tartu Õlletehase turundusjuht Katrin Vernik, EMT turundusdirektor Piret Mürk, Olympic Entertainment Groupi turundusdirektor Katre Kaarenperk-Vanatoa, Hewlett-Pacard Eesti filiaali juhataja Tõnis Mäe, Baltic Logistic System Eesti AS tegevjuht Tarmo Tael ja Skype Eesti juht Sten Tamkivi

  7. Eesti kirjandus 1997

    Index Scriptorium Estoniae

    1998-01-01

    Aut.: Märt Väljataga, Mart Velsker, Barbi Pilvre, Indrek Särg, Tarmo Vahter, Piret Viires, Tõnu Kaalep, Janika Kronberg, Lauri Sommer, Sven Kivisildnik, Eve Annuk, Aarne Ruben, Jan Kaus, Karl Martin Sinijärv, Jüri Ehlvest, Hasso Krull

  8. Kirjad Paduasse / Marijke Vallanzasca ; tõlkinud Mart Rummo

    Index Scriptorium Estoniae

    Vallanzasca, Marijke

    2010-01-01

    Eesti ehtekunstinäitus Marijke Studios Paduas 23. 04.-30. 06. 2010. 17 osalejat loetletud. Eksponeeritud oli 69 ehteobjekti, ilmus kataloog. Kadri Mälgu, Piret Hirve, Tanel Veenre, Villu Plingi, Eve Margus-Villemsi, Kristiina Kibe ja Kertu Tubergi töödest

  9. Kuidas värvata tarka juhti?

    Index Scriptorium Estoniae

    2007-01-01

    Tipp- ja kesktaseme juhtide värbamisest räägivad: Piret Lukk SEB Eesti Ühispangast, Kaidi Kask Rautakesko AS-ist, Sven Suurraid ja Riina Beljajeva Express Post AS-ist, Sirje Tammiste omanimelisest konsultatsioonibüroost, Ursula Muddi Nordnet Eesti AS-ist ja Ülle Matt Elcoteq Eesti AS-ist

  10. ÕhuLoss - ehtides maailma / Pekka Erelt

    Index Scriptorium Estoniae

    Erelt, Pekka, 1965-

    2011-01-01

    Ehtekunstnike rühmitusest õhuLoss (Kadri Mälk, Piret Hirv, Eve Margus-Villems, Tanel Veenre, Kristiina Laurits, Villu Plink, Katrin Sipelgas). Esimest korda astus rühmitus üles 10 aastat tagasi Hollandis Marzee galeriis toimunud näitusel. 2011. aasta augustis-septembris toimus näitus Tallinna Põhjatuletornis

  11. Eesti oli Baltimaade raamatukonkursil võidukas

    Index Scriptorium Estoniae

    2003-01-01

    Peapreemia: Toots, Villu. Kiri eesti kultuuriloos; lasteraamatutest peeti auhinnavääriliseks: Märjamaa, Leelo. Cupido & Psyche / jutustanud [ja kaane disain:] Leelo Märjamaa ; illustreerinud Sveta Aleksejeva. Tallinn : Draakon & Kuu, 2002; Pervik, Aino. Draakonid võõrsil : [jutustus] / illustreerinud Piret Raud. [Tallinn] : Tiritamm, 2002; vt. ka Postimees, 28. veebr. lk. 18

  12. Veel kord KLS-i muutmise eelnõust / Sirje Kessler

    Index Scriptorium Estoniae

    Kessler, Sirje

    2010-01-01

    Vastukaja artiklile: Uluots, Piret. Kui me ise end ei aita, ei aita meid keegi. Õpetajate Leht (2010) 19. märts, lk. 5. Koolieelse lasteasutuse seaduse muutmise seaduse eelnõuga tahetakse muuta lasteasutuse rühmade vanuselist liigitust

  13. Tartu Ülikool raamatukogus / Tiina Tammet

    Index Scriptorium Estoniae

    Tammet, Tiina, 1971-

    2005-01-01

    Kuni 13 II näitus "R.A.I.S.K." (Radikaalne Agiteeriv Intrigeeriv Sotsiaalne Kunst). Krutskilist ökokunsti teevad Infotankistid, Puhas Rõõm, Piret Räni, Maris Suits, Katrin Tees, Anu Vahtra, Mart Viljus, Ivika Kivi & Sulo Kallas, Taavi Suits, Kai Herkel ja Henry van Noordenburg

  14. Põhjamaade ehtekunst

    Index Scriptorium Estoniae

    2002-01-01

    Tarbekunstimuuseumis II Põhjamaade ehtekunsti triennaal. Kujundaja Castello Hansen. Eesti ehtekunsti esindavad Piret Hirv, Eve Margus Villems, Maria Valdma, valiku pani kokku Kadri Mälk. Uuenduseks ühe klassiku, rootsi kunstniku Torun Bülow Hübe loomingu eksponeerimine

  15. Ilmusid Rahvusraamatukogu uuenenud toimetised / Mihkel Volt

    Index Scriptorium Estoniae

    Volt, Mihkel

    2009-01-01

    Tutvustus: Ajalookirjutaja aeg = Aetas historicorum / Eesti Rahvusraamatukogu ; koostanud Piret Lotman. (Eesti Rahvusraamatukogu toimetised, nr. 11). Tallinn, 2008 ; Teenuse kvaliteet – raamatukogutöö tulemuslikkuse näitaja = Service quality – library perfomance indicator / Eesti Rahvusraamatukogu ; koostanud Anne Veinberg. (Eesti Rahvusraamatukogu toimetised ; 12). Tallinn, 2009.

  16. Ehtekunstnikud Genfis

    Index Scriptorium Estoniae

    2002-01-01

    Eesti Kunstiakadeemia ehteväljapanek kõrgkoolide ehetekunstiüliõpilaste suursündmusel "L'ornament est-il toujours un crime?". Eksponeeritud Tanel Veenre, Bruno Lillemetsa, Julia Maria Pihlaku, Kertu Tubergi, Villu Plingi, Piret Hirve ja Eve Margus-Villemsi tööd

  17. Unustagem kõvaketas, kasutagem operatiivmälu! / Katrin Ruus

    Index Scriptorium Estoniae

    Ruus, Katrin

    2008-01-01

    Valik Mart Viljuse, Katrin Teesi, Piret Räni, Reimo Võsa-Tangsoo, Merle ja Erki Kannuse ning rühmituste Puhas Rõõm ja Infotankistid viimaste aastate töödest näituseprojektina "Operatiivmälu" Pärnu Kunstnike Maja galeriis ja Pärnu Linnagaleriis. 11 ill

  18. Riiklike teenetemärkide saajate nimekiri

    Index Scriptorium Estoniae

    2007-01-01

    Teenetemärgi saajate nimekiri. Maarjamaa Risti V klass: Irja Dittmann-Grönholm. Valgetähe IV klass: Astrid Ivask, Leo Metsar. Valgetähe V klass: Piret Kruuspere, Dagmar Normet. Vt. ka Eesti Päevaleht, 8. veebr., lk. 11

  19. [Raamat] / Elisa Loopealne

    Index Scriptorium Estoniae

    Loopealne, Elisa

    2007-01-01

    Tutvustus: Bristol, Piret. Nöörist ja seebist. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Kivisildnik. Vägistatud jäämägi. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Sild, Ivar. Spermaga ja puha. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Meiel, Kaupo. Polügrafisti käsiraamat, 2006

  20. Suvi on lühike, kunst aga pikk / Ille Rohtlaan

    Index Scriptorium Estoniae

    Rohtlaan, Ille

    2009-01-01

    Suvised kunstinäitused Pärnus: "Mees ja naine" Pärnu uue kunsti muuseumis, Tarmo Roosimöldri graafika ja maalid Endla teatrigaleriis, Piret Vapajeva graafika teatrikohvikus, Haapsalu graafilise disaini festivali külalisnäitused Linnagaleriis ja kontserdimajas, Lea Tomsoni maalid "Monkey Business"kunstnike majas

  1. Bedwetters esineb tänutuuri raames Rakveres

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontsert 30. nov. Rakveres, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  2. Vankumatu Andersen / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2005-01-01

    Areen tähistas Anderseni juubeliaastat erinumbri ja illustratsioonidega eesti kunstnikelt: Valli Lember-Bogatkina, Evald Okas, Jüri Arrak, Kaido Ole, Laurentsius, Ülle Meister, Regina Lukk-Toompere, Piret Raud, Marko Mäetamm. Vt. H. C. Andersen. Vankumatu tinasõdur, Eesti Ekspress, 30. juuni, lk. B1-13

  3. Täna kell 17.30 avatakse Tallinna Kunstihoones briti, eesti ja soome fotonäitus "Fantastiline realism"

    Index Scriptorium Estoniae

    2004-01-01

    Kuraator Eve Kiiler. Osalejad loetletud. Avamisel esineb Naeruorgesster. 28. II seminaril räägib Asko Mäkela soome fotokunstist, David Bate briti fotost, Mike Marshall, Denny Robson, Outi Liusvaara, Marja Pirilä, Kai Kaljo ja Piret Räni presenteerivad oma töid

  4. Karje kunstniku südamest / Kärt Hellerma

    Index Scriptorium Estoniae

    Hellerma, Kärt, 1956-

    1997-01-01

    Arvustus: Dinesen, Isak [Blixen, Karen]. Babette'i pidusöök / tlk. Piret Peiker. Tallinn : Varrak, 1996. Ilmunud ka kogumikus: Hellerma, Kärt. Kohanenud kirjandus : valik kirjanduskriitikat 1987-2006. Eesti Keele Sihtasutus : Tallinn, 2006. Lk. 167-169

  5. Õhuloss ehk tuletorni juurde / Tiina Käesel ; kommenteerinud Tamara Luuk

    Index Scriptorium Estoniae

    Käesel, Tiina, 1943-

    2011-01-01

    Ehtekunstinäitus "Õhuloss" Tallinna Põhjatuletornis 25. septembrini 2011. Näitusega kaasneb raamat "Castle in the Air - Jewellery from Estonia - Õhuloss", koostajad Kadri Mälk ja Tanel Veenre. Rühmitusse "õhuLoss" kuuluvad Kadri Mälk, Piret Hirv, Eve Margus-Villems, Kristiina Laurits, Villu Plink, Tanel Veenre, Katrin Sipelgas

  6. Räägi nii, et pisarad voolaksid! Kuidas saab inimesi oma lugude abil juhtida / Taivo Paju

    Index Scriptorium Estoniae

    Paju, Taivo, 1968-

    2011-01-01

    Kuulajat puudutavate lugude rääkimine. Kuidas toimub lugude loomine inimese ajus. Termin "corporate storytelling". Noppeid Pärnu turunduskonverentsi firmalugude võisturääkimiselt, kus jutustasid Ants Lusti, Marika Pärn, Piret Järvan ja Matts Heijbel

  7. Flawlessi tankeriga sõitnud Küprose firma ei võta merereostuse tekitamist omaks / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2006-01-01

    Flawlessi tankeriga opereerivat Küprose firmat Hanseatic Shipping ei saa reostuses süüdistada, sest nemad vedasid rasket kütteõli, kuid Lääne-Eesti rannikult leiti pooltahke õlimass. Vt. samas: Piret Reiljan. Alambra reostuse puhul jäi Eestil trahv saamata; Prokuratuuril sadu kahtlusaluseid

  8. Ettelugemisepäev on tulekul / Krista Kumberg

    Index Scriptorium Estoniae

    Kumberg, Krista, 1959-

    2004-01-01

    Ettelugemispäevast, mil propageeritakse raamatute ettelugemist. Sisaldab ka muinasjuttu "Elasid kord eit ja taat..." ainsalt kutseliselt jutuvestjalt Eestis, Piret Päärilt. Vaata ka "Virumaa Teataja" 19. 10., lk. 4 pealkirjaga "Homne ettelugemispäev veedetakse koos raamatutega"

  9. Tartu kevad / Juta Kivimäe

    Index Scriptorium Estoniae

    Kivimäe, Juta, 1952-

    2003-01-01

    Tartu Ülikooli maali õppetooli üliõpilaste näitus "Tartu kevad" Kastellaanimaja galeriis. Osalevad Kadri Ilves, Piret Mikkelsen, Anna Kainulainen, Anna Mägi, Jaan-Jürgen Klaus, Merike Orav, Irina Krivonogova, Angela Orro, Peeter Krosmann, Kärt Putk, Kadi Kängsepp, Jane Remm, Liina Laaser, Ode Taul, Sami Kalevi Makkonen, Maive Õunapuu

  10. Kinetic models of cell growth, substrate utilization and bio ...

    African Journals Online (AJOL)

    Bio-decolorization kinetic studies of distillery effluent in a batch culture were conducted using Aspergillus fumigatus. A simple model was proposed using the Logistic Equation for the growth, Leudeking-Piret kinetics for bio-decolorization, and also for substrate utilization. The proposed models appeared to provide a suitable ...

  11. Hudozhniki ubirali les / Alina Zelimhanova

    Index Scriptorium Estoniae

    Zelimhanova, Alina

    2003-01-01

    Fotonäitus "Kirju pall" Eesti Kunstiakadeemia galeriis on pühendatud hoolitsusele looduse puhtuse eest. Näituse avamise järel suundusid kunstnikud Pääsküla metsa prügi koristama. Näituse korraldaja Piret Räni selgitus

  12. Kirjavahetus, millest sündis kirjanik / Eerik Purje ; fotod: Eerik Purje

    Index Scriptorium Estoniae

    Purje, Eerik, 1927-

    2010-01-01

    6. mai õhtul toimus Tartu College’i meeskorporatsioonide ruumis Piret Noorhani loeng, milles lektor käsitas peaasjalikult Ella Ilbaku ja August Gailiti kirjavahetust aastatest 1952 - 1961. Selle kirjavahetuse on ta ka avaldanud raamatuna möödunud aastal

  13. Progress and Perspectives of Plasmon-Enhanced Solar Energy Conversion.

    Science.gov (United States)

    Cushing, Scott K; Wu, Nianqiang

    2016-02-18

    Plasmonics allows extraordinary control of light, making it attractive for application in solar energy harvesting. In metal-semiconductor heterojunctions, plasmons can enhance photoconversion in the semiconductor via three mechanisms, including light trapping, hot electron/hole transfer, and plasmon-induced resonance energy transfer (PIRET). To understand the plasmonic enhancement, the metal's geometry, constituent metal, and interface must be viewed in terms of the effects on the plasmon's dephasing and decay route. To simplify design of plasmonic metal-semiconductor heterojunctions for high-efficiency solar energy conversion, the parameters controlling the plasmonic enhancement can be distilled to the dephasing time. The plasmonic geometry can then be further refined to optimize hot carrier transfer, PIRET, or light trapping.

  14. Kinetics of Batch Fermentation in the Cultivation of a Probiotic Strain Lactobacillus Delbrueckii Ssp. Bulgaricus B1

    Directory of Open Access Journals (Sweden)

    Goranov Bogdan

    2015-07-01

    Full Text Available A comparative study of kinetic models to describe the dynamics of the fermentation process of culturing of a probiotic strain Lactobacillus delbrueckii ssp. bulgaricus B1 was performed. The models of Monod, Aiba, Tiessier, Hinshelwood and the equation of the logistic curve combined with the model of Ludeking-Piret were used. It has been found that the different models described the observed fermentation dynamics differently. The conducted comparative study demonstrated that the models of Monod and the equation of the logistic curve combined with the model of Ludeking-Piret were suitable for the description of the fermentation dynamics. The mathematical models showed no significant product and/or substrate inhibition. The culture developed with a low specific growth rate, but nevertheless it accumulated 1012-1013 viable cells. The substrate was absorbed primarily from cells in the stationary growth phase rather than cells in the exponential growth phase

  15. Complexity analysis of the turbulent environmental fluid flow time series

    Science.gov (United States)

    Mihailović, D. T.; Nikolić-Đorić, E.; Drešković, N.; Mimić, G.

    2014-02-01

    We have used the Kolmogorov complexities, sample and permutation entropies to quantify the randomness degree in river flow time series of two mountain rivers in Bosnia and Herzegovina, representing the turbulent environmental fluid, for the period 1926-1990. In particular, we have examined the monthly river flow time series from two rivers (the Miljacka and the Bosnia) in the mountain part of their flow and then calculated the Kolmogorov complexity (KL) based on the Lempel-Ziv Algorithm (LZA) (lower-KLL and upper-KLU), sample entropy (SE) and permutation entropy (PE) values for each time series. The results indicate that the KLL, KLU, SE and PE values in two rivers are close to each other regardless of the amplitude differences in their monthly flow rates. We have illustrated the changes in mountain river flow complexity by experiments using (i) the data set for the Bosnia River and (ii) anticipated human activities and projected climate changes. We have explored the sensitivity of considered measures in dependence on the length of time series. In addition, we have divided the period 1926-1990 into three subintervals: (a) 1926-1945, (b) 1946-1965, (c) 1966-1990, and calculated the KLL, KLU, SE, PE values for the various time series in these subintervals. It is found that during the period 1946-1965, there is a decrease in their complexities, and corresponding changes in the SE and PE, in comparison to the period 1926-1990. This complexity loss may be primarily attributed to (i) human interventions, after the Second World War, on these two rivers because of their use for water consumption and (ii) climate change in recent times.

  16. Modeling of Clostridium tyrobutyricum for Butyric Acid Selectivity in Continuous Fermentation

    OpenAIRE

    Du, Jianjun; McGraw, Amy; Hestekin, Jamie

    2014-01-01

    A mathematical model was developed to describe batch and continuous fermentation of glucose to organic acids with Clostridium tyrobutyricum. A modified Monod equation was used to describe cell growth, and a Luedeking-Piret equation was used to describe the production of butyric and acetic acids. Using the batch fermentation equations, models predicting butyric acid selectivity for continuous fermentation were also developed. The model showed that butyric acid production was a strong function ...

  17. Modeling of Clostridium t yrobutyricum for Butyric Acid Selectivity in Continuous Fermentation

    OpenAIRE

    Jianjun Du; Amy McGraw; Jamie A. Hestekin

    2014-01-01

    A mathematical model was developed to describe batch and continuous fermentation of glucose to organic acids with Clostridium tyrobutyricum . A modified Monod equation was used to describe cell growth, and a Luedeking-Piret equation was used to describe the production of butyric and acetic acids. Using the batch fermentation equations, models predicting butyric acid selectivity for continuous fermentation were also developed. The model showed that butyric acid production was a strong function...

  18. Telefon asendab töövihikut / Madiken Kütt ; kommenteerinud Chernice Keenan, Carl Oskar Kvalųysęter, Kristiina Veevo

    Index Scriptorium Estoniae

    Kütt, Madiken

    2013-01-01

    Tallinna ülikooli Haapsalu kolledži klassiõpetaja eriala õppekavast seotakse sügisest kuni kolmandik haridustehnoloogiaga ehk laste õpetamisel tehnoloogia kasutamisega. Selgitusi jagavad kolleži arendusjuht Liina Põld ja uue õppekava looja Piret Lehiste. Erasmuse intensiivprogrammist "IKT hariduses: interaktiivne õpe meediakasutuse kaudu" Haapsalu kolledžis. Koolituse läbinud tudengite kommentaarid ning intervjuu neid juhendanud õppejõu Jonathan Audainiga

  19. Short outlines of books by Estonian authors / Rutt Hinrikus, Janika Kronberg

    Index Scriptorium Estoniae

    Hinrikus, Rutt, 1946-

    2002-01-01

    Ehlvest, Jüri. Taevatrepp ; Suuman, Aleksander. Tondihobu tõugud vetikatega ; Õunapuu, Ervin. Mõõk. Nagu jõgi ; Nigov, Anton. Harjutused ; Hainsalu, Lehte. Kellakuuljad ; Heinsaar, Mehis. Härra Pauli kroonikad ; Bristol, Piret. Sajandi öömajad ; Kas kuulete...? : [kuuldemängud] / koost. Tamur Tohver; Rummo, Paul-Eerik. Kohvikumuusikat ; Käsper, Kalle. Vennad Luiged ; Põldroos, Enn. Mees narrimütsiga ; Remsu, Olev. Margit Puusaag ja tema mehed ; Sauter, Peeter. Pori

  20. Tiina Piisang sai preemia

    Index Scriptorium Estoniae

    2001-01-01

    III rahvusvaheline köitekunstisümpoosion 14.-21. XI Vilniuses. Avati näitus "Raamat". Preemiad: I - Anne Giordani, Prantsusmaa, II - Isabelle Poitras, Kanada, III - Tiina Piisang, ergutuspreemia - Duda Rimantas, Leedu. Eestist osalevad väljapanekul veel Silvi Kalda, Marje Kask, Külli Veelaid, Zhanna Zhuravel, Elin Kard, Piret Männa. Odette Drapeau Kanadast tutvustas kalanaha kasutamisvõimalusi raamatuköitmisel

  1. Kuidas me läksime Euroopa Liitu / Dorel Käosaar

    Index Scriptorium Estoniae

    Käosaar, Dorel

    2004-01-01

    Ülevaade Eesti politseiametnike tegevusest liitumisläbirääkimistel ja õigusaktide vastavusse viimisel Euroopa Liidu justiits- ja siseküsimusi reguleeriva õigustikuga. Vt. samas: Liitumisläbirääkimiste 24. peatükk - justiits- ja siseküsimused. Lisa: Ettevalmistused Euroopa Liitu astumiseks. Kommenteerivad Jana Napa, Jüri Kasesalu, Heete Simm, Ulvi Põllu, Risto Kasemäe, Varmo Rein, Elina Rikken ja Piret Palusoo

  2. Figuur teeb võidukäiku / Krista Piirimäe

    Index Scriptorium Estoniae

    Piirimäe, Krista, 1946-

    2006-01-01

    Tartu kunstnike aastalõpunäitus Tartu Kunstimajas kuni 22. I. Näituse on kujundanud Maris Palgi ja Rauno Moss. Jaan Punga, Sven Saagi, Albert Gulki, Markus Kasemaa, Saskia Kasemaa, Rauno Mossi, Meiu Mündi, Külli Kalde, Anne Vasara, Piret Mihkelseni, Priit Pajose, Harri Puderselli, Imat Suumanni, Eda Lõhmuse, Sütevaka Andrese, Tiit Tamme, Helle Vahersalu, Malev Toome, Jass Kaselaane, Jaan Luige, Tõnis Paberiti ja Ahti Seppeti töödest

  3. Ergutavad, lohutavad ja ravivad värvid / Jana Rand

    Index Scriptorium Estoniae

    Rand, Jana, 1963-

    2005-01-01

    Altmõisa puhkemaja Läänemaal Tuuru külas. Hoone sisekujunduse on teinud Heli Tuksam, abiks olid kunstnikud Piret Veski ja Tuuli Puhvel ning Tartu Kõrgema Kunstikooli üliõpilased. Toad on kujundatud erinevates värvitoonides. Fuajees on mosaiikpõrand. Kasutatud ökoloogilisi ehitus- ja viimistlusmaterjale. Ill.: välisvaade 7 sisevaadet, värv.

  4. Terrorism, pommid ja pangarööv / Anari Koppel

    Index Scriptorium Estoniae

    Koppel, Anari

    2008-01-01

    Töös olevad Eesti mängufilmid - "Kid&Killer" (produtsent Piret Tibbo Hudgins, stsenaristid Mart Kivastik, Katrin Laur ja Hannu Salonen, kes ka filmi lavastab), "Külaline" (soome, saksa eesti, inglise koostööfilm, lavastaja Jukka-Pekka Valkeapää, operaator Tuomo Hutri, produtsent Marit Ahven), "Pangarööv" (režissöör Andrus Tuisk, stsenarist Mihkel Ulman, produtsent Manfred Vainokivi)

  5. Edukas äritegevus ja kunst käivad käsikäes / Reinhold Würth ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Würth, Reinhold

    2005-01-01

    Intervjuu suurärimehe ja kunstimetseeni Reinhold Würthiga, kelle kontserni kontori- ja laohoone (arhitekt Priit Kaljapulk, sisekujundaja Piret Mudist) avati 31. VII Assakul. Hoone juurde kuuluv galerii avati Jaan Elkeni koostatud näitusega, mille avamistseremoonia kujundas Riina Vanhanen. R. Würthi kunstikogust, mille põhjal ta avas 1991. a. Künzelsau-Gaisbachis muuseumi. 2001. a. avati Schwäbischis Kunsthalle Würth. Eesti galeriiga seotud plaanidest

  6. Eesti Lastekirjanduse Keskus = The Estonian Children's Literature Centre

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Lastekirjanduse Keskuse hoone (1910, Pikk 73, Tallinn) sisekujundusest. Sisearhitektid: Malle Jürgenson, Krista Lepland ja Tea Tammelaan (Laika, Belka & Strelka OÜ). Varakambrit kaunistavad istmed erinevate illustraatorite tehtud maalingutega. Muinasjututoa aknaluuke kaunistavad Jüri Mildebergi loodud fantastilised tüübid. Pööningukorrust kujundas Piret Mildeberg. Sisearhitektidest, nende tähtsamad ühiselt tehtud tööd. 3 korruse plaani, värv. välisvaade, 9 sisevaadet, fotod sisearhitektidest

  7. TÜ bakalaureusetöid 2003

    Index Scriptorium Estoniae

    2004-01-01

    Teatriteaduse erialal : Kerle Arula "Naised ja mehed Madis Kõivu näidendites. Feministliku kirjandusanalüüsi võimalusi "; Piret Jaaks "Populaarkultuuri ilminguid eesti teatris" ; Külli Paulus "Gooti romaan ja teater E. T. A. Hoffmanni "Kuradi eliksiiride" näitel" ; Käthe Pihlak "Lavastaja ja näitleja koostöö" ; Sirle Põdersoo "Näitlemine. Kaks vaateviisi" ; Merilin Raud "Mare Tommingase lavastus "Gypsy" ; Triinu Sillaste "Psühhodraama ja teater"

  8. Üksindus tipus / Asko Talu

    Index Scriptorium Estoniae

    Talu, Asko

    2008-01-01

    Mentor Asko Talu mentorluse ajaloost, tähtsusest organisatsioonile ja juhtimise täiustumisele, isiklikest kogemustest. Vt. samas: Aivar Haller. Asko isepäisus ajas mind algul segadusse; Kadi Kütt. Me tõepoolest hoolime Selveris uutest juhtidest; Piret Jamnes. Iga juht vajab vähemalt kord elus mentori või nõustaja abi. Lisad: Kuidas on tekkinud mõiste mentor?; Kuulsamaid mentori-mentee paare; Mentorluse võimalikkusest ja vajalikkusest Eestis

  9. Selgusid kirjanduse aastapreemiate saajad / Rein Veidemann ; komment. Karl Martin Sinijärv, Viivi Luik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2006-01-01

    Eesti Kultuurkapitali aastapreemiad: Kristiina Ehini luulekogu "Kaitseala" ja Jürgen Rooste luulekogu "Ilusaks inimeseks", Piret Raud "Sanna ja salakütid", Merle Karusoo näidend "Misjonärid", Madis Kõivu artiklikogumik "Luhta-minek". Tõlkepreemiad tõlkijatele Anu Saluäär, Heili Einasto, Lembi Loigu, Veronika Kivisilla, Risto Järv. Vabaauhind Käbi Laretei. Artiklipreemia Aare Pilv. Venekeelse autori kirjandusauhind Gohar Markosjan-Käsper, Svetlan Semenenko

  10. Perekond on kolmes kohas / Ave Randviir

    Index Scriptorium Estoniae

    Randviir, Ave, 1981-

    2006-01-01

    Tallinn Pride 2006 kultuurinädala raames Viru keskuses samasooliste paaride suhteid kujutav maalinäitus "Meie oleme perekond". Esinevad Tiina Tammetalu, Lilian Mosolainen ja Pille Neeve. Samanimeline näitus Cafe Angel'is Chintis Lundgreni ja Heikki-Erich Merila töödest ning kinos Sõprus kunstnike ühenduse Infotankistid (Anu Vahtra, Reimo Võsa-Tangsoo, Katrin Tees, Maris Mändel, Taavi Suits, Sulo Kallas, Piret Räni) fotonäitus

  11. Iskusstvo objekta / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Tallinna IV rakenduskunsti triennaalist "Kaks lähedast" Eesti Tarbekunsti- ja Disainimuuseumis. Triennaali erikülalise inglise ehtekunstniku Wendy Ramshaw ehtesarjast "Picasso's ladies". Maris Galise, Krista Leesi, Andrea Petrakovièi, Rozemarijn Van der Moleni, Kärt Summataveti, Hilde Foksi, Jurgita Erminaite, Piret Valgu, Jurate Petruskeviciene, Tine Deweerdt'i, Ave Maseri ja Kadri Pärnametsa töödest näitusel

  12. Parimad juubelifotod teada / Grete Naaber

    Index Scriptorium Estoniae

    Naaber, Grete, 1942-

    2000-01-01

    Pärnu linna juubelile pühendatud fotovõistlusele "Päev 750-aastases Pärnus" laekus 57 tööd 15-lt kunstnikult, peapreemiat välja ei antud, 3 esimest preemiat (á 5000 kroni) said: Lembit Michelsoni ja Piret Miku ühistöö ja 2 Esta Ruusmanni fotot, välja anti ka 6 ergutuspreemiat (á 1500 krooni)

  13. Round-table discussion at Tallinn City Council (March 8, 2010). Part one : The European Union strategy for the Baltic Sea Region - a challenge for cooperation on local and regional levels

    Index Scriptorium Estoniae

    2010-01-01

    Konverentsi ümarlaual võtsid sõna Erik Terk, Toomas Vitsut, Thomas Johansson, Katrin Savomägi, Jasmin Etelämäki, Edvins Karnitis, Ulf Johansson, Per Gudmund Lindencrona, Mika Keränen, Uno Aldegren, Georg Sootla, Heikki Telakivi, Piret Hedin, Mart Repnau, Jüri Riives, Madis Kanarbik, Enn Saar, Tiiu Evert, Galina Gribanova, Keijo Sahrman, Linda Talve

  14. Radar tegi Moora küla kuulsaks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne

    2003-01-01

    Kellavere mäel avati Eesti võimsaim õhuseireradar, USA päritolu Lockhead-Martini radar TPS-117. Laekvere vallavanem Aarne Laasi ja õhuseiredivisjoni ülem jaak Tarien'i kommentaarid. Foto: President Arnold Rüütel ja kaitseväe juhataja viitseadmiral Tarmo Kõuts tulevad koos teiste külalistega radari sisseõnnistamiselt, mis sai endale hellitusnimeks Piret

  15. Bedwetters kihutab Eesti tuurile

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontserdid 29. nov. Tartus, 30. nov. Rakveres, 1. dets. Haapsalus ja 2. dets. Pärnus, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  16. Näidendivõistluse võitis lugu buumijärgsest ängist / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2011-01-01

    Eesti teatriagentuuri näidendivõistluse võitis Piret Jaaks näidendiga "Näha roosat elevanti", teise koha said Jan Rahmani "Lell" ja Donald Tombergi "Andmed Liina Pihlapuust" ning kolmanda koha Paavo Piik "Keti lõpp" ja Kadri Noormets "GO NEO UND ROMANTIX". Lühinäidendi eripreemia läks Küllike Veedele "Puudutamata" eest

  17. Kulka kroonis aasta kümme sulesangarit / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2010-01-01

    Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)

  18. Aasta parimad teosed Krullilt ja Keskülalt / Heili Sibrits

    Index Scriptorium Estoniae

    Sibrits, Heili, 1977-

    2010-01-01

    Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)

  19. Kuni 20. VIII on Tallinnas vastavatud kultuuritehases Polymer ennast sisse seadnud...Rael Artel Gallery

    Index Scriptorium Estoniae

    2004-01-01

    Näha saab G-Labi (Arturas Bumsteinas, Laura Garbstiene, Leedu) heliinstallatsiooni "Mirrors and Copulations", Kiwa heliteost "Hlör U Fang Axaxaxas mlö", Anu Allase kureeritud väljapanekut "Juhitud reisid/Guided Tours" (osalevad Liisi Peets, Katrin Tees, Piret Räni, Anu Vahtra, Daisy Lappard, rühmitus Tiit Sokk: Ulvi Tiit & Marili Sokk, Raivo Hool, Rataplan), Grace Schwindti (London) videot "Desire"

  20. Põhjamaade esteetika tumedam pool Londonis / Reet Rast

    Index Scriptorium Estoniae

    Rast, Reet, 1964-

    2010-01-01

    Londoni disainifestivali väljapanek "Was it a Dream?" ("Kas see oli unenägu?") Londonis (94 Berwick Street, Soho) 14.-24. septembrini 2010. Kuraator Merilyn Kesküla, kujundajad Merilyn Kesküla ja Paul Drummond. Eestlastest esinesid näitusel Kriss Soonik, Piret Kartus, Tanel Veenre, Tarmo Luisk, Jaanus Orgusaar, Kärt Ojavee ja Vinteco. Eesti kuraatori kureeritud näitus koondas Põhjamaade ja Eesti disainerite ja kunstnike loomingu

  1. Teel taevatundmise poole / Pille-Riin Purje

    Index Scriptorium Estoniae

    Purje, Pille-Riin, 1963-

    2009-01-01

    Neljast rollist teatriaastast 2008: Rein Oja - akadeemik Gustav Naan (Erki Aule - Enn Vetemaa - Merle Karusoo "Sigma Tau-C705", Eesti Draamateater), Priit Võigemast - Rannap (Tiit Ojasoo - Ene-Liis Semper "Ruja", Vanemuine), Ülle Kaljuste - Salme (Andrus Kivirähk "Üks udune päev" (kuuldemäng), režissöör Astrid Relve. Raadioteater), Piret Laurimaa - Eleonore ja Esme (vanem) Tom Stoppard "Rock'n'roll", lavastaja Heiti Pakk, Endla)

  2. Loeme veel! / Kristi Pärn-Valdoja, Katrin Pauts

    Index Scriptorium Estoniae

    Pärn-Valdoja, Kristi, 1970-

    2006-01-01

    TNS Emor väärtushinnangute uuringu RISC 2006 andmetel on igapäevane lugemisharjumus 29 protsendil Eesti naistest ja 20 protsendil meestest. Tallinna abilinnapea Kaia Jäppinen, investeerimistoodete turundusjuht Piret Reinson, KUMU direktor Sirje Helme, laulja Maarja-Liis Ilus ning näitleja Riina Maide kõige enam nende elu ja tegevust mõjutanud raamatutest. Lisa: Millised on Hollywoodi naiste lemmikraamatud?

  3. Triennaalist ja preemiatest : tarbekunst / Lesley Jackson ; tõlk. Kai Lobjakas

    Index Scriptorium Estoniae

    Jackson, Lesley

    2006-01-01

    Inglise disainiajaloolane, auhinnažürii liige Eesti Tarbekunsti- ja Disainimuuseumis avatud IV Tallinna rakenduskunsti triennaalist "Kaks lähedast" ja preemia saanud töödest. Näituse kujundus: 3+1 Arhitektid. I preemia: Kersti Laanmaa ja Tiit Rammuli (rühmitus Muki) töö "Loomaarmastus", kaks teist preemiat: Piret Valk "Maa vägi", Caro Bärtling "Salvrätt-kraed"

  4. Noort moodi / Kätlin Karik

    Index Scriptorium Estoniae

    Karik, Kätlin

    2011-01-01

    ERKI Moeshow Volta tehases 4. juunil 2011. Loetletud lavale pääsenud kollektsioonid. Pikemalt kollektsioonidest "All that money" (Madis Luik, Karen Milistver, Nele Aunap), "Satellite orchids" (Olga Jazepova), "Vaktsiin" (Triinu Jõhve, Diana Tombak, Katrina Kaubi, Maarja Siim, Piret Mägi, Elina Peippo), "I love you...me neither" (Olga Rattik), "Haute sport couture" (Kristina Tatarinova). Kollektsioonide autorid vastavad kolmele küsimusele

  5. Interchannel interactions in high-energetic radiationless transitions of neon-like ions

    International Nuclear Information System (INIS)

    Fritzsche, S.; Zschornack, G.; Musiol, G.; Soff, G.

    1990-07-01

    Relativistic K-LL Auger transition rates in intermediate coupling including interchannel interactions are presented for nine ions in the neon-isoelectronic sequence up to uranium. For neutral neon a comparison with experimental data is given. We demonstrate for the first time, that intercontinuum interactions result in a remarkable redistribution of individual transition rates even in high-energetic transitions. For instance, channel mixing shifts the K-L 1 L 1 rate by about 4% and the K-L 3 L 3 (J = 0) rate by about 11% in neon-like uranium, while total Auger rates are almost not affected. (orig.)

  6. Relativistic effects on inner-shell electron properties

    International Nuclear Information System (INIS)

    Desclaux, J.P.

    1976-01-01

    The influence of relativistic effects on hydrogen-like systems is first reviewed. After having considered one-electron systems, the influence of the other electrons is to be taken into account when considering inner ionization energy and ionization cross sections. Two-hole states in inner shells being then dealt with, the problem of angular momentum coupling among electrons can no longer be neglected. In an other way, this implies that wave functions are to be built on a jj basis instead of a ls one. Ksub(α)sup(h) hypersatellite spectra and KLL Auger transition energies are successively discussed

  7. X-ray spectroscopic measurements of dielectronic recombination of highly charged krypton ions

    International Nuclear Information System (INIS)

    Biedermann, C.; Fuchs, T.; Liebisch, P.; Radtke, R.; Behar, E.; Doron, R.

    1999-01-01

    We have performed X-ray spectroscopic measurements of the dielectronic recombination (DR) resonance strengths for the KLn (n = 2, .., 5) series of He-, Li-, and Be-like krypton ions. The ions were produced with an electron beam ion trap, and the strengths were obtained from a fit procedure that compares the experimental excitation function for DR to theory. The results agree well with the predictions. By looking at the KLL resonance, the time evolution of different krypton charge states was measured with this technique and compared with a model of the trap inventory. (orig.)

  8. IMPLEMENTASI HUTAN TANAMAN RAKYAT DI KABUPATEN PESISIR BARAT-LAMPUNG DAN KABUPATEN TEBO-JAMBI (Implementation of Community Timber Plantation in Pesisir Barat District-Lampung and Tebo District-Jambi

    Directory of Open Access Journals (Sweden)

    Sanudin Sanudin

    2015-11-01

    Full Text Available ABSTRAK Pembangunan Hutan Tanaman Rakyat (HTR merupakan upaya pemerintah dalam rangka meningkatkan partisipasi dan tanggung jawab masyarakat sekitar hutan dalam pengelolaan hutan dengan didasari oleh prinsip-prinsip pengelolaan hutan produksi. Penelitian ini bertujuan untuk mengetahui implementasi HTR pada koperasi yang mendapatkan Pinjaman Dana Bergulir (PDB dari Pusat Pembiyaan Pembangunan Hutan (PPPH. Penelitian dilakukan pada bulan Oktober 2014 – Januari 2015 di KLL, Kabupaten Pesisir Barat, Provinsi Lampung dan KMB, Kabupaten Tebo, Provinsi Jambi. Data primer seperti pengelolaan HTR, kinerja PDB, dan permasalahan yang dihadapi dikumpulkan melalui wawancara dengan pengelola koperasi, pejabat di Balai Pemantauan Pemanfaatan Hutan Produksi (BP2HP, Dinas Kehutanan Kabupaten/Provinsi, petani dan melalui pengamatan lapangan. Data yang terkumpul kemudian dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa tingkat penerimaan masyarakat terhadap program HTR masih rendah akibat kurang maksimalnya kegiatan sosialisasi. Hal ini menyebabkan konflik dalam implementasi HTR. Berdasarkan kondisi lapangan dan tantangan yang dihadapi, tingkat keberhasilan implementasi HTR di KLL sangat tergantung kepada kesungguhan pihak koperasi dalam melakukan teknik silvikultur dalam pengelolaan hutan berbasis masyarakat, sementara implementasi HTR di KMB dari sisi silvikultur sudah cukup baik namun perlu pendekatan persuasif dalam penanganan masalah sosial. Sifat dari PDB adalah untuk memperkuat modal, oleh karena itu koperasi HTR harus mencari sumber permodalan lainnya baik lembaga keuangan maupun pihak swasta lainnya.   ABSTRACT Development of Community Timber Plantation (HTR is government effort to increase participation and responsibility of community around the forest on forest management based on management production forest. This study aimed is to know HTR implementation of cooperative which get revolving fund scheme (PDB-HTR from Forest Development

  9. Fuel Character Effects on Current, High Pressure Ratio, Can-Type Turbine Combustion Systems

    Science.gov (United States)

    1980-04-01

    1135 17000 71 4 1130 22000 92 5 1122 32000 133 6 1126 27000 113II 7 (JP-8) 1127 25000 104 8 1132 20000 83 9 1139 14000 58 10 1123 30000 125 11 1124...0.100 0.100 - -- 143l- 7ll /( Iso -kbP[) Fool fl-s,, kg/hr 20.00 -- 29.85 20.17 21.14 24.63 --Srl (t/L 6 /kll 5.116 1 0.081 0.002 6.577 14.284 - - b

  10. Tumor-Infiltrating Merkel Cell Polyomavirus-Specific T Cells Are Diverse and Associated with Improved Patient Survival. | Office of Cancer Genomics

    Science.gov (United States)

    Tumor-infiltrating CD8+ T cells are associated with improved survival of patients with Merkel cell carcinoma (MCC), an aggressive skin cancer causally linked to Merkel cell polyomavirus (MCPyV). However, CD8+ T-cell infiltration is robust in only 4% to 18% of MCC tumors. We characterized the T-cell receptor (TCR) repertoire restricted to one prominent epitope of MCPyV (KLLEIAPNC, "KLL") and assessed whether TCR diversity, tumor infiltration, or T-cell avidity correlated with clinical outcome.

  11. Comparing and counting logs in direct and effective methods of QCD resummation

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Leandro G. [Laboratoire de Physique Théorique, Université Paris-Sud 11 and CNRS,91405 Orsay Cedex (France); Institut de Biologie de l’École Normale Supérieure (IBENS),Inserm 1024-CNRS 8197, 46 rue d’Ulm, 75005 Paris (France); Ellis, Stephen D. [Department of Physics, University of Washington,Seattle, WA 98195 (United States); Lee, Christopher [Theoretical Division, MS B283, Los Alamos National Laboratory,Los Alamos, NM 87544 (United States); Sterman, George [C.N. Yang Institute for Theoretical Physics, Stony Brook University,Stony Brook, NY 11794 (United States); Sung, Ilmo [Department of Applied Physics, New York University,Brooklyn, NY 11201 (United States); Queens College, City University of New York,Flushing, NY 11367 (United States); Walsh, Jonathan R. [Lawrence Berkeley National Laboratory, University of California,Berkeley, CA 94720 (United States); Berkeley Center for Theoretical Physics, University of California,Berkeley, CA 94720 (United States)

    2014-04-29

    We compare methods to resum logarithms in event shape distributions as they have been used in perturbative QCD directly and in effective field theory. We demonstrate that they are equivalent. In showing this equivalence, we are able to put standard soft-collinear effective theory (SCET) formulae for cross sections in momentum space into a novel form more directly comparable with standard QCD formulae, and endow the QCD formulae with dependence on separated hard, jet, and soft scales, providing potential ways to improve estimates of theoretical uncertainty. We show how to compute cross sections in momentum space to keep them as accurate as the corresponding expressions in Laplace space. In particular, we point out that that care is required in truncating differential distributions at N{sup k}LL accuracy to ensure they match the accuracy of the corresponding cumulant or Laplace transform. We explain how to avoid such mismatches at N{sup k}LL accuracy, and observe why they can also be avoided by working to N{sup k}LL{sup ′} accuracy.

  12. The characterisation of non-evaporable getters by Auger electron spectroscopy Analytical potential and artefacts

    CERN Document Server

    Scheuerlein, C; Taborelli, M

    2002-01-01

    The surfaces of getter materials are particularly difficult to analyse because of their high chemical reactivity. The results obtained can be strongly influenced by the experimental set-up and procedures. In this paper the experimental influence on the Auger electron spectroscopy results is discussed, based on the measurements of more than 100 different non-evaporable getter (NEG) materials. There are four typical changes in the Auger electron spectra when a NEG becomes activated. The oxygen peak intensity decreases, the shape of the metal peaks changes, the carbon peak shape changes shape and intensity and a chlorine peak occurs. All these changes are affected by instrumental artefacts. The Zr-MNV peak shape changes occurring during the reduction of ZrO2 are well suited to determine the onset of NEG activation, while the slope with which the O-KLL peak intensity decreases in a certain temperature range is a better criterion for the determination of the temperature at which activation is complete. The O-KLL i...

  13. Effect of Temperature and pH on Formulating the Kinetic Growth Parameters and Lactic Acid Production of Lactobacillus bulgaricus

    Directory of Open Access Journals (Sweden)

    Marzieh Aghababaie

    2014-09-01

    Results: Second order model for Xmax, μmax, P and K was significant but product formation parameters were almost constant. The optimum values of temperature and pH for attaining maximum biomass, maximum specific growth rate, and maximum acid production were obtained at 44 °C and 5.7, respectively. Conclusions: The attained empirical mathematical correlations of RSM alongside the kinetic equations could be used to determine growth conditions under predefined temperature and pH in the fermentation process. Keywords: Lactobacillus bulgaricus, Richards model, Response surface methodology, Lactic acid production, Luedeking-Piret model

  14. Kas teie arvates tuleks Ülejõe pargid Emajõe vasakkaldal taashoonestada? / intervjueerinud Ivi Drikkit ja Jüri Saar

    Index Scriptorium Estoniae

    2011-01-01

    Vastasid: Mati Tolmoff, Veljo Ipits, Toomas Savi, Verni Loodmaa, Väino Kull, Toomas Kapp, Triin Anette Kaasik, Kristjan Karis, Hele Everaus, Margot Fjuk, Janika Mölder, Hannes Astok, Jaak Adamsoo, Martin Parmas, Toivo Kabanen, Oleg Nesterenko, Tõnu Ints, Piret Uluots, Peep Peterson, Marju Lauristin, Jarno Laur, Arno Arukask, Ülo Veldre, Toomas Jürgenstein, Veera Sirg, Maie Pastik, Elmut Paavel, Avo Rosenvald, Toivo Maimets, Peeter Tulviste, Joel Luhamets, Jüri Kõre, Ants Kask, Enn Tarto, Tarmo Punger, Merle Jääger, Vladimir Šokman, Boris Habramov, Jevgenia Lindevaldt, Harri Jallajas, Natalja Trošina, Olev Raju, Nikolai Põdramägi

  15. Short outlines of books by Estonian authors / Janika Kronberg, Rutt Hinrikus

    Index Scriptorium Estoniae

    Kronberg, Janika, 1963-

    2006-01-01

    Arvustus: Krull, Hasso. Loomise mõnu ja kiri. Tallinn : Kultuurileht, 2006 ; Aleksejev, Tiit. Valge kuningriik. Tallinn : Varrak, 2006 ; Baturin, Nikolai. Sõnajalg kivis. Tallinn : Eesti Raamat, 2006 ; Nõu, Helga. Ood lastud rebasele. Tallinn : Eesti Keele Sihtasutus, 2006 ; Kaus, Jan. Tema. Tallinn : Tuum, 2006 ; Krull, Hasso. Talv. Tallinn : Tuum, 2006 ; Soomets, Triin. Väljas. Tallinn : Tuum, 2006 ; Kareva, Doris. Aja kuju. Tallinn : Verb, 2006 ; Vint, Toomas. Topeltvalguses. Tallinn : Eesti Keele Sihtasutus, 2005 ; Bristol, Piret. Sõud. Tallinn : Eesti Keele Sihtasutus, 2005 ; Valton, Arvo. Taltsutatud lammas : jutud. Tallinn : Kirjastuskeskus, 2005 ; Kivastik, Mart. Külmetava kunstniku portreed. Viinistu triloogia. Tartu : Väike Öömuusika, 2006

  16. Jutuvõistluse "Musta mantliga mees" võitis Katrin Johanson

    Index Scriptorium Estoniae

    2007-01-01

    Eduard Vilde muuseumi poolt läbi viidud krimi- ja põnevusjuttude võistlusest "Musta mantliga mees". Žürii: Karl Martin Sinijärv, Juhan Habicht, Paul Pajos, Rebekka Lotman, Kristin Rammus, Piret Meos.Võitja: Katrin Johanson, teine koht: Taavet Kase, kolmas koht: Imre Kõuts. Ajalehe "Postimees" eriauhinnad said: Juhan Voolaid, Hella Riisalu, Stina Maria Vilt, Sirle Poikkanen, Märt Kivimäe. Tallinna noorte infokeskuse auhinnad: Juhan Voolaid, Sirle Poikkalainen, Lilli Anderson, Aino Rätsep. Eduard Vilde muuseumi eriauhinnad: Merilin Jürjo, Laura Pirso

  17. Kunstnike Liit

    Index Scriptorium Estoniae

    2004-01-01

    EKLi volikogu töökoosolek 5. IV. SA ERF alllfondina loodud Olev Soansi mälestusfondi toetamisest, EKLi 2005. a. aastanäituse korraldamisest Tallinna Kunstihoones, vajalikest täiendustest ja muudatustest põhikirjas, mis puudutavad tehinguid Tallinna Kunstihoone ja selle galeriiga. Võeti vastu tööjuhised SA Tallinna Kunstihoone Fondi nõukogule. EKLi uued liikmed: Kaarel Eelma, Piret Hirv, Sandra Jõgeva, Irene Jürna, Kristin Kalamees, Kristiina Laurits, Eve Margus-Villems, Villu Plink, Lembe Ruben, Katrin Sipelgas, Margus Tamm, Tanel Veenre

  18. Kuninganna Silvia leidis aega ka lastele / Vilja Kohler

    Index Scriptorium Estoniae

    Kohler, Vilja, 1966-

    2007-01-01

    Rootsi kuninganna Silvia pani nurgakivi rootslaste ja eestlaste sihtasutuse Eesti Agrenska Fond poolt Tartu valda Tammistu mõisasse rajatavale puuetega laste perekeskusele. Kuningannat saatis proua Evelin Ilves, kes hakkas Eesti Agrenska Fondi patrooniks. Eesti Agrenska Fond kinkis Rootsi kuningannale ja proua E. Ilvesele eritellimusel kunstnik Piret Veski valmistatud keraamilised taldrikud, mille on kujutatud armastust, truudust ning kaitset sümboliseeriv jumalaema. Proua E. Ilves pani kingitud raamatuga aluse perekeskuse raamatukogule. Juuresoleval fotol kuninganna Silvia ja proua Evelin Ilves koos Reiniku gümnaasiumi poistekooriga

  19. Vikergallup : eesti kirjandus 2001 : [vastused Vikerkaare küsitlusele

    Index Scriptorium Estoniae

    2002-01-01

    Aut.: Vahur Afanasjev, Veiko Belials, Piret Jaaks, Jan Kaus, Janek Kraavi, Priit Kruus, Leo Luks, Ilona Martson, Hedda Maurer, Anneli Mihkelev, Jürgen Rooste, Aarne Ruben, Mihkel Samarüütel, François Serpent, Ivar Sild, Karl Martin Sinijärv, Lauri Sommer, Jaak Urmet, Berk Vaher. 2001. a. parima uudisraamatu tiitlit jagasid Mehis Heinsaare "Härra Pauli kroonikad", Jan Kausi "Maailm ja mõni" ning Ene Mihkelsoni "Ahasveeruse uni"; parimaks esikraamatuks valiti Mehis Heinsaare "Vanameeste näppaja"

  20. Stochastic growth logistic model with aftereffect for batch fermentation process

    Science.gov (United States)

    Rosli, Norhayati; Ayoubi, Tawfiqullah; Bahar, Arifah; Rahman, Haliza Abdul; Salleh, Madihah Md

    2014-06-01

    In this paper, the stochastic growth logistic model with aftereffect for the cell growth of C. acetobutylicum P262 and Luedeking-Piret equations for solvent production in batch fermentation system is introduced. The parameters values of the mathematical models are estimated via Levenberg-Marquardt optimization method of non-linear least squares. We apply Milstein scheme for solving the stochastic models numerically. The effciency of mathematical models is measured by comparing the simulated result and the experimental data of the microbial growth and solvent production in batch system. Low values of Root Mean-Square Error (RMSE) of stochastic models with aftereffect indicate good fits.

  1. Stochastic growth logistic model with aftereffect for batch fermentation process

    International Nuclear Information System (INIS)

    Rosli, Norhayati; Ayoubi, Tawfiqullah; Bahar, Arifah; Rahman, Haliza Abdul; Salleh, Madihah Md

    2014-01-01

    In this paper, the stochastic growth logistic model with aftereffect for the cell growth of C. acetobutylicum P262 and Luedeking-Piret equations for solvent production in batch fermentation system is introduced. The parameters values of the mathematical models are estimated via Levenberg-Marquardt optimization method of non-linear least squares. We apply Milstein scheme for solving the stochastic models numerically. The effciency of mathematical models is measured by comparing the simulated result and the experimental data of the microbial growth and solvent production in batch system. Low values of Root Mean-Square Error (RMSE) of stochastic models with aftereffect indicate good fits

  2. Degradation of phytosteril into androstenedione by mycobacterium SP-UV-8

    International Nuclear Information System (INIS)

    Yang Ying; Jiang Shaotong; Wei Zhaojun; Zhao Yanyan; Sunxiaoming

    2009-01-01

    The fermentation process of Mycobacterium sp-UV-8 was studied in batch system, and a kinetic model was proposed based on the Logistic and Leudeking-piret equations for microorganism growth, product formation and substrate consumption. Depending on the evaluated model parameters, the model appears to provide a reasonable description for the fermentation process,and the average relative error was no more than 7%. The calculated results of models were compared satisfactorily with experimental data, which offers assurance for the industrial design and production throught degradation of phytosterol by Mycobacterium sp-UV-8. (authors)

  3. IBBY Eesti osakond 2007

    Index Scriptorium Estoniae

    2007-01-01

    IBBY Eesti osakond esitas Astrid Lindgreni mälestusauhinna kandidaatideks kirjanik Aino Perviku, illustraatorid Regina Lukk-Toompere ja Ilon Wiklandi. Paabeli Torni auhinna pälvis Arvo Valton komi kirjaniku Vladimir Timini noorsooromaani "Vana-Permi poisi Tikö seiklused" eesti keelde tõlkimise eest. IBBY aunimekirja esitati A. Kivirähk raamatuga "Leiutajateküla Lotte", kunstnik Jüri Mildeberg illustratsioonidega raamatule "Ruttu tuttu" ja tõlkija Piret Saluri Hannu Mäkela raamatu "Härra Huu teeb aiatööd" tõlkimise eest

  4. Stochastic growth logistic model with aftereffect for batch fermentation process

    Energy Technology Data Exchange (ETDEWEB)

    Rosli, Norhayati; Ayoubi, Tawfiqullah [Faculty of Industrial Sciences and Technology, Universiti Malaysia Pahang, Lebuhraya Tun Razak, 26300 Gambang, Pahang (Malaysia); Bahar, Arifah; Rahman, Haliza Abdul [Department of Mathematical Sciences, Faculty of Science, Universiti Teknologi Malaysia, 81310 Johor Bahru, Johor (Malaysia); Salleh, Madihah Md [Department of Biotechnology Industry, Faculty of Biosciences and Bioengineering, Universiti Teknologi Malaysia, 81310 Johor Bahru, Johor (Malaysia)

    2014-06-19

    In this paper, the stochastic growth logistic model with aftereffect for the cell growth of C. acetobutylicum P262 and Luedeking-Piret equations for solvent production in batch fermentation system is introduced. The parameters values of the mathematical models are estimated via Levenberg-Marquardt optimization method of non-linear least squares. We apply Milstein scheme for solving the stochastic models numerically. The effciency of mathematical models is measured by comparing the simulated result and the experimental data of the microbial growth and solvent production in batch system. Low values of Root Mean-Square Error (RMSE) of stochastic models with aftereffect indicate good fits.

  5. Lugemiseks mõeldud / Tiina Tammer

    Index Scriptorium Estoniae

    Tammer, Tiina, 1960-

    2005-01-01

    Tutvustus: Käo, Henno. Väike rüütel Rikardo ; Raud, Piret. Ernesto küülikud ; Kass, Kristiina. Kasper ja viis tarka kassi ; Vaiksoo, Jaanus. Lumemöll ; Made, Reet. Veli Oliver (Tallinn : Tänapäev) - 2004. a. lastejutuvõistluse "Minu esimene raamat" auhinnatud tööd. Neljapäeval, 3. märtsil esitletakse kolme viimast Eesti Lastekirjanduse Teabekeskuses. Vt. ka sõnum: Postimees, 1. märts, lk. 14

  6. Pärnus kestab VIII "IN graafika" festival

    Index Scriptorium Estoniae

    2004-01-01

    Linnagaleriis ja kontserdimajas Loit Jõekalda kureeritud Eesti Vabagraafikute Ühenduse (EVÜ) väljapanek, kontserdimaja II korrusel Lembe Rubeni kureeritud "Igaviku konserv", Muuseumi Aidas rahvusvaheline näitus "Best of IG" ja soome graafika Reijo Mörö valikus, TÜ Pärnu kolledzhi raamatukogus Urmas Viigi TPÜ kunstiüliõpilaste tööd, Hansapanga kontoris Piret Smagari graafika jpm. 12. I esitleti Marianne Männi koomiksiraamatut "Paradise", esines rühmitus FLY, toimus EVÜ konverents jm. Workshopid 16.-17. I

  7. Uued raamatud

    Index Scriptorium Estoniae

    2008-01-01

    Fotoalbum "Väikeste majade Haapsalu" (Evald Okase Muuseum, 2008; toimetajad Üla Koppel ja Ingrid Ruudi, kujundaja Pärtel Eelma, fotod: Ly Lestberg, Katrin Rihm, Lembit Michelson, Liivia Leshkin, Piret Looveer, Erki Meister, Romer Laidsaar, Karli Luik, Maris Kerge, Üla Koppel). "Tallinna maja : hoonetüübi areng ja säästev uuendamine" (Tallinna Kultuuriväärtuste Amet, 2008; ajaloolise osa koostas Mark Sepp). Näituse kataloog "Keskkonnad, projektid, kontseptsioonid. Tallinna kooli arhitektid 1972-1985" (Eesti Arhitektuurimuuseum, 2008; koostajad Andres Kurg ja Mari Laanemets, kujundaja Indrek Sirkel, tekstid: A. Kurg, M. Laanemets, Juhani Pallasmaa, Georg Schöllhammer)

  8. Kas Eesti avastamine algab Põhja-Eestist? : Põhja-Eesti V turismikonverents

    Index Scriptorium Estoniae

    2010-01-01

    17. novembril Jõhvi Kontserdimajas toimunud Põhja-Eesti V turismikonverentsist “Kas Eesti avastamine algab Põhja- Eestist?", mille avas Ida-Virumaa maavalitsuse Arengu- ja planeeringuosakonna juhataja Urmas Majaääs. Ülevaade SA Ida-Virumaa Ettevõtluskeskuse turismikoordinaatori Sigrid Karoni, Estonian Airi asepresidendi kommertsalal Rauno Parrase, EASi koordinaatori turismiuuringute alal Piret Kallase, kommunikatsioonikonsultandi Raul Rebase, SA Põhja-Eesti Turism projektijuhi Erika Pääbuse ja nõukogu liikme Moonika Sooneste, CityBike OÜ tegevjuhi Toomas Lelovi, Narva-Jõesuu linnapea Andres Noormägi, Loodusturismi arendaja ja koolitaja Rein Kuresoo ettekannetest

  9. Õiguskantsler ei toeta haridusministri algatust / Jaana Padrik

    Index Scriptorium Estoniae

    Padrik, Jaana, 1958-

    2008-01-01

    Õiguskantsler Indrek Teder korraldas koostöös lastekaitse liiduga 25. novembril õiguskantsleri kantseleis ümarlaua "Kool - kas haridus- või karistusasutus?", et arutada probleeme, mis võivad tuleneda munitsipaalkoolide direktoritele kohtuvälise väärteomenetleja õiguste andmisest. Kommenteerivad: HTM-i õigusosakonna juhataja Anno Aedmaa, lastepsühhiaater Piret Visnapuu, EKJÜ esimees, inglise kolledzhi direktor Toomas Kruusimägi, politseiameti vanemkomissar Rauni Rohuniit ja Tuuli Poom justiitsministeeriumi karistusõiguse ja menetluse talitusest

  10. Ekskavaatorid, puit ja torud tõstsid väikefirmad Eesti gasellide edetabelisse / Vilja Kohler

    Index Scriptorium Estoniae

    Kohler, Vilja, 1966-

    2005-01-01

    Ajaleht Äripäev reastas gasellettevõtted, võttes aluseks nende kasumi ja käibe aastatel 2001-2003. Kõige rohkem gasellettevõtteid on Tartu- ja Harjumaal. Gasellettevõtteks pürgimise tingimustest. Tartumaa gasellettevõtetest Derek Trade OÜ, Hage Puit OÜ, Aqua & Waste Services OÜ, Water Ser Lõuna-Eesti AS. Diagrammid: Käive, kasum. Tabel: Tartumaa kiireimad gasellid. Vt. samas: Piret Arusaar. Klient hoiab ettevõtte arenguvõtit enda käes

  11. X-ray photoelectron spectrometry and binding energies of Be 1s and O 1s core levels in clinobarylite, BaBe2Si2O7, from Khibiny massif, Kola peninsula

    International Nuclear Information System (INIS)

    Atuchin, V.V.; Kesler, V.G.; Sapozhnikov, V.K.; Yakovenchuk, V.N.

    2008-01-01

    The electronic structure of BaBe 2 Si 2 O 7 , clinobarylite, has been investigated by means of X-ray photoelectron spectroscopy (XPS). The valence band of the crystal is mainly formed by Ba 5p, Ba 3s and O 2s states. At higher binding energies the emission lines related to the Si 2p, Be 1s, Si 2s, O 1s and numerous Ba-related states were analyzed in the photoemission spectrum. The Si KLL Auger line has been measured under excitation by the bremsstrahlung X-rays from the Al anode. Chemical bonding effects for Be 1s core level have been considered by comparison with electronic parameters measured for other beryllium containing oxides

  12. Influence of the partial temporal coherence of short FEL pulses on two-colour photoionization and photoinduced Auger decay of atoms

    International Nuclear Information System (INIS)

    Kazansky, A K; Sazhina, I P; Kabachnik, N M

    2013-01-01

    The influence of the partial temporal coherence of free electron laser (FEL) radiation on the sidebands arising in the electron spectra of laser-assisted photoionization and photoinduced Auger decay of atoms is theoretically analysed. A simple model is developed which describes the inner-shell photoionization by a short (femtosecond) FEL pulse and the following Auger decay in a strong field of an infrared laser. The model is based on the time-dependent approach and uses the strong field approximation for both photo- and Auger electrons. Particular calculations have been carried out for Ne 1s photoionization and KLL Auger emission. We demonstrate that the temporal coherence of FEL pulses influences the line widths in the photoelectron spectrum. For a small coherence time the sidebands in this spectrum cannot be resolved. On the other hand, our calculations show that in the Auger electron spectrum the sidebands are practically independent of the coherence time of the ionizing pulse.

  13. Photoion Auger-electron coincidence measurements near threshold

    International Nuclear Information System (INIS)

    Levin, J.C.; Biedermann, C.; Keller, N.; Liljeby, L.; Short, R.T.; Sellin, I.A.; Lindle, D.W.

    1990-01-01

    The vacancy cascade which fills an atomic inner-shell hole is a complex process which can proceed by a variety of paths, often resulting in a broad distribution of photoion charge states. We have measured simplified argon photoion charge distributions by requiring a coincidence with a K-LL or K-LM Auger electron, following K excitation with synchrotron radiation, as a function of photon energy, and report here in detail the argon charge distributions coincident with K-L 1 L 23 Auger electrons. The distributions exhibit a much more pronounced photon-energy dependence than do the more complicated non-coincident spectra. Resonant excitation of the K electron to np levels, shakeoff of these np electrons by subsequent decay processes, double-Auger decay, and recapture of the K photoelectron through postcollision interaction occur with significant probability. 17 refs

  14. Low Power, Room Temperature Systems for the Detection and Identification of Radionuclides from Atmospheric Nuclear Test

    Science.gov (United States)

    2013-07-01

    DTRA-TR-13-48 Low Power, Room Temperature Systems for the Detection and Identification of Radionuclides from Atmospheric Nuclear Test Approved for...01-C-0071 Radionuclides from Atmospheric Nuclear Tests 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Muren Chu...I IIlIl4eI ilf "tt""f;lk~ l).t::l’e.do)- mllin:: in an n-t~’J𔃻f mlllril.: II!’ ,-kll ~".r’I::!, ..... ·hkh j,-, .:auI,,·d br thP . la-ek f.r ·;IIff

  15. How to Use Equipment Specifications to Predict Measurement Uncertainty An Example Using Tunnels A, B and C Data System

    Science.gov (United States)

    2012-06-01

    compliance to standards like ISO 9001, ANSIINCSL Z540-1 and ISO’lEC 17025 . To learn more about Nl calibration service s orto locate a qualified service...ITS-90 conversions of Type B, E, J, K, N, R, S, T Thermistor: 5 kll RTD: Type o =.00385 and o =.00392. R, from 4.9 0 to 2.1 kO. ITS -90 ( IEC -751...x 103.6 mm H (1002" Wx 1472" Lx 4.08" H) Weight: 3 kg (6.5 lbs). Safety: Designed to GSA, UL-1 244, IEC -1 010. RFI and ESD: CISPR 11. AEDC-TR

  16. Double differential distributions of electron emission in ion-atom and electron-atom collisions using an electron spectrometer

    International Nuclear Information System (INIS)

    Misra, Deepankar; Thulasiram, K.V.; Fernandes, W.; Kelkar, Aditya H.; Kadhane, U.; Kumar, Ajay; Singh, Yeshpal; Gulyas, L.; Tribedi, Lokesh C.

    2009-01-01

    We study electron emission from atoms and molecules in collisions with fast electrons and heavy ions (C 6+ ). The soft collision electrons (SE), two center electron emission (TCEE), the binary encounter (BE) events and the KLL Auger lines along with the elastically scattered peaks (in electron collisions) are studied using a hemispherical electrostatic electron analyzer. The details of the measurements along with description of the spectrometer and data acquisition system are given. The angular distributions of the low energy (few eV) electrons in soft collisions and the binary encounter electrons at keV energies are compared with quantum mechanical models based on the first Born (B1) and the continuum distorted wave-Eikonal initial state approximation (CDW-EIS).

  17. Surface study and thickness control of thin Al2O3 film on Cu-9%Al(111) single crystal

    International Nuclear Information System (INIS)

    Yamauchi, Yasuhiro; Yoshitake, Michiko; Song Weijie

    2004-01-01

    We were successful in growing a uniform flat Al 2 O 3 film on the Cu-9%Al(111) surface using the improved cleaning process, low ion energy and short time sputtering. The growth of ultra-thin film of Al 2 O 3 on Cu-9%Al was investigated using Auger electron spectroscopy (AES) and a scanning electron microscope (SEM). The Al 2 O 3 film whose maximum thickness was about 4.0 nm grew uniformly on the Cu-9%Al surface. The Al and O KLL Auger peaks of Al 2 O 3 film shifted toward low kinetic energy, and the shifts were related to Schottky barrier formation and band bending at the Al 2 O 3 /Cu-9%Al interface. The thickness of Al 2 O 3 film on the Cu-9%Al surface was controlled by the oxygen exposure

  18. Double K-vacancy production by x-ray photoionization

    International Nuclear Information System (INIS)

    Southworth, S. H.; Dunford, R. W.; Kanter, E. P.; Krassig, B.; Young, L.; Armen, G. B.; Levin, J. C.; Chen, M. H.; Ederer, D. L.

    2002-01-01

    We have studied double K-shell photoionization of Ne and Mo (Z = 10 and 42) at the Advanced Photon Source. Double K-vacancy production in Ne was observed by recording the KK-KLL Auger hypersatellite spectrum. Comparison is made with calculations using the multiconfiguration Dirac-Fock method. For Mo, double K-vacancy production was observed by recording the Kα, β fluorescence hypersatellite and satellite x rays in coincidence. From the intensities of the Auger or x-ray hypersatellites relative to diagram lines, the probabilities for double K-vacancy production relative to single K-vacancies were determined. These results, along with reported measurements on other atoms, are compared with Z-scaling calculations of the high-energy limits of the double-to-single K-shell photoionization ratio

  19. Temperature effect on surface oxidation of titanium

    International Nuclear Information System (INIS)

    Vaquilla, I.; Barco, J.L. del; Ferron, J.

    1990-01-01

    The effect of temperature on the first stages of the superficial oxidation of polycrystalline titanium was studied using both Auger electron spectroscopy (AES) and emission shreshold (AEAPS). The number of compounds present on the surface was determined by application of the factor analysis technique. Reaction evolution was followed through the relative variation of Auger LMM and LMV transitions which are characteristic of titanium. Also the evolution of the chemical shift was determined by AEAPS. The amount of oxygen on the surface was quantified using transition KLL of oxygen. It was found that superficial oxidation depends on temperature. As much as three different compounds were determined according to substrate temperature and our exposure ranges. (Author). 7 refs., 5 figs

  20. AES, EELS and TRIM simulation method study of InP(100 subjected to Ar+, He+ and H+ ions bombardment.

    Directory of Open Access Journals (Sweden)

    Abidri B.

    2012-06-01

    Full Text Available Auger Electron Spectroscopy (AES and Electron Energy Loss Spectroscopy (EELS have been performed in order to investigate the InP(100 surface subjected to ions bombardment. The InP(100 surface is always contaminated by carbon and oxygen revealed by C-KLL and O-KLL AES spectra recorded just after introduction of the sample in the UHV spectrometer chamber. The usually cleaning process of the surface is the bombardment by argon ions. However, even at low energy of ions beam (300 eV indium clusters and phosphorus vacancies are usually formed on the surface. The aim of our study is to compare the behaviour of the surface when submitted to He+ or H+ ions bombardment. The helium ions accelerated at 500V voltage and for 45 mn allow removing contaminants but induces damaged and no stoichiometric surface. The proton ions were accelerated at low energy of 500 eV to bombard the InP surface at room temperature. The proton ions broke the In-P chemical bonds to induce the formation of In metal islands. Such a chemical reactivity between hydrogen and phosphorus led to form chemical species such as PH and PH3, which desorbed from the surface. The chemical susceptibly and the small size of H+ advantaged their diffusion into bulk. Since the experimental methods alone were not able to give us with accuracy the disturbed depth of the target by these ions. We associate to the AES and EELS spectroscopies, the TRIM (Transport and Range of Ions in Matter simulation method in order to show the mechanism of interaction between Ar+, He+ or H+ ions and InP and determine the disturbed depth of the target by argon, helium or proton ions.

  1. Kinetic analysis and modeling of daptomycin batch fermentation by Streptomyces roseosporus.

    Science.gov (United States)

    Lu, Wenyu; Fan, Jinghua; Wen, Jianping; Xia, Zhendong; Caiyin, Qinggele

    2011-02-01

    In this study, Streptomyces roseosporus was subjected to helium-neon (He-Ne) laser (632.8 nm) irradiation to improve the production ability of extracellular antibiotic daptomycin. Under the optimum irradiation dosage of 18 mW for 22 min, a stable positive mutant strain S. roseosporus LC-54 was obtained. The maximum A21978C (daptomycin is a semisynthetic antimicrobial substance derived from the A21978C complex) yield of this mutant strain was 296 mg/l, which was 146% higher than that of the wild strain. The mutant strain grew more quickly and utilized carbohydrate sources more efficiently than the wild strain. The batch culture kinetics was investigated in a 7 l bioreactor. The logistic equation for growth, the Luedeking-Piret equation for daptomycin production, and Luedeking-Piret-like equations for carbon substrate consumption were established. This model appeared to provide a reasonable description for each parameter during the growth phase and fitted fairly well with the experiment data.

  2. Modeling of growth and laccase production by Pycnoporus sanguineus.

    Science.gov (United States)

    Saat, Muhammad Naziz; Annuar, Mohamad Suffian Mohamad; Alias, Zazali; Chuan, Ling Tau; Chisti, Yusuf

    2014-05-01

    Production of extracellular laccase by the white-rot fungus Pycnoporus sanguineus was examined in batch submerged cultures in shake flasks, baffled shake flasks and a stirred tank bioreactor. The biomass growth in the various culture systems closely followed a logistic growth model. The production of laccase followed a Luedeking-Piret model. A modified Luedeking-Piret model incorporating logistic growth effectively described the consumption of glucose. Biomass productivity, enzyme productivity and substrate consumption were enhanced in baffled shake flasks relative to the cases for the conventional shake flasks. This was associated with improved oxygen transfer in the presence of the baffles. The best results were obtained in the stirred tank bioreactor. At 28 °C, pH 4.5, an agitation speed of 600 rpm and a dissolved oxygen concentration of ~25 % of air saturation, the laccase productivity in the bioreactor exceeded 19 U L(-1 )days(-1), or 1.5-fold better than the best case for the baffled shake flask. The final concentration of the enzyme was about 325 U L(-1).

  3. "Tere! Head teatripäeva!" : Rakveres jagati auhindu mulluste teatriteenete eest / Verni Leivak

    Index Scriptorium Estoniae

    Leivak, Verni, 1966-

    2009-01-01

    Rakvere Teatris toimunud teatriauhindade jagamisest. Lisatud aastaauhindade laureaadid - Tiit Ojasoo ja Ene-Liis Semper parim lavastus ("Ruja"), Lembit Peterson - lavastaja auhind ("Maarja kuulutamine" ja "Linn"), Maria Peterson ja Laura Peterson - naisnäitleja auhind, Marius Peterson - meesnäitleja auhind, Piret Laurimaa - naiskõrvalosa auhind, Rain Simmul - meeskõrvalosa auhind, Liisi Eelmaa - kunstniku auhind, Ain Saviauk - žürii eriauhind, Valle-Sten Maiste - Reet Neimari kriitikaauhind, Arvo Volmer - muusikalavastuse auhind, Eve Andre - balletilavastuse auhind, Jaan Undusk - algupärase dramaturgia auhind, Marius Peterson - sõnalavastuse muusikalise kujunduse auhind, Tiina Tauraite ja Margus Prangel - Ants Lauteri auhind, Lembit Peterson - Priit Põldroosi auhind, Mart Madiste - Georg Otsa auhind, Sigrid Orusaar - Otto Hermanni auhind, Tiit Härm - Rahel Olbrei auhind, Ene-Liis Semper - Natalie Mei auhind, Jevgeni Ibragimov - Salme Reegi auhind, Margus Alver - Aleksander Kurtna auhind, Toomas Suuman - Karl Adra auhind, Sten Karpov ja Uku Uusberg - Kristallkingakese auhind

  4. Teatri aastaauhindade laureaadid 2008

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  5. Eesti teatri aastaauhinnad 2007

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  6. Endla teater 2006 : aasta omadramaturgiat / Luule Epner

    Index Scriptorium Estoniae

    Epner, Luule, 1953-

    2007-01-01

    Andrus Kivirähki "Rehepapp" (lav. Priit Pedajas), Liisu Krassi/ Sandra Sillaotsa "Sõbrapäev" (juh. Enn Keerd), August Kitzbergi "Kauka jumal" (lav. Andres Noormets), Silvi Väljali/Kiti Põllu "Jussikese seitse sõpra" (lav. Piret Rauk), A. H. Tammsaare /Urmas Lennuki "Vargamäe kuningriik" (lav. Jaanus Rohumaa), Jim Ashilevi "Nagu poisid vihma käes" (lav. Andres Noormets), Jaan Kruusvalli "Võikõllane üü" (lav. Enn Keerd), Friedebert Tuglase/Tiit Palu "Väike Illimar" (lav. Tiit Palu), Asrtid Reinla "Koduabiline" (lav. Tiit Palu), Jaan Kaplinski "Liblikas ja peegel" (lav. Madis Kalmet), Eva Koffi "Sabaga täht" (lav. Andres Noormets). Kasut. kirjandus lk. 39

  7. A kinetic model for growth and biosynthesis of medium-chain-length poly-(3-hydroxyalkanoates in Pseudomonas putida

    Directory of Open Access Journals (Sweden)

    M. S. M. Annuar

    2008-06-01

    Full Text Available A kinetic model is presented giving a mathematical description of batch culture of Pseudomonas putida PGA1 grown using saponified palm kernel oil as carbon source and ammonium as the limiting nutrient. The growth of the micro-organism is well-described using Tessier-type model which takes into account the inhibitory effect of ammonium at high concentrations. The ammonium consumption rate by the cells is related in proportion to the rate of growth. The intracellular production of medium-chain-length poly-(3-hydroxyalkanoates (PHA MCL by P. putida PGA1 cells is reasonably modeled by the modified Luedeking-Piret kinetics, which incorporate a function of product synthesis inhibition (or reduction by ammonium above a threshold level.

  8. Modelling of Ethanol Production from Red Beet Juice by Saccharomyces cerevisiae under Thermal and Acid Stress Conditions

    Directory of Open Access Journals (Sweden)

    Donaji Jiménez-Islas

    2014-01-01

    Full Text Available In this work the effects of pH and temperature on ethanol production from red beet juice by the strains Saccharomyces cerevisiae ITD00196 and S. cerevisiae ATCC 9763 are studied. Logistic, Pirt, and Luedeking-Piret equations were used to describe quantitatively the microbial growth, substrate consumption, and ethanol production, respectively. The two S. cerevisiae strains used in this study were able to produce ethanol with high yield and volumetric productivity under acid and thermal stress conditions. The equations used to model the fermentation kinetics fit very well with the experimental data, thus establishing that ethanol production was growth associated under the evaluated conditions. The yeast S. cerevisiae ITD00196 had the best fermentative capacity and could be considered as an interesting option to develop bioprocesses for ethanol production.

  9. Parim proosalugeja köitis küpsusega / Marika Rajamäe

    Index Scriptorium Estoniae

    Rajamäe, Marika, 1952-

    2008-01-01

    Toimus viies üle-eestiline proosalugemine "Hansenist Tammsaareni". Mõtteid võistulugemise kohta avaldavad konkursi algataja Enda Trubok, Järva maavalitsuse haridus- ja kultuuriosakonna peainspektor Anne Viljat, Eesti emakeeleõpetajate seltsi esimees Piret Järvela, žürii esimees Iivi Lepik, konkursil võistelnud Merilin Kulpsoo. Peavõidu sai Sabine Liias, V-VII klasside arvestuses läks I koht Sabine Liiasele, II koht Kristian Käreskile, III koht Kristiina Orasele. VIII-IX arvestuses läks I koht Katriin Altementile, II koht Indrek Jõele, III koht Linda Randojale. X-XII klasside arvestuses võitis Kaire Olesk, II koha saii Sten-Robert Pullerits ning III koha Katrin Ojalill

  10. UJI TOKSISITAS AKUT EKSTRAK DAUN PSIDIUM GUAVA LINN (DAUN JAMBU BIJI TERHADAP MENCIT (MUS MUSCULUS

    Directory of Open Access Journals (Sweden)

    Amiyatun Naini

    2015-09-01

    Full Text Available The Psidium guava Linn leaf extract as mouthrinse has been suggested to be used against toothache, and also has suggested effect against diarrhea and vomiting, as well as anti spasmodic and rheumatic symptoms, anti inflammation, anti piretic, analgetic, and anti bacterial activity. However, to consider potential side effects, this work aimed to test the acute toxicity of guava leaf extract. For this purpose guava leaf extract was given orally to to groups of ten mice each at a doses of 1.25g, 2.5, 5, 10 and 21 g/kg body weight in a suspension with CMC Na 0,5%. Ten mice were used as control with a dose of 1 ml CMC Na 0,5%. The results suggest no acute toxicity to mice, since even the biggest dose given (show no measurable value of LD 50. It could be concluded that guava leaf extract shows no acute toxicity to mice at tested concentrations.

  11. Time of flight spectra of electrons emitted from graphite after positron annihilation

    International Nuclear Information System (INIS)

    Gladen, R W; Chirayath, V A; Chrysler, M D; Mcdonald, A D; Fairchild, A J; Shastry, K; Koymen, A R; Weiss, A H

    2017-01-01

    Low energy (∼2 eV) positrons were deposited onto the surface of highly oriented pyrolytic graphite (HOPG) using a positron beam equipped with a time of flight (TOF) spectrometer. The energy of the electrons emitted as a result of various secondary processes due to positron annihilation was measured using the University of Texas at Arlington’s (UTA) TOF spectrometer. The positron annihilation-induced electron spectra show the presence of a carbon KLL Auger peak at ∼263 eV. The use of a very low energy beam allowed us to observe a new feature not previously seen: a broad peak which reached to a maximum intensity at ∼4 eV and extended up to a maximum energy of ∼15 eV. The low energy nature of the peak was confirmed by the finding that the peak was eliminated when a tube in front of the sample was biased at -15 V. The determination that the electrons in the peak are leaving the surface with energies up to 7 times the incoming positron energy indicates that the electrons under the broad peak were emitted as a result of a positron annihilation related process. (paper)

  12. Spectra of electrons emitted as a result of the sticking and annihilation of low energy positrons to the surfaces of graphene and highly oriented pyrolytic graphite (HOPG)

    Science.gov (United States)

    Chrysler, M.; Chirayath, V.; McDonald, A.; Lim, Z.; Shastry, K.; Gladen, R.; Fairchild, A.; Koymen, A.; Weiss, A.

    Positron annihilation induced Auger electron spectroscopy (PAES) was used to study the positron induced low energy electron spectra from HOPG and a sample composed of 6-8 layers of graphene grown on polycrystalline copper. A low energy (~2eV) beam of positrons was used to implant positrons into a surface localized state on the graphene and HOPG samples. Measurements of the energy spectra of the positron induced electrons obtained using a TOF spectrometer indicate the presence of an annihilation induced KLL C Auger peak (at ~263 eV) along with a narrow low energy secondary peak due to an Auger mediated positron sticking (AMPS) process. A broad spectral feature was also observed below ~15 eV which we believe may be due to a VVV C Auger transition not previously observed. The energy dependence of the integrated intensity of the AMPS peak was measured for a series of incident positron kinetic energies ranging from ~1.5 eV up to 11 eV from which the binding energy of the surface localized positron state on graphene and HOPG was estimated. The implication of our results regarding the applicability of AMPS and PAES to the study of graphene surfaces and interfaces will be discussed. This work was supported by NSF Grant No. DMR 1508719 and DMR 1338130.

  13. Multi-channel 1-to-2 transition amplitudes in a finite volume

    Energy Technology Data Exchange (ETDEWEB)

    Briceno, Raul [JLAB; Hansen, Maxwell [Helmholtz Institute Mainz; Walker-Loud, Andre P [W& M. JLAB

    2015-04-01

    We derive a model-independent expression for finite-volume matrix elements. Specifically, we present a relativistic, non-perturbative analysis of the matrix element of an external current between a one-scalar in-state and a two-scalar out-state. Our result, which is valid for energies below higher-particle inelastic thresholds, generalizes the Lellouch-Luscher formula in two ways: we allow the external current to inject arbitrary momentum into the system and we allow for the final state to be composed an arbitrary number of strongly coupled two-particle states with arbitrary partial waves (including partial-wave mixing induced by the volume). We also illustrate how our general result can be applied to some key examples, such as heavy meson decays and meson photo production. Finally, we point out complications that arise involving unstable resonance states, such as B to K*+l+l when staggered or mixed-action/partially-quenched calculations are performed.

  14. Comparison of experimental and theoretical binding and transition energies in the actinide region

    Energy Technology Data Exchange (ETDEWEB)

    Krause, M. O.; NESTOR, JR., C. W. [OAK RIDGE NATIONAL LAB., TENN. (USA)

    1977-11-15

    The present status of experimental and theoretical binding and transition energy determinations is reviewed. Experimental data and the most recent theoretical predictions are compared for the energies of K..cap alpha../sub 1/ X-rays, M series X-rays, K-LL Auger electrons, K, L/sub 3/, M and N levels, and the 4f spin-orbit splitting. In addition, the K..cap alpha../sub 1/ and L/sub 3/ data are fitted by Moseley-type diagrams, and data on the shallow levels and the valence bands of actinide oxides are discussed. Comparison shows that the single-particle Dirac-Fock theory and the inclusion of quantum-electrodynamic contributions predicts energies of the innermost levels generally within the accuracy of data, that is in the order of magnitude of 1 eV. However, in the N, O... shells large deviations do occur presumably due to strong many-electron interactions. The inclusion of many-electron effects in the relativistic theory remains a challenge, as do experimental investigations affording an accuracy of better than 1 eV for the various electronic levels.

  15. Catalytic growth of vertically aligned neutron sensitive {sup 10}Boron nitride nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, Pervaiz, E-mail: pervaizahmad@siswa.um.edu.my, E-mail: Pervaiz-pas@yahoo.com; Khandaker, Mayeen Uddin, E-mail: mu-khandaker@yahoo.com, E-mail: mu-khandaker@um.edu.my; Amin, Yusoff Mohd [University of Malaya, Department of Physics, Faculty of Science (Malaysia); Khan, Ghulamullah [University of Malaya, Department of Mechanical Engineering (Malaysia); Ramay, Shahid M. [King Saud University, Department of Physics and Astronomy, College of Science (Saudi Arabia); Mahmood, Asif [King Saud University, Department of Chemical Engineering, College of Engineering (Saudi Arabia); Amin, Muhammad [University of the Punjab, Department of Physics (Pakistan); Muhammad, Nawshad [Interdisciplinary Research Centre in Biomedical Materials (IRCBM) COMSATS Institute of Information Technology (Pakistan)

    2016-01-15

    {sup 10}Boron nitride nanotubes ({sup 10}BNNTs) are a potential neutron sensing element in a solid-state neutron detector. The aligned {sup 10}BNNT can be used for its potential application without any further purification. Argon-supported thermal CVD is used to achieve vertically aligned {sup 10}BNNT with the help of nucleation sites produced in a thin layer of magnesium–iron alloy deposited at the top of Si substrate. FESEM shows vertically aligned {sup 10}BNNTs with ball-like catalytic tips at top. EDX reveals magnesium (Mg) contents in the tips that refer to catalytic growth of {sup 10}BNNT. HR-TEM shows tubular morphology of the synthesized {sup 10}BNNT with lattice fringes on its outer part having an interlayer spacing of ∼0.34 nm. XPS shows B 1 s and N 1 s peaks at 190.5 and 398 eV that correspond to hexagonal {sup 10}Boron nitride ({sup 10}h-BN) nature of the synthesized {sup 10}BNNT, whereas the Mg kll auger peaks at ∼301 and ∼311 eV represents Mg contents in the sample. Raman spectrum has a peak at 1390 (cm{sup −1}) that corresponds to E{sub 2g} mode of vibration in {sup 10}h-BN.

  16. Catalytic growth of vertically aligned neutron sensitive 10Boron nitride nanotubes

    International Nuclear Information System (INIS)

    Ahmad, Pervaiz; Khandaker, Mayeen Uddin; Amin, Yusoff Mohd; Khan, Ghulamullah; Ramay, Shahid M.; Mahmood, Asif; Amin, Muhammad; Muhammad, Nawshad

    2016-01-01

    10 Boron nitride nanotubes ( 10 BNNTs) are a potential neutron sensing element in a solid-state neutron detector. The aligned 10 BNNT can be used for its potential application without any further purification. Argon-supported thermal CVD is used to achieve vertically aligned 10 BNNT with the help of nucleation sites produced in a thin layer of magnesium–iron alloy deposited at the top of Si substrate. FESEM shows vertically aligned 10 BNNTs with ball-like catalytic tips at top. EDX reveals magnesium (Mg) contents in the tips that refer to catalytic growth of 10 BNNT. HR-TEM shows tubular morphology of the synthesized 10 BNNT with lattice fringes on its outer part having an interlayer spacing of ∼0.34 nm. XPS shows B 1 s and N 1 s peaks at 190.5 and 398 eV that correspond to hexagonal 10 Boron nitride ( 10 h-BN) nature of the synthesized 10 BNNT, whereas the Mg kll auger peaks at ∼301 and ∼311 eV represents Mg contents in the sample. Raman spectrum has a peak at 1390 (cm −1 ) that corresponds to E 2g mode of vibration in 10 h-BN

  17. Trapped Electron Mode Turbulence Driven Intrinsic Rotation in Tokamak Plasmas

    International Nuclear Information System (INIS)

    Wang, W.X.; Hahm, T.S.; Ethier, S.; Zakharov, L.E.

    2011-01-01

    Recent progress from global gyrokinetic simulations in understanding the origin of intrinsic rotation in toroidal plasmas is reported with emphasis on electron thermal transport dominated regimes. The turbulence driven intrinsic torque associated with nonlinear residual stress generation by the fluctuation intensity and the intensity gradient in the presence of zonal flow shear induced asymmetry in the parallel wavenumber spectrum is shown to scale close to linearly with plasma gradients and the inverse of the plasma current. These results qualitatively reproduce empirical scalings of intrinsic rotation observed in various experiments. The origin of current scaling is found to be due to enhanced kll symmetry breaking induced by the increased radial variation of the safety factor as the current decreases. The physics origin for the linear dependence of intrinsic torque on pressure gradient is that both turbulence intensity and the zonal flow shear, which are two key ingredients for driving residual stress, increase with the strength of turbulence drive, which is R0/LTe and R0/Lne for the trapped electron mode.

  18. Electron ejection from solids induced by fast highly-charged ions

    Energy Technology Data Exchange (ETDEWEB)

    Schiwietz, G. [Hahn-Meitner-Inst. GmbH, Berlin (Germany). Abt. FD; Xiao, G. [Hahn-Meitner-Inst. GmbH, Berlin (Germany). Abt. FD

    1996-02-01

    Total electron-ejection yields and Auger-electron spectra for highly-charged ions interacting with different foil targets have been investigated in this work. New experimental and theoretical data for normal incident 5 MeV/u heavy ions on graphite and polypropylene foils are presented and discussed. These two materials have been selected as model systems representing conductors and insulator targets. Our measured projectile nuclear-charge dependence of the total electron yield from carbon foils clearly deviates from results of some transport models that predict a proportionality with respect to the electronic stopping power of the projectiles. Possible reasons for this deviation are discussed. We have also extended our measurements on cascade-induced C-KLL Auger-electron production. The corresponding results for 5 MeV/u S ions on carbon were obtained with a new method and agree fairly well with previous data. Furthermore, we have performed an experimental and theoretical investigation on the nuclear-track potential in insulators. Comparison of experimental data with theoretical results for N{sup 7+}, Ne{sup 9+}, Ar{sup 16+} and Ni{sup 23+} ions allow for an estimate of the electron/hole pair recombination time at the center of the track in polypropylene. (orig.).

  19. The role of radiative de-excitation in the neutralization process of highly charged ions interacting with a single layer of graphene

    Science.gov (United States)

    Schwestka, J.; Wilhelm, R. A.; Gruber, E.; Heller, R.; Kozubek, R.; Schleberger, M.; Facsko, S.; Aumayr, F.

    2018-05-01

    X-ray emission of slow (graphene. To discriminate against X-ray emission originating from the graphene's support grid a coincidence technique is used. X-ray emission of 75 keV Ar17+ and Ar18+ ions with either one or two K-shell vacancies is recorded. Using a windowless Bruker XFlash detector allows us to measure additionally Ar KLL and KLM Auger electrons and determine the branching ratio of radiative vs. non-radiative decay of Ar K-shell holes. Furthermore, X-ray spectra for 100 keV Xe22+-Xe35+ ions are compared, showing a broad M-line peak for all cases, where M-shell vacancies are present. All these peaks are accompanied by emission lines at still higher energies indicating the presence of a hollow atom during X-ray decay. We report a linear shift of the main M-line peak to higher energies for increasing incident charge state, i.e. increasing number of M-shell holes.

  20. Effect of heating on the behaviors of hydrogen in C-TiC films with auger electron spectroscopy and secondary ion mass spectroscopy analyses

    International Nuclear Information System (INIS)

    Zou, Y.; Wang, L.W.; Huang, N.K.

    2007-01-01

    C-TiC films with a content of 75% TiC were prepared with magnetron sputtering deposition followed by Ar + ion bombardment. Effect of heating on the behaviors of hydrogen in C-TiC films before and after heating was studied with Auger Electron Spectroscopy and Secondary Ion Mass Spectroscopy (SIMS) analyses. SIMS depth profiles of hydrogen after H + ion implantation and thermal treatment show different hydrogen concentrations in C-TiC coatings and stainless steel. SIMS measurements show the existence of TiH, TiH 2 , CH 3 , CH 4 , C 2 H 2 bonds in the films after H + ion irradiation and the changes in the Ti LMM, Ti LMV and C KLL Auger line shape reveal that they have a good hydrogen retention ability after heating up to the temperature 393 K. All the results show that C-TiC coatings can be used as a hydrogen retainer or hydrogen permeable barrier on stainless steel to protect it from hydrogen brittleness

  1. Magnetism and molecular interactions at solid surfaces: Progress report for period June 1, 1987--May 31, 1988

    International Nuclear Information System (INIS)

    Rothberg, G.M.

    1988-08-01

    Measurements of photoemission EXAFS (PEXAFS) and spin polarized photoemission EXAFS (SPEXAFS) have been carried out at the National Synchrotron Light Source and in Japan at the Photon Factory. The SPEXAFS measurements made on thin films of MnO show the expected dependence on electron spin and magnetic state of the sample but must be analyzed further before they can be accepted. For the first time PEXAFS has been applied to a single crystal surface. An ordered array of one-third of a monolayer of chlorine on the (111) surface of nickel was studied using the Cl is photoelectrons and with two different polarizations of the light. PEXAFS results agreed with SEXAFS measurements using the Cl KLL Auger electrons. The effects of heat treatments on the oxidation of polycrystalline aluminum were also studied by making use of the chemical sensitivity of PEXAFS and it was shown that the gamma alumina structure forms on heating at 450/degree/C. In our laboratory electron energy loss fine structure (EXELFS) measurements have been made of nickel and its interaction with carbon monoxide and oxygen and of the influence of potassium predosing. 1 ref., 3 figs., 1 tab

  2. Photoionization of the Fe lons: Structure of the K-Edge

    Science.gov (United States)

    Palmeri, P.; Mendoza, C.; Kallman, T.; Bautista, M.; White, Nicholas E. (Technical Monitor)

    2002-01-01

    X-ray absorption and emission features arising from the inner-shell transitions in iron are of practical importance in astrophysics due to the Fe cosmic abundance and to the absence of traits from other elements in the nearby spectrum. As a result, the strengths and energies of such features can constrain the ionization stage, elemental abundance, and column density of the gas in the vicinity of the exotic cosmic objects, e.g. active galactic nuclei (AGN) and galactic black hole candidates. Although the observational technology in X-ray astronomy is still evolving and currently lacks high spectroscopic resolution, the astrophysical models have been based on atomic calculations that predict a sudden and high step-like increase of the cross section at the K-shell threshold (see for instance. New Breit-Pauli R-matrix calculations of the photoionization cross section of the ground states of Fe XVII in the region near the K threshold are presented. They strongly support the view that the previously assumed sharp edge behaviour is not correct. The latter has been caused by the neglect of spectator Auger channels in the decay of the resonances converging to the K threshold. These decay channels include the dominant KLL channels and give rise to constant widths (independent of n). As a consequence, these series display damped Lorentzian components that rapidly blend to impose continuity at threshold, thus reformatting the previously held picture of the edge. Apparent broadened iron edges detected in the spectra of AGN and galactic black hole candidates seem to indicate that these quantum effects may be at least partially responsible for the observed broadening.

  3. Partial inversion of elliptic operator to speed up computation of likelihood in Bayesian inference

    KAUST Repository

    Litvinenko, Alexander

    2017-08-09

    In this paper, we speed up the solution of inverse problems in Bayesian settings. By computing the likelihood, the most expensive part of the Bayesian formula, one compares the available measurement data with the simulated data. To get simulated data, repeated solution of the forward problem is required. This could be a great challenge. Often, the available measurement is a functional $F(u)$ of the solution $u$ or a small part of $u$. Typical examples of $F(u)$ are the solution in a point, solution on a coarser grid, in a small subdomain, the mean value in a subdomain. It is a waste of computational resources to evaluate, first, the whole solution and then compute a part of it. In this work, we compute the functional $F(u)$ direct, without computing the full inverse operator and without computing the whole solution $u$. The main ingredients of the developed approach are the hierarchical domain decomposition technique, the finite element method and the Schur complements. To speed up computations and to reduce the storage cost, we approximate the forward operator and the Schur complement in the hierarchical matrix format. Applying the hierarchical matrix technique, we reduced the computing cost to $\\\\mathcal{O}(k^2n \\\\log^2 n)$, where $k\\\\ll n$ and $n$ is the number of degrees of freedom. Up to the $\\\\H$-matrix accuracy, the computation of the functional $F(u)$ is exact. To reduce the computational resources further, we can approximate $F(u)$ on, for instance, multiple coarse meshes. The offered method is well suited for solving multiscale problems. A disadvantage of this method is the assumption that one has to have access to the discretisation and to the procedure of assembling the Galerkin matrix.

  4. Studies Of Oxidation And Thermal Reduction Of The Cu(100) Surface Using Positron Annihilation Induced Auger Electron Spectroscopy

    Science.gov (United States)

    Fazleev, N. G.; Nadesalingam, M. P.; Maddox, W.; Weiss, A. H.

    2011-06-01

    Positron annihilation induced Auger electron spectroscopy (PAES) measurements from the surface of an oxidized Cu(100) single crystal show a large increase in the intensity of the annihilation induced Cu M2,3VV Auger peak as the sample is subjected to a series of isochronal anneals in vacuum up to annealing temperature 300 °C. The PAES intensity then decreases monotonically as the annealing temperature is increased to ˜550 °C. Experimental positron annihilation probabilities with Cu 3p and O 1s core electrons are estimated from the measured intensities of the positron annihilation induced Cu M2,3VV and O KLL Auger transitions. PAES results are analyzed by performing calculations of positron surface states and annihilation probabilities of the surface-trapped positrons with relevant core electrons taking into account the charge redistribution at the surface and various surface structures associated with low and high oxygen coverages. The variations in atomic structure and chemical composition of the topmost layers of the oxidized Cu(100) surface are found to affect localization and spatial extent of the positron surface state wave function. The computed positron binding energy and annihilation characteristics reveal their sensitivity to charge transfer effects, atomic structure and chemical composition of the topmost layers of the oxidized Cu(100) surface. Theoretical positron annihilation probabilities with Cu 3p and O 1s core electrons computed for the oxidized Cu(100) surface are compared with experimental ones. The obtained results provide a demonstration of thermal reduction of the copper oxide surface after annealing at 300 °C followed by re-oxidation of the Cu(100) surface at higher annealing temperatures presumably due to diffusion of subsurface oxygen to the surface.

  5. Studies Of Oxidation And Thermal Reduction Of The Cu(100) Surface Using Positron Annihilation Induced Auger Electron Spectroscopy

    International Nuclear Information System (INIS)

    Fazleev, N. G.; Nadesalingam, M. P.; Maddox, W.; Weiss, A. H.

    2011-01-01

    Positron annihilation induced Auger electron spectroscopy (PAES) measurements from the surface of an oxidized Cu(100) single crystal show a large increase in the intensity of the annihilation induced Cu M2,3VV Auger peak as the sample is subjected to a series of isochronal anneals in vacuum up to annealing temperature 300 deg. C. The PAES intensity then decreases monotonically as the annealing temperature is increased to ∼550 deg. C. Experimental positron annihilation probabilities with Cu 3p and O 1s core electrons are estimated from the measured intensities of the positron annihilation induced Cu M 2,3 VV and O KLL Auger transitions. PAES results are analyzed by performing calculations of positron surface states and annihilation probabilities of the surface-trapped positrons with relevant core electrons taking into account the charge redistribution at the surface and various surface structures associated with low and high oxygen coverages. The variations in atomic structure and chemical composition of the topmost layers of the oxidized Cu(100) surface are found to affect localization and spatial extent of the positron surface state wave function. The computed positron binding energy and annihilation characteristics reveal their sensitivity to charge transfer effects, atomic structure and chemical composition of the topmost layers of the oxidized Cu(100) surface. Theoretical positron annihilation probabilities with Cu 3p and O 1s core electrons computed for the oxidized Cu(100) surface are compared with experimental ones. The obtained results provide a demonstration of thermal reduction of the copper oxide surface after annealing at 300 deg. C followed by re-oxidation of the Cu(100) surface at higher annealing temperatures presumably due to diffusion of subsurface oxygen to the surface.

  6. Investigation of some physical properties of ZnO nanofilms synthesized by micro-droplet technique

    Directory of Open Access Journals (Sweden)

    N. Hamzaoui

    Full Text Available In this paper, ZnO nanocrystals were synthesized using a simple micro-droplets technique from a solution prepared by dissolving zinc acetate di-hydrate [Zn(CH3COO2, 2H2O] in methanol. Microdroplets were deposited on glass substrates heated at 100 °C, the obtained samples of ZnO films were investigated by XRD, AES, AFM, ellipsometry and PL. XRD patterns reveal the wurtzite structure of ZnO where the lattice parameters a and c, calculated from XRD signals, show a nanometric character of ZnO nanoparticles. The chemical composition of ZnO film surfaces was verified by Auger electron spectroscopy (AES. From Auger signals, oxygen (O-KLL and zinc (Zn-LMM Auger transitions indicate well the presence of Zn-O bonding. The surface topography of the samples was measured by atomic force microscopy (AFM where ZnO nanoparticles of average size ranging between 20 and 80 nm were determined. Some optical properties as dielectric constants, refractive index, extinction coefficient as well as the optical band gap were determined from ellipsometry analysis. The dispersion of the refractive index was discussed in terms of both Cauchy parameters and Wemple & Di-Dominico single oscillator model. The photoluminescence (PL measurements exhibited two emission peaks. The first at 338 nm, corresponding to the band gap of ZnO, is due to excitonic emission while the second around 400 nm, is attributed to the single ionized oxygen vacancies. Keywords: ZnO nanoparticles, Micro droplets technique, AFM, Auger spectroscopy, Ellipsometry, Photoluminescence (PL

  7. Studies in the electronic structure of matter

    International Nuclear Information System (INIS)

    Miller, D.L.

    1979-01-01

    KLL Auger transition rates for helium are computed using simple atomic orbital wavefunctions which take into account the difference in average electron--electron repulsion of initial and final states. The results are consistent with transition rates computed by other authors using a variety of many-electron techniques. It is suggested that wavefunctions determined in the manner described provide a useful representation of the autoionizing state within the first Bohr radius. A method for extracting atomic pseudopotentials from photoelectron angular distributions is described and applied photoionization of the outermost p shells of Ar, Kr, and Xe and to the 4d shell of Xe. The pseudopotentials obtained reproduce the data, and also predict accurate cross sections and phase shifts for photoelectron energies up to 100 eV. It is suggested that the pseudopotentials aptly mimic the effects of intrashell electron--electron correlations in the photoionization process. The extended Hueckel theory is applied to the nitrogen trap in GaAs and GaP. Perfect crystal band structures are computed and are shown to be in reasonable agreement with those computed with empirical pseudopotentials. Nitrogen impurity levels in GaAs and GaP are computed using an extended Hueckel cluster model. In each case the model predicts two states within the band gap, in contrast to experiment which detects one impurity state in GaP and none in GaAs. It is suggested that the choice of cluster used unrealistically concentrates states near the conduction band edge on the central atom

  8. Studies in the electronic structure of matter

    International Nuclear Information System (INIS)

    Miller, D.L.

    1979-01-01

    KLL Auger transition rates for helium are computed using simple atomic orbital wavefunctions which take into account the difference in average electron-electron repulsion of initial and final states. The results are consistent with transition rates computed by other authors using a variety of many-electron techniques. It is suggested that wavefunctions determined in the manner described provide a useful representation of the autoionizing state within the first Bohr radius. A method for extracting atomic psuedopotentials from photoelectron angular distributions is described and applied photoionization of the outermost p shells of Ar, Kr, and Xe and to the 4d shell of Xe. The pseudopotentials obtained reproduce the data, and also predict accurate cross sections and phase shifts for photoelectron energies up to 100 eV. It is suggested that the pseudopotentials aptly mimic the effects of intrashell electron-electron correlations in the photoionization process. The extended Hueckel theory is applied to the nitrogen trap in GaAs and GaP. Perfect crystal band structures are computed and are shown to be in reasonable agreement with those computed with empirical psuedopotentials. Nitrogen impurity levles in GaAs and GaP are computed using an extended Hueckel cluster model. In each case the model predicts two states within the band gap, in contrast to experiment which detects one impurity state in GaP and none in GaAs. It is suggested that the choice of cluster used unrealistically concentrates states near the conduction band edge on the central atom

  9. Biodegradation kinetics of thin-stillage treatment by Aspergillus awamori and characterization of recovered chitosan.

    Science.gov (United States)

    Ray, S Ghosh; Ghangrekar, M M

    2016-02-01

    An attempt has been made to provide solution for distillery wastewater using fungal pretreatment followed by an anaerobic process to achieve higher organic matter removal, which is a challenge at present with currently adopted technologies. Submerged growth kinetics of distillery wastewater supernatant by Aspergillus awamori was also evaluated. The proposed kinetic models using a logistic equation for fungal growth and the Leudeking-Piret equation for product formation were validated experimentally, and substrate consumption equation was derived using estimated kinetic coefficients. Up to 59.6 % chemical oxygen demand (COD) and 70 % total organic carbon (TOC) removals were observed in 96 h of fungal incubation. Maximum specific growth rate of fungi, coefficient of biomass yield on substrate and growth-associated product formation coefficient were estimated to be 0.07 ± 0.01 h(-1), 0.614 kg biomass/kg utilized COD and 0.215 kg CO2/kg utilized TOC, respectively. The chitosan recovery of 0.072-0.078 kg/kg of dry mycelium was obtained using dilute sulphuric acid extraction, showing high purity and characteristic chitosan properties according to FTIR and XRD analyses. After anaerobic treatment of the fungal pretreated effluent with COD concentration of 7.920 ± 0.120 kg COD/m(3) (organic loading rate of 3.28 kg COD/m(3) day), overall COD reduction of 91.07 % was achieved from distillery wastewater.

  10. Modeling of Clostridium tyrobutyricum for Butyric Acid Selectivity in Continuous Fermentation

    Directory of Open Access Journals (Sweden)

    Jianjun Du

    2014-04-01

    Full Text Available A mathematical model was developed to describe batch and continuous fermentation of glucose to organic acids with Clostridium tyrobutyricum. A modified Monod equation was used to describe cell growth, and a Luedeking-Piret equation was used to describe the production of butyric and acetic acids. Using the batch fermentation equations, models predicting butyric acid selectivity for continuous fermentation were also developed. The model showed that butyric acid production was a strong function of cell mass, while acetic acid production was a function of cell growth rate. Further, it was found that at high acetic acid concentrations, acetic acid was metabolized to butyric acid and that this conversion could be modeled. In batch fermentation, high butyric acid selectivity occurred at high initial cell or glucose concentrations. In continuous fermentation, decreased dilution rate improved selectivity; at a dilution rate of 0.028 h−1, the selectivity reached 95.8%. The model and experimental data showed that at total cell recycle, the butyric acid selectivity could reach 97.3%. This model could be used to optimize butyric acid production using C. tyrobutyricum in a continuous fermentation scheme. This is the first study that mathematically describes batch, steady state, and dynamic behavior of C. tyrobutyricum for butyric acid production.

  11. A Coordenação Motora como Dispositivo para a Criação: uma abordagem somática na dança contemporânea

    Directory of Open Access Journals (Sweden)

    Paloma

    2014-12-01

    Full Text Available O artigo parte do princípio de que a educação somática articula questões próximas aos estudos da percepção tanto das ciências cognitivas como da filosofia. Indica que as abordagens somáticas podem ampliar sua área de atuação e transbordar sua função inicial de manutenção da saúde e melhora da qualidade técnica para habitar o campo da pesquisa e da criação em dança. A fim de estreitar a relação entre educação somática e dança, busca-se abordar alguns princípios do estudo da Coordenação Motora de Béziers e Piret e apontar seus possíveis desdobramentos no processo de investigação e criação em dança via percepção.

  12. Suvine Tallinn on täis head tarbekunsti, ka harrastajad on aktiivsed / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2005-01-01

    Andres ja Katja Koorti korraldatud kobarnäitus "18 tuba" Sakala t. 9 majas, Adolfas Shaulyse ja Mari Relo-Shaulyse näitus "Viva la vida!" A-galeriis, Piret Räni näitus "Hello friend - are you impotent?" EKA galeriis, Tiina Piisangu tööd köitekunstinäitusel "Scripta manent III. Maailma parim asi" Eesti Tarbekunsti- ja Disainimuuseumis, Kristiina Kalistru ja Silvia Kelle tööd Kullo galeriis, Anne Türni tööd ja väljapanek Lühikese jala galeriis, Eesti Keraamikute Liidu puupõletustehnikas teostatud tööde näitus arhitektuurimuuseumis, Thomas Häntzscheli fotode näitus ArtDepoos, Angelika Kauffmanni näitus Kadrioru Kunstimuuseumis, Adam Greeni ja Simona Dell'Agli näitus "Tekkimine" Tallinna Linnagaleriis, Merike Estna maalinäitus "The Sexiest Girl, Pussycat, the Happiest Girl and Two Loverabbits" Haus galeriis, Monica del Norte maalinäitus "Lugupilt" G-galeriis, Päivi Randveri näitus "Reisid kosmosesse" Draakoni galeriis, Kelli Valk Kagovere näitus "Kõik muutub" Ühispanga galeriis, Toomas Sarapuu näitus "Deebetkaart" Tallinna Kunstihoone galeriis jm.

  13. Kinetics of β-galactosidase Production by Lactobacillus bulgaricus During pH Controlled Batch Fermentation in Three Commercial Bulk Starter Media

    Directory of Open Access Journals (Sweden)

    Saeed Abbasalizadeh

    2015-10-01

    Full Text Available The potential of bulk starter fermentation strategy for production of a cost-effective and GRAS source of β-galactosidase from a starter culture strain Lactobacillus bulgaricus was investigated. Three different media were selected and the strain, L. bulgaricus DSM 20081 was cultivated in these media under pH-controlled condition (pH = 5.6 at 43°C. The media were: bulk starter medium based on skim milk + whey, bulk starter medium based on whey, and skim milk. Growth and β-lactic acid production parameters were estimated from experimental data with the Garcia and Luedeking-Piret models, respectively. β-galactosidase production kinetics was also simulated using models based on biomass concentration and lactic acid production. Growth in the bulk starter medium based on skim milk + whey resulted in a higher rate of lactic acid production (7.35 ± 0.23  mg lactic acid ml-1 media h-1 and β-galactosidase activity (800.1± 0.7 nmol ONP ml-1 media compared to the other two media (P<0.01. Simulation of β- galactosidase production based on rate of lactic acid production resulted in very good agreement with experimental data for all three tested media. The results revealed the potential of bulk starter fermentation strategy and skim milk + whey based medium for in-house and relatively low cost production of food-grade β-galactosidase by dairy plants.

  14. Kinetic studies on batch cultivation of Trichoderma reesei and application to enhance cellulase production by fed-batch fermentation.

    Science.gov (United States)

    Ma, Lijuan; Li, Chen; Yang, Zhenhua; Jia, Wendi; Zhang, Dongyuan; Chen, Shulin

    2013-07-20

    Reducing the production cost of cellulase as the key enzyme for cellulose hydrolysis to fermentable sugars remains a major challenge for biofuel production. Because of the complexity of cellulase production, kinetic modeling and mass balance calculation can be used as effective tools for process design and optimization. In this study, kinetic models for cell growth, substrate consumption and cellulase production in batch fermentation were developed, and then applied in fed-batch fermentation to enhance cellulase production. Inhibition effect of substrate was considered and a modified Luedeking-Piret model was developed for cellulase production and substrate consumption according to the growth characteristics of Trichoderma reesei. The model predictions fit well with the experimental data. Simulation results showed that higher initial substrate concentration led to decrease of cellulase production rate. Mass balance and kinetic simulation results were applied to determine the feeding strategy. Cellulase production and its corresponding productivity increased by 82.13% after employing the proper feeding strategy in fed-batch fermentation. This method combining mathematics and chemometrics by kinetic modeling and mass balance can not only improve cellulase fermentation process, but also help to better understand the cellulase fermentation process. The model development can also provide insight to other similar fermentation processes. Copyright © 2013 Elsevier B.V. All rights reserved.

  15. Biohydrogen Production and Kinetic Modeling Using Sediment Microorganisms of Pichavaram Mangroves, India

    Directory of Open Access Journals (Sweden)

    P. Mullai

    2013-01-01

    Full Text Available Mangrove sediments host rich assemblages of microorganisms, predominantly mixed bacterial cultures, which can be efficiently used for biohydrogen production through anaerobic dark fermentation. The influence of process parameters such as effect of initial glucose concentration, initial medium pH, and trace metal (Fe2+ concentration was investigated in this study. A maximum hydrogen yield of 2.34, 2.3, and 2.6 mol H2 mol−1 glucose, respectively, was obtained under the following set of optimal conditions: initial substrate concentration—10,000 mg L−1, initial pH—6.0, and ferrous sulphate concentration—100 mg L−1, respectively. The addition of trace metal to the medium (100 mg L−1 FeSO4·7H2O enhanced the biohydrogen yield from 2.3 mol H2 mol−1 glucose to 2.6 mol H2 mol−1 glucose. Furthermore, the experimental data was subjected to kinetic analysis and the kinetic constants were estimated with the help of well-known kinetic models available in the literature, namely, Monod model, logistic model and Luedeking-Piret model. The model fitting was found to be in good agreement with the experimental observations, for all the models, with regression coefficient values >0.92.

  16. Lastekirjandus vallutab uusi tippe : eesti lastekirjandus 2009 / Jaanus Vaiksoo

    Index Scriptorium Estoniae

    Vaiksoo, Jaanus, 1967-

    2010-01-01

    Ülevaade 2009. aasta eesti lastekirjandusest. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Kadi Hinrikus "Kui emad olid väikesed", Kristiina Kass "Peeter ja mina", Mika Keränen "Varastatud oranž jalgratas", Andrus Kivirähk "Kaka ja kevad", Aino Pervik "Ühes väikses veidras linnas", Maarja Undusk "Päkapikk Ingo", Ilmar Tomusk "Vend Johannes", Indrek Koff "Enne kooli", Piret Raud "Härra Linnu lugu", Wimberg "Suur pidusöök", Artur Jurin "Puru kuningriigi lood II", Joonas Sildre "Maailma naba", kogumik "Uued eesti muinasjutud", Aino Pervik "Tirilinna lood", Aimeé Beekman "Päästekoer Walter", Eve Ernis "Karupoeg Nummi seiklused", Priit Aimla "Torisev vanatoi", Juhani Püttsepp "Väikese hundi lood" ja "Lauajupi Madonna", Epp Petrone "Siis, kui seened veel rääkisid", Heiki Vilep "Habemega nali", "Nõiutud linn", Leelo Tungal "Naljatilgad lähevad laulupeole", "Kama üks ja kama kaks", koos Peep Pedmansoniga Miriami lood"(esimene 3D-piltidega lasteraamat), Aidi Vallik "Pints ja Tutsik" 2. osa, Mare Müürsepp "Viis vaba kutsikat", Tiia Selli "Kass Kriibik", Aleksei Turovski "Kassipoeg Võilill", Kaider Vardja "Vana maja lugu", Merca "Mullivesi", Ülle Kütsen "Väike puu ja rändur kuu", Lehte Hainsalu "Mängiks midagi", Peep Veedla "Pöialpoiss"

  17. Linnulennult 2008. aasta lastekirjandusest / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare, 1958-

    2009-01-01

    Lühidalt on iseloomustatud järgmisi 2008. a. ilmunud lasteraamatuid: Raud, Piret. Printsess Luluu ja härra Kere (Tänapäev) ; Vilep, Heiki. Horlok ja Ürgvärava võti (A-Disain) ; Reinaus, Reeli. Saladuslik päevik (Tänapäev) ; Kumberg, Krista. Autopõnn Anto läheb seiklema (Koolibri) ; Ausman, Piia. Kaptenid avastavad maailma (Haus Galerii) ; Selli, Tiia. Neletriin ja Kapi-Kaarup (Tänapäev) ; Samuel, Evelin. Ükskord, kui sadas vihma (Ajakirjade Kirjastus) ; Pervik, Aino. Presidendilood (Tänapäev) ; Vainola, Kätlin. Mia, Konrad ja avanevad uksed (Tänapäev) ; Smitt, Katri. Varesejalakiri (Ilo) ; Käo, Henno. Mina, emme ja teised (Tänapäev) ; Saarna, Meelike. Mattias ja mamma (Tänapäev) ; Hinrikus, Kadri. Miia ja Friida (Eesti Ekspressi Kirjastus) ; Soopan, Ivar. Kõik poisid ei saa suureks (Eesti Päevaleht) ; Kutsar, Kuulo. Mõmmikute telerihaigus (Ilo)

  18. Statistical optimization for enhanced yields of probiotic Bacillus coagulans and its phage resistant mutants followed by kinetic modelling of the process.

    Science.gov (United States)

    Pandey, Kavita R; Joshi, Chetan; Vakil, Babu V

    2016-01-01

    Probiotics are microorganisms which when administered in adequate amounts confer health benefits to the host. A leading pharmaceutical company producing Bacillus coagulans as a probiotic was facing the problem of recurring phage attacks. Two mutants viz. B. co PIII and B. co MIII that were isolated as phage resistant mutants after UV irradiation and MMS treatment of phage sensitive B. coagulans parental culture were characterized at functional and molecular level and were noted to have undergone interesting genetic changes. The non-specific genetic alterations induced by mutagenesis can also lead to alterations in cell performance. Hence, in the current study the parental strain and the two mutants were selected for shake flask optimization. Plackett-Burman design was used to select the significant culture variables affecting biomass production. Evolutionary operation method was applied for further optimization. The study showed wide variations in the nutritional requirements of phage resistant mutants, post exposure to mutagens. An increment of 150, 134 and 152 % was observed in the biomass productions of B. coagulans (parental type) and mutants B.co PIII and B.co MIII respectively, compared to the yield from one-factor-at-a-time technique. Using Logistic and modified Leudeking-Piret equations, biomass accumulation and substrate utilization efficiency of the bioprocess were determined. The experimental data was in agreement with the results predicted by statistical analysis and modelling. The developed model may be useful for controlling the growth and substrate consumption kinetics in large scale fermentation using B. coagulans .

  19. Jaan Krossist Kalevputrani

    Index Scriptorium Estoniae

    2012-01-01

    Välismaal ilmunud eesti kirjandusest ja eesti kirjanike tegemistest piiri taga: Eric Dickensi tõlkes ilmus inglise keeles Jaan Krossi romaan "Vastutuulelaev" (Sailing Against the Wind) ja eesti lühiproosa kogumik "The Dedalus Book of Estonian Literature" ; Indias esitleti eesti rahvuseepose "Kalevipoeg" Vishnu Khare tõlget hindi keelde ("Kalevputra") ; USA kirjandusajakiri "The Bitter Oleander" pühendas oma viimase numbri 32 lehekülge Kristiina Ehinile ja tema loomingule ; Piret Raua raamat "Printsess Luluu ja härra Kere" (läti keeles "Princese Skella un Leta kungs") võitis esikoha 2011. aasta Läti Lastežürii 3.-4. klassi vanuserühmas ; Viivi Luige teos "Varjuteater", mis ilmus 2011. aastal soome keeles, tunnistati üheks Helsingi Linnaraamatukogu iga-aastase auhinna "12 osumaa" laureaadiks ; UNESCO ülemaailmse luulepäeva tähistamiseks toimunud rahvusvahelisest luulemaratonist võttis osa ka Jüri Talvet

  20. Production of D- and L-Lactic Acid by Mono- and Mixed Cultures of Lactobacillus sp.

    Directory of Open Access Journals (Sweden)

    Antonija Trontel

    2011-01-01

    Full Text Available Batch cultivation of monoculture of Lactobacillus sp. and two–strain mixed culture of Lactobacillus sp. and Lactobacillus amylovorus DSM 20531T was carried out with the aim of producing L-(+- and D-(–/L-(+-lactic acid to be implemented in poly(lactic acid polymer production. Metabolic capacity of two Lactobacillus strains to ferment different carbon sources (glucose, sucrose or soluble starch during cultivation in MRS medium at 40 °C, in a laboratory-scale stirred tank bioreactor was defined. Lactobacillus sp. showed similar affinity towards mono- and disaccharide substrates, which were homofermentatively converted mostly to L-(+-lactic acid. L. amylovorus DSM 20531T has been characterized as a D/L-lactate producer and it is capable of conducting simultaneous saccharification and fermentation. Due to the interaction of Lactobacillus sp. with L. amylovorus DSM 20531T, starch was hydrolysed and fermented to the mixture of L-(+- and D-(–-lactic acid. Modified Luedeking-Piret kinetics used for the description of substrate utilization, growth of mono- and mixed cultures and production of lactic acid stereoisomers showed good agreement with experimental data.

  1. Lastekirjandus 2008 kurja kriitiku pilgu läbi / Ilona Martson

    Index Scriptorium Estoniae

    Martson, Ilona, 1970-

    2009-01-01

    Ülevaade 2008. aasta eesti lastekirjandusest. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Piret Raud "Printsess Luluu", Aino Pervik "Presidendilood", Kristiina Kass "Petra lood", Kätlin Vainola "Mia, Konrad ja avanevad uksed", Kerttu Soans "Külaline vannis", Wimberg "Härra Padakonn", Leelo Tungal "Seltsimees laps", Kadri Hinrikus "Miia ja Friida", Ivar Soopan "Kõik poisid ei saa suureks", Siiri Laidla "Raamatukogunõid Rosaalie", Siiri Laidla "Armas hunt", Reeli Reinaus "Saladuslik päevik", Tiia Selli "Neletriin ja Kapi-Kaarup", Markus Saksatamm "Võlur Sinku-Vinku ja nõiatrall", Evelin Samuel "Ükskord, kui sadas vihma", Mikä Keränen "Varastatud oranž jalgratas", Ivo Parbus "Draakon Rudolf", Urmas Nemvalts "Väikeste meeste lennumasinajutud", Lehte Hainsalu "Väike valge", Jaan Tangsoo "Mina ja minu pere", Aidi Vallik "Pints ja Tutsik", Heiki Vilep "Horlok ja Ürgvärava võti", Evelin Samuel "Hiigelsoojad pilvelambad", Sulev Oll "Hea tuju kuju", Paul-Eerik Rummo "Kui lähed teele koidu eel", Heljo Mänd "Suve suurmüük", Heljo Mänd "Sügise süda", Heljo Mänd "Kevade reklaam", Heljo Mänd "Talve Top", Ülo Pikkov. Presidendi torukübar

  2. Biosynthesis of poly(3-hydroxybutyrate) (PHB) by Cupriavidus necator H16 from jatropha oil as carbon source.

    Science.gov (United States)

    Batcha, Abeed Fatima Mohidin; Prasad, D M Reddy; Khan, Maksudur R; Abdullah, Hamidah

    2014-05-01

    Poly(3-hydroxybutyrate) (PHB) is a biodegradable polymer that can be synthesized through bacterial fermentation. In this study, Cupriavidus necator H16 is used to synthesize PHB by using Jatropha oil as its sole carbon source. Different variables mainly jatropha oil and urea concentrations, and agitation rate were investigated to determine the optimum condition for microbial fermentation in batch culture. Based on the results, the highest cell dry weight and PHB concentrations of 20.1 and 15.5 g/L, respectively, were obtained when 20 g/L of jatropha oil was used. Ethanol was used as external stress factor and the addition of 1.5 % ethanol at 38 h had a positive effect with a high PHB yield of 0.987 g PHB/g jatropha oil. The kinetic studies for cell growth rate and PHB production were conducted and the data were fitted with Logistic and Leudeking–Piret models. The rate constants were evaluated and the theoretical values were in accordance with the experimental data obtained

  3. Optimization of Baker's Yeast Production on Date Extract Using Response Surface Methodology (RSM).

    Science.gov (United States)

    Kara Ali, Mounira; Outili, Nawel; Ait Kaki, Asma; Cherfia, Radia; Benhassine, Sara; Benaissa, Akila; Kacem Chaouche, Noreddine

    2017-08-07

    This work aims to study the production of the biomass of S. cerevisiae on an optimized medium using date extract as the only carbon source in order to obtain a good yield of the biomass. The biomass production was carried out according to the central composite experimental design (CCD) as a response surface methodology using Minitab 16 software. Indeed, under optimal biomass production conditions, temperature (32.9 °C), pH (5.35) and the total reducing sugar extracted from dates (70.93 g/L), S. cerevisiae produced 40 g/L of their biomass in an Erlenmeyer after only 16 h of fermentation. The kinetic performance of the S. cerevisiae strain was investigated with three unstructured models i.e., Monod, Verhulst, and Tessier. The conformity of the experimental data fitted showed a good consistency with Monod and Tessier models with R² = 0.945 and 0.979, respectively. An excellent adequacy was noted in the case of the Verhulst model ( R² = 0.981). The values of kinetic parameters ( Ks , X m , μ m , p and q ) calculated by the Excel software, confirmed that Monod and Verhulst were suitable models, in contrast, the Tessier model was inappropriately fitted with the experimental data due to the illogical value of Ks (-9.434). The profiles prediction of the biomass production with the Verhulst model, and that of the substrate consumption using Leudeking Piret model over time, demonstrated a good agreement between the simulation models and the experimental data.

  4. Mathematical modeling of fed-batch fermentation of Schizochytrium sp. FJU-512 growth and DHA production using a shift control strategy.

    Science.gov (United States)

    Zhang, Mingliang; Wu, Weibin; Guo, Xiaolei; Weichen, You; Qi, Feng; Jiang, Xianzhang; Huang, Jianzhong

    2018-03-01

    To obtain high-cell-density cultures of Schizochytrium sp. FJU-512 for DHA production, two stages of fermentation strategy were used and carbon/nitrogen ratio, DO and temperature were controlled at different levels. The final dry cell weight, total lipid production and DHA yield in 15 l bioreactor reached 103.9, 37.2 and 16.0 g/l, respectively. For the further study of microbial growth and DHA production dynamics, we established a set of kinetic models for the fed-batch production of DHA by Schizochytrium sp. FJU-512 in 15 and 100 l fermenters and a compensatory parameter n was integrated into the model in order to find the optimal mathematical equations. A modified Logistic model was proposed to fit the cell growth data and the following kinetic parameters were obtained: µ m  = 0.0525/h, X m  = 100 g/l and n  = 4.1717 for the 15 l bioreactor, as well as µ m  = 0.0382/h, X m  = 107.4371 g/l and n  = 10 for the 100 l bioreactor. The Luedeking-Piret equations were utilized to model DHA production, yielding values of α  = 0.0648 g/g and β  = 0.0014 g/g/h for the 15 l bioreactor, while the values of α and β obtained for the 100 l fermentation were 0.0209 g/g and 0.0030 g/g/h. The predicted results compared with experimental data showed that the established models had a good fitting precision and were able to exactly depict the dynamic features of the DHA production process.

  5. Modelling growth of, and removal of Zn and Hg by a wild microalgal consortium

    Energy Technology Data Exchange (ETDEWEB)

    Monteiro, Cristina M.; Brandao, Teresa R.S.; Castro, Paula M.L. [Universidade Catolica Portuguesa, Porto (Portugal). CBQF/Escola Superior de Biotecnologia; Malcata, F. Xavier [ISMAI - Instituto Superior da Maia, Avioso S. Pedro (Portugal); CIMAR/CIIMAR - Centro Interdisciplinar de Investigacao Marinha e Ambiental, Porto (Portugal)

    2012-04-15

    Microorganisms isolated from sites contaminated with heavy metals usually possess a higher removal capacity than strains from regular cultures. Heavy metal-containing soil samples from an industrial dumpsite in Northern Portugal were accordingly collected; following enrichment under metal stress, a consortium of wild microalgae was obtained. Their ability to grow in the presence of, and their capacity to recover heavy metals was comprehensively studied; the datasets thus generated were fitted to by a combined model of biomass growth and metal uptake, derived from first principles. After exposure to 15 and 25 mg/L Zn{sup 2+} for 6 days, the microalgal consortium reached similar, or higher cell density than the control; however, under 50 and 65 mg/L Zn{sup 2+}, 71% to 84% inhibition was observed. Growth in the presence of Hg{sup 2+} was significantly inhibited, even at a concentration as low as 25 {mu}g/L, and 90% inhibition was observed above 100 {mu}g/L. The maximum amount of Zn{sup 2+} removed was 21.3 mg/L, upon exposure to 25 mg/L for 6 day, whereas the maximum removal of Hg{sup 2+} was 335 {mu}g/L, upon 6 day in the presence of 350 {mu}g/L. The aforementioned mechanistic model was built upon Monod assumptions (including heavy metal inhibition), coupled with Leudeking-Piret relationships between the rates of biomass growth and metal removal. The overall fits were good under all experimental conditions tested, thus conveying a useful tool for rational optimisation of microalga-mediated bioremediation. (orig.)

  6. Optimization of Baker’s Yeast Production on Date Extract Using Response Surface Methodology (RSM)

    Science.gov (United States)

    Kara Ali, Mounira; Outili, Nawel; Ait Kaki, Asma; Cherfia, Radia; Benhassine, Sara; Benaissa, Akila; Kacem Chaouche, Noreddine

    2017-01-01

    This work aims to study the production of the biomass of S. cerevisiae on an optimized medium using date extract as the only carbon source in order to obtain a good yield of the biomass. The biomass production was carried out according to the central composite experimental design (CCD) as a response surface methodology using Minitab 16 software. Indeed, under optimal biomass production conditions, temperature (32.9 °C), pH (5.35) and the total reducing sugar extracted from dates (70.93 g/L), S. cerevisiae produced 40 g/L of their biomass in an Erlenmeyer after only 16 h of fermentation. The kinetic performance of the S. cerevisiae strain was investigated with three unstructured models i.e., Monod, Verhulst, and Tessier. The conformity of the experimental data fitted showed a good consistency with Monod and Tessier models with R2 = 0.945 and 0.979, respectively. An excellent adequacy was noted in the case of the Verhulst model (R2 = 0.981). The values of kinetic parameters (Ks, Xm, μm, p and q) calculated by the Excel software, confirmed that Monod and Verhulst were suitable models, in contrast, the Tessier model was inappropriately fitted with the experimental data due to the illogical value of Ks (−9.434). The profiles prediction of the biomass production with the Verhulst model, and that of the substrate consumption using Leudeking Piret model over time, demonstrated a good agreement between the simulation models and the experimental data. PMID:28783118

  7. D-Lactic acid biosynthesis from biomass-derived sugars via Lactobacillus delbrueckii fermentation.

    Science.gov (United States)

    Zhang, Yixing; Vadlani, Praveen V

    2013-12-01

    Poly-lactic acid (PLA) derived from renewable resources is considered to be a good substitute for petroleum-based plastics. The number of poly L-lactic acid applications is increased by the introduction of a stereocomplex PLA, which consists of both poly-L and D-lactic acid and has a higher melting temperature. To date, several studies have explored the production of L-lactic acid, but information on biosynthesis of D-lactic acid is limited. Pulp and corn stover are abundant, renewable lignocellulosic materials that can be hydrolyzed to sugars and used in biosynthesis of D-lactic acid. In our study, saccharification of pulp and corn stover was done by cellulase CTec2 and sugars generated from hydrolysis were converted to D-lactic acid by a homofermentative strain, L. delbrueckii, through a sequential hydrolysis and fermentation process (SHF) and a simultaneous saccharification and fermentation process (SSF). 36.3 g L(-1) of D-lactic acid with 99.8 % optical purity was obtained in the batch fermentation of pulp and attained highest yield and productivity of 0.83 g g(-1) and 1.01 g L(-1) h(-1), respectively. Luedeking-Piret model described the mixed growth-associated production of D-lactic acid with a maximum specific growth rate 0.2 h(-1) and product formation rate 0.026 h(-1), obtained for this strain. The efficient synthesis of D-lactic acid having high optical purity and melting point will lead to unique stereocomplex PLA with innovative applications in polymer industry.

  8. Measurements of Polarization Transfers in Real Compton Scattering by a proton target at JLAB. A new source of information on the 3D shape of the nucleon

    Energy Technology Data Exchange (ETDEWEB)

    Fanelli, Cristiano V. [Sapienza Univ. of Rome (Italy)

    2015-03-01

    In this thesis work, results of the analysis of the polarization transfers measured in real Compton scattering (RCS) by the Collaboration E07-002 at the Je fferson Lab Hall-C are presented. The data were collected at large scattering angle (theta_cm = 70deg) and with a polarized incident photon beam at an average energy of 3.8 GeV. Such a kind of experiments allows one to understand more deeply the reaction mechanism, that involves a real photon, by extracting both Compton form factors and Generalized Parton Distributions (GPDs) (also relevant for possibly shedding light on the total angular momentum of the nucleon). The obtained results for the longitudinal and transverse polarization transfers K_LL and K_LT, are of crucial importance, since they confirm unambiguously the disagreement between experimental data and pQCD prediction, as it was found in E99-114 experiment, and favor the Handbag mechanism. The E99-114 and E07-002 results can contribute to attract new interest on the great yield of the Compton scattering by a nucleon target, as demonstrated by the recent approval of an experimental proposal submitted to the Jefferson Lab PAC 42 for a Wide-angle Compton Scattering experiment, at 8 and 10 GeV Photon Energies. The new experiments approved to run with the updated 12 GeV electron beam at JLab, are characterized by much higher luminosities, and a new GEM tracker is under development to tackle the challenging backgrounds. Within this context, we present a new multistep tracking algorithm, based on (i) a Neural Network (NN) designed for a fast and efficient association of the hits measured by the GEM detector which allows the track identification, and (ii) the application of both a Kalman filter and Rauch-Tung-Striebel smoother to further improve the track reconstruction. The full procedure, i.e. NN and filtering, appears very promising, with high performances in terms of both association effciency and reconstruction accuracy, and these preliminary results will

  9. Mastimännid ja muu mets : mitmekülgsuse võlu Eesti proosast aastal 2007 / Sirje Olesk

    Index Scriptorium Estoniae

    Olesk, Sirje, 1954-

    2008-01-01

    Ülevaade 2007. aasta eesti proosast. Käsitletakse järgimisi autoreid ja nende teoseid: Ene Mihkelson "Katkuhaud", Andrus Kivirähk "Mees, kes teadis ussisõnu", Jaan Kaplinski "Seesama jõgi", Tõnu Õnnepalu "Flandria päevik", Toomas Vint "Mäluauguga naine", Indrek Hargla "French ja Koulu Tarbatus", Kalle Käsper "Buridanid IV", Jaan Tooming "Teekond mäe südamesse", Ustav Mikelsaar "Tunnimehed", Henn Mikelsaar "Teema variatsioonidega", Reet Kudu "Pidupäevad võõrsil", Mara Maret Aronovich "Tagasikäiguga edasi", Aimée Beekman "Proovielu", Valentine Nõlvak "Ellujääja : mälestused", Mehis Heinsaar "Rändaja õnn", Maimu Berg "Unustatud inimesed", Mats Traat "Sarviku armastus : valik kultuuriloolisi novelle", Mihkel Mutt "Siseemigrant : novellid Rui taevalike kommentaaridega", Paavo Kivine "Kaks kavaleri", Kärt Hellerma "Ma armastasin David Copperfieldi", Piret Bristol "Paralleelmeri", Imre Siil "Mereröövlite loss", Kalju Saaber "Issanda loomaaed. Viru sektor", Veiko Märka "Lendas üle marmortahvli", Vahur Afanasjev "Kaadrid otsustavad, ehk, Sööbik ja Pisik seiklevad jälle, ehk, Eesti rahva lühike, kuid õnnelik ajalugu, Ehk kirjalik komejant tühjusest", Aarne Ruuben "Lugusid Anveltist ja Kingissepast", Epp Annus "Sina, Matilda", Peeter Helme "Puudutus", Ivar Sild "Tantsiv linn", Tui Hirv "Tähe tänav. Per musica ad astra", Tiina Laanem "Väikesed vanamehed", Angela Hofberg (pseud.) "Päev nagu elu", Marion Andra "Vähemalt...", Olle Lauli "Niguliste õpilased", Aarne Biin "Linna valitsemine", Erik Tohvri "Mürgiliblikas", Riina Kangur "Elisa", Kerttu Rakke "Küpsiseparadiis", Epp Petrone ja Dagmar Reintam "Õun ära süüa?", Elme Väljaste "Päriselu Proletariaadi puiesteel", Ketlin Priilinn "Hõbeingel", Ira Lember "Kohvik pärnade all", Paul Pajos "Krimijutud edasijõudnuile", Andres Anvelt "Punane elavhõbe", Klaara ja Kaarel Kivi "Mõrvasügis", Tiit Sepa "Hommik ühele", Lembit Uustulnd "Ruutuemanda sündroom : rahvusvaheline

  10. Low-Energy Electrons Emitted in Ion Collisions with Thin Foils

    Science.gov (United States)

    Kraemer, Michael; Kozhuharov, Christophor; Durante, Marco; Hagmann, Siegbert; Kraft, Gerhard; Lineva, Natallia

    this end, electron spectra were measured from collisions of 3.6 and 11.4 MeV/u carbon ions impinging on thin (4 to 40ug/cm**2) C, Ni, Ag, and Au targets. The results were compared with simple conventional theories as well as with dedicated TRAX Monte Carlo simulations taking transport through the material into account. We will discuss the importance of the projectile electrons as well as the instantaneous charge state of the projectile within the target material. These investigations were complemented with protons in comparison with singly charged H3 molecules as projectiles. The fact that the ratio of the cross sections for electron production is not unity and slightly increases with the electron energy supports the emphasis that we put on the importance of the projectile electrons and on the knowledge of the instantaneous charge state. The spectra further exhibit two structures that belong to the KLL-Auger lines of carbon and oxygen. The C-line originates from the target surface and from the adsorbed carbon; the O-line originates entirely from the adsorbed oxygen molecules. It appears that the line structure can be explained by the back-diffusion of the Auger electrons.

  11. PREFACE: Nanosafe2010: International Conference on Safe Production and Use of Nanomaterials

    Science.gov (United States)

    Sentein, Carole; Schuster, Frédéric; Tardif, François

    2011-07-01

    ESevertsov Inst. of Ecology and Evolution, RU KÜCK AUniv. Bremen, DE KUO Y-MChung Hwa University, TW KVITEK LPalacky Univ., CZ LABILLE JCEREGE, FR LAMMINEN EDekati, FI LARUE CCEA, FR LE BIHAN OINERIS, FR LE DUR DEcomesure, FR LECERF PCILAS, FR LEGRAND MCordouan, FR LELONG CUJF CEA, FR LIMOUSIN SINERIS, FR LINDELOEV JGEA Process Engineering, DK LIU P PChina Jiliang University, CN LIU WCEREGE, FR MACHEREY A-CCNRS, FR MAGGA YCEA, FR MAHLENDORF FUniversity Duisburg-Essen, DE MANIER NINERIS, FR MANZO LUniv. Pavia, IT MARCHETTO ACEA, FR MARCONE GUNICAMP, BR MARI DEPFL, CH MARIE-DESVERGNE CCEA, FR MARIE-LOUISE APSA Peugeot-Citroen, FR MARMUSE LNano-H S.A.S., FR MARRA JPhilips Research Aerasense, NL MASION ACEREGE, FR MATEI EPolitehnica University Bucharest, RO MATSUI YKyoto Univ., JP MATZKE MUniv. Gothenburg, SE MAYNE-L'HERMITE MCEA, FR MELINTE G ABabes-Bolyai University, RO MERINO CGrupo Antolin Ingenieria, ES MICHAUD-SORET ICEA, FR MICHELETTI CJRC, IT MONTIGEL EBasler Versicherungen, CH MONTOYA ERAMEM, ES MOSSUZ VCEA, FR MOTELLIER SCEA, FR MOTZKUS CLNE, FR MUIR BNaneum, GB NAKAMURA KJAPAN NUS CO., JP NEUBAUER NKarlsruhe Institute of Technologie, DE NEUMEISTER LBG ETEM, DE NGUYEN TNIST, US NIORT NINTERTEK, FR NOIRTIN AINTERTEK, FR NOWACK BEmpa, CH NYEMBE DUniv. Johannesburg, ZA Ó CLAONADH NDublin Institute of Technology, IE OBERDÖRSTER GUniv. Rochester, US OGURA IAIST, JP OSTIGUY CIRSST, CA OTSUKA KJFE Techno-Research Corp., JP OUF F-XIRSN, FR OUSACI SALMA, FR PAGET VCEA, FR PAILLEUX MEcole des Mines de Saint Etienne, FR PANDARD PINERIS, FR PANZER OEuropean Research Services, DE PARISELLI FCNRS, FR PERLET JNANO Magazine, GB PETERS RRIKILT, NL PETIT A-NCEA, FR PETKOVIC JNational Institute of Biology, SI PIMENOFF JBeneq, FI PINAULT MCEA, FR PIRET J-PUniv. Namur, BE PONTONE RTekna Plasma Systems, FR POURCHEZ JEcole des Mines de Saint Etienne, FR PRAETORIUS AETH Zurich, CH PRAT OCEA, FR PREVENSLIK TQED Radiations, CN PREVOST CIRSN, FR PROY HUART DFrance Nature Environnement, FR PUI