MODEL SPECTRA OF THE FIRST POTENTIALLY HABITABLE SUPER-EARTH-Gl581d
International Nuclear Information System (INIS)
Kaltenegger, Lisa; Segura, AntIgona; Mohanty, Subhanjoy
2011-01-01
Gl581d has a minimum mass of 7 M Earth and is the first detected potentially habitable rocky Super-Earth. Our models confirm that a habitable atmosphere can exist on Gl581d. We derive spectroscopic features for atmospheres assuming an Earth-like composition for this planet, from high-oxygen atmosphere analogous to Earth's to high-CO 2 atmospheres with and without biotic oxygen concentrations. We find that a minimum CO 2 partial pressure of about 7 bar, in an atmosphere with a total surface pressure of 7.6 bar, is needed to maintain a mean surface temperature above freezing on Gl581d. We model transmission and emergent synthetic spectra from 0.4 μm to 40 μm and show where indicators of biological activities in such a planet's atmosphere could be observed by future ground- and space-based telescopes. The model we present here only represents one possible nature-an Earth-like composition-of a planet like Gl581d in a wide parameter space. Future observations of atmospheric features can be used to examine if our concept of habitability and its dependence on the carbonate-silicate cycle is correct, and assess whether Gl581d is indeed a habitable Super-Earth.
Atmospheric studies of habitability in the Gliese 581 system
von Paris, P.; Gebauer, S.; Godolt, M.; Rauer, H.; Stracke, B.
2011-01-01
The M-type star Gliese 581 is orbited by at least one terrestrial planet candidate in the habitable zone, i.e. GL 581 d. Orbital simulations have shown that additional planets inside the habitable zone of GL 581 would be dynamically stable. Recently, two further planet candidates have been claimed, one of them in the habitable zone. In view of the ongoing search for planets around M stars which is expected to result in numerous detections of potentially habitable Super-Earths, we take the GL ...
CONSTRAINTS ON PLANET OCCURRENCE AROUND NEARBY MID-TO-LATE M DWARFS FROM THE MEARTH PROJECT
International Nuclear Information System (INIS)
Berta, Zachory K.; Irwin, Jonathan; Charbonneau, David
2013-01-01
The MEarth Project is a ground-based photometric survey intended to find planets transiting the closest and smallest main-sequence stars. In its first four years, MEarth discovered one transiting exoplanet, the 2.7 R ⊕ planet GJ1214b. Here, we answer an outstanding question: in light of the bounty of small planets transiting small stars uncovered by the Kepler mission, should MEarth have found more than just one planet so far? We estimate MEarth's ensemble sensitivity to exoplanets by performing end-to-end simulations of 1.25 × 10 6 observations of 988 nearby mid-to-late M dwarfs, gathered by MEarth between 2008 October and 2012 June. For 2-4 R ⊕ planets, we compare this sensitivity to results from Kepler and find that MEarth should have found planets at a rate of 0.05-0.36 planets yr –1 in its first four years. As part of this analysis, we provide new analytic fits to the Kepler early M dwarf planet occurrence distribution. When extrapolating between Kepler's early M dwarfs and MEarth's mid-to-late M dwarfs, we find that assuming the planet occurrence distribution stays fixed with respect to planetary equilibrium temperature provides a good match to our detection of a planet with GJ1214b's observed properties. For larger planets, we find that the warm (600-700 K), Neptune-sized (4 R ⊕ ) exoplanets that transit early M dwarfs like Gl436 and GJ3470 occur at a rate of –1 (at 95% confidence) around MEarth's later M dwarf targets. We describe a strategy with which MEarth can increase its expected planet yield by 2.5 × without new telescopes by shifting its sensitivity toward the smaller and cooler exoplanets that Kepler has demonstrated to be abundant
The MEarth Project: Finding the Best Targets for Atmospheric Characterization with JWST
Berta-Thompson, Z.
2014-04-01
If we want to directly observe the radius, orbit, mass, and atmosphere of a small, cool, habitable exoplanet, our best opportunity is to find such a planet transiting a small, cool, nearby M dwarf star. The MEarth Project is an ongoing all-sky survey for Earth-like planets transiting the closest, smallest M dwarfs in the Galaxy. MEarth aims to find good targets for atmospheric characterization with JWST and the next generation of enormous ground-based telescopes. This poster provides a status update on the MEarth Project, including the progress we've made over the past five years with 8 telescopes in the Northern hemisphere and promising early results from our new installation of 8 more telescopes in the Southern hemisphere.
Irwin, Jonathan M.; Berta-Thompson, Zachory K.; Charbonneau, David; Dittmann, Jason; Falco, Emilio E.; Newton, Elisabeth R.; Nutzman, Philip
2015-01-01
Detection and characterization of potentially habitable Earth-size extrasolar planets is one of the major goals of contemporary astronomy. By applying the transit method to very low-mass M-dwarfs , it is possible to find these planets from the ground with present-day instrumentation and observational techniques. The MEarth project is one such survey with stations in both hemispheres: MEarth-North at the Fred Lawrence Whipple Observatory, Mount Hopkins, Arizona, and MEarth-South at Cerro Tololo Inter-American Observatory, Chile. We present an update on recent results of this survey, for planet occurrence rates, and interesting stellar astrophysics, for which our sample of 3000 nearby mid-to-late M-dwarfs has been very fruitful. All light curves gathered during the survey are made publicly available after one year, and we describe how to access and use these data.
Orbit and Dynamical Mass of the Late-T Dwarf GL 758 B
Bowler, Brendan P.; Dupuy, Trent J.; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Fulton, Benjamin J.; Petigura, Erik A.; Howard, Andrew W.; Hirsch, Lea; Kratter, Kaitlin M.; Crepp, Justin R.; Biller, Beth A.; Johnson, Marshall C.; Wittenmyer, Robert A.
2018-04-01
Gl 758 B is a late-T dwarf orbiting a metal-rich Sun-like star at a projected separation of ρ ≈ 1.″6 (25 au). We present four epochs of astrometry of this system with NIRC2 at Keck Observatory spanning 2010 to 2017 together with 630 radial velocities (RVs) of the host star acquired over the past two decades from McDonald Observatory, Keck Observatory, and the Automated Planet Finder at Lick Observatory. The RVs reveal that Gl 758 is accelerating with an evolving rate that varies between 2 and 5 m s‑1 yr‑1, consistent with the expected influence of the imaged companion Gl 758 B. A joint fit of the RVs and astrometry yields a dynamical mass of {42}-7+19 M Jup for the companion with a robust lower limit of 30.5 M Jup at the 4-σ level. Gl 758 B is on an eccentric orbit (e = 0.26–0.67 at 95% confidence) with a semimajor axis of a = {21.1}-1.3+2.7 au and an orbital period of P = {96}-9+21 yr, which takes it within ≈9 au from its host star at periastron passage. Substellar evolutionary models generally underpredict the mass of Gl 758 B for nominal ages of 1–6 Gyr that have previously been adopted for the host star. This discrepancy can be reconciled if the system is older—which is consistent with activity indicators and recent isochrone fitting of the host star—or alternatively if the models are systematically overluminous by ≈0.1–0.2 dex. Gl 758 B is currently the lowest-mass directly imaged companion inducing a measured acceleration on its host star. In the future, bridging RVs and high-contrast imaging with the next generation of extremely large telescopes and space-based facilities will open the door to the first dynamical mass measurements of imaged exoplanets. Some of the data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible
Flares of Nearby, Mid-to-late M-dwarfs Characterized by the MEarth Project
Mondrik, Nicholas; Charbonneau, David; Irwin, Jonathan; Newton, Elisabeth R.
2017-01-01
Stellar flares are both a curse and a blessing: Transit and radial velocity searches for exoplanets are hindered by the variability caused by flares, while the characteristics of this variability offer valuable insight into the magnetic properties of the star. We present an analysis of flare events of nearby, mid-to-late M-dwarfs from the MEarth Project. MEarth consists of a northern and a southern array of 8 telescopes each that photometrically monitors most mid-to-late M-dwarfs within 30 parsecs. Although the initial motivation was to search for exoplanet transits, the cadence of approximately 20 minutes is well-suited to capturing long-lived flares. However, MEarth employs a single, wide, red bandpass, which poses challenges to the robust detection of flare events, which are typically bluer in color. Using MEarth data, our team has recently published trigonometric parallaxes and estimates of rotation periods for an unprecedented number of nearby low-mass stars. We also gathered supplementary optical and near infrared spectra of a subset of these stars. We describe here the properties of the flares detected by MEarth, and explore the relation of the presence of flares on individual stars with stellar parameters such as rotational period, mass, and H-alpha equivalent width. We also provide an estimate of flare rate for individual stars by injecting flares into our pipeline.The MEarth project acknowledges funding from the National Science Foundation and the David and Lucile Packard Foundation Fellowship for Science and Engineering. This work was made possible through the support of a grant from the John Templeton Foundation.
International Nuclear Information System (INIS)
Howard, Andrew W.; Marcy, Geoffrey W.; Isaacson, Howard; Johnson, John Asher; Fischer, Debra A.; Wright, Jason T.; Henry, Gregory W.; Valenti, Jeff A.; Anderson, Jay; Piskunov, Nikolai E.
2011-01-01
We report the discovery of planets orbiting two bright, nearby early K dwarf stars, HD 97658 and Gl 785. These planets were detected by Keplerian modeling of radial velocities measured with Keck-HIRES for the NASA-UC Eta-Earth Survey. HD 97658 b is a close-in super-Earth with minimum mass Msin i = 8.2 ± 1.2 M + , orbital period P = 9.494 ± 0.005 days, and an orbit that is consistent with circular. Gl 785 b is a Neptune-mass planet with Msin i = 21.6 ± 2.0 M + , P = 74.39 ± 0.12 days, and orbital eccentricity e = 0.30 ± 0.09. Photometric observations with the T12 0.8 m automatic photometric telescope at Fairborn Observatory show that HD 97658 is photometrically constant at the radial velocity period to 0.09 mmag, supporting the existence of the planet.
International Nuclear Information System (INIS)
Makarov, Valeri V.; Berghea, Ciprian; Efroimsky, Michael
2012-01-01
GJ 581d is a potentially habitable super-Earth in the multiple system of exoplanets orbiting a nearby M dwarf. We investigate this planet's long-term dynamics with an emphasis on its probable final rotation states acquired via tidal interaction with the host. The published radial velocities for the star are re-analyzed with a benchmark planet detection algorithm to confirm that there is no evidence for the recently proposed two additional planets (f and g). Limiting the scope to the four originally detected planets, we assess the dynamical stability of the system and find bounded chaos in the orbital motion. For the planet d, the characteristic Lyapunov time is 38 yr. Long-term numerical integration reveals that the system of four planets is stable, with the eccentricity of the planet d changing quasi-periodically in a tight range around 0.27, and with its semimajor axis varying only a little. The spin-orbit interaction of GJ 581d with its host star is dominated by the tides exerted by the star on the planet. We model this interaction, assuming a terrestrial composition of the mantle. Besides the triaxiality-caused torque and the secular part of the tidal torque, which are conventionally included in the equation of motion, we also include the tidal torques' oscillating components. It turns out that, depending on the mantle temperature, the planet gets trapped into the 2:1 or an even higher spin-orbit resonance. It is very improbable that the planet could have reached the 1:1 resonance. This improves the possibility of the planet being suitable for sustained life.
Berta-Thompson, Zachory K.; Irwin, Jonathan; Charbonneau, David; Newton, Elisabeth R.; Dittmann, Jason
2014-06-01
The MEarth Project is an ongoing all-sky survey for Earth-like planets transiting the closest, smallest M dwarfs. MEarth aims to find good targets for atmospheric characterization with JWST and the next generation of enormous ground-based telescopes. MEarth's yearly data releases, containing precise light curves of nearby mid-to-late M dwarfs, provide a unique window into the photometric variability of the stars that will forever be among the most interesting targets in the search for potentially habitable exoplanets. We present a status update on the MEarth Project, including a detailed map of the progress we’ve made so far with 8 telescopes in the Northern hemisphere and promising early results from our new installation of 8 more telescopes in the Southern hemisphere.
The impact of red noise in radial velocity planet searches: only three planets orbiting GJ 581?
Baluev, Roman V.
2013-03-01
We perform a detailed analysis of the latest HARPS and Keck radial velocity data for the planet-hosting red dwarf GJ 581, which attracted a lot of attention in recent time. We show that these data contain important correlated noise component (`red noise') with the correlation time-scale of the order of 10 d. This red noise imposes a lot of misleading effects while we work in the traditional white-noise model. To eliminate these misleading effects, we propose a maximum-likelihood algorithm equipped by an extended model of the noise structure. We treat the red noise as a Gaussian random process with an exponentially decaying correlation function. Using this method we prove that (i) planets b and c do exist in this system, since they can be independently detected in the HARPS and Keck data, and regardless of the assumed noise models; (ii) planet e can also be confirmed independently by both the data sets, although to reveal it in the Keck data it is mandatory to take the red noise into account; (iii) the recently announced putative planets f and g are likely just illusions of the red noise; (iv) the reality of the planet candidate GJ 581 d is questionable, because it cannot be detected from the Keck data, and its statistical significance in the HARPS data (as well as in the combined data set) drops to a marginal level of ˜2σ, when the red noise is taken into account. Therefore, the current data for GJ 581 really support the existence of no more than four (or maybe even only three) orbiting exoplanets. The planet candidate GJ 581 d requests serious observational verification.
ASTROPHYSICAL PARAMETERS AND HABITABLE ZONE OF THE EXOPLANET HOSTING STAR GJ 581
International Nuclear Information System (INIS)
Von Braun, Kaspar; Kane, Stephen R.; Ciardi, David R.; Boyajian, Tabetha S.; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Van Belle, Gerard T.; Lopez-Morales, Mercedes; Subasavage, John P.; Schaefer, Gail; Ten Brummelaar, Theo A.; Sturmann, Laszlo; Sturmann, Judit; Mazingue, Jude; Turner, Nils H.; Farrington, Chris; Goldfinger, P. J.; Ridgway, Stephen
2011-01-01
GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be 0.299 ± 0.010 R sun . Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature T EFF = 3498 ± 56 K and its luminosity L = 0.01205 ± 0.00024 L sun . From these measurements, we recompute the location and extent of the system's habitable zone and conclude that two of the planets orbiting GJ 581, planets d and g, spend all or part of their orbit within or just on the edge of the habitable zone.
Observing the Spectra of MEarth and TRAPPIST Planets with JWST
Morley, Caroline; Kreidberg, Laura; Rustamkulov, Zafar; Robinson, Tyler D.; Fortney, Jonathan J.
2017-10-01
During the past two years, nine planets close to Earth in radius have been discovered around nearby M dwarfs cooler than 3300 K. These planets include the 7 planets in the TRAPPIST-1 system and two planets discovered by the MEarth survey, GJ 1132b and LHS 1140b (Dittmann et al. 2017; Berta-Thompson et al. 2015; Gillon et al. 2017). These planets are the smallest planets discovered to date that will be amenable to atmospheric characterization with JWST. They span equilibrium temperatures from ˜130 K to >500 K, and radii from 0.7 to 1.43 Earth radii. Some of these planets orbit as distances potentially amenable to surface liquid water, though the actual surface temperatures will depend strongly on the albedo of the planet and the thickness and composition of its atmosphere. The stars they orbit also vary in activity levels, from the quiet LHS 1140b host star to the more active TRAPPIST-1 host star. This set of planets will form the testbed for our first chance to study the diversity of atmospheres around Earth-sized planets. Here, we will present model spectra of these 9 planets, varying the composition and the surface pressure of the atmosphere. We base our elemental compositions on three outcomes of planetary atmosphere evolution in our own solar system: Earth, Titan, and Venus. We calculate the molecular compositions in chemical equilibrium. We present both thermal emission spectra and transmission spectra for each of these objects, and make predictions for the observability of these spectra with different instrument modes with JWST.
Is Gliese 581d habitable? Some constraints from radiative-convective climate modeling
Wordsworth, R. D.; Forget, F.; Selsis, F.; Madeleine, J. -B.; Millour, E.; Eymet, V.
2010-01-01
The recently discovered exoplanet Gl 581d is extremely close to the outer edge of its system’s habitable zone, which has led to much speculation on its possible climate. We have performed a range of simulations to assess whether, given simple combinations of chemically stable greenhouse gases, the planet could sustain liquid water on its surface. For best estimates of the surface gravity, surface albedo and cloud coverage, we find that less than 10 bars of CO2 is sufficient to maintain a glob...
International Nuclear Information System (INIS)
Dittmann, Jason A.; Irwin, Jonathan M.; Charbonneau, David; Newton, Elisabeth R.
2016-01-01
The MEarth Project is a photometric survey systematically searching the smallest stars near the Sun for transiting rocky planets. Since 2008, MEarth has taken approximately two million images of 1844 stars suspected to be mid-to-late M dwarfs. We have augmented this survey by taking nightly exposures of photometric standard stars and have utilized this data to photometrically calibrate the MEarth system, identify photometric nights, and obtain an optical magnitude with 1.5% precision for each M dwarf system. Each optical magnitude is an average over many years of data, and therefore should be largely immune to stellar variability and flaring. We combine this with trigonometric distance measurements, spectroscopic metallicity measurements, and 2MASS infrared magnitude measurements in order to derive a color–magnitude–metallicity relation across the mid-to-late M dwarf spectral sequence that can reproduce spectroscopic metallicity determinations to a precision of 0.1 dex. We release optical magnitudes and metallicity estimates for 1567 M dwarfs, many of which did not have an accurate determination of either prior to this work. For an additional 277 stars without a trigonometric parallax, we provide an estimate of the distance, assuming solar neighborhood metallicity. We find that the median metallicity for a volume-limited sample of stars within 20 pc of the Sun is [Fe/H] = −0.03 ± 0.008, and that 29/565 of these stars have a metallicity of [Fe/H] = −0.5 or lower, similar to the low-metallicity distribution of nearby G dwarfs. When combined with the results of ongoing and future planet surveys targeting these objects, the metallicity estimates presented here will be important for assessing the significance of any putative planet–metallicity correlation
Energy Technology Data Exchange (ETDEWEB)
Dittmann, Jason A.; Irwin, Jonathan M.; Charbonneau, David; Newton, Elisabeth R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)
2016-02-20
The MEarth Project is a photometric survey systematically searching the smallest stars near the Sun for transiting rocky planets. Since 2008, MEarth has taken approximately two million images of 1844 stars suspected to be mid-to-late M dwarfs. We have augmented this survey by taking nightly exposures of photometric standard stars and have utilized this data to photometrically calibrate the MEarth system, identify photometric nights, and obtain an optical magnitude with 1.5% precision for each M dwarf system. Each optical magnitude is an average over many years of data, and therefore should be largely immune to stellar variability and flaring. We combine this with trigonometric distance measurements, spectroscopic metallicity measurements, and 2MASS infrared magnitude measurements in order to derive a color–magnitude–metallicity relation across the mid-to-late M dwarf spectral sequence that can reproduce spectroscopic metallicity determinations to a precision of 0.1 dex. We release optical magnitudes and metallicity estimates for 1567 M dwarfs, many of which did not have an accurate determination of either prior to this work. For an additional 277 stars without a trigonometric parallax, we provide an estimate of the distance, assuming solar neighborhood metallicity. We find that the median metallicity for a volume-limited sample of stars within 20 pc of the Sun is [Fe/H] = −0.03 ± 0.008, and that 29/565 of these stars have a metallicity of [Fe/H] = −0.5 or lower, similar to the low-metallicity distribution of nearby G dwarfs. When combined with the results of ongoing and future planet surveys targeting these objects, the metallicity estimates presented here will be important for assessing the significance of any putative planet–metallicity correlation.
14 CFR 25.581 - Lightning protection.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Lightning protection. 25.581 Section 25.581 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Lightning Protection § 25.581 Lightning protection. (a...
Cozzi, Patrick
2012-01-01
Get Real-World Insight from Experienced Professionals in the OpenGL Community With OpenGL, OpenGL ES, and WebGL, real-time rendering is becoming available everywhere, from AAA games to mobile phones to web pages. Assembling contributions from experienced developers, vendors, researchers, and educators, OpenGL Insights presents real-world techniques for intermediate and advanced OpenGL, OpenGL ES, and WebGL developers. Go Beyond the Basics The book thoroughly covers a range of topics, including OpenGL 4.2 and recent extensions. It explains how to optimize for mobile devices, explores the design
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D
5 CFR 581.202 - Service of process.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Service of process. 581.202 Section 581... GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Service of Process § 581.202 Service of process. (a) A... facilitate proper service of process on its designated agent(s). If legal process is not directed to any...
GLIESE 581D IS THE FIRST DISCOVERED TERRESTRIAL-MASS EXOPLANET IN THE HABITABLE ZONE
International Nuclear Information System (INIS)
Wordsworth, Robin D.; Forget, Francois; Millour, Ehouarn; Charnay, Benjamin; Madeleine, Jean-Baptiste; Selsis, Franck
2011-01-01
It has been suggested that the recently discovered exoplanet GJ581d might be able to support liquid water due to its relatively low mass and orbital distance. However, GJ581d receives 35% less stellar energy than Mars and is probably locked in tidal resonance, with extremely low insolation at the poles and possibly a permanent night side. Under such conditions, it is unknown whether any habitable climate on the planet would be able to withstand global glaciation and/or atmospheric collapse. Here we present three-dimensional climate simulations which demonstrate that GJ581d will have a stable atmosphere and surface liquid water for a wide range of plausible cases, making it the first confirmed super-Earth (exoplanet of 2-10 Earth masses) in the habitable zone. We find that atmospheres with over 10 bar CO 2 and varying amounts of background gas (e.g., N 2 ) yield global mean temperatures above 0 0 C for both land and ocean-covered surfaces. Based on the emitted IR radiation calculated by the model, we propose observational tests that will allow these cases to be distinguished from other possible scenarios in the future.
Movania, Muhammad Mobeen
2013-01-01
The book is written in a Cookbook format with practical recipes aimed at helping you exploit OpenGL to its full potential.This book is targeted towards intermediate OpenGL programmers. However, those who are new to OpenGL and know an alternate API like DirectX might also find these recipes useful to create OpenGL animations.
7 CFR 58.1 - Meaning of words.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 58.1 Section 58.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... Meaning of words. For the purpose of the regulations in this subpart, words in the singular form shall be...
Gl(2/2)-oscillators and Gl(2/2)-dynamical symmetry
International Nuclear Information System (INIS)
Kamupingene, A.H.; Nguyen Anh Ky.
1991-07-01
Extending the concept of the dynamical symmetry, we identify the Lie superalgebra Gl(2/2) as a dynamical (super-)algebra of a class of non-canonical quantum systems, whose dynamical variables and quantities can be realized in terms of the Gl(2/2)-generators. In this way, a new class of harmonic oscillators is established. As a consequence of the choice of the dynamical variables the Heisenberg algebra and the Hermitian condition for the Gl(2/2)-representations are also given. (author). 12 refs
40 CFR 60.581 - Definitions and symbols.
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Definitions and symbols. 60.581 Section... Coating and Printing § 60.581 Definitions and symbols. (a) All terms used in this subpart, not defined... solvent vapors emitted from the flexible vinyl or urethane rotogravure printing line. (b) All symbols used...
40 CFR 52.581 - Significant deterioration of air quality.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Significant deterioration of air quality. 52.581 Section 52.581 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) All applications and other information required pursuant to § 52.21 of this...
A PALETTE OF CLIMATES FOR GLIESE 581g
International Nuclear Information System (INIS)
Pierrehumbert, R. T.
2011-01-01
We consider a range of possible climates for the habitable-zone planet candidate, Gliese 581g, contingent on a plausible set of hypothetical atmospheres and assuming the planet to be tide locked. The two most habitable states we find are (1) a nearly airless Super-Europa with thin ice at the substellar point and (2) an 'Eyeball Earth' which is mostly frozen but supports a substantial stable pool of open water centered on the substellar point. We discuss the prospects for observational determination of what kind of climate 581g actually supports.
On the Hopf structure of Up,q(gl(1/1)) and the universal Τ-matrix of Funp,q(GL(1/1))
International Nuclear Information System (INIS)
Chakrabarti, R.; Jagannathan, R.
1994-08-01
Using the technique developed by Fronsdal and Galindo (Lett. Math. Phys, 27 (1993) 57) for studying the Hopf duality between the quantum algebras Fun p,q (GL(2)) and U p,q (gl(2)), the Hopf structure of U p,q (gl(1/1)), dual to Fun p,q (GL(1/1)), is derived and the corresponding universal Τ-matrix of Fun p,q (GL(1/1)), embodying the suitably modified exponential relationship U p,q (gl(1/1)) → Fun p,q (GL(1/1)), is obtained. (author). 10 refs
Modular representations of GL(n) distinguished by GL(n-1) over a p-adic field
Sécherre , Vincent; Venketasubramanian , C. G.
2015-01-01
Let $\\F$ be a non-Archimedean locally compact field, $q$ be the cardinality of its residue field, and $\\R$ be an algebraically closed field of characteristic $\\ell$ not dividing $q$.We classify all irredu\\-cible smooth $\\R$-representations of $\\GL\\_n(\\F)$ having a nonzero $\\GL\\_{n-1}(\\F)$-inva\\-riant linear form, when $q$ is not congruent to $1$ mod $\\ell$.Partial results in the case when $q$ is $1$ mod $\\ell$ show that, unlike the complex case, the space of $\\GL\\_{n-1}(\\F)$-invariant linear ...
27 CFR 19.581 - Authorized containers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Authorized containers. 19..., DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Containers and Marks Containers § 19.581 Authorized containers. (a) General. Proprietors shall use for any purpose of containing, storing...
5 CFR 581.304 - Nonliability for disclosure.
2010-01-01
... § 581.303(b), shall be subject to any disciplinary action or civil or criminal liability or penalty for... not be precluded from taking disciplinary action against an employee who consistently or purposely...
OpenGL 4 shading language cookbook
Wolff, David
2013-01-01
OpenGL Shading Language 4 Cookbook is a hands-on guide that gets straight to the point - actually creating graphics, instead of just theoretical learning. Each recipe is specifically tailored to satisfy your appetite for producing real-time 3-D graphics using the latest GLSL specification.This book is for OpenGL programmers looking to use the modern features of GLSL 4 to create real-time, three-dimensional graphics. Familiarity with OpenGL programming, along with the typical 3D coordinate systems, projections, and transformations is assumed. It can also be useful for experienced GLSL programme
Effect of lunar gravity models on Chang'E-2 orbit determination using VLBI tracking data
Directory of Open Access Journals (Sweden)
Erhu Wei
2016-11-01
Full Text Available The precise orbit determination of Chang'E-2 is the most important issue for successful mission and scientific applications, while the lunar gravity field model with big uncertainties has large effect on Chang'E-2 orbit determination. Recently, several new gravity models have been produced using the latest lunar satellites tracking data, such as LP165P, SGM150J, GL0900D and GRGM900C. In this paper, the four gravity models mentioned above were evaluated through the power spectra analysis, admittance and coherence analysis. Effect of four lunar gravity models on Chang'E-2 orbit determination performance is investigated and assessed using Very Long Baseline Interferometry (VLBI tracking data. The overlap orbit analysis, the posteriori data residual, and the orbit prediction are used to evaluate the orbit precision between successive arcs. The LP165P model has better orbit overlap performance than the SGM150J model for Chang'E-2100 km × 100 km orbit and the SGM150J model performs better for Chang'E-2100 km × 15 km orbit, while GL0900D and GRGM900C have the best orbit overlap results for the two types of Chang'E-2 orbit. For the orbit prediction, GRGM900C has the best orbit prediction performance in the four models.
Considerations for the habitable zone of super-Earth planets in Gliese 581
Chylek, P.; Perez, M. R.
2007-01-01
We assess the possibility that planets Gliese 581 c and d are within the habitable zone. In analogy with our solar system, we use an empirical definition of the habitable zone. We include assumptions such as planetary climates, and atmospheric circulation on gravitationally locked synchronous rotation. Based on the different scenarios, we argue that both planets in Gliese 581 could develop conditions for a habitable zone. In an Earth-like environment planet d could be within a habitable zone,...
Robertson, Paul; Mahadevan, Suvrath; Endl, Michael; Roy, Arpita
2014-07-25
The M dwarf star Gliese 581 is believed to host four planets, including one (GJ 581d) near the habitable zone that could possibly support liquid water on its surface if it is a rocky planet. The detection of another habitable-zone planet--GJ 581g--is disputed, as its significance depends on the eccentricity assumed for d. Analyzing stellar activity using the Hα line, we measure a stellar rotation period of 130 ± 2 days and a correlation for Hα modulation with radial velocity. Correcting for activity greatly diminishes the signal of GJ 581d (to 1.5 standard deviations) while significantly boosting the signals of the other known super-Earth planets. GJ 581d does not exist, but is an artifact of stellar activity which, when incompletely corrected, causes the false detection of planet g. Copyright © 2014, American Association for the Advancement of Science.
Incorporating modern OpenGL into computer graphics education.
Reina, Guido; Muller, Thomas; Ertl, Thomas
2014-01-01
University of Stuttgart educators have updated three computer science courses to incorporate forward-compatible OpenGL. To help students, they developed an educational framework that abstracts some of modern OpenGL's difficult aspects.
Astrophysical Parameters and Habitable Zone of the Exoplanet Hosting Star GJ 581
von Braun, Kaspar; Boyajian, Tabetha S.; Kane, Stephen R.; van Belle, Gerard T.; Ciardi, David R.; Lόpez-Morales, Mercedes; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Subasavage, John P.; Schaefer, Gail; ten Brummelaar, Theo A.; Ridgway, Stephen; Sturmann, Laszlo
2011-01-01
GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be $0.299 \\pm 0.010 R_{\\odot}$. Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature $T_{\\rm EFF}=3498 \\pm 56$ K and its luminosity $L=0.01205 \\pm 0.00024 L_{\\odot}$. From these measuremen...
2010-10-01
... corrosion and what coating material may I use? 195.581 Section 195.581 Transportation Other Regulations... Corrosion Control § 195.581 Which pipelines must I protect against atmospheric corrosion and what coating... atmosphere, except pipelines under paragraph (c) of this section. (b) Coating material must be suitable for...
Directory of Open Access Journals (Sweden)
L.
Full Text Available La mejoría del contorno glúteo y de caderas en un paciente varón que desea un contorno femenino es difícil de conseguir cuando no es posible disponer de una cantidad de grasa suficiente para inyectar y lograr una mejoría integral. Presentamos la técnica quirúrgica utilizada en un paciente transexual masculino que había tenido dos intentos fallidos de feminizar su contorno de glúteos y caderas. Utilizamos implantes ovales de silicona cohesiva, tanto para la región glútea como para las caderas, inyectando grasa en las áreas de transición entre los dos implantes. Con esta combinación obtuvimos un contorno femenino integral, eliminando por completo el aspecto masculino de la región glúteo-trocantérea. En conclusión, pensamos que la combinación empleada supone una opción novedosa y no descrita hasta el momento para el tratamiento de pacientes transexuales que buscan un contorno glúteo más femenino de forma integral, con resultados predecibles y muy gratificantes, que mejora las deficiencias que los pacientes masculinos tienen en esta zona en comparación con el contorno de los glúteos femeninos.
Litiasis de las glándulas salivales
Berini Aytés, Leonardo; Gay Escoda, Cosme; Sánchez Garcés, Ma. Ángeles
2012-01-01
La litiasis es hoy día la enfermedad más frecuente de las glándulas salivales mayores y, muy en concreto, el motivo de exéresis quirúrgica de la glándula submaxilar. Se hace una revisión de la etiopatogenia, incidencia y clínica, así como de los métodos de diagnóstico y del estado actual de su tratamiento.
Continuum limit of gl(M vertical stroke N) spin chains
International Nuclear Information System (INIS)
Candu, Constantin
2011-03-01
We study the spectrum of an integrable antiferromagnetic Hamiltonian of the gl(M vertical stroke N) spin chain of alternating fundamental and dual representations. After extensive numerical analysis, we identify the vacuum and low lying excitations and with this knowledge perform the continuum limit, while keeping a finite gap. All antiferromagnetic gl(n+N vertical stroke N) spin chains with n>0 and N≠0 are shown to possess in the continuum limit 2n-2 multiplets of massive particles which scatter with gl(n) Gross-Neveu like S-matrices, namely their eigenvalues do not depend on N. We argue that the continuum theory is the gl(M vertical stroke N) Gross-Neveu model, that is the massive deformation of the gl(M vertical stroke N) 1 Wess-Zumino-Witten model. As we can see ion the example of gl(2m vertical stroke 1) spin chains, the full particle spectrum is much richer. Our analysis suggests that for a complete characterization of the latter it is not enough to restrict to large volume calculations, as we do in this work. (orig.)
Learn OpenGL ES for mobile game and graphics development
Mehta, Prateek
2013-01-01
One of the first OpenGL ES version 3 books for game app developers doing mobile. Covers Android code and may be useful to iOS game developers too. OpenGL ES 3 is a new significant tech update to OpenGL ES graphics API engine that fuels game apps in both iOS and Android.
RADIAL VELOCITY PLANETS DE-ALIASED: A NEW, SHORT PERIOD FOR SUPER-EARTH 55 Cnc e
International Nuclear Information System (INIS)
Dawson, Rebekah I.; Fabrycky, Daniel C.
2010-01-01
Radial velocity measurements of stellar reflex motion have revealed many extrasolar planets, but gaps in the observations produce aliases, spurious frequencies that are frequently confused with the planets' orbital frequencies. In the case of Gl 581 d, the distinction between an alias and the true frequency was the distinction between a frozen, dead planet and a planet possibly hospitable to life. To improve the characterization of planetary systems, we describe how aliases originate and present a new approach for distinguishing between orbital frequencies and their aliases. Our approach harnesses features in the spectral window function to compare the amplitude and phase of predicted aliases with peaks present in the data. We apply it to confirm prior alias distinctions for the planets GJ 876 d and HD 75898 b. We find that the true periods of Gl 581 d and HD 73526 b/c remain ambiguous. We revise the periods of HD 156668 b and 55 Cnc e, which were afflicted by daily aliases. For HD 156668 b, the correct period is 1.2699 days and the minimum mass is (3.1 ± 0.4) M + . For 55 Cnc e, the correct period is 0.7365 days-the shortest of any known planet-and the minimum mass is (8.3 ± 0.3) M + . This revision produces a significantly improved five-planet Keplerian fit for 55 Cnc, and a self-consistent dynamical fit describes the data just as well. As radial velocity techniques push to ever-smaller planets, often found in systems of multiple planets, distinguishing true periods from aliases will become increasingly important.
Continuum limit of gl(M vertical stroke N) spin chains
Energy Technology Data Exchange (ETDEWEB)
Candu, Constantin [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany). Gruppe Theorie
2011-03-15
We study the spectrum of an integrable antiferromagnetic Hamiltonian of the gl(M vertical stroke N) spin chain of alternating fundamental and dual representations. After extensive numerical analysis, we identify the vacuum and low lying excitations and with this knowledge perform the continuum limit, while keeping a finite gap. All antiferromagnetic gl(n+N vertical stroke N) spin chains with n>0 and N{ne}0 are shown to possess in the continuum limit 2n-2 multiplets of massive particles which scatter with gl(n) Gross-Neveu like S-matrices, namely their eigenvalues do not depend on N. We argue that the continuum theory is the gl(M vertical stroke N) Gross-Neveu model, that is the massive deformation of the gl(M vertical stroke N){sub 1} Wess-Zumino-Witten model. As we can see ion the example of gl(2m vertical stroke 1) spin chains, the full particle spectrum is much richer. Our analysis suggests that for a complete characterization of the latter it is not enough to restrict to large volume calculations, as we do in this work. (orig.)
RDF-GL: A SPARQL-Based Graphical Query Language for RDF
Hogenboom, Frederik; Milea, Viorel; Frasincar, Flavius; Kaymak, Uzay
This chapter presents RDF-GL, a graphical query language (GQL) for RDF. The GQL is based on the textual query language SPARQL and mainly focuses on SPARQL SELECT queries. The advantage of a GQL over textual query languages is that complexity is hidden through the use of graphical symbols. RDF-GL is supported by a Java-based editor, SPARQLinG, which is presented as well. The editor does not only allow for RDF-GL query creation, but also converts RDF-GL queries to SPARQL queries and is able to subsequently execute these. Experiments show that using the GQL in combination with the editor makes RDF querying more accessible for end users.
Habitability of extrasolar planets and tidal spin evolution.
Heller, René; Barnes, Rory; Leconte, Jérémy
2011-12-01
Stellar radiation has conservatively been used as the key constraint to planetary habitability. We review here the effects of tides, exerted by the host star on the planet, on the evolution of the planetary spin. Tides initially drive the rotation period and the orientation of the rotation axis into an equilibrium state but do not necessarily lead to synchronous rotation. As tides also circularize the orbit, eventually the rotation period does equal the orbital period and one hemisphere will be permanently irradiated by the star. Furthermore, the rotational axis will become perpendicular to the orbit, i.e. the planetary surface will not experience seasonal variations of the insolation. We illustrate here how tides alter the spins of planets in the traditional habitable zone. As an example, we show that, neglecting perturbations due to other companions, the Super-Earth Gl581d performs two rotations per orbit and that any primordial obliquity has been eroded.
Tides and the evolution of planetary habitability.
Barnes, Rory; Raymond, Sean N; Jackson, Brian; Greenberg, Richard
2008-06-01
Tides raised on a planet by the gravity of its host star can reduce the planet's orbital semi-major axis and eccentricity. This effect is only relevant for planets orbiting very close to their host stars. The habitable zones of low-mass stars are also close in, and tides can alter the orbits of planets in these locations. We calculate the tidal evolution of hypothetical terrestrial planets around low-mass stars and show that tides can evolve planets past the inner edge of the habitable zone, sometimes in less than 1 billion years. This migration requires large eccentricities (>0.5) and low-mass stars ( less or similar to 0.35 M(circle)). Such migration may have important implications for the evolution of the atmosphere, internal heating, and the Gaia hypothesis. Similarly, a planet that is detected interior to the habitable zone could have been habitable in the past. We consider the past habitability of the recently discovered, approximately 5 M(circle) planet, Gliese 581 c. We find that it could have been habitable for reasonable choices of orbital and physical properties as recently as 2 Gyr ago. However, when constraints derived from the additional companions are included, most parameter choices that indicate past habitability require the two inner planets of the system to have crossed their mutual 3:1 mean motion resonance. As this crossing would likely have resulted in resonance capture, which is not observed, we conclude that Gl 581 c was probably never habitable.
Professional WebGL Programming Developing 3D Graphics for the Web
Anyuru, Andreas
2012-01-01
Everything you need to know about developing hardware-accelerated 3D graphics with WebGL! As the newest technology for creating 3D graphics on the web, in both games, applications, and on regular websites, WebGL gives web developers the capability to produce eye-popping graphics. This book teaches you how to use WebGL to create stunning cross-platform apps. The book features several detailed examples that show you how to develop 3D graphics with WebGL, including explanations of code snippets that help you understand the why behind the how. You will also develop a stronger understanding of W
Exploring Physics with Computer Animation and PhysGL
Bensky, T. J.
2016-10-01
This book shows how the web-based PhysGL programming environment (http://physgl.org) can be used to teach and learn elementary mechanics (physics) using simple coding exercises. The book's theme is that the lessons encountered in such a course can be used to generate physics-based animations, providing students with compelling and self-made visuals to aid their learning. Topics presented are parallel to those found in a traditional physics text, making for straightforward integration into a typical lecture-based physics course. Users will appreciate the ease at which compelling OpenGL-based graphics and animations can be produced using PhysGL, as well as its clean, simple language constructs. The author argues that coding should be a standard part of lower-division STEM courses, and provides many anecdotal experiences and observations, that include observed benefits of the coding work.
The Case for Teaching Computer Graphics with WebGL: A 25-Year Perspective.
Angel, Ed
2017-01-01
OpenGL has been the standard API for teaching computer graphics. There are now multiple versions of the standard, including WebGL. which is the JavaScript implementation of OpenGL ES 2.0. The author argues that WebGL is the version best suited for an introductory course in computer graphics.
The GL(1 vertical stroke 1)-symplectic fermion correspondence
International Nuclear Information System (INIS)
Creutzig, Thomas; Roenne, Peter B.
2008-12-01
In this note we prove a correspondence between the Wess-Zumino-Novikov-Witten model of the Lie supergroup GL(1 vertical stroke 1) and a free model consisting of two scalars and a pair of symplectic fermions. This model was discussed earlier by LeClair. Vertex operators for the symplectic fermions include twist fields, and correlation functions of GL(1 vertical stroke 1) agree with the known results for the scalars and symplectic fermions. We perform a detailed study of boundary states for symplectic fermions and apply them to branes in GL(1 vertical stroke 1). This allows us to compute new amplitudes of strings stretching between branes of different types and confirming Cardy's condition. (orig.)
The GL(1 vertical stroke 1)-symplectic fermion correspondence
Energy Technology Data Exchange (ETDEWEB)
Creutzig, Thomas; Roenne, Peter B.
2008-12-15
In this note we prove a correspondence between the Wess-Zumino-Novikov-Witten model of the Lie supergroup GL(1 vertical stroke 1) and a free model consisting of two scalars and a pair of symplectic fermions. This model was discussed earlier by LeClair. Vertex operators for the symplectic fermions include twist fields, and correlation functions of GL(1 vertical stroke 1) agree with the known results for the scalars and symplectic fermions. We perform a detailed study of boundary states for symplectic fermions and apply them to branes in GL(1 vertical stroke 1). This allows us to compute new amplitudes of strings stretching between branes of different types and confirming Cardy's condition. (orig.)
Comparison of Physics Frameworks for WebGL-Based Game Engine
Directory of Open Access Journals (Sweden)
Yogya Resa
2014-03-01
Full Text Available Recently, a new technology called WebGL shows a lot of potentials for developing games. However since this technology is still new, there are still many potentials in the game development area that are not explored yet. This paper tries to uncover the potential of integrating physics frameworks with WebGL technology in a game engine for developing 2D or 3D games. Specifically we integrated three open source physics frameworks: Bullet, Cannon, and JigLib into a WebGL-based game engine. Using experiment, we assessed these frameworks in terms of their correctness or accuracy, performance, completeness and compatibility. The results show that it is possible to integrate open source physics frameworks into a WebGLbased game engine, and Bullet is the best physics framework to be integrated into the WebGL-based game engine.
Farvel til glødepæren - goddag til...?
DEFF Research Database (Denmark)
Bülow, Katja
2009-01-01
Glødepæren er, som vi kender den, er hastigt på vej ud af markedet idet EU har vedtaget at udfase glødepæren inden udgangen af 2012. Og det er godt, for glødepæren er en energiforbrugende lyskilde, der foranlediger tonsvis af CO2 udledning til atmosfæren. Spørgsmålet er så hvilken lyskilde der ka...... spørgsmål om at kaste sig ud i helt nye og uopdagede løsningsmodeller?...
Control of IgE and IgGl antibody production in mice
International Nuclear Information System (INIS)
De Macedo, M.S.; Braga, F.; Mota, I.
1976-01-01
The production of IgE and IgCl was studied in untreated, thymectomized, splenectomized, anti-thymocyte serum-treated, or sublethally X-irradiated mice. Dinitrophenyl, Ascaris, and ovalbumin were used as antigens, and aluminum hydroxide was used as adjuvant. A suppression of IgE production was observed in adult thymectomized mice, although the kinetic pattern of the antibody response was the same as in control animals. IgGl antibody production was not affected by thymectomy. Splenectomy did not change either IgE or IgGl production. A single dose of rabbit antithymocyte serum (ATS) given 8 days after immunization inhibited IgE antibody production. The effect of ATS was dose dependent and also varied with the amount of antigen used, the immune response to high doses being more susceptible to the effect of ATS. No alteration in IgGl production was caused by ATS even when IgE antibody formation was completely inhibited. When preceding immunization, sublethal irradiation enhanced IgE antibody formation and partially suppressed IgGl production; applied after immunization, irradiation caused an enhancement of IgE production which was inversely proportional to the interval elapsed between the two procedures. On the other hand, the IgGl antibody production was fairly resistant to the same treatment. The results suggest a clearcut separation between the mechanisms regulating IgE and IgGl production in mice
2010-01-01
... the payment of attorney fees, interest, and/or court costs. 581.307 Section 581.307 Administrative... payment of attorney fees, interest, and/or court costs. Before complying with legal process that requires withholding for the payment of attorney fees, interest, and/or court costs, the governmental entity must...
Morfologia das glândulas salivares de Glironia venusta Thomas, 1912 (Didelphimorphia
Directory of Open Access Journals (Sweden)
Bruna S. Vieira
2015-02-01
Full Text Available O objetivo deste trabalho foi descrever a morfologia das glândulas salivares de Glironia venusta. Foi utilizado um exemplar coletado no resgate de fauna da Usina Hidroeletrica Teles Pires. Este foi fixado com solução de formaldeído a 10%. Para a análise macroscópica, as glândulas foram dissecadas e fotografadas in situ e para a microscopia foram retirados fragmentos das glândulas. Estes foram desidratados em concentrações crescentes de álcool, diafanizados em xilol, inclusos em parafina e corados com HE. G. venusta apresentou as glândulas mandibulares, parótidas, sublinguais, labiais e zigomáticas. As mandibulares se mostraram como estruturas alongadas, constituídas por lobos não septados e localizadas na porção anterior da região cervical. De formato triangular, a parótida estava localizada na depressão do masseter, ventral à cartilagem auricular. As sublinguais encontravam-se ventrais ao ramo da mandíbula, caudais ao digástrico. Foi observado na porção dorsoposterior à comissura labial, dorsal ao músculo orbicular da boca, as glândulas labiais, que apresentaram formato de "U". Já as glândulas zigomáticas acompanhavam a forma da porção anterior do arco zigomático, na margem infraorbital. As glândulas mandibulares e sublinguais apresentaram ácinos do tipo mucosos, com alguns ácinos serosos. A parótida era constituída por ácinos puramente serosos. Na glândula labial foi observado ácinos do tipo mistos ou seromucosos. Para a glândula zigomática não foi possível a realização da análise microscópica devido problemas de procedimento histológico. As características das glândulas salivares observadas em G. venusta se assemelham a de outros mamíferos onívoros, entretanto, apresentaram pequenas diferenças no que se refere à sua localização e forma.
RDF-GL : a SPARQL-based graphical query language for RDF
Hogenboom, F.P.; Milea, D.V.; Frasincar, F.; Kaymak, U.; Chbeir, R.; Badr, Y.; Abraham, A.; Hassanien, A.-E.
2010-01-01
This chapter presents RDF-GL, a graphical query language (GQL) for RDF. The GQL is based on the textual query language SPARQL and mainly focuses on SPARQL SELECT queries. The advantage of a GQL over textual query languages is that complexity is hidden through the use of graphical symbols. RDF-GL is
Directory of Open Access Journals (Sweden)
Villegas Josefina M.
2014-01-01
Full Text Available Several strains of Lactobacillus helveticus and Lactobacillus delbrueckii subsp. lactis were evaluated for their ability to release angiotensin-I-converting enzyme (ACE inhibitory peptides from α-casein (α-CN and β-casein (β-CN. Casein peptides resulting from L. delbrueckii subsp. lactis CRL 581-mediated hydrolysis exhibited the highest ACE-inhibitory (ACEI activities, with values of 53 and 40% for α-CN and β-CN, respectively. The casein hydrolysates were fractionated by reversedphase high pressure liquid chromatography and some of the active peptides were identified by mass spectrometry. The fraction with the highest ACEI activity arose from β-CN and contained a mixture of the β-CN f194-206 (QEPVLGPVRGPFP and f198-206 (LGPVRGPFP peptides. Furthermore, the ACEI tripeptide IPP was identified in all β-CN hydrolysates; L. delbrueckii subsp. lactis CRL 581 produced the highest amount of this peptide. The bioactive peptides released by CRL 581 strain may be used in the formulation of functional foods and nutraceuticals, representing a healthier and natural alternative for regulating blood pressure.
WebGL-rajapinta ja 3D-grafiikkakirjaston luominen
Kuokkanen, Juuso
2015-01-01
Opinnäytetyössä tutkittiin 3D-grafiikkaa ja sen ohjelmointia WebGL-ohjelmointirajapinnan avulla, ja opinnäytetyön tuotoksena tuotettiin WebGL-rajapintaa hyödyntävä 3D-grafiikkakirjaston prototyyppi, jolla voi luoda 3D-grafiikkaa hyödyntäviä sovelluksia, jotka toimivat selaimessa. Aihe valittiin opinnäytetyön tekijän henkilökohtaisesta kiinnostuksesta 3D-grafiikkaa kohtaan. Työssä tutkitaan 3D-grafiikkaan liittyviä matemaattisia käsitteitä ja laskutoimituksia sekä selvitetään, kuinka niitä...
Singh, Parminder
2015-01-01
If you are new to OpenGL ES or have some experience in 3D graphics, then this book will be extremely helpful in raising your expertise level from a novice to professional. The book implements more than 90 recipes to solve everyday challenges, helping you transition from a beginner to a professional.
Fischer matrices of Dempwolff group $2^{5}{^{cdot}}GL(5,2$
Directory of Open Access Journals (Sweden)
Ayoub Basheer Mohammed Basheer
2012-12-01
Full Text Available In cite{Demp2} Dempwolff proved the existence of a group of theform $2^{5}{^{cdot}}GL(5,2$ (a non split extension of theelementary abelian group $2^{5}$ by the general linear group$GL(5,2$. This group is the second largest maximal subgroup of thesporadic Thompson simple group $mathrm{Th}.$ In this paper wecalculate the Fischer matrices of Dempwolff group $overline{G} =2^{5}{^{cdot}}GL(5,2.$ The theory of projective characters isinvolved and we have computed the Schur multiplier together with aprojective character table of an inertia factor group. The fullcharacter table of $overline{G}$ is then can be calculated easily.
Li, Aiwen; Qiu, Jiguo; Chen, Dongzhi; Ye, Jiexu; Wang, Yuhong; Tong, Lu; Jiang, Jiandong; Chen, Jianmeng
2017-05-31
The presence of nicotine and nicotinic acid (NA) in the marine environment has caused great harm to human health and the natural environment. Therefore, there is an urgent need to use efficient and economical methods to remove such pollutants from the environment. In this study, a nicotine and NA-degrading bacterium-strain JQ581-was isolated from sediment from the East China Sea and identified as a member of Pseudomonas putida based on morphology, physio-biochemical characteristics, and 16S rDNA gene analysis. The relationship between growth and nicotine/NA degradation suggested that strain JQ581 was a good candidate for applications in the bioaugmentation treatment of nicotine/NA contamination. The degradation intermediates of nicotine are pseudooxynicotine (PN) and 3-succinoyl-pyridine (SP) based on UV, high performance liquid chromatography, and liquid chromatography-mass spectrometry analyses. However, 6-hydroxy-3-succinoyl-pyridine (HSP) was not detected. NA degradation intermediates were identified as 6-hydroxynicotinic acid (6HNA). The whole genome of strain JQ581 was sequenced and analyzed. Genome sequence analysis revealed that strain JQ581 contained the gene clusters for nicotine and NA degradation. This is the first report where a marine-derived Pseudomonas strain had the ability to degrade nicotine and NA simultaneously.
Efecto de la radioterapia en glándulas salivales accesorias.
Pérez Fernández, Carmen Aránzazu
2005-01-01
RESUMEN El objetivo de este trabajo es estudiar las alteraciones que las radiaciones ionizantes producen sobre las glándulas salivales accesorias labiales. En nuestro estudio se seleccionaron sujetos diagnosticados de un tumor maligno de cabeza y cuello que iban a recibir radioterapia dentro de su tratamiento, incluyendo los labios dentro del campo de irradiación. Se evaluó la secreción salival y las alteraciones morfológicas de las glándulas en el momento del diagnóstico...
Antimicrobial effects of GL13K peptide coatings on S. mutans and L. casei
Schnitt, Rebecca Ann
Background: Enamel breakdown around orthodontic brackets, so-called "white spot lesions", is the most common complication of orthodontic treatment. White spot lesions are caused by bacteria such as Streptococci and Lactobacilli, whose acidic byproducts cause demineralization of enamel crystals. Aims: The aim of this project was to develop an antimicrobial peptide coating for titanium alloy that is capable of killing acidogenic bacteria, specifically Streptococcus mutans and Lactobacillus casei. The long-term goal is to create an antimicrobial-coated orthodontic bracket with the ability to reduce or prevent the formation of white spot lesions in orthodontic patients thereby improving clinical outcomes. Methods: First, an alkaline etching method with NaOH was established to allow effective coating of titanium discs with GL13K, an antimicrobial peptide derived from human saliva. Coatings were verified by contact angle measures, and treated discs were characterized using scanning electron microscopy. Secondly, GL13K coatings were tested against hydrolytic, proteolytic and mechanical challenges to ensure robust coatings. Third, a series of qualitative and quantitative microbiology experiments were performed to determine the effects of GL13K--L and GL13K--D on S. mutans and L. casei, both in solution and coated on titanium. Results: GL13K-coated discs were stable after two weeks of challenges. GL13K--D was effective at killing S. mutans in vitro at low doses. GL13K--D also demonstrated a bactericidal effect on L. casei, however, in contrast to S. mutans, the effect on L. casei was not statistically significant. Conclusion: GL13K--D is a promising candidate for antimicrobial therapy with possible applications for prevention of white spot lesions in orthodontics.
Genome Sequence of the Cheese-Starter Strain Lactobacillus delbrueckii subsp. lactis CRL 581.
Hebert, Elvira María; Raya, Raúl R; Brown, Lucía; Font de Valdez, Graciela; Savoy de Giori, Graciela; Taranto, María Pía
2013-08-08
We report the genome sequence of Lactobacillus delbrueckii subsp. lactis CRL 581 (1,911,137 bp, GC 49.7%), a proteolytic strain isolated from a homemade Argentinian hard cheese which has a key role in bacterial nutrition and releases bioactive health-beneficial peptides from milk proteins.
Tensor product varieties and crystals. GL case
Malkin, Anton
2001-01-01
The role of Spaltenstein varieties in the tensor product for GL is explained. In particular a direct (non-combinatorial) proof of the fact that the number of irreducible components of a Spaltenstein variety is equal to a Littlewood-Richardson coefficient (i.e. certain tensor product multiplicity) is obtained.
Morfologia da glândula adrenal da paca (Cuniculus paca, L. 1766
Directory of Open Access Journals (Sweden)
Sergio Pinter Garcia Filho
2014-02-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2014v27n2p163 A paca (Cuniculus paca, Linnaeus, 1766 é um roedor de porte médio que, embora pertencente à fauna brasileira, possui poucas informações acerca de sua morfologia na literatura especializada. Nesse sentido, objetivou-se estudar a morfologia da sua glândula adrenal mediante análise de microscopia de luz, cuja importância refere-se ao fato da glândula adrenal ser um órgão secretor de substâncias particulares que promovem no organismo funções biológicas de grande importância, além de proporcionar informações à anatomia comparada. Foram utilizadas oito pacas adultas, quatro machos e quatro fêmeas. Logo após o óbito, os animais foram posicionados em decúbito dorsal, foi realizada a abertura de sua cavidade abdominal por meio de incisão pré-retroumbilical e seguido do rebatimento lateral das paredes abdominais para a exposição da glândula em questão. As glândulas adrenais foram individualizadas, fragmentos foram colhidos, fixados e preparados para observação histológica. Constatou-se que a morfologia geral da glândula adrenal da paca assemelha-se à de outros mamíferos.
Warum macht Fliegen glücklich?
Directory of Open Access Journals (Sweden)
Gertrud Pfister
2005-07-01
Full Text Available Berufliche Orientierungen von Pilotinnen weckt große Erwartungen, die leider nur teilweise eingelöst werden. Es ermöglicht Einsichten in die Berufsbiographien von Pilotinnen und in das „Gendering“ des Berufsfelds, gibt aber auf zentrale Fragen, u.a. nach den Barrieren, die Frauen den Weg an die Spitze versperren, keine befriedigenden Antworten. So bleibt auch offen, warum Fliegen glücklich macht.
Research on Chinese characters display of airborne MFD based on GL studio
Wang, Zhile; Dong, Junyu; Hu, Wenting; Cui, Yipeng
2018-04-01
GL Studio cannot display Chinese characters during developing the airborne MFD, this paper propose a method of establishing a Chinese character font with GB2312 encoding, establish the font table and the display unit of Chinese characters based on GL Studio. Abstract the storage and display data model of Chinese characters, parse the GB encoding of the corresponding Chinese characters that MFD received, find the coordinates of the Chinese characters in the font table, establish the dynamic control model and the dynamic display model of Chinese characters based on the display unit of Chinese characters. In GL Studio and VC ++.NET environment, this model has been successfully applied to develop the airborne MFD in a variety of mission simulators. This method has successfully solved the problem that GL Studio software cannot develop MFD software of Chinese domestic aircraft and can also be used for other professional airborne MFD development tools such as IDATA. It has been proved by experiments that this is a fast effective scalable and reconfigurable method of developing both actual equipment and simulators.
Birgit Steinbügl: Deutsch-englische Kollokationen
African Journals Online (AJOL)
R.B. Ruthven
This study investigates the role of collocations in dictionary use, and the extent to which ... In the first chapter of her book, Steinbügl gives a theoretical exposition by ... expression chambre forte is not automatically understandable for non-native speakers of French, because they cannot deduce the meaning from the individ-.
5 CFR Appendix A to Part 581 - List of Agents Designated To Accept Legal Process
2010-01-01
... REGULATIONS PROCESSING GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Pt. 581, App. A Appendix A to Part... Supervisor, 1969 So. Sheridan Ave., Sheridan, WY 82801, (307) 672-0751 Medicine Bow—Forest Supervisor, 2468...
Incerta glòria di Joan Sales tra filologia, storia e traduzione
Directory of Open Access Journals (Sweden)
Patrizio Rigobon
2015-12-01
Full Text Available In questo saggio si fa una riflessione sull’opera di Joan Sales Incerta glòria e particolarmente si vede le conessione tra filologia, storia e traduzione. This article makes a reflection on the work of Joan Sales, Incerta glòria, and it particularly affects the connection between philology, history and translation.
Tidal Venuses: Triggering a Climate Catastrophe via Tidal Heating
Mullins, Kristina; Goldblatt, Colin; Meadows, Victoria S.; Kasting, James F.; Heller, René
2013-01-01
Abstract Traditionally, stellar radiation has been the only heat source considered capable of determining global climate on long timescales. Here, we show that terrestrial exoplanets orbiting low-mass stars may be tidally heated at high-enough levels to induce a runaway greenhouse for a long-enough duration for all the hydrogen to escape. Without hydrogen, the planet no longer has water and cannot support life. We call these planets “Tidal Venuses” and the phenomenon a “tidal greenhouse.” Tidal effects also circularize the orbit, which decreases tidal heating. Hence, some planets may form with large eccentricity, with its accompanying large tidal heating, and lose their water, but eventually settle into nearly circular orbits (i.e., with negligible tidal heating) in the habitable zone (HZ). However, these planets are not habitable, as past tidal heating desiccated them, and hence should not be ranked highly for detailed follow-up observations aimed at detecting biosignatures. We simulated the evolution of hypothetical planetary systems in a quasi-continuous parameter distribution and found that we could constrain the history of the system by statistical arguments. Planets orbiting stars with massestidal heating. We have applied these concepts to Gl 667C c, a ∼4.5 MEarth planet orbiting a 0.3 MSun star at 0.12 AU. We found that it probably did not lose its water via tidal heating, as orbital stability is unlikely for the high eccentricities required for the tidal greenhouse. As the inner edge of the HZ is defined by the onset of a runaway or moist greenhouse powered by radiation, our results represent a fundamental revision to the HZ for noncircular orbits. In the appendices we review (a) the moist and runaway greenhouses, (b) hydrogen escape, (c) stellar mass-radius and mass-luminosity relations, (d) terrestrial planet mass-radius relations, and (e) linear tidal theories. Key Words: Extrasolar terrestrial planets—Habitability—Habitable zone
Dittmann, Jason; Charbonneau, David; Irwin, Jonathan; Agol, Eric; Kipping, David; Newton, Elisabeth; Berta-Thompson, Zachory; Haywood, Raphaelle; Winters, Jennifer; Ballard, Sarah
2017-06-01
Exoplanets that transit nearby small stars present the best opportunity for future atmospheric studies with the James Webb Space Telescope and the ground based ELTs currently under construction. The MEarth Project has discovered a rocky planet with a period of 27.43 days residing in the habitable zone of the nearby inactive star LHS 1140. This planet will be the subject of GTO observations by JWST, and additional objects in the system would also be tantalizing targets for future study. Owing to the large planetary mass and orbital separation from its star, LHS 1140b is unique among the planets known to transit nearby M dwarfs in its capability to host a large moon. We propose to survey LHS 1140b for signs of exomoons and to search for transit timing variations that may indicate the presence of additional companions. The long orbital period of 25 days, the 12 hour duration for the transit of the Hill sphere, and the small amplitude of the expected signal preclude pursuing this from the ground and make Spitzer uniquely capable to undertake this study. If successful, we may discover additional planets via TTVs for which we may conduct future searches for transits and atmospheric spectroscopy with JWST, and possibly provide the first evidence for exomoons outside of the Solar System.
On the gl(1|1) Wess-Zumino-Witten model
Energy Technology Data Exchange (ETDEWEB)
Troost, Jan [Laboratoire de Physique Théorique de l’École Normale Supérieure,CNRS, PSL Research University and Sorbonne Universités,24 rue Lhomond, 75005, Paris (France)
2017-05-10
We continue the study of the gl(1|1) Wess-Zumino-Witten model. The Knizhnik-Zamolodchikov equations for the one, two, three and four point functions are analyzed, for vertex operators corresponding to typical and projective representations. We demonstrate their interplay with the logarithmic global conformal Ward identities. We compute the four point function for one projective and three typical representations. Three coupled first order Knizhnik-Zamolodchikov equations are integrated consecutively in terms of generalized hypergeometric functions, and we assemble the solutions into a local correlator. Moreover, we prove crossing symmetry of the four point function of four typical representations at generic momenta. Throughout, the map between the gl(1|1) Wess-Zumino-Witten model and symplectic fermions is exploited and extended.
A browser-based event display for the CMS Experiment at the LHC using WebGL
McCauley, T.
2017-10-01
Modern web browsers are powerful and sophisticated applications that support an ever-wider range of uses. One such use is rendering high-quality, GPU-accelerated, interactive 2D and 3D graphics in an HTML canvas. This can be done via WebGL, a JavaScript API based on OpenGL ES. Applications delivered via the browser have several distinct benefits for the developer and user. For example, they can be implemented using well-known and well-developed technologies, while distribution and use via a browser allows for rapid prototyping and deployment and ease of installation. In addition, delivery of applications via the browser allows for easy use on mobile, touch-enabled devices such as phones and tablets. iSpy WebGL is an application for visualization of events detected and reconstructed by the CMS Experiment at the Large Hadron Collider at CERN. The first event display developed for an LHC experiment to use WebGL, iSpy WebGL is a client-side application written in JavaScript, HTML, and CSS and uses the WebGL API three.js. iSpy WebGL is used for monitoring of CMS detector performance, for production of images and animations of CMS collisions events for the public, as a virtual reality application using Google Cardboard, and asa tool available for public education and outreach such as in the CERN Open Data Portal and the CMS masterclasses. We describe here its design, development, and usage as well as future plans.
WebGL and web audio software lightweight components for multimedia education
Chang, Xin; Yuksel, Kivanc; Skarbek, Władysław
2017-08-01
The paper presents the results of our recent work on development of contemporary computing platform DC2 for multimedia education usingWebGL andWeb Audio { the W3C standards. Using literate programming paradigm the WEBSA educational tools were developed. It offers for a user (student), the access to expandable collection of WEBGL Shaders and web Audio scripts. The unique feature of DC2 is the option of literate programming, offered for both, the author and the reader in order to improve interactivity to lightweightWebGL andWeb Audio components. For instance users can define: source audio nodes including synthetic sources, destination audio nodes, and nodes for audio processing such as: sound wave shaping, spectral band filtering, convolution based modification, etc. In case of WebGL beside of classic graphics effects based on mesh and fractal definitions, the novel image processing analysis by shaders is offered like nonlinear filtering, histogram of gradients, and Bayesian classifiers.
Quantification of PRL/Stat5 signaling with a novel pGL4-CISH reporter.
Fang, Feng; Antico, Giovanni; Zheng, Jiamao; Clevenger, Charles V
2008-02-06
Elevations of serum prolactin (PRL) are associated with an increased risk for breast cancer. PRL signaling through its prolactin receptor (PRLr) involves the Jak2/Stat5 pathway. Luciferase-based reporter assays have been widely used to evaluate the activity of this pathway. However, the existing reporters are often not sensitive enough to monitor the effect of PRL in this pathway. In this study, a new biologically relevant reporter, pGL4-CISH, was generated to study the PRL/Jak2/Stat5 signaling pathway. The sensitivity of pGL4-CISH to detect PRL was superior to that of several other commonly utilized Stat5-responsive reporters. Interestingly, the enhanced function pGL4-CISH was restricted to the estrogen receptor positive (ER+) human breast cancer cell lines T47D and MCF7, but not in the ER-MDA-231, BT-474, or MCF10A cell lines. Overexpression of Stat5 further enhanced the effect of PRL on pGL4-CISH. These studies demonstrate that pGL4-CISH is a novel and sensitive reporter for assessing the activity of the PRL/Stat5 signaling pathway in the ER+ human breast cancer cells.
3D Web-based HMI with WebGL Rendering Performance
Directory of Open Access Journals (Sweden)
Muennoi Atitayaporn
2016-01-01
Full Text Available An HMI, or Human-Machine Interface, is a software allowing users to communicate with a machine or automation system. It usually serves as a display section in SCADA (Supervisory Control and Data Acquisition system for device monitoring and control. In this papper, a 3D Web-based HMI with WebGL (Web-based Graphics Library rendering performance is presented. The main purpose of this work is to attempt to reduce the limitations of traditional 3D web HMI using the advantage of WebGL. To evaluate the performance, frame rate and frame time metrics were used. The results showed 3D Web-based HMI can maintain the frame rate 60FPS for #cube=0.5K/0.8K, 30FPS for #cube=1.1K/1.6K when it was run on Internet Explorer and Chrome respectively. Moreover, the study found that 3D Web-based HMI using WebGL contains similar frame time in each frame even though the numbers of cubes are up to 5K. This indicated stuttering incurred less in the proposed 3D Web-based HMI compared to the chosen commercial HMI product.
Quantification of PRL/Stat5 signaling with a novel pGL4-CISH reporter
Directory of Open Access Journals (Sweden)
Zheng Jiamao
2008-02-01
Full Text Available Abstract Background Elevations of serum prolactin (PRL are associated with an increased risk for breast cancer. PRL signaling through its prolactin receptor (PRLr involves the Jak2/Stat5 pathway. Luciferase-based reporter assays have been widely used to evaluate the activity of this pathway. However, the existing reporters are often not sensitive enough to monitor the effect of PRL in this pathway. Results In this study, a new biologically relevant reporter, pGL4-CISH, was generated to study the PRL/Jak2/Stat5 signaling pathway. The sensitivity of pGL4-CISH to detect PRL was superior to that of several other commonly utilized Stat5-responsive reporters. Interestingly, the enhanced function pGL4-CISH was restricted to the estrogen receptor positive (ER+ human breast cancer cell lines T47D and MCF7, but not in the ER-MDA-231, BT-474, or MCF10A cell lines. Overexpression of Stat5 further enhanced the effect of PRL on pGL4-CISH. Conclusion These studies demonstrate that pGL4-CISH is a novel and sensitive reporter for assessing the activity of the PRL/Stat5 signaling pathway in the ER+ human breast cancer cells.
Morfologia da glândula pineal de gambás (Didelphis sp
Directory of Open Access Journals (Sweden)
Celina Almeida Furlanetto Mançanares
2007-06-01
Full Text Available A glândula pineal deve ser analisada e estudada em animais da fauna brasileira, para que dados da pesquisa básica possam ser aplicados em novas técnicas de manejo reprodutivo destes animais, inclusive em cativeiro, face à íntima relação deste órgão fotorreceptor com o ciclo reprodutivo. Para este estudo, foram utilizados 10 gambás (Didelphis sp, provenientes do Departamento de Anatomia da USP e da UNIFEOB, já mortos e fixados. Nenhum animal foi submetido a situações de dor/sofrimento e ao sacrifício de sua vida. A glândula pineal foi encontrada em todos animais estudados e apresentou-se com diminutas dimensões, não sendo possível, portanto descrever-lhe características macroscópicas. Através da análise microscópica pudemos localizar a glândula no espaço correspondente ao plano mediano, em relação ao encéfalo, rostral e dorsalmente aos colículos rostrais, ventralmente aos hemisférios cerebrais e caudalmente à comissura habenular. Consiste de uma evaginação do teto do diencéfalo e mostra-se em forma de "U" invertido. Comparativamente a características de glândulas pineais de outras espécies animais, a do Didelphis genus, que estudamos, revela peculiaridades tanto em relação ao seu tamanho, apenas perceptível microscopicamente, quanto ao fato de apresentar células semelhantes às secretoras, dispersas também em áreas vizinhas. Tais peculiaridades motivam reflexões sobre o papel funcional da glândula, na espécie considerada.
Game and Graphics Programming for iOS and Android with OpenGL ES 20
Marruchi-Foino, Romain; Semko, Roman
2012-01-01
Develop graphically sophisticated apps and games today! The smart phone app market is progressively growing, and there is new market gap to fill that requires more graphically sophisticated applications and games. Game and Graphics Programming for iOS and Android with OpenGL ES 2.0 quickly gets you up to speed on understanding how powerful OpenGL ES 2.0 technology is in creating apps and games for amusement and effectiveness. Leading you through the development of a real-world mobile app with live code, this text lets you work with all the best features and tools that Open GL ES 2.0 has to off
Dynamical structure of linearized GL(4) gravities
International Nuclear Information System (INIS)
Aragone, C.; Restuccia, A.
1978-01-01
The physical content of the three more natural models of GL(4) gravity is analyzed, for the case of weak fields. It is shown that the first model is the linearized version of Yang's one-tensor-field gravity and is a scalar-tensor theory, with its scalar part contained in a symmetric tensor. The second and the third linearized models, which can both be derived from the fourth-order action postulated by Yang, are two-tensor decoupled systems. In both cases one of the tensors is the symmetric weak metric gravity tensor field. the second tensor appearing in these two models, representing the GL(4)-gauge field, is either a linearized symmetric affinity (in the second model) or a linearized but nonsymmetric affinity (for the third model). It is shown that in these last two cases the affinity contains a helicity-3 propagating field. Owing to the presence of helicity-3 fields it is shown that it is better to regard Yang's action as an action for a two-tensor system instead of trying to recover from a pure gravity (one-tensor-field) action. Finally, it is shown what is the dynamical structure of the second and third linearized two-tensor models which can be derived from Yang's action. (author)
IRF models associated with representations of the Lie superalgebras gl(m|n) and sl(m|n)
International Nuclear Information System (INIS)
Deguchi, T.; Fujii, A.
1991-01-01
This paper presents two families of exactly solvable interaction round a face (IRF) models associated with representations of the Lie superalgebras gl(m/n) and sl(m/n). These IRF models are the generalizations of integrable spin chains with bosons and fermions. The authors present fusion models associated with higher representations of gl(m/n) and sl(m/n). The authors introduce restricted IRF models both for gl(m/n) and sl(m/n)
26 CFR 1.581-2 - Mutual savings banks, building and loan associations, and cooperative banks.
2010-04-01
... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Mutual savings banks, building and loan... § 1.581-2 Mutual savings banks, building and loan associations, and cooperative banks. (a) While the... deduction provided in section 172, any taxable year for which a mutual savings bank, building and loan...
Interactive WebGL-based 3D visualizations for EAST experiment
International Nuclear Information System (INIS)
Xia, J.Y.; Xiao, B.J.; Li, Dan; Wang, K.R.
2016-01-01
Highlights: • Developing a user-friendly interface to visualize the EAST experimental data and the device is important to scientists and engineers. • The Web3D visualization system is based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. • The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. • The original CAD model was discretized into different layers with different simplification to enable realistic rendering and improve performance. - Abstract: In recent years EAST (Experimental Advanced Superconducting Tokamak) experimental data are being shared and analyzed by an increasing number of international collaborators. Developing a user-friendly interface to visualize the data, meta data and the relevant parts of the device is becoming more and more important to aid scientists and engineers. Compared with the previous virtual EAST system based on VRML/Java3D [1] (Li et al., 2014), a new technology is being adopted to create a 3D visualization system based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. It offers a highly interactive interface allowing scientists to roam inside EAST device and view the complex 3-D structure of the machine. It includes technical details of the device and various diagnostic components, and provides visualization of diagnostic metadata with a direct link to each signal name and its stored data. In order for the quick access to the device 3D model, the original CAD model was discretized into different layers with different simplification. It allows users to search for plasma videos in any experiment and analyze the video frame by frame. In this paper, we present the implementation details to enable realistic rendering and improve performance.
Interactive WebGL-based 3D visualizations for EAST experiment
Energy Technology Data Exchange (ETDEWEB)
Xia, J.Y., E-mail: jyxia@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China); Xiao, B.J. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China); Li, Dan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Wang, K.R. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China)
2016-11-15
Highlights: • Developing a user-friendly interface to visualize the EAST experimental data and the device is important to scientists and engineers. • The Web3D visualization system is based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. • The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. • The original CAD model was discretized into different layers with different simplification to enable realistic rendering and improve performance. - Abstract: In recent years EAST (Experimental Advanced Superconducting Tokamak) experimental data are being shared and analyzed by an increasing number of international collaborators. Developing a user-friendly interface to visualize the data, meta data and the relevant parts of the device is becoming more and more important to aid scientists and engineers. Compared with the previous virtual EAST system based on VRML/Java3D [1] (Li et al., 2014), a new technology is being adopted to create a 3D visualization system based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. It offers a highly interactive interface allowing scientists to roam inside EAST device and view the complex 3-D structure of the machine. It includes technical details of the device and various diagnostic components, and provides visualization of diagnostic metadata with a direct link to each signal name and its stored data. In order for the quick access to the device 3D model, the original CAD model was discretized into different layers with different simplification. It allows users to search for plasma videos in any experiment and analyze the video frame by frame. In this paper, we present the implementation details to enable realistic rendering and improve performance.
International Nuclear Information System (INIS)
Nguyen Anh Ky.
1993-05-01
In the present paper we construct all typical finite-dimensional representations of the quantum Lie superalgebra U q [gl(2/2)] at generic deformation parameter q. As in the non-deformed case the finite-dimensional U q [gl(2/2)]-module W q obtained is irreducible and can be decomposed into finite-dimensional irreducible U q [l(2)+gl(2)]submodules V i q . (authohor). 32 refs
Branes in the GL(1 vertical stroke 1) WZNW-Model
Energy Technology Data Exchange (ETDEWEB)
Creutzig, T.; Schomerus, V. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Quella, T. [Amsterdam Univ. (Netherlands). KdV Inst. for Mathematics
2007-08-15
We initiate a systematic study of boundary conditions in conformal field theories with target space supersymmetry. The WZNW model on GL(1 vertical stroke 1) is used as a prototypical example for which we find the complete set of maximally symmetric branes. This includes a unique brane of maximal super-dimension 2 vertical stroke 2, a 2-parameter family of branes with super-dimension 0 vertical stroke 2 and an infinite set of fully localized branes possessing a single modulus. Members of the latter family can only exist along certain lines on the bosonic base, much like fractional branes at orbifold singularities. Our results establish that all essential algebraic features of Cardy-type boundary theories carry over to the non-rational logarithmic WZNW model on GL(1 vertical stroke 1). (orig.)
Anatomía quirúrgica del músculo glúteo mayor: espacio Intramuscular de FROD
Directory of Open Access Journals (Sweden)
Freddy Rodríguez-García
Full Text Available Antecedentes y Objetivos. El músculo glúteo mayor es el más voluminoso y superficial de la región glútea, con forma cuadrilátera, dos inserciones diferentes, espesor variable en sus distintas zonas, y cubierto con diferentes fascias o aponeurosis. Realizamos un detallado estudio de la anatomía descriptiva y quirúrgica de dicho músculo para comparar cuál de las técnicas actuales utilizadas para el aumento glúteo con implantes es más segura y cuál proporciona mejores resultados. Material y método. Estudiamos 10 cadáveres frescos facilitados por el Instituto de Medicina Legal Regional Norte, y 10 cadáveres formolizados del anfiteatro de la Universidad Libre Seccional Barranquilla (Colombia, durante el período comprendido entre marzo de 2009 y febrero de 2010. Resultados. Determinamos que el músculo glúteo mayor, además de sus características anatómicas detalladas en los textos de anatomía descriptiva, está constituido por gruesos fascículos musculares paralelos y adyacentes unidos por fuertes tabiques o septos fibroaponeuróticos, del plano superficial al profundo. En el desarrollo del estudio encontramos un espacio anatómico intramuscular en el glúteo mayor, no descrito antes en las publicaciones de Cirugía Plástica ni en los textos de Anatomía más conocidos. Se presenta como una zona limpia, de aproximadamente 10 cm. de diámetro, con delicada aponeurosis muscular en su piso, sin la presencia de los tabiques fibroaponeuróticos interfasciculares habituales y exenta de estructuras vasculonerviosas importantes. Conclusiones. Describimos un nuevo espacio intramuscular en el glúteo mayor, que identificamos como Espacio Intramuscular de FROD, que consideramos de enorme potencial quirúrgico para la ejecución de las técnicas de aumento glúteo.
Contreras, Carlos; Jiménez, Luis Felipe; Ortiz, Mª de Jesús; Moret de González, Yuli; González, osé María
2008-01-01
La cavidad bucal está conformada por diversas estructuras anatómicas, donde las glándulas salivales desempeñan funciones de vital importancia como son la producción y excreción de saliva. Las mismas se dividen en glándulas salivales mayores y menores. Las glándulas salivales mayores son las glándulas parótidas, las submaxilares y las sublinguales. Las glándulas salivales menores están distribuidas en diferentes localizaciones anatómicas de la mucosa bucal. Ellas son: las glándulas labiales, p...
UV SURFACE ENVIRONMENT OF EARTH-LIKE PLANETS ORBITING FGKM STARS THROUGH GEOLOGICAL EVOLUTION
Energy Technology Data Exchange (ETDEWEB)
Rugheimer, S.; Sasselov, D. [Harvard Smithsonian Center for Astrophysics, 60 Garden st., 02138 MA Cambridge (United States); Segura, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autónoma de México, México (Mexico); Kaltenegger, L., E-mail: srugheimer@cfa.harvard.edu [Carl Sagan Institute, Cornell University, Ithaca, NY 14853 (United States)
2015-06-10
The UV environment of a host star affects the photochemistry in the atmosphere, and ultimately the surface UV environment for terrestrial planets and therefore the conditions for the origin and evolution of life. We model the surface UV radiation environment for Earth-sized planets orbiting FGKM stars in the circumstellar Habitable Zone for Earth through its geological evolution. We explore four different types of atmospheres corresponding to an early-Earth atmosphere at 3.9 Gyr ago and three atmospheres covering the rise of oxygen to present-day levels at 2.0 Gyr ago, 0.8 Gyr ago, and modern Earth. In addition to calculating the UV flux on the surface of the planet, we model the biologically effective irradiance, using DNA damage as a proxy for biological damage. We find that a pre-biotic Earth (3.9 Gyr ago) orbiting an F0V star receives 6 times the biologically effective radiation as around the early Sun and 3520 times the modern Earth–Sun levels. A pre-biotic Earth orbiting GJ 581 (M3.5 V) receives 300 times less biologically effective radiation, about 2 times modern Earth–Sun levels. The UV fluxes calculated here provide a grid of model UV environments during the evolution of an Earth-like planet orbiting a range of stars. These models can be used as inputs into photo-biological experiments and for pre-biotic chemistry and early life evolution experiments.
UV SURFACE ENVIRONMENT OF EARTH-LIKE PLANETS ORBITING FGKM STARS THROUGH GEOLOGICAL EVOLUTION
International Nuclear Information System (INIS)
Rugheimer, S.; Sasselov, D.; Segura, A.; Kaltenegger, L.
2015-01-01
The UV environment of a host star affects the photochemistry in the atmosphere, and ultimately the surface UV environment for terrestrial planets and therefore the conditions for the origin and evolution of life. We model the surface UV radiation environment for Earth-sized planets orbiting FGKM stars in the circumstellar Habitable Zone for Earth through its geological evolution. We explore four different types of atmospheres corresponding to an early-Earth atmosphere at 3.9 Gyr ago and three atmospheres covering the rise of oxygen to present-day levels at 2.0 Gyr ago, 0.8 Gyr ago, and modern Earth. In addition to calculating the UV flux on the surface of the planet, we model the biologically effective irradiance, using DNA damage as a proxy for biological damage. We find that a pre-biotic Earth (3.9 Gyr ago) orbiting an F0V star receives 6 times the biologically effective radiation as around the early Sun and 3520 times the modern Earth–Sun levels. A pre-biotic Earth orbiting GJ 581 (M3.5 V) receives 300 times less biologically effective radiation, about 2 times modern Earth–Sun levels. The UV fluxes calculated here provide a grid of model UV environments during the evolution of an Earth-like planet orbiting a range of stars. These models can be used as inputs into photo-biological experiments and for pre-biotic chemistry and early life evolution experiments
Glándula pediosa de moluscos terrestres y sus implicancias evolutivas, con énfasis en Megalobulimus
Directory of Open Access Journals (Sweden)
Victor Borda
2011-05-01
Full Text Available Se describe la anatomía de la glándula pediosa de cinco especies de Megalobulimus (Megalobulimidae, y son comparadas con gastrópodos pulmonados Succineidae, Orthalicidae, Helicidae y Veronicellidae. Una sinapomorfía considerada para el clado Stylommatophora es la presencia de una membrana que aísla a la glándula pediosa de la cavidad visceral. Las especies estudiadas mostraron un grado variable de sujeción de la glándula al pie, desde apenas sujeta por escasa fibras (Megalobulimus hasta aquella totalmente aislada por una membrana (Cantareus pasando por grados intermedios (Succinea y Bostryx. La glándula pediosa en la seudobabosa Heterovaginia limayana (Systellommatophora no está adherida al piso de la cavidad visceral. En Megalobulimus, la parte glandular es voluminosa y pende del techo de la cápsula, a diferencia de las otras especies en que los acinos glandulares están uniformemente adosados a la pared interna de la cápsula. Se describen nuevos caracteres para la glándula pediosa que mejoran la diagnosis del género Megalobulimus y su evaluación filogenética.
Evaluation of pGL1-TNF-alpha therapy in combination with radiation
Li, J.; Andres, M. L.; Fodor, I.; Nelson, G. A.; Gridley, D. S.
1998-01-01
Long-term control of high-grade brain tumors is rarely achieved with current therapeutic regimens. In this study a new plasmid-based human tumor necrosis factor-alpha (TNF-alpha) expression vector was synthesized (pGL1-TNF-alpha) and evaluated together with radiation in the aggressive, rapidly growing C6 rat glioma model. pGL1-TNF-alpha was successfully transfected into C6 cells in vitro using a cationic polyamine method. Expression was detected up to 7 days and averaged 0.4 ng of TNF-alpha in the culture medium from 1x10(5) cells. The expressed protein was biologically functional, as evidenced by growth inhibition of L929, a TNF-alpha-susceptible cell line. Using fluorescence-labeled monoclonal antibodies and laser scanning cytometry, we confirmed that both the P55 and P75 receptors for TNF-alpha were present on the C6 cell membrane. However, the receptors were present at low density and P55 was expressed more than the P75 receptor. These findings were in contrast to results obtained with TNF-alpha-susceptible L929 cells. Tests in athymic mice showed that pGL1-TNF-alpha administered intratumorally 16-18 h before radiation (each modality given three times) significantly inhibited C6 tumor progression (Palpha alone did not slow tumor growth and radiation alone had little effect on tumor growth. These results indicate that pGL1-TNF-alpha has potential to augment the antitumor effects of radiation against a tumor type that is virtually incurable.
Morfologia da glândula adrenal da paca (Cuniculus paca, L. 1766)
Filho, Sergio Pinter Garcia; Esper Gomes de Figueiredo Carvalho, Ana Laura; Luís Martins, Leandro; Martins Leal, Leonardo; Pacheco, Maria Rita; Fernandes Machado, Marcia Rita
2014-01-01
http://dx.doi.org/10.5007/2175-7925.2014v27n2p163 A paca (Cuniculus paca, Linnaeus, 1766) é um roedor de porte médio que, embora pertencente à fauna brasileira, possui poucas informações acerca de sua morfologia na literatura especializada. Nesse sentido, objetivou-se estudar a morfologia da sua glândula adrenal mediante análise de microscopia de luz, cuja importância refere-se ao fato da glândula adrenal ser um órgão secretor de substâncias particulares que promovem no organismo funções ...
Adsorption kinetics of maxilon yellow 4GL and maxilon red GRL dyes on kaolinite
International Nuclear Information System (INIS)
Dogan, Mehmet; Karaoglu, M. Hamdi; Alkan, Mahir
2009-01-01
Kaolinite, a low-costly material, is the most abundant phyllosilicate mineral in highly weathered soils. In this work, the adsorption kinetics of maxilon yellow 4GL (MY 4GL) and maxilon red GRL (MR GRL) dyes on kaolinite from aqueous solutions was investigated using the parameters such as contact time, stirring speed, initial dye concentration, initial pH, ionic strength, acid-activation, calcination and solution temperature. The equilibrium time was 150 min for both dyes. The results showed that alkaline pH was favorable for the adsorption of MY 4GL and MR GRL dyes and physisorption seemed to play a major role in the adsorption process. It was found that the rate of adsorption decreases with increasing temperature and the process is exothermic. The adsorption kinetics followed the pseudo-second-order equation for both dyes investigated in this work with the k 2 values lying in the region of 1.79 x 10 4 to 107.87 x 10 4 g/mol min for MY 4GL and 3.44 x 10 4 to 72.09 x 10 4 g/mol min for MR GRL. The diffusion coefficient values calculated for the dyes were in the range of 3.76 x 10 -9 to 62.50 x 10 -9 cm 2 /s for MY 4GL and 1.98 x 10 -9 to 44.00 x 10 -9 cm 2 /s for MR GRL, and are compatible with other studies reported in the literature. The thermodynamic activation parameters such as the enthalpy, entropy and free energy were determined. The obtained results confirmed the applicability of this clay as an efficient adsorbent for cationic dyes.
Carcinoma de glándulas sebáceas limitado a conjuntiva bulbar
Directory of Open Access Journals (Sweden)
Manuel Fernando Buitrago-Torrado
Full Text Available El carcinoma de glándulas sebáceas es un tumor infrecuente que puede desarrollarse a partir de cualquier glándula sebácea en la piel. El 75 % de las veces es de origen ocular y afecta principalmente las glándulas de Zeiss, Meibomio y de la carúncula. Se caracteriza por un comportamiento agresivo, con alta probabilidad de invasión a piel, conjuntiva y córnea. Sin embargo, el compromiso de la conjuntiva como localización primaria es raro. Se presenta un caso con diagnóstico de carcinoma sebáceo de patrón nodular primario de la conjuntiva bulbar, atendido en el Hospital Universitario de Santander durante los años 2014-2016. El propósito del presente estudio es dar a conocer el caso de una patología infrecuente con pocos casos reportados en la literatura, enfatizar su importancia dentro de los diagnósticos diferenciales de masas en la conjuntiva y del estudio histopatológico como método para obtener un diagnóstico definitivo y realizar un abordaje temprano.
Tumor glómico do pulmão: Apresentação de um caso pouco frequente
Directory of Open Access Journals (Sweden)
Vítor Sousa
2006-05-01
Full Text Available Resumo: Os tumores glómicos são tumores perivasculares cujas células se assemelham a células musculares lisas modificadas do corpo glómico. São mais frequentes na região subungueal e raros no pulmão.Os autores apresentam um caso de uma doente de 62 anos, com toracalgia esquerda e dispneia para grandes esforços. Apresentava nódulo solitário localizado ao segmento basal-externo do LIE, com 1,9 cm de diâmetro, de limites bem definidos, consistência firme e superfície de secção nodular e branco-rosada.Os tumores glómicos são geralmente benignos. Podem ter origem em células glómicas ectópicas ou diferenciarem-se a partir de células não glómicas. Devem ser classificados em tumor glómico, glomangioma ou glomangiomioma de acordo com a abundância relativa de células glómicas, do componente vascular e muscular. Estão descritas metástases pulmonares de tumores glómicos malignos, sendo necessário excluir origem primária extra-pulmonar nesses casos.O diagnóstico diferencial dos tumores glómicos do pulmão inclui o carcinóide, hemangiopericitoma, tumores musculares lisos (leiomioma epitelióide e o paraganglioma.Rev Port Pneumol 2006; XII (3: 269-274 Abstract: Glomic tumours are perivascular tumours whose cells resemble modified smooth muscular cells of the glomic body.They are more frequent in the subungueal region and rare in the lung.The authors present a case of a 62 year old women with left thoracic pain and great enforces dyspnoea. She presented a solitary nodule in the external basal segment of the LLL, 1.9 cm diameter, circumscribed, firm and with nodular whitish rose cut surface.Glomic tumours are generally benign. They may origin in ectopic glomic cells or be differentiated from non glomic cells. They should be classified as glomic tumor, glomangioma and glomangiomioma according to the relative abundance of glomic cells and of the vascular and muscular components. Pulmonary metastasis of malignant glomic tumours
Tumor glómico do pulmão: Apresentação de um caso pouco frequente
Directory of Open Access Journals (Sweden)
Vítor Sousa
2006-05-01
Full Text Available Resumo: Os tumores glómicos são tumores perivasculares cujas células se assemelham a células musculares lisas modificadas do corpo glómico. São mais frequentes na região subungueal e raros no pulmão.Os autores apresentam um caso de uma doente de 62 anos, com toracalgia esquerda e dispneia para grandes esforços. Apresentava nódulo solitário localizado ao segmento basal-externo do LIE, com 1,9 cm de diâmetro, de limites bem definidos, consistência firme e superfície de secção nodular e branco-rosada.Os tumores glómicos são geralmente benignos. Podem ter origem em células glómicas ectópicas ou diferenciarem-se a partir de células não glómicas. Devem ser classificados em tumor glómico, glomangioma ou glomangiomioma de acordo com a abundância relativa de células glómicas, do componente vascular e muscular. Estão descritas metástases pulmonares de tumores glómicos malignos, sendo necessário excluir origem primária extra-pulmonar nesses casos.O diagnóstico diferencial dos tumores glómicos do pulmão inclui o carcinóide, hemangiopericitoma, tumores musculares lisos (leiomioma epitelióide e o paraganglioma. Abstract: Glomic tumours are perivascular tumours whose cells resemble modified smooth muscular cells of the glomic body.They are more frequent in the subungueal region and rare in the lung.The authors present a case of a 62 year old women with left thoracic pain and great enforces dyspnoea. She presented a solitary nodule in the external basal segment of the LLL, 1.9 cm diameter, circumscribed, firm and with nodular whitish rose cut surface.Glomic tumours are generally benign. They may origin in ectopic glomic cells or be differentiated from non glomic cells. They should be classified as glomic tumor, glomangioma and glomangiomioma according to the relative abundance of glomic cells and of the vascular and muscular components. Pulmonary metastasis of malignant glomic tumours have been described. In these cases
Antiangiogenic Effects of Noscapine Enhance Radioresponse for GL261 Tumors
International Nuclear Information System (INIS)
Newcomb, Elizabeth W.; Lukyanov, Yevgeniy; Alonso-Basanta, Michelle; Esencay, Min; Smirnova, Iva; Schnee, Tona; Shao Yongzhao; Devitt, Mary Louise; Zagzag, David; McBride, William; Formenti, Silvia C.
2008-01-01
Purpose: To assess the effects of noscapine, a tubulin-binding drug, in combination with radiation in a murine glioma model. Methods and Materials: The human T98G and murine GL261 glioma cell lines treated with noscapine, radiation, or both were assayed for clonogenic survival. Mice with established GL261 hind limb tumors were treated with noscapine, radiation, or both to evaluate the effect of noscapine on radioresponse. In a separate experiment with the same treatment groups, 7 days after radiation, tumors were resected and immunostained to measure proliferation rate, apoptosis, and angiogenic activity. Results: Noscapine reduced clonogenic survival without enhancement of radiosensitivity in vitro. Noscapine combined with radiation significantly increased tumor growth delay: 5, 8, 13, and 18 days for control, noscapine alone, radiation alone, and the combination treatment, respectively (p < 0.001). To assess the effect of the combination of noscapine plus radiation on the tumor vasculature, tubule formation by the murine endothelial 2H11 cells was tested. Noscapine with radiation significantly inhibited tubule formation compared with radiation alone. By immunohistochemistry, tumors treated with the combination of noscapine plus radiation showed a decrease in BrdU incorporation, an increase in apoptosis by terminal deoxynucleotidyl transferase-mediated deoxyuridine triphosphate nick end labeling, and a decrease in tumor vessel density compared with tumors treated with radiation alone. Conclusion: Noscapine enhanced the sensitivity of GL261 glioma tumors to radiation, resulting in a significant tumor growth delay. An antiangiogenic mechanism contributed to the effect. These findings are clinically relevant, particularly in view of the mild toxicity profile of this drug
iPhone 3D Programming Developing Graphical Applications with OpenGL ES
Rideout, Philip
2010-01-01
What does it take to build an iPhone app with stunning 3D graphics? This book will show you how to apply OpenGL graphics programming techniques to any device running the iPhone OS -- including the iPad and iPod Touch -- with no iPhone development or 3D graphics experience required. iPhone 3D Programming provides clear step-by-step instructions, as well as lots of practical advice, for using the iPhone SDK and OpenGL. You'll build several graphics programs -- progressing from simple to more complex examples -- that focus on lighting, textures, blending, augmented reality, optimization for pe
Estudio anatomopatológico de los tumores de las glándulas salivares
Ortega Salas, Rosa María
2011-01-01
Hemos estudiado, de forma retrospectiva, las características epidemiológicas, morfológicas e inmunohistoquímicas de 400 tumores de las glándulas salivares. La clasificación diagnóstica utilizada ha sido la de Ellis y Auclair (AFIP 1995). Los tumores de las glándulas salivares de nuestras serie son neoplasias que afectan con mayor frecuencia a pacientes entre 30 y 60 años de edad; en los pacientes con tumores benignos, la edad es significativamente menor que los que presentan turmores malignos...
A note on glN type-I integrable defects
International Nuclear Information System (INIS)
Doikou, Anastasia
2014-01-01
Type-I quantum defects are considered in the context of the gl N spin chain. The type-I defects are associated with the generalized harmonic oscillator algebra, and the chosen defect matrix is that of the vector nonlinear Schrödinger (NLS) model. The transmission matrices relevant to this particular type of defects are computed via the Bethe ansatz methodology. (paper)
Directory of Open Access Journals (Sweden)
Bruno G.
2015-01-01
Full Text Available We present the analysis of the multi-planetary system Kepler-117, which is part of our program of observations of Kepler planets. This system is composed of a ~ 30 MEarth planet in a ~ 19 days orbit and a ~ 2 MJ planet orbiting in ~ 51 days. Both the orbits have low eccentricity. The planets are not close to an exact low-order mean motion resonance, but exhibit significant transit timing variations (TTVs nevertheless. We perform a combined Markov Chain Monte Carlo fit on all the available data: the Kepler photometry, the TTVs, the radial velocities we obtained with SOPHIE/OHP and the stellar parameters. The prime result is that the modelling of the TTVs allows to increase the precision on the system parameters which are not constrained by the radial velocities alone.
The Murid Herpesvirus-4 gL regulates an entry-associated conformation change in gH.
Directory of Open Access Journals (Sweden)
Laurent Gillet
2008-07-01
Full Text Available The glycoprotein H (gH/gL heterodimer is crucial for herpesvirus membrane fusion. Yet how it functions is not well understood. The Murid Herpesvirus-4 gH, like that of other herpesviruses, adopts its normal virion conformation by associating with gL. However, gH switched back to a gL-independent conformation after virion endocytosis. This switch coincided with a conformation switch in gB and with capsid release. Virions lacking gL constitutively expressed the down-stream form of gH, prematurely switched gB to its down-stream form, and showed premature capsid release with poor infectivity. These data argue that gL plays a key role in regulating a gH and gB functional switch from cell binding to membrane fusion.
Directory of Open Access Journals (Sweden)
Shyama Majumdar
2013-07-01
Full Text Available Urothelial carcinoma (UC causes substantial morbidity and mortality worldwide. However, the molecular mechanisms underlying urothelial cancer development and tumor progression are still largely unknown. Using informatics analysis, we identified Sh3gl2 (endophilin A1 as a bladder urothelium-enriched transcript. The gene encoding Sh3gl2 is located on chromosome 9p, a region frequently altered in UC. Sh3gl2 is known to regulate endocytosis of receptor tyrosine kinases implicated in oncogenesis, such as the epidermal growth factor receptor (EGFR and c-Met. However, its role in UC pathogenesis is unknown. Informatics analysis of expression profiles as well as immunohistochemical staining of tissue microarrays revealed Sh3gl2 expression to be decreased in UC specimens compared to nontumor tissues. Loss of Sh3gl2 was associated with increasing tumor grade and with muscle invasion, which is a reliable predictor of metastatic disease and cancer-derived mortality. Sh3gl2 expression was undetectable in 19 of 20 human UC cell lines but preserved in the low-grade cell line RT4. Stable silencing of Sh3gl2 in RT4 cells by RNA interference 1 enhanced proliferation and colony formation in vitro, 2 inhibited EGF-induced EGFR internalization and increased EGFR activation, 3 stimulated phosphorylation of Src family kinases and STAT3, and 4 promoted growth of RT4 xenografts in subrenal capsule tissue recombination experiments. Conversely, forced re-expression of Sh3gl2 in T24 cells and silenced RT4 clones attenuated oncogenic behaviors, including growth and migration. Together, these findings identify loss of Sh3gl2 as a frequent event in UC development that promotes disease progression.
Villegas, Josefina M; Brown, Lucía; Savoy de Giori, Graciela; Hebert, Elvira M
2015-05-01
The cell envelope-associated proteinase (CEP) of Lactobacillus delbrueckii subsp. lactis CRL 581 (PrtL) has an essential role in bacterial growth, contributes to the flavor and texture development of fermented products, and can release bioactive health-beneficial peptides during milk fermentation. The genome of L. delbrueckii subsp. lactis CRL 581 possesses only one gene that encodes PrtL, which consists of 1924 amino acids and is a multidomain protein anchored to the cell via its W domain. PrtL was extracted from the cell under high ionic strength conditions using NaCl, suggesting an electrostatic interaction between the proteinase and the cell envelope. The released PrtL was purified and biochemically characterized; its activity was maximal at temperatures between 37 and 40 °C and at pH between 7 and 8. Under optimal conditions, PrtL exhibited higher affinity for succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide than for succinyl-alanyl-glutamyl-prolyl-phenylalanine-p-nitroanilide, while methoxy-succinyl-arginyl-prolyl-tyrosyl-p-nitroanilide was not degraded. A similar α- and β-casein degradation pattern was observed with the purified and the cell envelope-bound proteinase. Finally, on the basis of its specificity towards caseins and the unique combination of amino acids at residues thought to be involved in substrate specificity, PrtL can be classified as a representative of a new group of CEP.
Análise histoquímica das glândulas anexas do aparelho reprodutor do macho de paca (Cuniculus paca
Directory of Open Access Journals (Sweden)
Aretuza C. Capalbo
Full Text Available RESUMO: A paca (Cuniculus paca é um roedor típico de regiões tropicais. Com a finalidade de estudar esta espécie selvagem para manejo adequado e sua preservação, objetivou-se neste trabalho caracterizar a histoquímica das glândulas anexas do trato reprodutor do macho da paca. Para este fim, cortes histológicos dessas glândulas foram submetidas às reações histoquímicas com Ácido Periódico de Schiff (PAS, Alcian blue (AB, PAS. + AB. e PAS + Amilase. Na glândula bulbouretral foi constatado que o epitélio produz secreção rica em glicoproteínas neutras e ácidas, glicosaminoglicanas, e em algumas regiões produz mais de um tipo de secreção. Não foi observada a presença de glicogênio no epitélio. Na glândula vesicular, seu epitélio em borda em escova corou-se por glicoproteínas neutras e também por substância de composição desconhecida, não contendo glicoproteínas ácidas, glicogênio ou glicosaminoglicanas. Verificou-se presença de pequena quantidade de glicoproteínas ácidas e neutras na próstata, em especial na mucosa, além de glicoproteínas ácidas carboxiladas e sulfatadas em pequena quantidade no tecido conjuntivo da lâmina própria dessa glândula. Por fim, a glândula coaguladora apresentou pequena quantidade de glicoproteínas neutras na borda em escova de seu epitélio e substância de composição desconhecida, sendo ausente o glicogênio. Conclui-se que as glândulas anexas do trato reprodutor da paca apresentam características histoquímicas que compartilham certa similaridade com outras espécies da ordem Rodentia, com a presença de glicoproteínas neutras e ácidas em algumas glândulas, principalmente no epitélio da glândula bulbouretal e na borda em escova do epitélio das demais glândulas.
Directory of Open Access Journals (Sweden)
Karoline Carula
2008-01-01
Full Text Available Este artigo aborda o darwinismo exposto, entre 1875 e 1880, nas Conferências Populares da Glória - preleções públicas realizadas na escola da Freguesia da Glória, no Rio de Janeiro. As conferências que tiveram as idéias darwinistas como temática foram recebidas e repercutidas na imprensa de maneira polêmica. Apresenta-se a concepção sobre o darwinismo do médico Miranda Azevedo, o primeiro, mas não o único, a discursar sobre o tema. Com relação às conferências desse médico, analisa-se a aplicabilidade social do darwinismo por ele defendida, e as discussões na imprensa sobre a propagação do darwinismo no Brasil e sobre a possível origem símia do homem. Por fim, analisam-se as preleções de outros conferencistas que ou versaram sobre o tema mais diretamente ou perpassaram o assunto.In this paper I examine the Darwinism that transpired, between 1875 and 1880, during the Popular Conferences in the Gloria district - public conferences that took place at the Freguesia da Glória school, in Rio de Janeiro. The Conferences that had Darwinism as a subject were received and reverberated in the press polemically. I present the conception of Darwinism held by doctor Miranda Azevedo, the first, but not the only speaker, to discuss the subject. Concerning this doctor's conferences, I analyze the social application of Darwinism defended by him, and the discussions in the press about the spread of Darwinism in Brazil, and the possible simian origin of man. Finally, I talk about other lecturers' talks that either directly broached the subject or mentioned it in passing.
New reflection matrices for the Uq(gl(m|n)) case
International Nuclear Information System (INIS)
Doikou, Anastasia; Karaiskos, Nikos
2009-01-01
We examine supersymmetric representations of the B-type Hecke algebra. We exploit such representations to obtain new non-diagonal solutions of the reflection equation associated with the super algebra U q (gl(m|n)). The boundary super algebra is briefly discussed and it is shown to be central to the supersymmetric realization of the B-type Hecke algebra. (letter)
Classificação Morfológica da Glândula Prepucial do Nasua nasua (Quati.
Directory of Open Access Journals (Sweden)
Bruno Machado Bertassoli
2011-05-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n2p83 A proposta desta pesquisa é descrever a glândula prepucial do Nasua nasua. Utilizaram-se oito quatis provenientes do Criatόrio Científico Cecrimpas (Unifeob; as glândulas prepuciais foram analisadas, dissecadas e descritas macro e microscopicamente, visando estabelecer sua classificação morfofuncional para, assim, poder compará-las com as de outras espécies já descritas na literatura. Amostras de tecido glandular foram coletadas, coradas (Hematoxilina e Eosina, Azul Toluidina, e Picrosirius e analisadas através da microscopia de luz. Todos os resultados foram compilados e fotodocumentados. Na espécie citada, essa glândula tem como principal função a demarcação territorial e está situada na porção prepucial do mesmo modo que nos javalis. Em outros animais, como primatas, cervídeos e roedores, essas glândulas demarcatόrias estão localizadas em diferentes regiões anatômicas, como entre os olhos, no metatarso, nas áreas perianais e esternais. Em nosso resultado das medidas biométricas, obtivemos como média 3,8 ± 1,41cm de largura, 3,15 ± 0,93cm de altura e 10,26 ± 1,89cm de circunferência, e essa glândula foi histologicamente classificada como do tipo tubuloalveolar, com secreção holόcrina.
SM-ROM-GL (Strong Motion Romania Ground Level Database
Directory of Open Access Journals (Sweden)
Ioan Sorin BORCIA
2015-07-01
Full Text Available The SM-ROM-GL database includes data obtained by the processing of records performed at ground level by the Romanian seismic networks, namely INCERC, NIEP, NCSRR and ISPH-GEOTEC, during recent seismic events with moment magnitude Mw ≥ 5 and epicenters located in Romania. All the available seismic records were re-processed using the same basic software and the same procedures and options (filtering and baseline correction, in order to obtain a consistent dataset. The database stores computed parameters of seismic motions, i.e. peak values: PGA, PGV, PGD, effective peak values: EPA, EPV, EPD, control periods, spectral values of absolute acceleration, relative velocity and relative displacement, as well as of instrumental intensity (as defined bz Sandi and Borcia in 2011. The fields in the database include: coding of seismic events, stations and records, a number of associated fields (seismic event source parameters, geographical coordinates of seismic stations, links to the corresponding ground motion records, charts of the response spectra of absolute acceleration, relative velocity, relative displacement and instrumental intensity, as well as some other representative parameters of seismic motions. The conception of the SM-ROM-GL database allows for an easy maintenance; such that elementary knowledge of Microsoft Access 2000 is sufficient for its operation.
Yi, Liang; Zhou, Chun; Wang, Bing; Chen, Tunan; Xu, Minhui; Xu, Lunshan; Feng, Hua
2013-08-01
Recent studies have demonstrated that inflammatory cells and inflammatory mediators are indispensable components of the tumor-initiating cell (TIC) niche and regulate the malignant behavior of TICs. However, conventional animal models for glioma-initiating cell (GIC) studies are based on the implantation of GICs from human glioblastoma (GBM) into immunodeficient mice without the regulation of immune system. Whether animal models can mimic the cellular microenvironment of malignancy and evaluate the biological features of GICs accurately is unclear. Here, we detected the biological features of neurosphere-like tumor cells derived from the murine GBM cell line GL261 (GL261-NS) and from primary human GBM (PGBM-NS) in vitro, injected GL261-NS into syngeneic C57/BL6 mouse brain and injected PGBM-NS into NOD/SCID mouse brain, respectively. The tumorigenic characteristics of the two different orthotopic transplantation models were analyzed and the histological discrepancy between grafts and human primary GBM was compared. We found that GICs enriched in GL261-NS, GL261-NS and PGBM-NS exhibited increased GIC potential and enhanced chemoresistance in vitro. GL261-NS was significantly more aggressive compared to GL261 adhesive cells (GL261-AC) in vivo and the enhanced aggression was more significant in syngeneic mice compared to immunodeficient mice. The discrepancy of tumorigenicity between GL261-NS and GL261-AC in C57/BL6 mice was also larger compared to that between PGBM-NS and PGBM-AC in immunodeficient mice. Syngrafts derived from GL261-NS in C57/BL6 mice corresponded to the human GBM histologically better, compared with xenografts derived from PGBM-NS in NOD/SCID mice, which lack inflammatory cells and inflammatory mediators. We conclude that the inflammatory niche is involved in the tumorigenicity of GICs and implantation of GL261-NS into C57/BL6 mice is a more reliable syngeneic graft model for in vivo study on GICs relative to the immunodeficiency model.
Protein Kinase CK2 Content in GL261 Mouse Glioblastoma.
Ferrer-Font, Laura; Alcaraz, Estefania; Plana, Maria; Candiota, Ana Paula; Itarte, Emilio; Arús, Carles
2016-07-01
Glioblastoma (GBM) is the most prevalent and aggressive human glial tumour with a median survival of 14-15 months. Temozolomide (TMZ) is the standard chemotherapeutic choice for GBM treatment. Unfortunately, chemoresistence always ensues with concomitant tumour regrowth. Protein kinase CK2 (CK2) contributes to tumour development, proliferation, and suppression of apoptosis in cancer and it is overexpressed in human GBM. Targeting CK2 in GBM treatment may benefit patients. With this translational perspective in mind, we have studied the CK2 expression level by Western blot analysis in a preclinical model of GBM: GL261 cells growing orthotopically in C57BL/6 mice. The expression level of the CK2 catalytic subunit (CK2α) was higher in tumour (about 4-fold) and in contralateral brain parenchyma (more than 2-fold) than in normal brain parenchyma (p < 0.05). In contrast, no significant changes were found in CK2 regulatory subunit (CK2β) expression, suggesting an increased unbalance of CK2α/CK2β in GL261 tumours with respect to normal brain parenchyma, in agreement with a differential role of these two subunits in tumours.
Strong, Averey D; Daniels, Richard L
2017-08-02
The tumor-derived GL261 cell line is used as a model for studying glioblastoma and other high-grade gliomas, and can be cultured adherently or as free-floating aggregates known as neurospheres. These different culture conditions give rise to distinct phenotypes, with increased tumorigenicity displayed by neurosphere-cultured cells. An important technique for understanding GL261 pathobiology is live cell fluorescent imaging of intracellular calcium. However, live cell imaging of GL261 neurospheres presents a technical challenge, as experimental manipulations where drugs are added to the extracellular media cause the cells to move during analysis. Here we present a method to immobilize GL261 neurospheres with low melting point agarose for calcium imaging using the fluorescent calcium sensor fura-2. GL261 cells were obtained from the NCI-Frederick Cancer Research Tumor Repository and cultured as adherent cells or induced to form neurospheres by placing freshly trypsinized cells into serum-free media containing fibroblast growth factor 2, epidermal growth factor, and B-27 supplement. Prior to experiments, adherent cells were loaded with fura-2 and cultured on 8-well chamber slides. Non-adherent neurospheres were first loaded with fura-2, placed in droplets onto an 8-well chamber slide, and finally covered with a thin layer of low melting point agarose to immobilize the cells. Ratiometric pseudocolored images were obtained during treatment with ATP, capsaicin, or vehicle control. Cells were marked as responsive if fluorescence levels increased more than 30% above baseline. Differences between treatment groups were tested using Student's t-tests and one-way ANOVA. We found that cellular responses to pharmacological treatments differ based on cellular phenotype. Adherent cells and neurospheres both responded to ATP with a rise in intracellular calcium. Notably, capsaicin treatment led to robust responses in GL261 neurospheres but not adherent cells. We demonstrate the use
Arithmetic differential equations on $GL_n$, I: differential cocycles
Buium, Alexandru; Dupuy, Taylor
2013-01-01
The theory of differential equations has an arithmetic analogue in which derivatives are replaced by Fermat quotients. One can then ask what is the arithmetic analogue of a linear differential equation. The study of usual linear differential equations is the same as the study of the differential cocycle from $GL_n$ into its Lie algebra given by the logarithmic derivative. However we prove here that there are no such cocycles in the context of arithmetic differential equations. In sequels of t...
Directory of Open Access Journals (Sweden)
Madlen eNietzsche
2014-02-01
Full Text Available In plants, SNF1-related kinase (SnRK1 responds to the availability of carbohydrates as well as to environmental stresses by down-regulating ATP consuming biosynthetic processes, while stimulating energy-generating catabolic reactions through gene expression and post-transcriptional regulation. The functional SnRK1 complex is a heterotrimer where the catalytic alpha subunit associates with a regulatory beta subunit and an activating gamma subunit. Several different metabolites as well as the hormone abscisic acid (ABA have been shown to modulate SnRK1 activity in a cell- and stimulus-type specific manner. It has been proposed that tissue- or stimulus-specific expression of adapter proteins mediating SnRK1 regulation can at least partly explain the differences observed in SnRK1 signaling. By using yeast two-hybrid and in planta bi-molecular fluorescence complementation assays we were able to demonstrate that proteins containing the domain of unknown function (DUF 581 could interact with both isoforms of the SnRK1 alpha subunit (AKIN10/11 of Arabidopsis. A structure/function analysis suggests that the DUF581 is a generic SnRK1 interaction module and co-expression with DUF581 proteins in plant cells leads to reallocation of the kinase to specific regions within the nucleus. Yeast two-hybrid analyses suggest that SnRK1 and DUF581 proteins can share common interaction partners inside the nucleus. The analysis of available microarray data implies that expression of the 19 members of the DUF581 encoding gene family in Arabidopsis is differentially regulated by hormones and environmental cues, indicating specialized functions of individual family members. We hypothesize that DUF581 proteins could act as mediators conferring tissue- and stimulus-type specific differences in SnRK1 regulation.
Study to determine the clinical significance of HEmolysis During Orbital AtheRectomy (CLEAR study).
Staniloae, Cezar S; Korabathina, Ravikiran; Lane, Thomas A; Dattilo, Raymond; Church, Kevin J; Mody, Kanika P; Mayeda, Guy S
2011-02-01
To evaluate the incidence of clinically evident hemolysis associated with orbital atherectomy used to treat severe peripheral artery disease. The observational CLEAR study enrolled 31 subjects (16 men; mean age 71 ± 10 years, range 44-92) with claudication (58.1%) or critical limb ischemia (38.7%) who underwent orbital atherectomy with the Diamondback 360 system at 4 US centers. The 42 lesions in 31 limbs were located in the superficial femoral (n = 19, 45.2%), popliteal (n = 8, 19.0%), and tibial arteries (n = 15, 35.8%). The majority of lesions (34, 81.0%) were de novo; moderate or severe calcification was identified in 90.5% of cases. Lesion and procedural parameters were analyzed at a core laboratory. Blood samples were collected during and post procedure and analyzed for markers of hemolysis. The primary endpoint was the occurrence of clinically significant hemolysis. The secondary endpoints included the occurrence of any clinical symptoms/signs potentially related to hemolysis. Statistical analysis was performed to identify predictors for hemolysis. Laboratory evidence of hemolysis was seen in 11 (35.5%) subjects. No one met the clinical event criteria, and so the primary endpoint of the study was not reached. The secondary endpoints were hypertensive crisis (1, 3.2%) and transient hemoglobinuria (3, 9.7%). Lower glomerular filtration rates, calcified plaque, long atherectomy runs, and solid crown selection were independent predictors of hemolysis. There was no clinically significant hemolysis after orbital atherectomy. The results of this study will enable users to predict conditions that predispose to high levels of red cell hemolysis following orbital atherectomy and to take appropriate measures to limit its occurrence.
Cheloni, Giulia; Slaveykova, Vera I
2013-10-01
Lipid oxidation is a recognized end point for the study of oxidative stress and is an important parameter to describe the mode of micropollutant action on aquatic microorganisms. Therefore, the development of quick and reliable methodologies probing the oxidative stress and damage in living cells is highly sought. In the present proof-of-concept work, we examined the potential of the fluorescent dye C11-BODIPY(591/581) to probe lipid oxidation in the green microalga Chlamydomonas reinhardtii. C11-BODIPY(591/581) staining was combined with flow cytometry measurements to obtain multiparameter information on cellular features and oxidative stress damage within single cells. First, staining conditions were optimized by exploring the capability of the dye to stain algal cells under increasing cell and dye concentrations and different staining procedures. Then lipid oxidation in algae induced by short- and long-term exposures to the three metallic micropollutants, copper, mercury, and nanoparticulate copper oxide, and the two organic contaminants, diethyldithiocarbamate (DDC) and diuron was determined. In this work we pointed out C11-BODIPY(591/581) applicability in a wide range of exposure conditions, including studies of oxidation as a function of time and that it is suitable for in vivo measurements of lipid oxidation due to its high permeation and stability in cells and its low interference with algal autofluorescence. © 2013 International Society for Advancement of Cytometry. Copyright © 2013 International Society for Advancement of Cytometry.
2010-07-01
... retention requirements for motor vehicle diesel fuel, NRLM diesel fuel, and ECA marine fuel? 80.581 Section...) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel... requirements for motor vehicle diesel fuel, NRLM diesel fuel, and ECA marine fuel? (a) Beginning on June 1...
Directory of Open Access Journals (Sweden)
Mário Luiz Ribeiro Monteiro
2009-02-01
Full Text Available We report the case of a 40-year-old woman with chronic renal failure and secondary hyperparathyroidism that presented with slowly progressive proptosis of the right eye and mass sensation in the temporal and frontal orbital margins. Computerized tomography scan revealed two separate hyperdense and well-circumscribed lesions in the right orbital walls. A biopsy followed by histopathologic study revealed a dense lesion, with fibrous proliferation associated with osseous metaplasia and osteoclastic activity in the tumor, compatible with the diagnosis of brown tumor. The patient was submitted to surgical removal of the parathyroid glands that resulted in marked improvement in her condition and regression of the orbital tumors. Although the occurrence of more than one separate bone lesion in the orbit usually suggests metastasis, our case shows that brown tumors should also be included in the differential diagnosis of such lesions, particularly in patients with hyperparathyroidism.Este trabalho relata o caso de uma paciente de 40 anos, com insuficiência renal crônica e hiperparatireoidismo secundário que se apresentou com proptose progressiva e tumoração nas regiões lateral da órbita e superior da órbita. Tomografia computadorizada revelou duas lesões ósseas separadas, bem delimitadas e hiperdensas nas paredes orbitárias. Uma biópsia seguida de estudo histopatológico revelou um tumor denso, com proliferação fibrosa associada a metaplasia óssea e atividade osteoclástica no tumor, características compatíveis com tumor marrom. A paciente foi submetida a remoção das glândulas paratiróides que resultou em melhora dramática do seu estado geral e regressão dos tumores orbitais. Embora a presença de mais de uma lesão óssea separada na órbita geralmente sugira o diagnóstico de lesões metastáticas, nosso caso evidencia que tumores marrons devem também ser incluídos no diagnóstico diferencial, particularmente em pacientes com
Employing WebGL to develop interactive stereoscopic 3D content for use in biomedical visualization
Johnston, Semay; Renambot, Luc; Sauter, Daniel
2013-03-01
Web Graphics Library (WebGL), the forthcoming web standard for rendering native 3D graphics in a browser, represents an important addition to the biomedical visualization toolset. It is projected to become a mainstream method of delivering 3D online content due to shrinking support for third-party plug-ins. Additionally, it provides a virtual reality (VR) experience to web users accommodated by the growing availability of stereoscopic displays (3D TV, desktop, and mobile). WebGL's value in biomedical visualization has been demonstrated by applications for interactive anatomical models, chemical and molecular visualization, and web-based volume rendering. However, a lack of instructional literature specific to the field prevents many from utilizing this technology. This project defines a WebGL design methodology for a target audience of biomedical artists with a basic understanding of web languages and 3D graphics. The methodology was informed by the development of an interactive web application depicting the anatomy and various pathologies of the human eye. The application supports several modes of stereoscopic displays for a better understanding of 3D anatomical structures.
Yang, Qingjie; Yuan, Dawei; Shi, Lianxuan; Capell, Teresa; Bai, Chao; Wen, Nuan; Lu, Xiaodan; Sandmann, Gerhard; Christou, Paul; Zhu, Changfu
2012-10-01
The accumulation of carotenoids in plants depends critically on the spatiotemporal expression profiles of the genes encoding enzymes in the carotenogenic pathway. We cloned and characterized the Gentiana lutea zeaxanthin epoxidase (GlZEP) promoter to determine its role in the regulation of carotenogenesis, because the native gene is expressed at high levels in petals, which contain abundant chromoplasts. We transformed tomato (Solanum lycopersicum cv. Micro-Tom) plants with the gusA gene encoding the reporter enzyme β-glucuronidase (GUS) under the control of the GlZEP promoter, and investigated the reporter expression profile at the mRNA and protein levels. We detected high levels of gusA expression and GUS activity in chromoplast-containing flowers and fruits, but minimal levels in immature fruits containing green chloroplasts, in sepals, leaves, stems and roots. GlZEP-gusA expression was strictly associated with fruit development and chromoplast differentiation, suggesting an evolutionarily-conserved link between ZEP and the differentiation of organelles that store carotenoid pigments. The impact of our results on current models for the regulation of carotenogenesis in plants is discussed.
Quantized planes and multiparameter deformations of Heisenberg and GL(N) algebras
International Nuclear Information System (INIS)
Fairlie, D.B.; Zachos, C.
1991-01-01
We summarize our work on explicitly deforming classical oscillators to multiparameter quantum oscillators which do not commute with each other. These ''anyonic'' oscillators lead to the construction of a consistent quantum algebra GL q (N) with (N - 1)(N - 2)/2 independent parameters, some of whose features and applications we shall discuss. 22 refs
El diagnóstico por la imagen de las enfermedades de las glándulas salivales
Paz Expósito, Francisco
2002-01-01
Las lesiones de las glándulas salivales son relativamente frecuentes, presentando una patología tan diversa como la de cualquier otro sistema orgánico. La mayoría de las lesiones son inflamatorias, otras son de origen litiásico, algunas tienen una patogenia incierta que pueden confundirse con neoplasias malignas y, por último, hay un amplio espectro de neoplasias tanto benignas como malignas. La mayoría de los agrandamientos de las glándulas salivales están causados por procesos inflamator...
Directory of Open Access Journals (Sweden)
Su-Ying Yu
2016-05-01
Full Text Available AIM:To investigate the effect of 0.5g/L cyclosporine A for symptom and sign scores in patients with moderate to severe dry eye.METHODS:Eighty patients(160 eyeswith moderate to severe dry eye were divided into two groups by double-blind and random principles:40 patients(80 eyesin observation group were treated with 10g/L sodium carboxymethyl cellulose and 0.5g/L cyclosporine A eye drops, 40 patients(80 eyesin the control group were treated with 10g/L sodium carboxymethyl cellulose eye drops. The changes of ocular sign and symptom scores were compared between the two groups.RESULTS:The total effective rate of observation group was 95.0%, which was significantly higher than that of control group(85.0%, PPPP>0.05. After treatment, the four parameters of observation group were improved significantly(PPPCONCLUSION:The 0.5g/L cyclosporine A eye drops can effectively relieve the symptoms and signs of moderate to severe dry eye, promote tear secretion, and improve ocular surface environment. The treatment effect is good.
Directory of Open Access Journals (Sweden)
Jeffrey L Bose
Full Text Available The most prominent murein hydrolase of Staphylococcus aureus, AtlA, is a bifunctional enzyme that undergoes proteolytic cleavage to yield two catalytically active proteins, an amidase (AM and a glucosaminidase (GL. Although the bifunctional nature of AtlA has long been recognized, most studies have focused on the combined functions of this protein in cell wall metabolism and biofilm development. In this study, we generated mutant derivatives of the clinical S. aureus isolate, UAMS-1, in which one or both of the AM and GL domains of AtlA have been deleted. Examination of these strains revealed that each mutant exhibited growth rates comparable to the parental strain, but showed clumping phenotypes and lysis profiles that were distinct from the parental strain and each other, suggesting distinct roles in cell wall metabolism. Given the known function of autolysis in the release of genomic DNA for use as a biofilm matrix molecule, we also tested the mutants in biofilm assays and found both AM and GL necessary for biofilm development. Furthermore, the use of enzymatically inactive point mutations revealed that both AM and GL must be catalytically active for S. aureus to form a biofilm. The results of this study provide insight into the relative contributions of AM and GL in S. aureus and demonstrate the contribution of Atl-mediated lysis in biofilm development.
Bose, Jeffrey L; Lehman, McKenzie K; Fey, Paul D; Bayles, Kenneth W
2012-01-01
The most prominent murein hydrolase of Staphylococcus aureus, AtlA, is a bifunctional enzyme that undergoes proteolytic cleavage to yield two catalytically active proteins, an amidase (AM) and a glucosaminidase (GL). Although the bifunctional nature of AtlA has long been recognized, most studies have focused on the combined functions of this protein in cell wall metabolism and biofilm development. In this study, we generated mutant derivatives of the clinical S. aureus isolate, UAMS-1, in which one or both of the AM and GL domains of AtlA have been deleted. Examination of these strains revealed that each mutant exhibited growth rates comparable to the parental strain, but showed clumping phenotypes and lysis profiles that were distinct from the parental strain and each other, suggesting distinct roles in cell wall metabolism. Given the known function of autolysis in the release of genomic DNA for use as a biofilm matrix molecule, we also tested the mutants in biofilm assays and found both AM and GL necessary for biofilm development. Furthermore, the use of enzymatically inactive point mutations revealed that both AM and GL must be catalytically active for S. aureus to form a biofilm. The results of this study provide insight into the relative contributions of AM and GL in S. aureus and demonstrate the contribution of Atl-mediated lysis in biofilm development.
Artérias das glândulas adrenais em avestruzes (Struthio camelus
Directory of Open Access Journals (Sweden)
Angelita das Graças de Oliveira Honorato
2011-10-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n1p125 O crescimento da criação racional de avestruz e seus subprodutos têm despertado interesse dos pesquisadores em ampliar os estudos com esse animal. Assim, áreas de pesquisa básicas, como a morfologia, tornam-se necessárias para dar subsídios às áreas aplicadas. Com o intuito de contribuir com o conhecimento referente aos arranjos vasculares das glândulas adrenais, utilizaram-se 30 avestruzes (Struthio camelus, de quatro dias de vida, tendo seus contingentes arteriais marcados com solução aquosa corada de Neoprene Látex “450” a 50% e fixados em solução diluída de formol a 10%. A cavidade celomática foi exposta para a identificação das referidas glândulas, que são órgãos pares e encontram-se recobertas por tecido conjuntivo frouxo, disposto simetricamente nos dois antímeros, lateralmente à aorta descendente, caudalmente aos pulmões e cranio-medialmente aos lobos craniais dos rins. O aporte sanguíneo arterial, em ambos os antímeros, é proveniente das artérias adrenais direita e esquerda, dos ramos das artérias renais craniais direita e esquerda e dos ramos diretos da aorta descendente. Independentemente da origem, os números de ramos destinados às glândulas adrenais variaram de um a dois e de um a três respectivamente para os antímeros esquerdo e direito.
Duvall, Brian Edward
Interest in small unmanned aerial vehicles has increased dramatically in recent years. Hybrid vehicles which allow forward flight as a fixed wing aircraft and a true vertical landing capability have always had applications. Management of the available energy and noise associated with electric propeller propulsion systems presents many challenges. NASA Langley has developed the Greased Lightning 10 (GL-10) vertical takeoff, unmanned aerial vehicle with ten individual motors and propellers. All are used for propulsion during takeoff and contribute to acoustic noise pollution which is an identified nuisance to the surrounding users. A propeller test capability was developed to gain an understanding of how the noise can be reduced while meeting minimum thrust requirements. The designed propeller test stand allowed for various commercially available propellers to be tested for potential direct replacement of the current GL-10 propellers and also supported testing of a newly designed propeller provided by the Georgia Institute of Technology. Results from the test program provided insight as to which factors affect the noise as well as performance characteristics. The outcome of the research effort showed that the current GL-10 propeller still represents the best choice of all the candidate propellers tested.
Learning Three.js the JavaScript 3D library for WebGL
Dirksen, Jos
2015-01-01
If you know JavaScript and want to start creating 3D graphics that run in any browser, this book is a great choice for you. You don't need to know anything about math or WebGL; all that you need is general knowledge of JavaScript and HTML.
Directory of Open Access Journals (Sweden)
Nilton Di Chiacchio
2012-06-01
Full Text Available The glomus tumor is an uncommon benign neoplasm of glomus cells. In the majority of the cases it is presented as a solitary painful papule in the subungual region. We report a rare case of a patient with two individual synchronous glomus tumors under the nail bed of the same finger.O tumor glômico é uma neoplasia benigna de células glômicas. Na maioria dos casos se apresenta como uma pápula solitária dolorosa na região subungueal. Relatamos o caso raro de um paciente com dois tumores glômicos sincrônicos sob o leito ungueal do mesmo dedo.
Directory of Open Access Journals (Sweden)
Barbosa, Renata Pereira de Sousa et al.
2005-01-01
Full Text Available Este trabalho objetivou identificar a ocorrência de neoplasias malignas em glândulas salivares de pacientes dos hospitais de referência no tratamento de Câncer do Estado da Paraíba no período de 1998 a 2003. Foi realizado um estudo retrospectivo pelo método indireto, através da análise de 914 prontuários arquivados do Hospital Dr. Napoleão Laureano, em João Pessoa-PB, e do Centro de Cancerologia Ulisses Pinto, em Campina Grande-PB. Encontrou-se 29 casos de neoplasias malignas de glândulas salivares, dos quais 53,6% acometeram indivíduos do gênero masculino e 46,4% do feminino; a faixa etária com maior número de casos foi de 61-80 anos com 48,3%. A glândula parótida apresentou maior prevalência com 48,3%, sendo o tipo neoplásico com maior representação da amostra o Carcinoma adenóide cístico com 58,6%
International Nuclear Information System (INIS)
Nguyen Anh Ky; Stoilova, N.I.
1994-11-01
The construction approach proposed in the previous paper Ref.1 allows us there and in the present paper to construct at generic deformation parameter q all finite-dimensional representations of the quantum Lie superalgebra U q [gl(2/2)]. The finite-dimensional U q [gl(2/2)]-modules W q constructed in Ref.1 are either irreducible or indecomposable. If a module W q is indecomposable, i.e. when the condition (4.41) in Ref.1 does not hold, there exists an invariant maximal submodule of W q , to say I q k , such that the factor-representation in the factor-module W q /I q k is irreducible and called nontypical. Here, in this paper, indecomposable representations and nontypical finite-dimensional representations of the quantum Lie superalgebra U q [gl(2/2)] are considered and classified as their module structures are analyzed and the matrix elements of all nontypical representations are written down explicitly. (author). 23 refs
Learning game physics with Bullet Physics and OpenGL
Dickinson, Chris
2013-01-01
A comprehensive set of straight-forward, easy-to-follow tutorials in OpenGL and Bullet Physics that will teach you how modern game physics and 3D graphics work.If you're a beginner or intermediate programmer with a basic understanding of 3D mathematics, and you want a stronger foundation in 3D graphics and physics, then this book is perfect for you! You'll even learn some of the fundamental concepts in 3D mathematics and software design that lies beneath them both, discovering some techniques and tricks in graphics and physics that you can use in any game development project.
Form factors in quantum integrable models with GL(3)-invariant R-matrix
Energy Technology Data Exchange (ETDEWEB)
Pakuliak, S., E-mail: pakuliak@theor.jinr.ru [Laboratory of Theoretical Physics, JINR, 141980 Dubna, Moscow Reg. (Russian Federation); Moscow Institute of Physics and Technology, 141700 Dolgoprudny, Moscow Reg. (Russian Federation); Institute of Theoretical and Experimental Physics, 117259 Moscow (Russian Federation); Ragoucy, E., E-mail: eric.ragoucy@lapth.cnrs.fr [Laboratoire de Physique Théorique LAPTH, CNRS and Université de Savoie, BP 110, 74941 Annecy-le-Vieux Cedex (France); Slavnov, N.A., E-mail: nslavnov@mi.ras.ru [Steklov Mathematical Institute, Moscow (Russian Federation)
2014-04-15
We study integrable models solvable by the nested algebraic Bethe ansatz and possessing GL(3)-invariant R-matrix. We obtain determinant representations for form factors of off-diagonal entries of the monodromy matrix. These representations can be used for the calculation of form factors and correlation functions of the XXX SU(3)-invariant Heisenberg chain.
2010-01-01
... garnishment of the remuneration for employment due from the United States are listed in appendix A to part 581..., (Civilian Personnel Policy/Director of Civilian Personnel), 111 Army Pentagon, Washington, DC 20310-0111... Management Director, 6508 Dogwood Parkway, Suite E, Jackson, MS 39213, (601) 965-4140 Human Resources...
Directory of Open Access Journals (Sweden)
L. Cárdenas-Camarena
2012-03-01
Full Text Available La mejoría del contorno glúteo y de caderas en un paciente varón que desea un contorno femenino es difícil de conseguir cuando no es posible disponer de una cantidad de grasa suficiente para inyectar y lograr una mejoría integral. Presentamos la técnica quirúrgica utilizada en un paciente transexual masculino que había tenido dos intentos fallidos de feminizar su contorno de glúteos y caderas. Utilizamos implantes ovales de silicona cohesiva, tanto para la región glútea como para las caderas, inyectando grasa en las áreas de transición entre los dos implantes. Con esta combinación obtuvimos un contorno femenino integral, eliminando por completo el aspecto masculino de la región glúteo-trocantérea. En conclusión, pensamos que la combinación empleada supone una opción novedosa y no descrita hasta el momento para el tratamiento de pacientes transexuales que buscan un contorno glúteo más femenino de forma integral, con resultados predecibles y muy gratificantes, que mejora las deficiencias que los pacientes masculinos tienen en esta zona en comparación con el contorno de los glúteos femeninos.Improvement of the gluteal and hip contour in patients seeking a more feminine shape is difficult to achieve, specially for those who don't have enough fat to transfer from other areas of the body. We describe the surgical technique used to improve hips and buttocks contour in a genetic male transsexual. This patient previously underrwent two unsuccessful surgeries to feminize his hip and buttock contour. Our successful approach involved the use of an oval-shaped cohesive silicone gel implants placed in both, the hip and buttock areas, along with fat injection in the areas between the two implants. A natural, feminine contour was achieved using the combination of buttock and hip implants with lipofilling using patient's own fat. These procedures completely eliminated the male contour previously noted in the gluteal trochanteric region
Millisecond accuracy video display using OpenGL under Linux.
Stewart, Neil
2006-02-01
To measure people's reaction times to the nearest millisecond, it is necessary to know exactly when a stimulus is displayed. This article describes how to display stimuli with millisecond accuracy on a normal CRT monitor, using a PC running Linux. A simple C program is presented to illustrate how this may be done within X Windows using the OpenGL rendering system. A test of this system is reported that demonstrates that stimuli may be consistently displayed with millisecond accuracy. An algorithm is presented that allows the exact time of stimulus presentation to be deduced, even if there are relatively large errors in measuring the display time.
Zhao, Yue; Sun, Yang; Ding, Youxiang; Wang, Xiaoping; Zhou, Yuxin; Li, Wenjun; Huang, Shaoliang; Li, Zhiyu; Kong, Lingyi; Guo, Qinglong; Lu, Na
2015-09-22
GL-V9, a new synthesized flavonoid derivative, has been reported to possess anti-cancer properties in our previous studies. Uncontrolled overproduction of reactive oxygen species (ROS) has been implicated in oxidative damage of inflammatory bowel disease (IBD). In this study, we aimed to investigate the protective effect of GL-V9 against dextran sulfate sodium (DSS)-induced colitis. GL-V9 attenuated DSS-induced body weight loss, colon length shortening and colonic pathological damage. GL-V9 also inhibited inflammatory cells infiltration and decreased myeloperoxidase (MPO) and inducible nitric oxide synthase (iNOS) activities. Moreover, GL-V9 inhibited ROS and malondialdehyde (MDA) generation, but enhanced superoxide dismutase (SOD), glutathione (GSH) and total antioxidant capacity. GL-V9 reduced pro-inflammatory cytokines production in serum and colon as well. Mechanically, GL-V9 could increase Trx-1 via activation of AMPK/FOXO3a to suppress DSS-induced colonic oxidative stress. Furthermore, GL-V9 decreased pro-inflammatory cytokines and ROS production and increased the antioxidant defenses in the mouse macrophage cells RAW264.7 by promoting Trx-1 expression. In conclusion, our study demonstrated that GL-V9 attenuated DSS-induced colitis against oxidative stress by up-regulating Trx-1 via activation of AMPK/FOXO3a pathway, suggesting that GL-V9 might be a potential effective drug for colitis.
GJ 3236: A NEW BRIGHT, VERY LOW MASS ECLIPSING BINARY SYSTEM DISCOVERED BY THE MEARTH OBSERVATORY
International Nuclear Information System (INIS)
Irwin, Jonathan; Charbonneau, David; Berta, Zachory K.; Quinn, Samuel N.; Latham, David W.; Torres, Guillermo; Blake, Cullen H.; Burke, Christopher J.; Esquerdo, Gilbert A.; Fueresz, Gabor; Mink, Douglas J.; Nutzman, Philip; Szentgyorgyi, Andrew H.; Calkins, Michael L.; Falco, Emilio E.; Bloom, Joshua S.; Starr, Dan L.
2009-01-01
We report the detection of eclipses in GJ 3236, a bright (I = 11.6), very low mass binary system with an orbital period of 0.77 days. Analysis of light and radial velocity curves of the system yielded component masses of 0.38 ± 0.02 M sun and 0.28 ± 0.02 M sun . The central values for the stellar radii are larger than the theoretical models predict for these masses, in agreement with the results for existing eclipsing binaries, although the present 5% observational uncertainties limit the significance of the larger radii to approximately 1σ. Degeneracies in the light curve models resulting from the unknown configuration of surface spots on the components of GJ 3236 currently dominate the uncertainties in the radii, and could be reduced by obtaining precise, multiband photometry covering the full orbital period. The system appears to be tidally synchronized and shows signs of high activity levels as expected for such a short orbital period, evidenced by strong Hα emission lines in the spectra of both components. These observations probe an important region of mass-radius parameter space around the predicted transition to fully convective stellar interiors, where there are a limited number of precise measurements available in the literature.
Influência do consumo de etanol nas glândulas salivares
Directory of Open Access Journals (Sweden)
Carrard, Vinicius Coelho et al.
2007-01-01
Full Text Available Objetivos: Realizar uma revisão da literatura sobre os efeitos do consumo de etanol nas glândulas salivares. Fonte de dados: Foi realizada uma busca no banco de dados Medline, utilizando as palavras alcohol/ ethanol, salivary glands. Síntese dos dados: Tem sido observada na população uma elevação no consumo de bebidas alcoólicas pela população, ocasionando alterações em diversos sistemas. Aumento de volume das glândulas salivares e redução do fluxo salivar são freqüentes em indivíduos alcoolistas. Como a saliva tem propriedades protetoras, a redução do fluxo torna a boca mais suscetível a injúrias, como as relacionadas à cárie e à periodontite. Podem ser observadas alterações morfológicas, como acúmulo de tecido adiposo, hiperplasia dos ductos e redução da proporção de células acinares. O consumo de etanol é responsável ainda pela redução dos níveis de imunoglobulinas presentes na saliva. A degradação do etanol gera metabólitos tóxicos, como o acetaldeído, que podem modificar a função das glândulas salivares. Existe a possibilidade de a saliva redistribuir o acetaldeído na boca, potencializando o dano produzido pelo consumo de etanol. Além disso, outros mecanismos podem estar presentes, como redução das prostaglandinas, desnutrição, alterações do sistema imune e estresse oxidativo, este último envolvido na patogênese de uma série de doenças crônico-degenerativas, entre elas o câncer. Conclusões: Os pacientes alcoolistas devem receber uma atenção especial em relação aos cuidados bucais, pois suas condições locais e sistêmicas os tornam mais suscetíveis a doenças da boca, como cárie, periodontite e câncer.
Directory of Open Access Journals (Sweden)
TEDRUS Guilherme de A. S.
2001-01-01
Full Text Available Farinhas de arroz e de aveia e amido de trigo foram adicionados de vital glúten e avaliados pelo Teste de Panificação. Usou-se como padrão uma amostra de farinha de trigo com características adequadas para produção de pão. Os níveis de adição de vital glúten foram de 10, 15, 17,5, 20 e 30% para a farinha de arroz e de 10, 20 e 30% para a farinha de aveia. Ao amido de trigo, extraído da farinha de trigo utilizada como padrão, foi adicionado vital glúten de forma a reconstituir o teor de glúten original da farinha. Os melhores resultados do teste de panificação foram obtidos com 17,5% de vital glúten na farinha de arroz e 20% de vital glúten na farinha de aveia. Foram obtidos pães com volumes específicos inferiores aos de trigo (2,67cm³/g para vital glúten + farinha de arroz, 3,07cm³/g para vital glúten + farinha de aveia e 4,14cm³/g para vital glúten + amido de trigo contra 5,15cm³/g para os de farinha de trigo. As melhores misturas foram analisadas quanto às suas características reológicas e comparadas com a farinha de trigo original. A mistura de amido de trigo e vital glúten apresentou características farinográficas extensográficas inferiores à farinha de trigo e deu origem a pães de menor volume e com estrutura compacta. No geral, a adição de vital glúten propiciou a obtenção de pães com características aceitáveis, embora inferiores às do pão de farinha de trigo. As características dos pães contendo vital glúten foram: pouca simetria e quebra praticamente inexistente. São necessários novos estudos sobre a interação do vital glúten com os demais componentes da farinha de trigo e sua influência na qualidade do produto final.
Tratamento das cavidades anoftálmicas secas com transplante de glândulas salivares labiais
Directory of Open Access Journals (Sweden)
Icaro Soares França
2011-12-01
Full Text Available OBJETIVOS: Estudar os efeitos clínicos da secreção das glândulas salivares labiais na lubrificação das cavidades anoftálmicas secas, avaliar a durabilidade dos resultados e apresentar a técnica do transplante. A aplicação desse procedimento em cavidades anoftálmicas secas é inédita na literatura. MÉTODOS: Estudo prospectivo das cirurgias de enxertos glândulo-mucosos, compostos pela mucosa labial e glândulas salivares subjacentes, colocados no fórnice conjuntival de 5 pacientes com cavidades anoftálmicas que apresentavam grave xeroftalmia e retração dos fórnices conjuntivais. As cirurgias foram realizadas durante o período de julho/00 a janeiro/09. Dois pacientes já haviam sido tratados previamente com enxertos de mucosa ou de pele. A técnica do procedimento é descrita em detalhes. Os parâmetros que serviram para a análise comparativa dos resultados foram o quadro clínico, o aspecto do revestimento da cavidade, o ressecamento da superfície da prótese e a frequência do uso de colírios lubrificantes. RESULTADOS: Em todos os casos foi constatada a integração do enxerto e a melhora dos parâmetros avaliados. A evolução mostrou persistência e estabilidade dos resultados. CONCLUSÕES: A lubrificação da superfície da cavidade produzida pela secreção salivar mostrou ser eficiente, bem tolerada e constante, resultando maior conforto do uso da prótese. Infere-se que essa melhor lubrificação obtida ajuda a prevenir a evolução do processo de retração da cavidade. O transplante das glândulas salivares labiais para o fórnice conjuntival demonstrou ser um procedimento de fácil execução, acessível a qualquer cirurgião oftalmologista.
LEY 581 DE 2000, O LEY DE CUOTAS, ¿GANAMOS O PERDIMOS?
Directory of Open Access Journals (Sweden)
Natalia Ramírez Bustamante
2007-05-01
Full Text Available Este ensayo presenta dos momentos de lucha de las mujeres por los derechos a la igualdad laboral, y la igualdad en el acceso a las oportunidades de trabajo. El primero de ellos, la lucha librada por las trabajadoras de Bello en 1920; el segundo, la lucha por la adopción como ley y posterior aplicación, de la ley 581 de 2000 o ley de cuotas. Aunque la lucha femenina y feminista2 ha estado encaminada a la consecución de una serie de derechos y garantías, tal vez sea el momento de replantear el camino, es decir, diversificar las metas de los movimientos de mujeres para que los fines no estén constituidos únicamente por la consagración legal de los derechos reclamados. En este orden, la crítica de los derechos de Wendy Brown resulta sugestiva
Morfologia da glândula mamária do quati (Nasua nasua
Directory of Open Access Journals (Sweden)
Juliana B. Casals
2013-11-01
Full Text Available Nasua nasua é um animal onívoro, encontrado em todo Brasil. A reprodução da espécie ocorre somente uma vez ao ano, na primavera. As fêmeas são matriarcas e amamentam suas crias até os 5 meses de idade, vivem com seus filhotes em bandos de até 30 indivíduos. Para descrição morfológica da glândula mamaria do Nasua nasua foram utilizados seis animais provenientes do Criatório Cientifico (Cecrimpas, Unifeob. Autorizado pelo Ibama (Proc.02027.002322/98-99. Para análise macroscópica um animal foi injetado com látex neoprene, sendo a artéria femoral injetada com látex de cor vermelha e a veia jugular de cor azul. Os demais animais foram fixados em solução aquosa a 10% de formaldeído. Para análise microscópica, fragmentos glandulares foram coletados e submetidos ao processo rotineiro, embebido em parafina e corados com Hematoxilina e Eosina, Picrossírius e Azul de Toluidina. Macroscopicamente foram evidenciados três pares de glândulas mamárias, sendo dois pares posicionados na região abdominal e um par na região inguinal. Microscopicamente, notou-se epitélio de revestimento externo das papilas mamárias, epitélio pavimentoso estratificado queratinizado, o qual seguia por toda glândula de forma irregular. Na entrada do óstio, o epitélio da epiderme era modificado ocorrendo uma transição de epitélio pavimentoso estratificado para um epitélio cúbico no ducto papilar. O parênquima glandular era caracteristicamente túbulo alveolar com células secretoras, evidenciado principalmente no animal lactente. Os resultados macroscópicos e microscópicos assemelham-se aos já descritos nas cadelas (Canis familiaris e os do Procyon cancrivorus pertencente à mesma família do quati, Família Procyonidae.
Directory of Open Access Journals (Sweden)
Caridad Verdecia Cañizares
2009-03-01
Full Text Available INTRODUCCIÓN. El objetivo de la presente publicación fue comunicar los casos detectados en nuestro estudio de anomalías estructurales de la glándula tiroidea en pacientes que recibieron radioterapia para el tratamiento de tumores malignos de cabeza y cuello. MÉTODOS. Se realizó un estudio descriptivo de corte transversal para determinar la prevalencia de alteraciones estructurales de la glándula tiroides en 43 pacientes sobrevivientes de tumores malignos de cabeza y cuello, que habían recibido radioterapia y que fueron atendidos en los Hospitales Pediátricos Docentes «William Soler» y «Juan Manuel Márquez» en un período de 10 años (1990 a 2000. RESULTADOS. La alteración estructural de la glándula tiroides más frecuente fue la fibrosis glandular (18,5 %, seguida del adenoma tiroideo y de quistes simples de la glándula (11,1 % respectivamente. Hubo 2 casos de carcinoma diferenciado de la glándula tiroides (7,4 % y uno de lesión mixta adenofolicular (3,7 %. La citología aspirativa con aguja fina permitió la detección de la mayoría de estas lesiones y posibilitó, guiada por ecografía, la detección de lesiones intraparenquimatosas de la glándula. El tratamiento de las alteraciones encontradas fue quirúrgico y se practicó tiroidectomía total a los dos pacientes con carcinoma diferenciado de la glándula tiroides, tiroidectomía subtotal a los tres pacientes con quistes de la glándula y adenomas tiroideos. En los casos de fibrosis glandular se detectó hipofunción tiroidea concomitante, por tanto se administró tratamiento sustitutivo con levotiroxina. CONCLUSIONES. La citología aspirativa con aguja fina guiada mediante ecografía de la glándula tiroides permitió diagnosticar alteraciones estructurales no detectadas en el examen físico. La patología maligna más irradiada correspondió a los linfomas no Hodgkin. Cuanto mayor es la dosis de irradiación, mayor es la patología tiroidea.INTRODUCTION: The aim of
Development of a Relap based Nuclear Plant Analyser with 3-D graphics using OpenGL and Object Relap
International Nuclear Information System (INIS)
Lee, Young Jin
2010-01-01
A 3-D Graphic Nuclear Plant Analyzer (NPA) program was developed using GLScene and the TRelap. GLScene is an OpenGL based 3D graphics library for the Delphi object-oriented program language, and it implements the OpenGL functions in forms suitable for programming with Delphi. TRelap is an object wrapper developed by the author to easily implement the Relap5 thermal hydraulic code under object oriented programming environment. The 3-D Graphic NPA was developed to demonstrate the superiority of the object oriented programming approach in developing complex programs
Qi, Lan; Ding, Yingbin; Zheng, Xiaoming; Xu, Rui; Zhang, Lizhen; Wang, Yanyan; Wang, Xiaoning; Zhang, Lifang; Cheng, Yunlian; Qiao, Weihua; Yang, Qingwen
2018-04-19
A wild rice QTL qGL12.2 for grain length was fine mapped to an 82-kb interval in chromosome 12 containing six candidate genes and none was reported previously. Grain length is an important trait for yield and commercial value in rice. Wild rice seeds have a very slender shape and have many desirable genes that have been lost in cultivated rice during domestication. In this study, we identified a quantitative trait locus, qGL12.2, which controls grain length in wild rice. First, a wild rice chromosome segment substitution line, CSSL41, was selected that has longer glume and grains than does the Oryza sativa indica cultivar, 9311. Next, an F 2 population was constructed from a cross between CSSL41 and 9311. Using the next-generation sequencing combined with bulked-segregant analysis and F 3 recombinants analysis, qGL12.2 was finally fine mapped to an 82-kb interval in chromosome 12. Six candidate genes were found, and no reported grain length genes were found in this interval. Using scanning electron microscopy, we found that CSSL41 cells are significantly longer than those of 9311, but there is no difference in cell widths. These data suggest that qGL12.2 is a novel gene that controls grain cell length in wild rice. Our study provides a new genetic resource for rice breeding and a starting point for functional characterization of the wild rice GL gene.
Vascularização das glândulas adrenais em galinhas da linhagem NPK (Gallus gallus domesticus
Directory of Open Access Journals (Sweden)
Vanessa Coutinho do Amaral
2004-11-01
Full Text Available Com o objetivo de contribuir com o conhecimento referente aos arranjos vasculares viscerais, que freqüentemente mostram suficientes variações para diferenciação entre famílias e ordens, utilizamos 34 galinhas da linhagem NPK, com idade aproximada de 10 semanas, eutanasiadas com dose de gás anestésico, tendo marcado seus contingentes arteriais com solução aquosa de Neoprene Látex ¨450¨ a 50 %, corada com corante específico e fixadas em solução aquosa de formol a 10 %, para estudar a vascularização das glândulas adrenais. Assim, os resultados indicam que as glândulas adrenais são órgãos pares, dispostos um em cada antímero, lateralmente à aorta descendente, caudalmente aos pulmões e médio-cranialmente aos rins. Nos dois antímeros, as glândulas adrenais receberam vasos oriundos das artérias adrenais homólogas provenientes da artéria renal cranial e da aorta descendente (ramos diretos. Independentemente da origem, o número de ramos destinados às glândulas adrenais variou de acordo com o antímero, sendo de 1 a 4 para o antímero esquerdo, e de 1 e 3 para o direito. Quanto maior o número de artérias totais e ramos emitidos pelas artérias adrenais contralaterais destinados a um antímero, maior será o número de ramos destinados pelas mesmas ao antímero oposto.
Toeplitz quantization of Kaehler manifolds and gl(N), N [yields] [infinity] limits
Energy Technology Data Exchange (ETDEWEB)
Bordemann, M. (Dept. of Physics, Univ. of Freiburg (Germany)); Meinrenken, E. (Dept. of Mathematics, M.I.T., Cambridge, MA (United States)); Schlichenmaier, M. (Dept. of Mathematics and Computer Science, Univ. of Mannheim (Germany))
1994-10-01
For general compact Kaehler manifolds it is shown that both Toeplitz quantization and geometric quantization lead to a well-defined (by operator norm estimates) classical limit. This generalizes earlier results of the authors and Klimek and Lesniewski obtained for the torus and higher genus Riemann surfaces, respectively. We thereby arrive at an approximation of the Poisson algebra by a sequence of finite-dimensional matrix algebras gl(N), N [yields] [infinity]. (orig.)
Analysis of the effects of 50g/L povidone iodine in conjuncfival sac before cataract surgery
Directory of Open Access Journals (Sweden)
Wen Yang
2013-12-01
Full Text Available AIM: To evaluate the sterilizing effects of 50g/L povidone Iodine used in conjunctival sag before cataract surgery.METHODS: Totally, 58 eyes of 45 cataract patients underwent phacoemulsification aspiration with intraocular lens implantation. The cojunctival sac secretions at three time points(admission, before and after disinfection with povidone iodinewere obtained and then cultured under the same condition and at the same time. The results were observed and identified.RESULTS: At the three points, the positive rate of bacterial culture was 79.3%, 41.9% and 3.4%, respectively. The positive rate significantly reduced gradually. CONCLUSION: The application effect of 50g/L povidone iodine in killing conjunctival sac bacteria is remarkable, which can avoid the postoperative endophthalmitis effectively.
Energy Technology Data Exchange (ETDEWEB)
Yuan, Ying [Department of Radiology, Shanghai Ninth People' s Hospital, Affiliated to JiaoTong University School of Medicine, Shanghai 200011 (China); Kuai, Xin-Ping [Department of Radiology, Changshu Second People' s Hospital, Jiangsu Province 215500 (China); Department of Radiology, Changzheng Hospital, Affiliated to Second Military Medical University, Shanghai 200003 (China); Chen, Xiao-Song [Comprehensive Breast Health Center, Ruijin Hospital Shanghai Jiaotong University School of Medicine, 197 Ruijin Er Road, Shanghai 20025 (China); Tao, Xiao-Feng, E-mail: cjr.taoxiaofeng@vip.163.com [Department of Radiology, Shanghai Ninth People' s Hospital, Affiliated to JiaoTong University School of Medicine, Shanghai 200011 (China)
2013-09-15
Objective: Dynamic contrast enhanced MR imaging (DCE-MRI) allows imaging of the physiology of the microcirculation. The purpose of this study was to determine the diagnostic efficacy of time intensity curve (TIC) and DCE parameters for characterization of orbital masses. Methods: Fifty-nine patients with untreated orbital lesions underwent DCE-MRI before surgery. For each lesion, peak height (PH), maximum enhancement ratio (ER{sub max}), time of peak enhancement (T{sub peak}) and maximum rise slope (Slope{sub max}) were plotted and calculated. Receiver operator characteristics (ROC) analysis was conducted to assess the appropriate cut-off value. Results: All 26 lesions that demonstrated persistent pattern (type-I) TICs were benign. Most of the masses with the washout pattern (type-III) TIC were malignant (10/14), including lymphoma (n = 6) and melanoma (n = 4). The Slope{sub max} of benign lesions was statistically lower than malignant ones, while the ER{sub max} and T{sub peak} values of benign lesions were significantly higher. No statistical difference was found in PH (P = 0.121). The AUC for ER{sub max}, T{sub peak} and Slope{sub max} in differentiating benign orbital lesions from malignant ones were 0.683, 0.837 and 0.738, respectively. In the three DCE parameters, Slope{sub max} cut-off value of 1.10 provided the highest sensitivity of 93.8%; however, the corresponding specificity was low (58.1%). The ER{sub max} cut-off value of 1.37 and T{sub peak} cut-off value of 35.14 respectively offered the best diagnostic performances. Conclusion: DCE-MRI, especially the qualitative TIC pattern and quantitative value of Slope{sub max}, ER{sub max} and T{sub peak}, could be a complementary investigation in distinguishing malignant orbital tumor from benign ones.
Norm of Bethe vectors in models with gl(m|n symmetry
Directory of Open Access Journals (Sweden)
A. Hutsalyuk
2018-01-01
Full Text Available We study quantum integrable models solvable by the nested algebraic Bethe ansatz and possessing gl(m|n-invariant R-matrix. We compute the norm of the Hamiltonian eigenstates. Using the notion of a generalized model we show that the square of the norm obeys a number of properties that uniquely fix it. We also show that a Jacobian of the system of Bethe equations obeys the same properties. In this way we prove a generalized Gaudin hypothesis for the norm of the Hamiltonian eigenstates.
Did A Planet Survive A Post-Main Sequence Evolutionary Event?
Sorber, Rebecca; Jang-Condell, Hannah; Zimmerman, Mara
2018-06-01
The GL86 is star system approximately 10 pc away with a main sequence K- type ~ 0.77 M⊙ star (GL 86A) with a white dwarf ~0.49 M⊙ companion (GL86 B). The system has a ~ 18.4 AU semi-major axis, an orbital period of ~353 yrs, and an eccentricity of ~ 0.39. A 4.5 MJ planet orbits the main sequence star with a semi-major axis of 0.113 AU, an orbital period of 15.76 days, in a near circular orbit with an eccentricity of 0.046. If we assume that this planet was formed during the time when the white dwarf was a main sequence star, it would be difficult for the planet to have remained in a stable orbit during the post-main sequence evolution of GL86 B. The post-main sequence evolution with planet survival will be examined by modeling using the program Mercury (Chambers 1999). Using the model, we examine the origins of the planet: whether it formed before or after the post-main sequence evolution of GL86B. The modeling will give us insight into the dynamical evolution of, not only, the binary star system, but also the planet’s life cycle.
Directory of Open Access Journals (Sweden)
Vítor Sousa
2006-05-01
Full Text Available Os tumores glómicos são tumores perivasculares cujas células se assemelham a células musculares lisas modificadas do corpo glómico. São mais frequentes na região subungueal e raros no pulmão. Os autores apresentam um caso de uma doente de 62 anos, com toracalgia esquerda e dispneia para grandes esforços. Apresentava nódulo solitário localizado ao segmento basal-externo do LIE, com 1,9 cm de diâmetro, de limites bem definidos, consistência firme e superfície de secção nodular e branco-rosada. Os tumores glómicos são geralmente benignos. Podem ter origem em células glómicas ectópicas ou diferenciarem-se a partir de células não glómicas. Devem ser classificados em tumor glómico, glomangioma ou glomangiomioma de acordo com a abundância relativa de células glómicas, do componente vascular e muscular. Estão descritas metástases pulmonares de tumores glómicos malignos, sendo necessário excluir origem primária extra-pulmonar nesses casos. O diagnóstico diferencial dos tumores glómicos do pulmão inclui o carcinóide, hemangiopericitoma, tumores musculares lisos (leiomioma epitelióide e o paraganglioma.Glomic tumours are perivascular tumours whose cells resemble modified smooth muscular cells of the glomic body. They are more frequent in the subungueal region and rare in the lung. The authors present a case of a 62 year old women with left thoracic pain and great enforces dyspnoea. She presented a solitary nodule in the external basal segment of the LLL, 1.9 cm diameter, circumscribed, firm and with nodular whitish rose cut surface. Glomic tumours are generally benign. They may origin in ectopic glomic cells or be differentiated from non glomic cells. They should be classified as glomic tumor, glomangioma and glomangiomioma according to the relative abundance of glomic cells and of the vascular and muscular components. Pulmonary metastasis of malignant glomic tumours have been described. In these cases an extra
Gauge invariance and the κ-gl relation
International Nuclear Information System (INIS)
Arima, A; Bentz, W; Enders, J; Richter, A
2005-01-01
The connection between the enhancement factor of the photonuclear E1 sum rule and the orbital angular momentum g-factor of a bound nucleon is discussed in the framework of the Landau-Migdal theory for isospin asymmetric nuclear matter, and compared to empirical informations
Gutman, Julie; Kalilani, Linda; Taylor, Steve; Zhou, Zhiyong; Wiegand, Ryan E.; Thwai, Kyaw L.; Mwandama, Dyson; Khairallah, Carole; Madanitsa, Mwayi; Chaluluka, Ebbie; Dzinjalamala, Fraction; Ali, Doreen; Mathanga, Don P.; Skarbinski, Jacek; Shi, Ya Ping; Meshnick, Steve; ter Kuile, Feiko O.
2015-01-01
Background. The A581G mutation in the gene encoding Plasmodium falciparum dihydropteroate synthase (dhps), in combination with the quintuple mutant involving mutations in both dhps and the gene encoding dihydrofolate reductase (dhfr), the so-called sextuple mutant, has been associated with increased
HTML5 games creating fun with HTML5, CSS3, and WebGL
Seidelin, Jacob
2011-01-01
Discover new opportunities for building 2D and 3D games with HTML5 The newest iteration of HTML, HTML5 can be used with JavaScript, CSS3, and WebGL to create beautiful, unique, engaging games that can be played on the web or mobile devices like the iPad or Android phones. Gone are the days where games were only possible with plugin technologies such as Flash and this cutting-edge book shows you how to utilize the latest open web technologies to create a game from scratch using Canvas, HTML5 Audio, WebGL, and WebSockets. You'll discover how to build a framework on which you will create your HTML5 game. Then each successive chapter covers a new aspect of the game, including user input, sound, multiplayer functionality, 2D and 3D graphics, and more. Aims directly at a new way to develop games for the web through the use of HTML5 Demonstrates how to make iOS and Android web apps Explains how to capture player input; create 3D graphics; and incorporate textures, lighting, and sound Guides you through the proce...
The solar neighborhood. XXXIV. A search for planets orbiting nearby M dwarfs using astrometry
International Nuclear Information System (INIS)
Lurie, John C.; Henry, Todd J.; Ianna, Philip A.; Jao, Wei-Chun; Quinn, Samuel N.; Winters, Jennifer G.; Koerner, David W.; Riedel, Adric R.; Subasavage, John P.
2014-01-01
Astrometric measurements are presented for seven nearby stars with previously detected planets: six M dwarfs (GJ 317, GJ 667C, GJ 581, GJ 849, GJ 876, and GJ 1214) and one K dwarf (BD-10 -3166). Measurements are also presented for six additional nearby M dwarfs without known planets, but which are more favorable to astrometric detections of low mass companions, as well as three binary systems for which we provide astrometric orbit solutions. Observations have baselines of 3 to 13 years, and were made as part of the RECONS long-term astrometry and photometry program at the CTIO/SMARTS 0.9 m telescope. We provide trigonometric parallaxes and proper motions for all 16 systems, and perform an extensive analysis of the astrometric residuals to determine the minimum detectable companion mass for the 12 M dwarfs not having close stellar secondaries. For the six M dwarfs with known planets, we are not sensitive to planets, but can rule out the presence of all but the least massive brown dwarfs at periods of 2–12 years. For the six more astrometrically favorable M dwarfs, we conclude that none have brown dwarf companions, and are sensitive to companions with masses as low as 1 M Jup for periods longer than two years. In particular, we conclude that Proxima Centauri has no Jovian companions at orbital periods of 2–12 years. These results complement previously published M dwarf planet occurrence rates by providing astrometrically determined upper mass limits on potential super-Jupiter companions at orbits of two years and longer. As part of a continuing survey, these results are consistent with the paucity of super-Jupiter and brown dwarf companions we find among the over 250 red dwarfs within 25 pc observed longer than five years in our astrometric program.
The solar neighborhood. XXXIV. A search for planets orbiting nearby M dwarfs using astrometry
Energy Technology Data Exchange (ETDEWEB)
Lurie, John C. [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); Henry, Todd J.; Ianna, Philip A. [RECONS Institute, Chambersburg, PA 17201 (United States); Jao, Wei-Chun; Quinn, Samuel N.; Winters, Jennifer G. [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30302 (United States); Koerner, David W. [Department of Physics and Astronomy, Northern Arizona University, Flagstaff, AZ 86011 (United States); Riedel, Adric R. [Department of Astrophysics, American Museum of Natural History, New York, NY 10034 (United States); Subasavage, John P., E-mail: lurie@uw.edu [United States Naval Observatory, Flagstaff, AZ 86001 (United States)
2014-11-01
Astrometric measurements are presented for seven nearby stars with previously detected planets: six M dwarfs (GJ 317, GJ 667C, GJ 581, GJ 849, GJ 876, and GJ 1214) and one K dwarf (BD-10 -3166). Measurements are also presented for six additional nearby M dwarfs without known planets, but which are more favorable to astrometric detections of low mass companions, as well as three binary systems for which we provide astrometric orbit solutions. Observations have baselines of 3 to 13 years, and were made as part of the RECONS long-term astrometry and photometry program at the CTIO/SMARTS 0.9 m telescope. We provide trigonometric parallaxes and proper motions for all 16 systems, and perform an extensive analysis of the astrometric residuals to determine the minimum detectable companion mass for the 12 M dwarfs not having close stellar secondaries. For the six M dwarfs with known planets, we are not sensitive to planets, but can rule out the presence of all but the least massive brown dwarfs at periods of 2–12 years. For the six more astrometrically favorable M dwarfs, we conclude that none have brown dwarf companions, and are sensitive to companions with masses as low as 1 M{sub Jup} for periods longer than two years. In particular, we conclude that Proxima Centauri has no Jovian companions at orbital periods of 2–12 years. These results complement previously published M dwarf planet occurrence rates by providing astrometrically determined upper mass limits on potential super-Jupiter companions at orbits of two years and longer. As part of a continuing survey, these results are consistent with the paucity of super-Jupiter and brown dwarf companions we find among the over 250 red dwarfs within 25 pc observed longer than five years in our astrometric program.
A new anti-glioma therapy, AG119: pre-clinical assessment in a mouse GL261 glioma model.
Towner, Rheal A; Ihnat, Michael; Saunders, Debra; Bastian, Anja; Smith, Nataliya; Pavana, Roheeth Kumar; Gangjee, Aleem
2015-07-17
High grade gliomas (HGGs; grades III and IV) are the most common primary brain tumors in adults, and their malignant nature ranks them fourth in incidence of cancer death. Standard treatment for glioblastomas (GBM), involving surgical resection followed by radiation and chemotherapy with temozolomide (TMZ) and the anti-angiogenic therapy bevacizumab, have not substantially improved overall survival. New therapeutic agents are desperately needed for this devastating disease. Here we study the potential therapeutic agent AG119 in a pre-clinical model for gliomas. AG119 possesses both anti-angiogenic (RTK inhibition) and antimicrotubule cytotoxic activity in a single molecule. GL261 glioma-bearing mice were either treated with AG119, anti-VEGF (vascular endothelial growth factor) antibody, anti c-Met antibody or TMZ, and compared to untreated tumor-bearing mice. Animal survival was assessed, and tumor volumes and vascular alterations were monitored with morphological magnetic resonance imaging (MRI) and perfusion-weighted imaging, respectively. Percent survival of GL261 HGG-bearing mice treated with AG119 was significantly higher (p mouse GL261 glioma model, and that AG119 is also not subject to methyl guanine transferase (MGMT) mediated resistance, as is the case with TMZ, indicating that AG119 may be potentially useful in treating resistant gliomas.
Morfologia e vascularização arterial das glândulas tireóides em gansos domésticos
Directory of Open Access Journals (Sweden)
Cheston César Honorato Pereira
2006-04-01
Full Text Available Objetivou-se estudar a morfologia e o comportamento das artérias que se destinam às glândulas tireóides, abordando seu número, origem e ordenação em 30 gansos domésticos (Anser domestica, injetados com Neoprene látex 450 corado e fixados em solução aquosa de formalina a 10%. As glândulas tireóides apresentam-se pares, ovóides e localizam-se na extremidade cranial da cavidade tóraco-abdominal, relacionam-se com o nervo vago, veia jugular e artéria carótida comum, e possuem em média de 0,97; 0,69 e 0,43 cm no antímero direito e 1,04; 0,62 e 0,38 cm no antímero esquerdo, para comprimento, largura e espessura, respectivamente. As glândulas tireóides recebem colaterais das artérias: carótida comum, cervical cutânea ascendente, esofagotraqueobronquial, esofágica ascendente, comum do nervo vago ipsilateralmente e ramo esofágico, sendo estes dois últimos somente para a glândula direita. O número de vasos variou de 1 a 5 vasos, sendo 2 vasos (15 casos, 50% ± 10 para o antímero direito e 3 vasos (12 casos, 40% ± 9,8 para o antímero esquerdo, o padrão mais freqüentemente observado. As artérias tireóideas cranial, média cranial, média, média caudal e caudal estiveram presentes no antímero direito em 29, 8, 8, 14 e 29 gansos respectivamente, e no antímero esquerdo em 28, 5, 14, 5 e 28 gansos respectivamente. Um único ramo, a artéria tireóidea, destinou-se a glândula em um animal à direita e em dois animais a esquerda.
The two-parameter deformation of GL(2), its differential calculus, and Lie algebra
International Nuclear Information System (INIS)
Schirrmacher, A.; Wess, J.
1991-01-01
The Yang-Baxter equation is solved in two dimensions giving rise to a two-parameter deformation of GL(2). The transformation properties of quantum planes are briefly discussed. Non-central determinant and inverse are constructed. A right-invariant differential calculus is presented and the role of the different deformation parameters investigated. While the corresponding Lie algebra relations are simply deformed, the comultiplication exhibits both quantization parameters. (orig.)
Linfoma tipo MALT de la glándula parótida Lymphoma type MALT of the parotid gland
Directory of Open Access Journals (Sweden)
Carlos Frómeta Neira
2010-09-01
Full Text Available Los linfomas tipo MALT (tejido linfoideo asociado a mucosa, constituyen la variedad más recientemente descubierta de los linfomas no Hodgkin, tienen lugar fundamentalmente en la mucosa gástrica asociados a infección por Helycobacter pylori, y en la glándula tiroides en relación con la tiroiditis de Hashimoto. Sin embargo, internacionalmente se han descrito casos en glándulas salivales asociados a linfoadenitis. La naturaleza de la lesión a menudo no puede ser determinada solo por el estudio citológico; se hace necesario el análisis histopatológico para el diagnóstico definitivo en la mayoría de los casos. El presente estudio muestra un paciente masculino con aumento de volumen bilateral de ambas glándulas parótidas y diagnóstico citohistopatológico de un proceso linfoepitelial benigno, el cual desarrolló un linfoma tipo MALT en relación con la glándula parótida derecha.The lymphomas type MALT or the mucosa-associated lymphoid tissue, are the most recent variety of non-Hodgkin lymphomas present mainly in the gastric mucosa associated with Helycobacter pylori infection and in the thyroid gland in relation to Hashimoto's thyroiditis. Frequently the origin of this lesion can't be determined only by cytology study, thus it is necessary the histopathology analysis for a definitive diagnosis in most cases. Present paper includes the case of male patient with bilateral volume increase of both parotid glands and a diagnosis cytopathological of a benign lymphoepithelial process and the development of a type MALT lymphoma in relation to the right parotid gland.
Abscesso cervical gigante provocado por sialolitíase de glândula submandibular
Directory of Open Access Journals (Sweden)
Fernanda Fruet
2016-10-01
Full Text Available Introdução: As infecções cervicais profundas apresentam alta mortalidade, apesar da eficácia da antibioticoterapia atual. Uma das principais complicações é a obstrução das vias aéreas superiores. A principal causa dessas infecções é de origem odontogênica e, raramente, a infecção das glândulas salivares. Objetivo: Apresentar um caso de abscesso cervical profundo, cuja etiologia rara está associada à sialolitíase com origem em glândula submandibular. Metodologia: O caso foi acompanhado no serviço de Cabeça e Pescoço do Conjunto Hospitalar de Sorocaba (CHS e sua descrição embasada na literatura. Relato de Caso: Paciente iniciou quadro de dor localizada em região submandibular posterior direita, acompanhada de disfagia e dispneia contínua. Procurou atendimento médico na cidade de origem, onde recebeu antibioticoterapia. Evoluiu com insuficiência respiratória, necessitando de transferência para o serviço de emergência do CHS aos cuidados da equipe de Cabeça e Pescoço. Ao exame físico, apresentava edema, abaulamento e hiperemia da lateral direita do pescoço. A Tomografia Computadorizada evidenciou abscesso em espaço retro-faríngeo com compressão da parede posterior da orofaringe e hipofaringe, além de glândula submandibular direita aumentada e imagem de cálculo. Foi realizada a traqueostomia e a resolução cirúrgica por meio da drenagem do abscesso através da incisão transversa em colar. Conclusão: O caso apresentado mostra um abscesso cervical profundo causado por etiologia incomum, a sialolitíase, cujo diagnóstico precoce, seguido do tratamento adequado, poderiam ter evitado a evolução grave do paciente. Neste caso, a drenagem cirúrgica precoce mostra sua importância na prevenção de insuficiência respiratória.
Da-Cruz Triple Tool: cómo hacer simple y precisa la cirugía de implante glúteo intramuscular
Directory of Open Access Journals (Sweden)
Luis Da-Cruz
Full Text Available El Da-Cruz Triple Tool es un instrumento multifuncional diseñado para la colocación de implantes glúteos intramusculares. Tiene 3 funciones; a saber: disector, separador y medidor. Consiste en 2 piezas para su uso articulado o por separado. Como disector logra la profundidad y el grosor deseables del músculo glúteo mayor a través de maniobras precisas que provocan menos trauma; por consiguiente, ayuda a obtener una mejor recuperación y resultados. Al mismo tiempo faculta para elevar los espacios abiertos y controlar adherencias o sangrados. La función de medidor permite calcular la dimensión cefalocaudal y la anchura del espacio para escoger el implante adecuado. Con el entrenamiento adecuado en el uso de esta herramienta y la implementación de medidas pre, trans y postoperatorias bien definidas, cualquier cirujano plástico puede obtener resultados consistentemente exitosos en la colocación de implantes glúteos intramusculares.
The evaluation of GL impact in Physical sciences using bibliometric indicators : preliminary results
Di Cesare, Rosa (CNR); GreyNet, Grey Literature Network Service
1994-01-01
A bibliometric study of the Italian grey literature in SIGLE database. Preliminary results. Given the increasing importance of Grey Literature (GL) for the information and documentation field, it is essential to apply a bibliometric analysis similar to the one widely used for the conventional literature. Study objectives: 1) impact evalutation of grey literature in physical sciences; and 2) differentiation between scientific and non scientific grey literature documents in the same discipline,...
TEDRUS,Guilherme de A. S.; ORMENESE,Rita de Cássia S. Celeste; SPERANZA,Sandra Maria; CHANG,Yoon K.; BUSTOS,Fernando M.
2001-01-01
Farinhas de arroz e de aveia e amido de trigo foram adicionados de vital glúten e avaliados pelo Teste de Panificação. Usou-se como padrão uma amostra de farinha de trigo com características adequadas para produção de pão. Os níveis de adição de vital glúten foram de 10, 15, 17,5, 20 e 30% para a farinha de arroz e de 10, 20 e 30% para a farinha de aveia. Ao amido de trigo, extraído da farinha de trigo utilizada como padrão, foi adicionado vital glúten de forma a reconstituir o teor de glúten...
Cistomatose de glândula apócrina em onça-pintada (Panthera onca
Directory of Open Access Journals (Sweden)
Leonardo Gruchouskei
Full Text Available RESUMO: A cistomatose de glândula apócrina é uma condição rara e não-neoplásica, que tem sido relatada em cães e gatos, e caracterizada por vários grupos de glândulas sudoríparas dilatadas, cuja distribuição generalizada raramente é observada. Uma fêmea de onça-pintada melânica (Panthera onca, com idade estimada de 16 anos e mantida em cativeiro, apresentou aumento de volume abdominal. Ao exame físico foram observados vários nódulos de consistência macia e flutuante, não aderidos, com tamanho de 2 a 15cm de diâmetro, na região ventral abdominal. Outras massas de menor diâmetro (0,5-1,0cm estavam presentes na região cervical e no dorso do animal. Estas massas foram removidas em um procedimento cirúrgico. Dentro deste cisto havia conteúdo líquido, inodoro e translúcido. Microscopicamente, observou-se entre a derme média e profunda a formação de múltiplos cistos de tamanho variável. Esses cistos eram revestidos por uma única camada de células predominantemente cubóides. Em alguns focos eram observadas raras projeções papiliformes de epitélio glandular. O citoplasma estava levemente eosinofílico e com raras imagens de decapitação do ápice. O diagnóstico de cistomatose de glândulas apócrinas foi realizado através dos achados macroscópicos e microscópicos.
Clinical effect of 1g/L anthocyanin eye-patch for mild and moderate dry eye
Directory of Open Access Journals (Sweden)
Ke-Hua Wang
2018-05-01
Full Text Available AIM:To evaluate the clinic efficacy of 1g/L anthocyanin eye-patch for mild and moderate dry eye. METHODS: In this prospective and multicenter study, a total of 320 cases(640 eyeswith mild and moderate dry eye were enrolled from 8 Aier Eye Hospitals in Changsha, Chongqing, Wuhan and so on from October 2016 to April 2017. The patients were assigned to eye patch group(160 casesand artificial tears group(160 casesbased on random number table. The patients in eye-patch group used 1g/L of anthocyanin eye-patch for more than 6h during night sleep, while the patients in artificial tears group used polyvinyl alcohol eye drops for 4 times per day. The evaluation of symptoms and signs were conducted on 1d before the treatment and 14d after the treatment. The evaluation of symptoms adopted the Ocular Surface Disease Index(OSDI, while the observation of signs included tear secretion test(Schirmer Ⅰ test, SⅠt, first noninvasive tear breakup time(NITBUTfas well as average noninvasive tear breakup time(NITBUTavmeasured by Oculus ocular surface analyser. RESULTS: OSDI score, NITBUTf and NITBUTav in the two groups after treatment were significantly improved compared with that before treatment, and the difference had a statistical significance(PP>0.05. There was no significant difference in OSDI score, NITBUTf, NITBUTav and SⅠt between the two groups after treatment(P>0.05.CONCLUSION: The 1g/L anthocyanin eye-patch has similar efficacy with artificial tears for mild and moderate dry eye, which can effectively improve the symptoms and tear film stability.
18 F-FDG PET/CT for planning external beam radiotherapy alters therapy in 11% of 581 patients.
Birk Christensen, Charlotte; Loft-Jakobsen, Annika; Munck Af Rosenschöld, Per; Højgaard, Liselotte; Roed, Henrik; Berthelsen, Anne K
2018-03-01
18 F-FDG PET/CT (FDG PET/CT) used in radiotherapy planning for extra-cerebral malignancy may reveal metastases to distant sites that may affect the choice of therapy. To investigate the role of FDG PET/CT on treatment strategy changes induced by the use of PET/CT as part of the radiotherapy planning. 'A major change of treatment strategy' was defined as either including more lesions in the gross tumour volume (GTV) distant from the primary tumour or a change in treatment modalities. The study includes 581 consecutive patients who underwent an FDG PET/CT scan for radiotherapy planning in our institution in the year 2008. All PET/CT scans were performed with the patient in treatment position with the use of immobilization devices according to the intended radiotherapy treatment. All scans were evaluated by a nuclear medicine physician together with a radiologist to delineate PET-positive GTV (GTV-PET). For 63 of the patients (11%), the PET/CT simulation scans resulted in a major change in treatment strategy because of the additional diagnostic information. Changes were most frequently observed in patients with lung cancer (20%) or upper gastrointestinal cancer (12%). In 65% of the patients for whom the PET/CT simulation scan revealed unexpected dissemination, radiotherapy was given - changed (n = 38) or unchanged (n = 13) according to the findings on the FDG PET/CT. Unexpected dissemination on the FDG PET/CT scanning performed for radiotherapy planning caused a change in treatment strategy in 11% of 581 patients. © 2017 Scandinavian Society of Clinical Physiology and Nuclear Medicine. Published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Kyu-Hong Choi
1990-06-01
Full Text Available The osculating orbital elements include the mean, secular, long period, and short period terms. The iterative algorithm used for conversion of osculating orbital elements to mean orbital elements is described. The mean orbital elements of Wc, Ws, and L are obtained.
Mouriaux, F; Coffin-Pichonnet, S; Robert, P-Y; Abad, S; Martin-Silva, N
2014-12-01
Orbital inflammation is a generic term encompassing inflammatory pathologies affecting all structures within the orbit : anterior (involvement up to the posterior aspect of the globe), diffuse (involvement of intra- and/or extraconal fat), apical (involvement of the posterior orbit), myositis (involvement of only the extraocular muscles), dacryoadenitis (involvement of the lacrimal gland). We distinguish between specific inflammation and non-specific inflammation, commonly referred to as idiopathic inflammation. Specific orbital inflammation corresponds to a secondary localization of a "generalized" disease (systemic or auto-immune). Idiopathic orbital inflammation corresponds to uniquely orbital inflammation without generalized disease, and thus an unknown etiology. At the top of the differential diagnosis for specific or idiopathic orbital inflammation are malignant tumors, represented most commonly in the adult by lympho-proliferative syndromes and metastases. Treatment of specific orbital inflammation begins with treatment of the underlying disease. For idiopathic orbital inflammation, treatment (most often corticosteroids) is indicated above all in cases of visual loss due to optic neuropathy, in the presence of pain or oculomotor palsy. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
PyORBIT: A Python Shell For ORBIT
Energy Technology Data Exchange (ETDEWEB)
Jean-Francois Ostiguy; Jeffrey Holmes
2003-07-01
ORBIT is code developed at SNS to simulate beam dynamics in accumulation rings and synchrotrons. The code is structured as a collection of external C++ modules for SuperCode, a high level interpreter shell developed at LLNL in the early 1990s. SuperCode is no longer actively supported and there has for some time been interest in replacing it by a modern scripting language, while preserving the feel of the original ORBIT program. In this paper, we describe a new version of ORBIT where the role of SuperCode is assumed by Python, a free, well-documented and widely supported object-oriented scripting language. We also compare PyORBIT to ORBIT from the standpoint of features, performance and future expandability.
PyORBIT: A Python Shell For ORBIT
International Nuclear Information System (INIS)
Jean-Francois Ostiguy; Jeffrey Holmes
2003-01-01
ORBIT is code developed at SNS to simulate beam dynamics in accumulation rings and synchrotrons. The code is structured as a collection of external C++ modules for SuperCode, a high level interpreter shell developed at LLNL in the early 1990s. SuperCode is no longer actively supported and there has for some time been interest in replacing it by a modern scripting language, while preserving the feel of the original ORBIT program. In this paper, we describe a new version of ORBIT where the role of SuperCode is assumed by Python, a free, well-documented and widely supported object-oriented scripting language. We also compare PyORBIT to ORBIT from the standpoint of features, performance and future expandability
DEFF Research Database (Denmark)
Aschenbach, W G; Suzuki, Y; Breeden, K
2001-01-01
In skeletal muscle both insulin and contractile activity are physiological stimuli for glycogen synthesis, which is thought to result in part from the dephosphorylation and activation of glycogen synthase (GS). PP1G/R(GL)(G(M)) is a glycogen/sarcoplasmic reticulum-associated type 1 phosphatase...... that was originally postulated to mediate insulin control of glycogen metabolism. However, we recently showed (Suzuki, Y., Lanner, C., Kim, J.-H., Vilardo, P. G., Zhang, H., Jie Yang, J., Cooper, L. D., Steele, M., Kennedy, A., Bock, C., Scrimgeour, A., Lawrence, J. C. Jr., L., and DePaoli-Roach, A. A. (2001) Mol....... Cell. Biol. 21, 2683-2694) that insulin activates GS in muscle of R(GL)(G(M)) knockout (KO) mice similarly to the wild type (WT). To determine whether PP1G is involved in glycogen metabolism during muscle contractions, R(GL) KO and overexpressors (OE) were subjected to two models of contraction...
Orbit Propagation and Determination of Low Earth Orbit Satellites
Directory of Open Access Journals (Sweden)
Ho-Nien Shou
2014-01-01
Full Text Available This paper represents orbit propagation and determination of low Earth orbit (LEO satellites. Satellite global positioning system (GPS configured receiver provides position and velocity measures by navigating filter to get the coordinates of the orbit propagation (OP. The main contradictions in real-time orbit which is determined by the problem are orbit positioning accuracy and the amount of calculating two indicators. This paper is dedicated to solving the problem of tradeoffs. To plan to use a nonlinear filtering method for immediate orbit tasks requires more precise satellite orbit state parameters in a short time. Although the traditional extended Kalman filter (EKF method is widely used, its linear approximation of the drawbacks in dealing with nonlinear problems was especially evident, without compromising Kalman filter (unscented Kalman Filter, UKF. As a new nonlinear estimation method, it is measured at the estimated measurements on more and more applications. This paper will be the first study on UKF microsatellites in LEO orbit in real time, trying to explore the real-time precision orbit determination techniques. Through the preliminary simulation results, they show that, based on orbit mission requirements and conditions using UKF, they can satisfy the positioning accuracy and compute two indicators.
Directory of Open Access Journals (Sweden)
Sumeet Jain
2016-01-01
Full Text Available Squamous cell carcinoma of the eyelid is the second most common malignant neoplasm of the eye with the incidence of 0.09 and 2.42 cases/100 000 people. Orbital invasion is a rare complication but, if recognized early, can be treated effectively with exenteration. Although with advancements in technology such as computer-aided design and computer-aided manufacturing, material science, and retentive methods like implants, orbital prosthesis with stock ocular prosthesis made of methyl methacrylate retained by anatomic undercuts is quiet effective and should not be overlooked and forgotten. This clinical report describes prosthetic rehabilitation of two male patients with polymethyl methacrylate resin orbital prosthesis after orbital exenteration, for squamous cell carcinoma of the upper eyelid. The orbital prosthesis was sufficiently retained by hard and soft tissue undercuts without any complications. The patients using the prosthesis are quite satisfied with the cosmetic results and felt comfortable attending the social events.
Directory of Open Access Journals (Sweden)
Andrej Kansky
2002-12-01
Full Text Available Background. Orbit is involved in 40% of all facial fractures. There is considerable variety in severity, ranging from simple nondisplaced to complex comminuted fractures. Complex comminuted fractures (up to 20% are responsible for the majority of complications and unfavorable results. Orbital fractures are classified as internal orbital fractures, zygomatico-orbital fractures, naso-orbito-ethmoidal fractures and combined fractures. The ophtalmic sequelae of midfacial fractures are usually edema and ecchymosis of the soft tissues, subconjuctival hemorrhage, diplopia, iritis, retinal edema, ptosis, enophthalmos, ocular muscle paresis, mechanical restriction of ocular movement and nasolacrimal disturbances. More severe injuries such as optic nerve trauma and retinal detachments have also been reported. Within the wide range of orbital fractures small group of complex fractures causes most of the sequelae. Therefore identification of severe injuries and adequate treatment is of major importance. The introduction of craniofacial techniques made possible a wide exposure even of large orbital wall defects and their reconstruction by bone grafts. In spite of significant progress, repair of complex orbital wall defects remains a problem even for the experienced surgeons.Results. In 1999 121 facial injuries were treated at our department (Clinical Centre Ljubljana Dept. Of Maxillofacial and Oral Surgery. Orbit was involved in 65% of cases. Isolated inner orbital fractures presented 4% of all fractures. 17 (14% complex cases were treated, 5 of them being NOE, 5 orbital (frame and inner walls, 3 zygomatico-orbital, 2 FNO and 2 maxillo-orbital fractures.Conclusions. Final result of the surgical treatment depends on severity of maxillofacial trauma. Complex comminuted fractures are responsable for most of the unfavorable results and ocular function is often permanently damaged (up to 75% in these fractures.
Gutman, Julie; Kalilani, Linda; Taylor, Steve; Zhou, Zhiyong; Wiegand, Ryan E; Thwai, Kyaw L; Mwandama, Dyson; Khairallah, Carole; Madanitsa, Mwayi; Chaluluka, Ebbie; Dzinjalamala, Fraction; Ali, Doreen; Mathanga, Don P; Skarbinski, Jacek; Shi, Ya Ping; Meshnick, Steve; ter Kuile, Feiko O
2015-06-15
The A581 G: mutation in the gene encoding Plasmodium falciparum dihydropteroate synthase (dhps), in combination with the quintuple mutant involving mutations in both dhps and the gene encoding dihydrofolate reductase (dhfr), the so-called sextuple mutant, has been associated with increased placental inflammation and decreased infant birth weight among women receiving intermittent preventive treatment with sulfadoxine-pyrimethamine (IPTp-SP) during pregnancy. Between 2009 and 2011, delivering women without human immunodeficiency virus infection were enrolled in an observational study of IPTp-SP effectiveness in Malawi. Parasites were detected by polymerase chain reaction (PCR); positive samples were sequenced to genotype the dhfr and dhps loci. The presence of K540 E: in dhps was used as a marker for the quintuple mutant. Samples from 1809 women were analyzed by PCR; 220 (12%) were positive for P. falciparum. A total of 202 specimens were genotyped at codon 581 of dhps; 17 (8.4%) harbored the sextuple mutant. The sextuple mutant was associated with higher risks of patent infection in peripheral blood (adjusted prevalence ratio [aPR], 2.76; 95% confidence interval [CI], 1.82-4.18) and placental blood (aPR 3.28; 95% CI, 1.88-5.78) and higher parasite densities. Recent SP use was not associated with increased parasite densities or placental pathology overall and among women with parasites carrying dhps A581 G: . IPTp-SP failed to inhibit parasite growth but did not exacerbate pathology among women infected with sextuple-mutant parasites. New interventions to prevent malaria during pregnancy are needed urgently. Published by Oxford University Press on behalf of the Infectious Diseases Society of America 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.
Directory of Open Access Journals (Sweden)
Danilo J. Ayres de Menezes
2010-09-01
Full Text Available The morphology of the accessory genital glands of the male agouti was studied in twenty-three animals that were raised in captivity. Twenty animals had their genital glands dissected in situ for macroscopic description. The samples of each gland were recovered, embedded in paraffin, sliced and stained by Hematoxylin-Eosin technique. It was founded four pairs of glands: the vesicular glands, the coagulating glands, the prostate and the bulbourethral glands. Histological characteristics of the vesicular, coagulating and prostate glands showed similar morphology, within the pseudostratified columnar epithelium. The tubulo-alveolar type of the bulbourethral glands showed a lack of connective tissue among the tubules, a small amount of red stained presented it the cytoplasm, and the presence of vacuoles in the tissue. This study concluded that the agouti showed to have similar morphological aspect described in the others species of rodents.A morfologia das glândulas genitais acessórias de cutias foram estudados em 23 animais criados em cativeiros. Vinte animais tiveram suas glândulas genitais dissecadas in situ para as descrições macroscópicas. Para o estudo microscópico foram utilizados três animais. Os fragmentos de cada glândula foram embebidos em parafina, seccionados e corados em hematoxilina e eosina. Foram encontrados quatro pares de glândulas: vesiculares, coaguladoras, próstata e bulbouretrais. As características histológicas da glândula vesicular, coaguladora e próstata mostraram morfologia similar, com epitélio colunar pseudoestratificado. O tipo tuboalveolar da glândula bulbouretral mostrou uma deficiência de tecido conjuntivo, citoplasma pouco corado e presença de vacúolos. Este estudo concluiu que a cutia apresenta as mesmas características morfológicas das glândulas genitais acessórias encontradas em roedores.
Yourshaw, Matthew Stephen
2017-01-01
Orbital is a virtual reality gaming experience designed to explore the use of traditional narrative structure to enhance immersion in virtual reality. The story structure of Orbital was developed based on the developmental steps of 'The Hero's Journey,' a narrative pattern identified by Joseph Campbell. Using this standard narrative pattern, Orbital is capable of immersing the player quickly and completely for the entirety of play time. MFA
Directory of Open Access Journals (Sweden)
Anatoliy Klimyk
2006-01-01
Full Text Available In the paper, properties of orbit functions are reviewed and further developed. Orbit functions on the Euclidean space E_n are symmetrized exponential functions. The symmetrization is fulfilled by a Weyl group corresponding to a Coxeter-Dynkin diagram. Properties of such functions will be described. An orbit function is the contribution to an irreducible character of a compact semisimple Lie group G of rank n from one of its Weyl group orbits. It is shown that values of orbit functions are repeated on copies of the fundamental domain F of the affine Weyl group (determined by the initial Weyl group in the entire Euclidean space E_n. Orbit functions are solutions of the corresponding Laplace equation in E_n, satisfying the Neumann condition on the boundary of F. Orbit functions determine a symmetrized Fourier transform and a transform on a finite set of points.
A new anti-glioma therapy, AG119: pre-clinical assessment in a mouse GL261 glioma model
International Nuclear Information System (INIS)
Towner, Rheal A.; Ihnat, Michael; Saunders, Debra; Bastian, Anja; Smith, Nataliya; Pavana, Roheeth Kumar; Gangjee, Aleem
2015-01-01
High grade gliomas (HGGs; grades III and IV) are the most common primary brain tumors in adults, and their malignant nature ranks them fourth in incidence of cancer death. Standard treatment for glioblastomas (GBM), involving surgical resection followed by radiation and chemotherapy with temozolomide (TMZ) and the anti-angiogenic therapy bevacizumab, have not substantially improved overall survival. New therapeutic agents are desperately needed for this devastating disease. Here we study the potential therapeutic agent AG119 in a pre-clinical model for gliomas. AG119 possesses both anti-angiogenic (RTK inhibition) and antimicrotubule cytotoxic activity in a single molecule. GL261 glioma-bearing mice were either treated with AG119, anti-VEGF (vascular endothelial growth factor) antibody, anti c-Met antibody or TMZ, and compared to untreated tumor-bearing mice. Animal survival was assessed, and tumor volumes and vascular alterations were monitored with morphological magnetic resonance imaging (MRI) and perfusion-weighted imaging, respectively. Percent survival of GL261 HGG-bearing mice treated with AG119 was significantly higher (p < 0.001) compared to untreated tumors. Tumor volumes (21–31 days following intracerebral implantation of GL261 cells) were found to be significantly lower for AG119 (p < 0.001), anti-VEGF (p < 0.05) and anti-c-Met (p < 0.001) antibody treatments, and TMZ-treated (p < 0.05) mice, compared to untreated controls. Perfusion data indicated that both AG119 and TMZ were able to reduce the effect of decreasing perfusion rates significantly (p < 0.05 for both), when compared to untreated tumors. It was also found that IC 50 values for AG119 were much lower than those for TMZ in T98G and U251 cells. These data support further exploration of the anticancer activity AG119 in HGG, as this compound was able to increase animal survival and decrease tumor volumes in a mouse GL261 glioma model, and that AG119 is also not subject to methyl guanine
CHELONI Giulia
2013-01-01
Lipid oxidation is a recognized end point for the study of oxidative stress and is an important parameter to describe the mode of micropollutant action on aquatic microorganisms. Therefore the development of quick and reliable methodologies probing the oxidative stress and damage in living cells is highly sought. In the present proof of concept work we examined the potential of the fluorescent dye C11 BODIPY591/581 to probe lipid oxidation in the green microalga Chlamydomonas reinhardtii. C11...
Directory of Open Access Journals (Sweden)
Jian Zhang
2016-04-01
Full Text Available Gastric cancer, which is the most common malignant gastrointestinal tumor, has jumped to the third leading cause of cancer-related mortality worldwide. It is of great importance to identify novel and potent drugs for gastric cancer treatment. P21-activated kinase 4 (PAK4 has emerged as an attractive target for the development of anticancer drugs in consideration of its vital functions in tumorigenesis and progression. In this paper, we reported that GL-1196, as a small molecular compound, effectively suppressed the proliferation of human gastric cancer cells through downregulation of PAK4/c-Src/EGFR/cyclinD1 pathway and CDK4/6 expression. Moreover, GL-1196 prominently inhibited the invasion of human gastric cancer cells in parallel with blockage of the PAK4/LIMK1/cofilin pathway. Interestingly, GL-1196 also inhibited the formation of filopodia and induced cell elongation in SGC7901 and BGC823 cells. Taken together, these results provided novel insights into the potential therapeutic strategy for gastric cancer.
Directory of Open Access Journals (Sweden)
Hui-Qun Xu
2018-04-01
Full Text Available AIM:To investigate the clinical efficacy of 3g/L sodium hyaluronate eye drops combined with bromhexine hydrochloride tablets on the treatment of dry eye. METHODS:Totally 200 patients with dry eye were randomly divided into the control group(n=100and observation group(n=100. Patients in two groups were given 3g/L sodium hyaluronate eye drops and physiotherapy. On the basis of this, the observation group were treated with bromhexine hydrochloride tablets. The inflammatory factors(IL-6, IL-10, TNF-α and IL-1βlevels and ocular symptom scores(OSDI, BUT, SⅠt, FLin the two groups were compared between before and after treatment. And the clinical efficacy and adverse reactions were evaluated. RESULTS: After treatment, the IL-6, IL-10, TNF-α, IL-1β, OSDI and FL scores in two groups were significantly lower than those before treatment, and BUT and SⅠt were significantly higher than those before treatment. Moreover, the improvement degree of the above indexes in the observation group were better than those in the control group, showing statistically significant difference(Pχ2=5.531, P=0.019, but there was no significant difference in the incidence of adverse reactions between the two groups(χ2=0.307, P=0.579. CONCLUSION:As for the patients with dry eye, the combination of 3g/L sodium hyaluronate eye drops with bromhexine hydrochloride tablets can significantly decrease the level of inflammatory factors, improve the eye symptoms and the clinical total efficiency, without increasing treatment-related adverse effects.
Adaptação nutricional diante da doença celíaca desencadeada pela intolerância ao glúten
Directory of Open Access Journals (Sweden)
Francileuda Batista de Almeida
2016-01-01
Full Text Available A intolerância ao glúten que desencadeia a doença celíaca DC tem analises e estudo a mais de dois séculos, glúten proteína presente nas farinhas, o doente celíaco tem como sintomas distúrbios gastrointestinais ente outros problemas de saúde decorrente de dietas a parti de alimentos que contem glúten. A partir de tais pressupostos, pretendeu-se com o trabalho de revisão, analisar a necessidade de adaptações nutricionais mediante a doença celíaca desencadeada pela intolerância ao glúten. Neste sentido, tem-se que os sintomas apesentam de formas típicas e atípicas. Fatores intrínsecos também contribuem para o problema tais com os imunológicos, genéticos e ambientais. Estudos comprovam que para melhor convivência com o problema o paciente celíaco deve obter todas as informações tanto do corpo clínico que lhe assiste quanto dos exames realizados como e o caso da biopsia do intestino. O tratamento se baseia em ingestão de dieta sem glúten, antes era difícil encontrar no mercado mais hoje já existem formulações sem glúten bolos goma xantana e biscoito de farrinha de palmeia real. Este trabalho descreve em formato de revisão bibliográfica este assunto.Nutritional adaptation faced with celiac disease triggered by intolerance to glutenAbstract: The intolerance to gluten that triggers the DC celiac disease has analysis and study more than two centuries, gluten protein found in flour, the patient celiac has the symptoms gastrointestinal being disorders other health problems due to diet the left of foods containing gluten. Based on these assumptions, it was intended with the revision work, examine the need for nutritional adaptations by celiac disease triggered by intolerance to gluten-. In this sense, it has to be apesentam symptoms of typical and atypical forms. Intrinsic factors also contribute to the problem with such immunological, genetic and environmental. Studies show that for better interaction with the patient
Detection of lipid peroxidation in frozen-thawed avian spermatozoa using C(11)-BODIPY(581/591).
Partyka, Agnieszka; Lukaszewicz, Ewa; Niżański, Wojciech; Twardoń, Jan
2011-06-01
The aim of this study was to perform flow cytometric analysis of C11-BODIPY581/591 oxidation in fowl and geese sperm as a marker for membrane lipid peroxidation (LPO) and to establish if the cryopreservation process would make sperm membranes more susceptible to oxidative stress. The experiment was carried out on 10 meat type line Flex roosters and 10 White Koluda® geese. The semen was collected two times a week, by dorso-abdominal massage method and pooled from 10 individuals of each species. Fowl semen samples were subjected to cryopreservation using the "pellet" method and Dimethylacetamide (DMA) as a cryoprotectant. Geese semen samples were cryopreserved in plastic straws in a programmable freezing unit with Dimethyloformamide (DMF) as the cryoprotectant. A fluorescent lipid probe C11-BODIPY581/591 provided with two double bonds that are oxidized during their contact with ROS, was used for the purpose of the assessment of the LPO in freshly diluted semen samples and frozen-thawed semen samples. This probe changes its color according to its state (non peroxidized: red; peroxidized: green). Flow cytometric analysis was used to monitor these changes. The White Koluda® geese fresh semen had a higher level of LPO than the Flex fresh semen (P > 0.01). The cryopreservation of fowl semen significantly (P > 0.01) increased the percentage of live and dead spermatozoa with lipid peroxidation. In frozen-thawed semen of White Koluda® geese the percentage of live spermatozoa with LPO significantly decreased (P > 0.05) whereas significantly (P > 0.01) higher level of dead cells with LPO was observed. There were significant differences between the two studied species. After thawing, the percentage of live and dead spermatozoa with lipid peroxidation was higher in fowl semen than in geese semen (P > 0.01). In conclusion, our data clearly indicate the existence of species specific differences in susceptibility of spermatozoa to the oxidation of PUFAs in the cell membranes
Rosengren, Mats
1991-12-01
The European remote sensing mission orbit control is addressed. For the commissioning phase, the orbit is defined by the following requirements: Sun synchronous, local time of descending node 10:30; three days repeat cycle with 43 orbital revolutions; overhead Venice tower (12.508206 deg east, 45.314222 deg north). The launch, maneuvers for the initial acquisition of the operational orbit, orbit maintenance maneuvers, evaluation of the orbit control, and the drift of the inclination are summarized.
A Typical Presentation of Orbital Pseudotumor Mimicking Orbital Cellulitis
Directory of Open Access Journals (Sweden)
J. Ayatollahi
2013-10-01
Full Text Available Introduction: Orbital pseudotumor, also known as idiopathic orbital inflammatory syndrome (IOIS, is a benign, non- infective inflammatory condition of the orbit without identifiable local or systemic causes. The disease may mimics a variety of pathologic conditions. We pre-sent a case of pseudotumor observed in a patient admitted under the name of orbital celluli-ties. Case Report: A 26-year-old woman reffered to our hospital with the history of left ocular pain and headache 2 days before her visit.. Ophthalmological examination of the patient was normal except for the redness and lid edema, mild chemosis and conjunctival injection. Gen-eral assessment was normal but a low grade fever was observed. She was hospitalized as an orbital cellulitis patient. She was treated with intravenous antibiotics. On the third day , sud-denly diplopia, proptosis in her left eye and ocular pain in her right side appeared. MRI re-vealed bilateral enlargement of extraocular muscles. Diagnosis of orbital pseudotumor was made and the patient was treated with oral steroid.She responded promptly to the treatment. Antibiotics were discontinued and steroid was tapered in one month period under close fol-low up. Conclusion: The clinical features of orbital pseudotumor vary widely . Orbital pseudotumor and orbital cellulitis can occasionally demonstrate overlapping features.. Despite complete physical examination and appropriate imaging, sometimes correct diagnosis of the disease would be difficult (Sci J Hamadan Univ Med Sci 2013; 20 (3:256-259
Degeneration of Bethe subalgebras in the Yangian of gl_n
Ilin, Aleksei; Rybnikov, Leonid
2018-04-01
We study degenerations of Bethe subalgebras B( C) in the Yangian Y(gl_n), where C is a regular diagonal matrix. We show that closure of the parameter space of the family of Bethe subalgebras, which parameterizes all possible degenerations, is the Deligne-Mumford moduli space of stable rational curves \\overline{M_{0,n+2}}. All subalgebras corresponding to the points of \\overline{M_{0,n+2}} are free and maximal commutative. We describe explicitly the "simplest" degenerations and show that every degeneration is the composition of the simplest ones. The Deligne-Mumford space \\overline{M_{0,n+2}} generalizes to other root systems as some De Concini-Procesi resolution of some toric variety. We state a conjecture generalizing our results to Bethe subalgebras in the Yangian of arbitrary simple Lie algebra in terms of this De Concini-Procesi resolution.
Yangian symmetry of long-range gl(N) integrable spin chains
International Nuclear Information System (INIS)
Beisert, Niklas; Erkal, Denis
2008-01-01
An interesting type of spin chain has appeared in the context of the planar AdS/CFT correspondence: it is based on an integrable nearest-neighbor spin chain, and it is perturbatively deformed by long-range interactions which apparently preserve the integrable structure. Similar models can be constructed by demanding the existence of merely one conserved local charge. Although the latter is not a sufficient integrability condition in general, the models often display convincing signs of full integrability. Here we consider a class of long-range spin chains with spins transforming in the fundamental representation of gl(N). For the most general such model with one conserved local charge we construct a conserved Yangian generator and show that it obeys the Serre relations. We thus provide a formal proof of integrability for this class of models
Multi-Frequency VLBA Polarimetry and the Twin-Jet Quasar 0850+581
Directory of Open Access Journals (Sweden)
Evgeniya Kravchenko
2017-11-01
Full Text Available We present the first multi-frequency VLBA study of the quasar 0850+581 which appears to have a two-sided relativistic jet. Apparent velocity in the approaching jet changes from 3.4c to 7c with the separation from the core. The jet-to-counter-jet ratio of about 5 and apparent superluminal velocities suggest that the observing angle of the inner jet is ≤ 17 ∘ . It is likely that this orientation significantly changes downstream due to an interaction of the jet with the surrounding medium; signs of this are seen in polarization. A dense inhomogeneous Faraday screen is detected in the innermost regions of this quasar. We suggest that there is a presence of ionized gas in its nucleus, which might be responsible for the free-free absorption of the synchrotron emission in the jet and counter-jet at frequencies below 8.4 GHz. The experiment makes use of slowly varying instrumental polarisation factors (polarization leakage or D-terms in time. We report application of the “D-term connection” technique for the calibration of an absolute orientation of electric vector position angle (EVPA observed by VLBA at 4.6, 5.0, 8.1, 8.4, 15.4, 22.3, and 43.3 GHz bands during the 2007–2011.
Hamilton, Douglas P.
2018-04-01
Solar radiation pressure is usually very effective at removing hazardous millimeter-sized debris from distant orbits around asteroidsand other small solar system bodies (Hamilton and Burns 1992). Theprimary loss mechanism, driven by the azimuthal component of radiationpressure, is eccentricity growth followed by a forced collision withthe central body. One large class of orbits, however, neatly sidestepsthis fate. Orbits oriented nearly perpendicular to the solar directioncan maintain their face-on geometry, oscillating slowly around a stableequilibrium orbit. These orbits, designated sunflower orbits, arerelated to terminator orbits studied by spacecraft mission designers(Broschart etal. 2014).Destabilization of sunflower orbits occurs only for particles smallenough that radiation pressure is some tens of percent the strength ofthe central body's direct gravity. This greatly enhanced stability,which follows from the inability of radiation incident normal to theorbit to efficiently drive eccentricities, presents a threat tospacecraft missions, as numerous dangerous projectiles are potentiallyretained in orbit. We have investigated sunflower orbits insupport of the New Horizons, Aida, and Lucy missions and find thatthese orbits are stable for hazardous particle sizes at asteroids,comets, and Kuiper belt objects of differing dimensions. Weinvestigate the sources and sinks for debris that might populate suchorbits, estimate timescales and equilibrium populations, and willreport on our findings.
Testing and analysis on total protein, albumin and A/G of salivary in radiation exposure persons
International Nuclear Information System (INIS)
Wang Jun; Zhang Yan; Li Guangwen; Li Gang; Guo Jing; Li Hui; Wang Yuxin; Li Cuixia
2012-01-01
Objective: To study the oral health effect of long term low dose radiation on exposure personnel and to provide a basis for further improving the protection ability. Methods: Testing method, which was based on APT and HSA interactions induced by synchronous fluorescence specific changes, and intensity and concentrations of HSA in the solution in the system of synchronous fluorescence showed a good linear relations. the establishment of a APT as a molecular probe was used to test concentration of salivary total protein (TP), albumin (ALB), globulin (GLO) and albumin by synchronous fluorescence spectrum analysis. The information was analyzed in Foxpro 6.0 and SPSS 16.0 software. Result: Protein (TP) Mean Value was 3.904 ±1.369 g/L, Minimum Value was 0.30 g/L and Maximum Value was 7.50 g/L. Albumin (ALB) Mean Value was 0.965±0.665 g/L, Minimum Value was 0.09 g/L and Maximum Value was 3.98 g/L. Globulin (GLO) Mean Value was 2.895±0.947 g/L, Minimum Value was 0.01 g/L and Maximum Value was 5.81 g/L. A/G Mean Value was 0.327. Conclusion: Long term and low dose of radiation would break the chronic physiological balance and concentration of salivary total protein (TP), albumin (ALB), globulin (GLO) and albumin and globulin ratio (A/G) changed obviously. It was necessary to do more special oral health care, further improve the individual protection consciousness, strengthen the radiation monitoring and protection measures, improve the regulation system, and reduce radiation damage on special personnel health significantly. (authors)
Xu, Guochang
2008-01-01
This is the first book of the satellite era which describes orbit theory with analytical solutions of the second order with respect to all possible disturbances. Based on such theory, the algorithms of orbits determination are completely revolutionized.
Instability timescale for the inclination instability in the solar system
Zderic, Alexander; Madigan, Ann-Marie; Fleisig, Jacob
2018-04-01
The gravitational influence of small bodies is often neglected in the study of solar system dynamics. However, this is not always an appropriate assumption. For example, mutual secular torques between low mass particles on eccentric orbits can result in a self-gravity instability (`inclination instability'; Madigan & McCourt 2016). During the instability, inclinations increase exponentially, eccentricities decrease (detachment), and orbits cluster in argument of perihelion. In the solar system, the orbits of the most distant objects show all three of these characteristics (high inclination: Volk & Malhotra (2017), detachment: Delsanti & Jewitt (2006), and argument of perihelion clustering: Trujillo & Sheppard (2014)). The inclination instability is a natural explanation for these phenomena.Unfortunately, full N-body simulations of the solar system are unfeasible (N ≈ O(1012)), and the behavior of the instability depends on N, prohibiting the direct application of lower N simulations. Here we present the instability timescale's functional dependence on N, allowing us to extrapolate our simulation results to that appropriate for the solar system. We show that ~5 MEarth of small icy bodies in the Sedna region is sufficient for the inclination instability to occur in the outer solar system.
Orbital Chondroma: A rare mesenchymal tumor of orbit
Directory of Open Access Journals (Sweden)
Ruchi S Kabra
2015-01-01
Full Text Available While relatively common in the skeletal system, cartilaginous tumors are rarely seen originating from the orbit. Here, we report a rare case of an orbital chondroma. A 27-year-old male patient presented with a painless hard mass in the superonasal quadrant (SNQ of left orbit since 3 months. On examination, best-corrected visual acuity of both eyes was 20/20, with normal anterior and posterior segment with full movements of eyeballs and normal intraocular pressure. Computerized tomography scan revealed well defined soft tissue density lesion in SNQ of left orbit. Patient was operated for anteromedial orbitotomy under general anesthesia. Mass was excised intact and sent for histopathological examination (HPE. HPE report showed lobular aggregates of benign cartilaginous cells with mild atypia suggesting of benign cartilaginous tumor - chondroma. Very few cases of orbital chondroma have been reported in literature so far.
Directory of Open Access Journals (Sweden)
Seokchan Kang
2017-01-01
Full Text Available A dedicated plug-in has been installed to visualize three-dimensional (3D city modeling spatial data in web-based applications. However, plug-in methods are gradually becoming obsolete, owing to their limited performance with respect to installation errors, unsupported cross-browsers, and security vulnerability. Particularly, in 2015, the NPAPI service was terminated in most existing web browsers except Internet Explorer. To overcome these problems, the HTML5/WebGL (next-generation web standard, confirmed in October 2014 technology emerged. In particular, WebGL is able to display 3D spatial data without plug-ins in browsers. In this study, we attempted to identify the requirements and limitations of displaying 3D city modeling spatial data using HTML5/WebGL, and we propose alternative ways based on the bin-packing algorithm that aggregates individual 3D city modeling data including buildings in tile units. The proposed method reduces the operational complexity and the number and volume of transmissions required for rendering processing to improve the speed of 3D data rendering. The proposed method was validated on real data for evaluating its effectiveness in 3D visualization of city modeling data in web-based applications.
A terrestrial planet candidate in a temperate orbit around Proxima Centauri.
Anglada-Escudé, Guillem; Amado, Pedro J; Barnes, John; Berdiñas, Zaira M; Butler, R Paul; Coleman, Gavin A L; de la Cueva, Ignacio; Dreizler, Stefan; Endl, Michael; Giesers, Benjamin; Jeffers, Sandra V; Jenkins, James S; Jones, Hugh R A; Kiraga, Marcin; Kürster, Martin; López-González, Marίa J; Marvin, Christopher J; Morales, Nicolás; Morin, Julien; Nelson, Richard P; Ortiz, José L; Ofir, Aviv; Paardekooper, Sijme-Jan; Reiners, Ansgar; Rodríguez, Eloy; Rodrίguez-López, Cristina; Sarmiento, Luis F; Strachan, John P; Tsapras, Yiannis; Tuomi, Mikko; Zechmeister, Mathias
2016-08-25
At a distance of 1.295 parsecs, the red dwarf Proxima Centauri (α Centauri C, GL 551, HIP 70890 or simply Proxima) is the Sun's closest stellar neighbour and one of the best-studied low-mass stars. It has an effective temperature of only around 3,050 kelvin, a luminosity of 0.15 per cent of that of the Sun, a measured radius of 14 per cent of the radius of the Sun and a mass of about 12 per cent of the mass of the Sun. Although Proxima is considered a moderately active star, its rotation period is about 83 days (ref. 3) and its quiescent activity levels and X-ray luminosity are comparable to those of the Sun. Here we report observations that reveal the presence of a small planet with a minimum mass of about 1.3 Earth masses orbiting Proxima with a period of approximately 11.2 days at a semi-major-axis distance of around 0.05 astronomical units. Its equilibrium temperature is within the range where water could be liquid on its surface.
Local orbitals by minimizing powers of the orbital variance
DEFF Research Database (Denmark)
Jansik, Branislav; Høst, Stinne; Kristensen, Kasper
2011-01-01
's correlation consistent basis sets, it is seen that for larger penalties, the virtual orbitals become more local than the occupied ones. We also show that the local virtual HF orbitals are significantly more local than the redundant projected atomic orbitals, which often have been used to span the virtual...
Considerations on scanography of orbital masses Aspecto escanográfico de algunas masas orbitarias
Directory of Open Access Journals (Sweden)
Guillermo Velásquez
1990-01-01
Full Text Available
We report on our experience with 75 patients with orbital masses, studied with Computerized Tomography (CT, at the Ophtalmology and Radiology Services, Hospital Universitario San Vicente de Paúl, and University of Antioquia, School of Medicine, Medellín, Colombia. The most frequent lesions were: retinoblastoma, vascular lesions, infectious lesions, tumors of the lacrymal gland, mucocele, meningloma, melanoma, and metastatic masses. On the basis of our experience we highly recommend CT as the most valuable diagnostic procedure for the study of patients with proptosis and clinical signs of an orbital mass.
En este artículo se presenta una casuística de 75 masas orbitarias estudiadas en el Hospital Universitario San Vicente de Paúl, de Medellín, mediante la Tomografía Axial Computada y se incluyen imágenes ilustrativas de ocho de ellas; las entidades más frecuentes fueron: retinoblastoma, lesiones vasculares, lesiones Infecciosas y neoplasias de la glándula lacrimal; se mencionan aspectos clínicos seleccionados y se discuten las ventajas de la tomografía para el estudio de este problema; finalmente, se consignan recomendaciones para el uso racional del procedimiento.
Application of risk based inspection methodology of API 581 BRD to oil pipelines
Energy Technology Data Exchange (ETDEWEB)
Pezzi Filho, M. [Petrobras, Rio de Janeiro (Brazil); Freire, J.L.F.; Maragone, F.. [Pontifica Univ. Catolica, Rio de Janeiro (Brazil)
2004-07-01
In response to public concerns regarding the safe operation of pipelines, operators are relying on risk management to balance the demands of pipeline integrity and service competitiveness. This paper presented a procedure for calculating the probability of failure according to the API 581 BRD RB I methodology that uses data collected from 3 existing oil pipelines subject to internal corrosion. The risk exposure that the pipeline may be subjected to during its remaining operating life was evaluated. Risk is a function of the probability of failure and the consequences of that failure. Therefore, if the consequences of the failure are assumed to remain unchanged for a given equipment under specific operational conditions, then risk reduction will only be achieved by decreasing the probability of failure and through management of the inspection process. It was shown that if the confidence on the damage rate and on the inspection effectiveness is known, then it is possible to design an alternative to an existing inspection plan. This calls for pig inspections at 5 year intervals to ensure that the probability of failures for pipelines will be under a certain level of tolerable risk. 9 refs., 4 tabs., 3 figs.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT
DUF581 is plant specific FCS-like zinc finger involved in protein-protein interaction.
Directory of Open Access Journals (Sweden)
Muhammed Jamsheer K
Full Text Available Zinc fingers are a ubiquitous class of protein domain with considerable variation in structure and function. Zf-FCS is a highly diverged group of C2-C2 zinc finger which is present in animals, prokaryotes and viruses, but not in plants. In this study we identified that a plant specific domain of unknown function, DUF581 is a zf-FCS type zinc finger. Based on HMM-HMM comparison and signature motif similarity we named this domain as FCS-Like Zinc finger (FLZ domain. A genome wide survey identified that FLZ domain containing genes are bryophytic in origin and this gene family is expanded in spermatophytes. Expression analysis of selected FLZ gene family members of A. thaliana identified an overlapping expression pattern suggesting a possible redundancy in their function. Unlike the zf-FCS domain, the FLZ domain found to be highly conserved in sequence and structure. Using a combination of bioinformatic and protein-protein interaction tools, we identified that FLZ domain is involved in protein-protein interaction.
Classical mechanics on the GL(n, R) group and Euler-Calogero-Sutherland model
International Nuclear Information System (INIS)
Khvedelidze, A.M.; Mladenov, D.M.
2002-01-01
Relations between free motion on the GL + (n, R) group manifold and the dynamics of an n-particle system with spin degrees of freedom on a line interacting with a pairwise 1/sinh 2 x 'potential' (Euler-Calogero-Sutherland model) are discussed within a Hamiltonian reduction. Two kinds of reductions of the degrees of freedom are considered: that which is due to continuous invariance and that which is due to discrete symmetry. It is shown that, upon projecting onto the corresponding invariant manifolds, the resulting Hamiltonian system represents the Euler-Calogero-Sutherland model in both cases
Orbital Dynamics of Low-Earth Orbit Laser-Propelled Space Vehicles
International Nuclear Information System (INIS)
Yamakawa, Hiroshi; Funaki, Ikkoh; Komurasaki, Kimiya
2008-01-01
Trajectories applicable to laser-propelled space vehicles with a laser station in low-Earth orbit are investigated. Laser vehicles are initially located in the vicinity of the Earth-orbiting laser station in low-earth orbit at an altitude of several hundreds kilometers, and are accelerated by laser beaming from the laser station. The laser-propelled vehicles start from low-earth orbit and finally escape from the Earth gravity well, enabling interplanetary trajectories and planetary exploration
Exploratory Visual Analytics of a Dynamically Built Network of Nodes in a WebGL-Enabled Browser
2014-01-01
dimensionality reduction, feature extraction, high-dimensional data, t-distributed stochastic neighbor embedding, neighbor retrieval visualizer, visual...WebGL-enabled rendering is supported natively by browsers such as the latest Mozilla Firefox , Google Chrome, and Microsoft Internet Explorer 11. At the...appropriate names. The resultant 26-node network is displayed in a Mozilla Firefox browser in figure 2 (also see appendix B). 3 Figure 1. The
International Nuclear Information System (INIS)
Schirrmacher, A.
1991-01-01
A n(n-1)/2+1 parameter solution of the Yang Baxter equation is presented giving rise to the quantum Group GL x;qij (n). Determinant and inverse are constructed. The group acts covariantly on a quantum vector space of non-commutative coordinates. The associated exterior space can be identified with the differentials exhibiting a multiparameter deformed differential calculus following the construction of Wess and Zumino. (orig.)
African Journals Online (AJOL)
was done without contrast and 3mm/5mm/10mm slices were obtained to cover the orbit, skull base and brain. The findings included a soft tissue mass arising from the orbit. The left eye ball was extra orbital. There was no defect .... love's Short Practice of Surgery. 7 Edition,. Levis London, 1997; 45-64. 2. Orbital tumor Part 1, ...
Building a Laboratory Information Management System Using Windows4GL
International Nuclear Information System (INIS)
Pickens, M.A.; Shaieb, M.R.
1996-05-01
The system discussed is currently implemented at LLNL in the Environmental Services program which operates out of the Chemistry ampersand Materials Science (C ampersand MS) directorate. Responsibility is to provide the C ampersand MS Environmental Services (CES) program with an enterprise-wide information system which will aid CES. The specific portion of the information system is the Sample Tracking, Analysis and Reporting System (STARS). Since CES was formed by merging two analytical laboratory organizations in May 1995, a new Laboratory Information Management System (LIMS) had to be developed. The development of a LIMS in Windows4GL was found to be satisfactory. The product STARS was well received by the user community, and it has improved business practices and efficiency in CES. The CES management staff has seen increased personnel productivity since STARS was release. We look forward to upgrading to CA-OpenROAD and taking advantage of its many improved and innovative features to further enhance STARS
Building a Laboratory Information Management System Using Windows4GL
Energy Technology Data Exchange (ETDEWEB)
Pickens, M.A.; Shaieb, M.R.
1996-05-01
The system discussed is currently implemented at LLNL in the Environmental Services program which operates out of the Chemistry & Materials Science (C&MS) directorate. Responsibility is to provide the C&MS Environmental Services (CES) program with an enterprise-wide information system which will aid CES. The specific portion of the information system is the Sample Tracking, Analysis and Reporting System (STARS). Since CES was formed by merging two analytical laboratory organizations in May 1995, a new Laboratory Information Management System (LIMS) had to be developed. The development of a LIMS in Windows4GL was found to be satisfactory. The product STARS was well received by the user community, and it has improved business practices and efficiency in CES. The CES management staff has seen increased personnel productivity since STARS was release. We look forward to upgrading to CA-OpenROAD and taking advantage of its many improved and innovative features to further enhance STARS.
International Nuclear Information System (INIS)
Abujamra, S.
1983-01-01
The authors present a method called ''Radiovolumetry of the orbit'' that permits the evaluation of the orbital volume from anteroposterior skull X-Rays (CALDWELL 30 0 position). The research was based in the determination of the orbital volume with lead spheres, in 1010 orbits of 505 dry skulls of Anatomy Museums. After the dry skulls was X-rayed six frontal orbital diameters were made, with care to correct the radiographic amplification. PEARSON correlation coeficient test was applied between the mean orbital diameter and the orbital volume. The result was r = 0,8 with P [pt
Sonda permeabilizadora en el tratamiento de la disfunción obstructiva de las glándulas de Meibomio
Directory of Open Access Journals (Sweden)
Taimí Cárdenas Díaz
Full Text Available El ojo seco constituye una de las principales afecciones de la superficie ocular por la que acuden las personas a la consulta de Oftalmología. El 70 % de los pacientes con este diagnóstico presentan algún signo relacionado con la enfermedad de las glándulas de Meibomio y su control con los tratamientos habituales continúa siendo un problema. Las compresas calientes y los lavados con champú infantil darán alivio temporal, pero por lo general son abandonados por los pacientes. Otro enfoque es la expresión de las glándulas de Meibomio, la cual es molesta y por lo general necesita realizarse más de una vez; de ahí que el sondeo quirúrgico de esta sea una alternativa a utilizar. El sondaje mediante las sondas de Maskin introducidas desde el 2009 constituye una nueva modalidad terapéutica, la cual, de acuerdo con el conocimiento de los autores, no había sido introducida previamente en el país. La no disponibilidad de sondas con este fin en Cuba fue la motivación para diseñarla con el objetivo de permeabilizar los conductos excretores en la disfunción obstructiva de las glándulas de Meibomio (O- MGD, y así implementar esta técnica. Este dispositivo se construyó con medios propios en el taller de prototipos del laboratorio, de acuerdo con las características anatómicas del sistema glandular. Actualmente se usa de manera regular por doctores con resultados alentadores, como en los casos que se presentan.
International Nuclear Information System (INIS)
Iinuma, Toshitaka; Ishio, Ken-ichirou; Yoshinami, Hiroyoshi; Kuriyama, Jun-ichi; Hirota, Yoshiharu.
1993-01-01
A total of 59 cases of mild facial fractures (simple orbital wall fractures, 34 cases, other facial fractures, 25 cases) with the clinical suspects of orbital wall fractures were evaluated both by conventional views (Waters' and Caldwell views) and coronal CT scans. Conventional views were obtained, as an average, after 4 days and CT after 7 days of injuries. Both the medial wall and the floor were evaluated at two sites, i.e., anterior and posterior. The ethmoid-maxillary plate was also included in the study. The degree of fractures was classified as, no fractures, fractures of discontinuity, dislocation and fragmentation. The coronal CT images in bone window condition was used as reference and the findings were compared between conventional views and CT. The correct diagnosis was obtained as follows: orbital floor (anterior, 78%, posterior, 73%), medial orbital wall (anterior, 72%, posterior, 72%) and ethmoid-maxillary plate (64%). The false positive diagnosis was as follows: orbital floor (anterior only, 13%), medial orbital wall (anterior only, 7%) and ethmoid-maxillary plate (11%). The false negative diagnosis was as follows: orbital floor (anterior, 9%, posterior, 10%), medial orbital wall (anterior, 21%, posterior, 28%) and ethmoid-maxillary plate (21%). The results were compared with those of others in the past. (author)
Charge-spin-orbital dynamics of one-dimensional two-orbital Hubbard model
Energy Technology Data Exchange (ETDEWEB)
Onishi, Hiroaki [Advanced Science Research Center, Japan Atomic Energy Agency, Tokai, Ibaraki 319-1195 (Japan)
2010-01-15
We study the real-time evolution of a charge-excited state in a one-dimensional e{sub g}-orbital degenerate Hubbard model, by a time-dependent density-matrix renormalization group method. Considering a chain along the z direction, electrons hop between adjacent 3z{sup 2}-r{sup 2} orbitals, while x{sup 2}-y{sup 2} orbitals are localized. For the charge-excited state, a holon-doublon pair is introduced into the ground state at quarter filling. At initial time, there is no electron in a holon site, while a pair of electrons occupies 3z{sup 2}-r{sup 2} orbital in a doublon site. As the time evolves, the holon motion is governed by the nearest-neighbor hopping, but the electron pair can transfer between 3z{sup 2}-r{sup 2} orbital and x{sup 2}-y{sup 2} orbital through the pair hopping in addition to the nearest-neighbor hopping. Thus holon and doublon propagate at different speed due to the pair hopping that is characteristic of multi-orbital systems.
Directory of Open Access Journals (Sweden)
Luiz Carlos Rosemberg
2000-01-01
Full Text Available Estudamos a distribuição e o arranjo vascular arterial dos ramos à glândula mamária em 30 caprinos sem raça definida, adultos, oriundos dos estados do Ceará e Minas Gerais, mediante a análise de esquemas de modelos obtidos pela injeção de látex "neoprene" 450, fixação em formol a 10% e dissecção. O suprimento sangüíneo de cada metade do úbere faz-se pela A. pudenda externa, complementado por conexões com ramos das Aa. pudenda interna e torácica interna. Próximo ao úbere a A. pudenda externa curva-se cranialmente, emite o ramo mamário superficial, torna-se A. mamária até a sua bifurcação; emite ainda ramos aos linfonodos mamários e à região labial ventral da vulva. Ao penetrar na glândula a A. mamária bifurca-se dando origem às Aa. mamárias cranial e medial que enviam diversos ramos à glândula em geral e pele da região. A A. mamária cranial percorre cranialmente a parede abdominal ventral como A. epigástrica caudal superficial. Não existem diferenças significativas entre os arranjos vasculares dos dois antímeros da mama. Ocorrem anastomoses entre as Aa. mamárias mediais e seus ramos. Fizemos uma análise comparativa do nosso trabalho em relação a outros estudos a respeito da irrigação da glândula mamária em ruminantes.
Borumandi, Farzad
2013-01-01
Compared to the cerebrospinalfluid (CSF) leak through the nose and ear, the orbital CSF leak is a rare and underreported condition following head trauma. We present the case of a 49-year-old woman with oedematous eyelid swelling and ecchymosis after a seemingly trivial fall onto the right orbit. Apart from the above, she was clinically unremarkable. The CT scan revealed a minimally displaced fracture of the orbital roof with no emphysema or intracranial bleeding. The fractured orbital roof in combination with the oedematous eyelid swelling raised the suspicion for orbital CSF leak. The MRI of the neurocranium demonstrated a small-sized CSF fistula extending from the anterior cranial fossa to the right orbit. The patient was treated conservatively and the lid swelling resolved completely after 5 days. Although rare, orbital CSF leak needs to be included in the differential diagnosis of periorbital swelling following orbital trauma. PMID:24323381
Orbitals from local RDMFT: Are they Kohn-Sham or natural orbitals?
International Nuclear Information System (INIS)
Theophilou, Iris; Helbig, Nicole; Lathiotakis, Nektarios N.; Gidopoulos, Nikitas I.; Rubio, Angel
2015-01-01
Recently, an approximate theoretical framework was introduced, called local reduced density matrix functional theory (local-RDMFT), where functionals of the one-body reduced density matrix (1-RDM) are minimized under the additional condition that the optimal orbitals satisfy a single electron Schrödinger equation with a local potential. In the present work, we focus on the character of these optimal orbitals. In particular, we compare orbitals obtained by local-RDMFT with those obtained with the full minimization (without the extra condition) by contrasting them against the exact NOs and orbitals from a density functional calculation using the local density approximation (LDA). We find that the orbitals from local-RMDFT are very close to LDA orbitals, contrary to those of the full minimization that resemble the exact NOs. Since local RDMFT preserves the good quality of the description of strong static correlation, this finding opens the way to a mixed density/density matrix scheme, where Kohn-Sham orbitals obtain fractional occupations from a minimization of the occupation numbers using 1-RDM functionals. This will allow for a description of strong correlation at a cost only minimally higher than a density functional calculation
Adição de colágeno em pão sem glúten elaborado com farinha de arroz
Directory of Open Access Journals (Sweden)
Carolina da Silva Graça
2017-02-01
Full Text Available Resumo Os portadores da doença celíaca, uma enteropatia, apresentam intolerância ao glúten e a restrição de alimentos que o contenham mostra-se eficaz na normalização da função intestinal e das manifestações clínicas. O objetivo do presente estudo foi avaliar o efeito da adição de colágeno em pó e em fibra nas características estruturais, tecnológicas e sensoriais de pães sem glúten, elaborados com farinha de arroz. Primeiramente, foram realizadas adições de 2%, 4%, 6% e 8% de colágeno, sob as formas em pó e em fibra, em pães elaborados com farinha de arroz, sendo estes avaliados quanto às suas características tecnológicas: volume específico, firmeza do miolo e cor da crosta e do miolo. O pão que apresentou as melhores características tecnológicas foi caracterizado quanto à sua composição química (proteínas, lipídios, cinzas, umidade e carboidratos, avaliado quanto às perdas decorrentes da cocção e submetido à análise sensorial. As massas cruas dos pães adicionados com o colágeno em fibra, assim como a massa do pão padrão (sem adição de colágeno, foram avaliadas através de reologia e microscopia eletrônica de varredura. A adição de colágeno aos pães elaborados com farinha de arroz não colaborou para a formação de uma rede semelhante à formada pelo glúten. O pão da formulação com 4% de colágeno em fibra apresentou as características tecnológicas mais próximas ao esperado, não diferindo significativamente quanto à composição química, do pão padrão. Por meio da análise sensorial, constatou-se que os pães sem glúten (padrão e com 4% de colágeno em fibra obtiveram aceitação sensorial superior a 75%. Conclui-se, com o estudo, que é possível adicionar colágeno em pães sem glúten, sendo que o pão adicionado de 4% de colágeno em fibra apresentou características mais próximas às do pão padrão testado.
New Evidence for a Substellar Luminosity Problem: Dynamical Mass for the Brown Dwarf Binary Gl 417BC
Dupuy, Trent J.; Liu, Michael C.; Ireland, Michael J.
2014-08-01
We present new evidence for a problem with cooling rates predicted by substellar evolutionary models that implies that model-derived masses in the literature for brown dwarfs and directly imaged planets may be too high. Based on our dynamical mass for Gl 417BC (L4.5+L6) and a gyrochronology system age from its young, solar-type host star, commonly used models predict luminosities 0.2-0.4 dex lower than we observe. This corroborates a similar luminosity-age discrepancy identified in our previous work on the L4+L4 binary HD 130948BC, which coincidentally has nearly identical component masses (≈50-55 M Jup) and age (≈800 Myr) as Gl 417BC. Such a luminosity offset would cause systematic errors of 15%-25% in model-derived masses at this age. After comparing different models, including cloudless models that should not be appropriate for mid-L dwarfs like Gl 417BC and HD 130948BC but actually match their luminosities better, we speculate the observed overluminosity could be caused by opacity holes (i.e., patchy clouds) in these objects. Moreover, from hybrid substellar evolutionary models that account for cloud disappearance, we infer the corresponding phase of overluminosity may extend from a few hundred million years up to a few gigayears and cause masses to be overestimated by up to 25%, even well after clouds disappear from view entirely. Thus, the range of ages and spectral types affected by this potential systematic shift in luminosity evolution would encompass most known directly imaged gas-giants and field brown dwarfs. Data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.
iview: an interactive WebGL visualizer for protein-ligand complex.
Li, Hongjian; Leung, Kwong-Sak; Nakane, Takanori; Wong, Man-Hon
2014-02-25
Visualization of protein-ligand complex plays an important role in elaborating protein-ligand interactions and aiding novel drug design. Most existing web visualizers either rely on slow software rendering, or lack virtual reality support. The vital feature of macromolecular surface construction is also unavailable. We have developed iview, an easy-to-use interactive WebGL visualizer of protein-ligand complex. It exploits hardware acceleration rather than software rendering. It features three special effects in virtual reality settings, namely anaglyph, parallax barrier and oculus rift, resulting in visually appealing identification of intermolecular interactions. It supports four surface representations including Van der Waals surface, solvent excluded surface, solvent accessible surface and molecular surface. Moreover, based on the feature-rich version of iview, we have also developed a neat and tailor-made version specifically for our istar web platform for protein-ligand docking purpose. This demonstrates the excellent portability of iview. Using innovative 3D techniques, we provide a user friendly visualizer that is not intended to compete with professional visualizers, but to enable easy accessibility and platform independence.
Directory of Open Access Journals (Sweden)
Anatoliy Klimyk
2007-02-01
Full Text Available In the paper, properties of antisymmetric orbit functions are reviewed and further developed. Antisymmetric orbit functions on the Euclidean space $E_n$ are antisymmetrized exponential functions. Antisymmetrization is fulfilled by a Weyl group, corresponding to a Coxeter-Dynkin diagram. Properties of such functions are described. These functions are closely related to irreducible characters of a compact semisimple Lie group $G$ of rank $n$. Up to a sign, values of antisymmetric orbit functions are repeated on copies of the fundamental domain $F$ of the affine Weyl group (determined by the initial Weyl group in the entire Euclidean space $E_n$. Antisymmetric orbit functions are solutions of the corresponding Laplace equation in $E_n$, vanishing on the boundary of the fundamental domain $F$. Antisymmetric orbit functions determine a so-called antisymmetrized Fourier transform which is closely related to expansions of central functions in characters of irreducible representations of the group $G$. They also determine a transform on a finite set of points of $F$ (the discrete antisymmetric orbit function transform. Symmetric and antisymmetric multivariate exponential, sine and cosine discrete transforms are given.
Angles-only relative orbit determination in low earth orbit
Ardaens, Jean-Sébastien; Gaias, Gabriella
2018-06-01
The paper provides an overview of the angles-only relative orbit determination activities conducted to support the Autonomous Vision Approach Navigation and Target Identification (AVANTI) experiment. This in-orbit endeavor was carried out by the German Space Operations Center (DLR/GSOC) in autumn 2016 to demonstrate the capability to perform spaceborne autonomous close-proximity operations using solely line-of-sight measurements. The images collected onboard have been reprocessed by an independent on-ground facility for precise relative orbit determination, which served as ultimate instance to monitor the formation safety and to characterize the onboard navigation and control performances. During two months, several rendezvous have been executed, generating a valuable collection of images taken at distances ranging from 50 km to only 50 m. Despite challenging experimental conditions characterized by a poor visibility and strong orbit perturbations, angles-only relative positioning products could be continuously derived throughout the whole experiment timeline, promising accuracy at the meter level during the close approaches. The results presented in the paper are complemented with former angles-only experience gained with the PRISMA satellites to better highlight the specificities induced by different orbits and satellite designs.
Directory of Open Access Journals (Sweden)
Jeffrey M Joseph
2011-01-01
Full Text Available Jeffrey M Joseph, Ioannis P GlavasDivision of Ophthalmic Plastic and Reconstructive Surgery, Department of Ophthalmology, School of Medicine, New York University, New York, NY, USA; Manhattan Eye, Ear, and Throat Hospital, New York, NY, USAAbstract: This review of orbital fractures has three goals: 1 to understand the clinically relevant orbital anatomy with regard to periorbital trauma and orbital fractures, 2 to explain how to assess and examine a patient after periorbital trauma, and 3 to understand the medical and surgical management of orbital fractures. The article aims to summarize the evaluation and management of commonly encountered orbital fractures from the ophthalmologic perspective and to provide an overview for all practicing ophthalmologists and ophthalmologists in training.Keywords: orbit, trauma, fracture, orbital floor, medial wall, zygomatic, zygomatic complex, zmc fracture, zygomaticomaxillary complex fractures
Spectral data for a pair of matrices of order three and an action of the group GL(2,Z)
International Nuclear Information System (INIS)
Neretin, Yurii A
2011-01-01
We consider the 10-dimensional complex space whose points are cubic curves on the projective complex plane with three marked points. The triples of marked points on the curve are defined up to equivalence of divisors. We construct a natural action of the group GL(2,Z) on this space.
Plan estratégico para la empresa Global Logistics (GL) para el periodo 2017-2019
Castello Manky, Luis Fernando; Grados Iturrizaga, Miguel Augusto; Hudson Okumura, Ciro
2017-01-01
El presente trabajo de investigación tiene como finalidad el desarrollo de un plan estratégico para la empresa Global Logistics (GL) para los años 2017 a 2019. Inicia con el análisis y diagnóstico situacional, donde se analiza el macroentorno en base al análisis PESTEL y luego se procede a analizar la industria considerando las cinco fuerzas de Porter, para, finalmente, determinar las oportunidades y amenazas que enfrenta la empresa. Una vez concluido el análisis y diagnóstico situacional, se...
Study of 3D visualization of fast active reflector based on openGL and EPICS
International Nuclear Information System (INIS)
Luo Mingcheng; Wu Wenqing; Liu Jiajing; Tang Pengyi; Wang Jian
2014-01-01
Active Reflector is the one of the innovations of Five hundred meter Aperture Spherical Telescope (FAST). Its performance will influence the performance of whole telescope and for display all status of ARS in real time, the EPICS (Experimental Physics and Industrial Control System) is used to develop the control system of ARS and virtual 3D technology-OpenGL is used to visualize the status. For the real-time performance of EPICS, the status visualization is also display in real time for users to improve the efficiency of telescope observing. (authors)
Hara, Yasuo
1975-01-01
Peripheral orbit model, in which an incoming hadron is assumed to revolve in a peripheral orbit around a target hadron, is discussed. The non-diffractive parts of two-body reaction amplitudes of hadrons are expressed in terms of the radius, width an absorptivity of the orbit. The radius of the orbit is about 1 fm and the width of the orbit is determined by the range of the interaction between the hadrons. The model reproduces all available experimental data on differential cross-sections and polarizations of $K^{-}p\\to K^{-}p$ and $\\bar K^{\\circ}n$ reactions for all angles successfully. This contribution is not included in the proceedings since it will appear in Progress of Theoretical Physics Vol. 51 (1974) No 2. Any person interested in the subject may apply for reprints to the author.
International Nuclear Information System (INIS)
Oertel, H. Jr.; Koerner, H.
1993-01-01
The Third Aerospace Symposium in Braunschweig presented, for the first time, the possibility of bringing together the classical disciplines of aerospace engineering and the natural science disciplines of meteorology and air chemistry in a european setting. In this way, aspects of environmental impact on the atmosphere could be examined quantitatively. An essential finding of the european conference, is the unrestricted agreement of the experts that the given launch frequencies of the present orbital transport result in a negligible amount of pollutants being released in the atmosphere. The symposium does, however, call attention to the increasing need to consider the effect of orbital and atmospheric environmental impact of a future increase in launch frequencies of orbital transport in connection with future space stations. The Third Aerospace Symposium, 'Orbital Transport, Technical, Meteorological and Chemical Aspects', constituted a first forum of discussion for engineers and scientists. Questions of new orbital transport technologies and their environmental impact were to be discussed towards a first consensus. Through the 34 reports and articles, the general problems of space transportation and environmental protection were addressed, as well as particular aspects of high temperatures during reentry in the atmosphere of the earth, precision navigation of flight vehicles or flow behavior and air chemistry in the stratosphere. (orig./CT). 342 figs
Orbital apex syndrome associated with fractures of the inferomedial orbital wall
Directory of Open Access Journals (Sweden)
Sugamata A
2013-03-01
Full Text Available Akira SugamataDepartment of Plastic and Reconstructive Surgery, Tokyo Medical University Hachioji Medical Center, Tokyo, JapanAbstract: Although trauma is one of the main causes of orbital apex syndrome (OAS, reports of OAS associated with orbital fractures are relatively rare. We recently treated two patients who sustained severe visual impairment with damage to multiple cranial nerves (third to sixth associated with inferomedial orbital wall fractures. In these patients, posterior movement of the globe caused neuropathy of the cranial and optic nerves by posterior globe edema and hemorrhage, or direct impact between the globe and wall, which might then have induced OAS in the cases described in this report. Steroid therapy was unsuccessful for optic neuropathy due to the delay between injury and administration. When treating patients with inferomedial orbital blowout fractures due to globe-to-wall contact, it is necessary to routinely assess and monitor visual acuity since there may be a delay between the injury and OAS onset.Keywords: orbital apex syndrome, orbital fracture, blowout fracture, optic nerve, globe-to-wall contact mechanism
On the atmospheric drag in orbit determination for low Earth orbit
Tang, Jingshi; Liu, Lin; Miao, Manqian
2012-07-01
The atmosphere model is always a major limitation for low Earth orbit (LEO) in orbit prediction and determination. The accelerometer can work around the non-gravitational perturbations in orbit determination, but it helps little to improve the atmosphere model or to predict the orbit. For certain satellites, there may be some specific software to handle the orbit problem. This solution can improve the orbit accuracy for both prediction and determination, yet it always contains empirical terms and is exclusive for certain satellites. This report introduces a simple way to handle the atmosphere drag for LEO, which does not depend on instantaneous atmosphere conditions and improves accuracy of predicted orbit. This approach, which is based on mean atmospheric density, is supported by two reasons. One is that although instantaneous atmospheric density is very complicated with time and height, the major pattern is determined by the exponential variation caused by hydrostatic equilibrium and periodic variation caused by solar radiation. The mean density can include the major variations while neglect other minor details. The other reason is that the predicted orbit is mathematically the result from integral and the really determinant factor is the mean density instead of instantaneous density for every time and spot. Using the mean atmospheric density, which is mainly determined by F10.7 solar flux and geomagnetic index, can be combined into an overall parameter B^{*} = C_{D}(S/m)ρ_{p_{0}}. The combined parameter contains several less accurate parameters and can be corrected during orbit determination. This approach has been confirmed in various LEO computations and an example is given below using Tiangong-1 spacecraft. Precise orbit determination (POD) is done using one-day GPS positioning data without any accurate a-priori knowledge on spacecraft or atmosphere conditions. Using the corrected initial state vector of the spacecraft and the parameter B^* from POD, the
Space station orbit maintenance
Kaplan, D. I.; Jones, R. M.
1983-01-01
The orbit maintenance problem is examined for two low-earth-orbiting space station concepts - the large, manned Space Operations Center (SOC) and the smaller, unmanned Science and Applications Space Platform (SASP). Atmospheric drag forces are calculated, and circular orbit altitudes are selected to assure a 90 day decay period in the event of catastrophic propulsion system failure. Several thrusting strategies for orbit maintenance are discussed. Various chemical and electric propulsion systems for orbit maintenance are compared on the basis of propellant resupply requirements, power requirements, Shuttle launch costs, and technology readiness.
Patología quirúrgica de glándulas salivales: Reporte de 79 casos
Directory of Open Access Journals (Sweden)
Enrique Pérez Abreus
1999-12-01
Full Text Available Se realiza una revisión actualizada de la patología quirúrgica de las glándulas salivales mayores y se presentan los resultados obtenidos en 7 años de experiencia, comprendidos de enero de 1990 a diciembre de 1996 en 79 pacientes portadores de esta patología en el Hospital Provincial Clinicoquirúrgico Docente "Dr. Gustavo Aldereguía Lima" de Cienfuegos. Se analizan los diferentes procesos inflamatorios, litiásicos y tumorales de las glándulas salivales y la terapéutica empleada. La edad media fue de 50,7 años, con un predominio del sexo femenino; la patología más frecuente fue la tumoral y dentro de ésta los adenomas, con el 52 %, seguidos de las lesiones afines con el 29,1 % y los carcinomas con el 10,2 %. La cirugía sola o combinada con otros procederes fueron los principales pilares de tratamiento.We made an updated review on surgical pathology of major salivary glands and to present results pobtained for 7 years of experience, from January 1990 to December 1996 in 79 patients presentig with this pathology in "Dr. Gustavo Aldereguía" Teaching Clinical Surgical Hospital of Cienfuegos province. Different inflammatory, lithiasic and tumoral processes of salivary glands as well as therapeutics used were analyzed. Mean age was 50.7 years with a predominance of female sex; commonest pathology was tumoral type including adenomas (52 %, followed by relate injuries (29.1 %, and carcinomas (10.2 %. Surgery alone or combined with others procedures were main cornerstones of treatment.
Orbit error characteristic and distribution of TLE using CHAMP orbit data
Xu, Xiao-li; Xiong, Yong-qing
2018-02-01
Space object orbital covariance data is required for collision risk assessments, but publicly accessible two line element (TLE) data does not provide orbital error information. This paper compared historical TLE data and GPS precision ephemerides of CHAMP to assess TLE orbit accuracy from 2002 to 2008, inclusive. TLE error spatial variations with longitude and latitude were calculated to analyze error characteristics and distribution. The results indicate that TLE orbit data are systematically biased from the limited SGP4 model. The biases can reach the level of kilometers, and the sign and magnitude are correlate significantly with longitude.
An Orbit Propagation Software for Mars Orbiting Spacecraft
Directory of Open Access Journals (Sweden)
Young-Joo Song
2004-12-01
Full Text Available An orbit propagation software for the Mars orbiting spacecraft has been developed and verified in preparations for the future Korean Mars missions. Dynamic model for Mars orbiting spacecraft has been studied, and Mars centered coordinate systems are utilized to express spacecraft state vectors. Coordinate corrections to the Mars centered coordinate system have been made to adjust the effects caused by Mars precession and nutation. After spacecraft enters Sphere of Influence (SOI of the Mars, the spacecraft experiences various perturbation effects as it approaches to Mars. Every possible perturbation effect is considered during integrations of spacecraft state vectors. The Mars50c gravity field model and the Mars-GRAM 2001 model are used to compute perturbation effects due to Mars gravity field and Mars atmospheric drag, respectively. To compute exact locations of other planets, JPL's DE405 ephemerides are used. Phobos and Deimos's ephemeris are computed using analytical method because their informations are not released with DE405. Mars Global Surveyor's mapping orbital data are used to verify the developed propagator performances. After one Martian day propagation (12 orbital periods, the results show about maximum ±5 meter errors, in every position state components(radial, cross-track and along-track, when compared to these from the Astrogator propagation in the Satellite Tool Kit. This result shows high reliability of the developed software which can be used to design near Mars missions for Korea, in future.
Burn Delay Analysis of the Lunar Orbit Insertion for Korea Pathfinder Lunar Orbiter
Bae, Jonghee; Song, Young-Joo; Kim, Young-Rok; Kim, Bangyeop
2017-12-01
The first Korea lunar orbiter, Korea Pathfinder Lunar Orbiter (KPLO), has been in development since 2016. After launch, the KPLO will execute several maneuvers to enter into the lunar mission orbit, and will then perform lunar science missions for one year. Among these maneuvers, the lunar orbit insertion (LOI) is the most critical maneuver because the KPLO will experience an extreme velocity change in the presence of the Moon’s gravitational pull. However, the lunar orbiter may have a delayed LOI burn during operation due to hardware limitations and telemetry delays. This delayed burn could occur in different captured lunar orbits; in the worst case, the KPLO could fly away from the Moon. Therefore, in this study, the burn delay for the first LOI maneuver is analyzed to successfully enter the desired lunar orbit. Numerical simulations are performed to evaluate the difference between the desired and delayed lunar orbits due to a burn delay in the LOI maneuver. Based on this analysis, critical factors in the LOI maneuver, the periselene altitude and orbit period, are significantly changed and an additional delta-V in the second LOI maneuver is required as the delay burn interval increases to 10 min from the planned maneuver epoch.
GLONASS Orbits in Teqc: Methodology and Future Extension for Using SP3 Orbits
Estey, L.; Wier, S.
2011-12-01
UNAVCO's teqc software package provides translation of a wide variety of GNSS receiver formats, metadata editing (either during translation to RINEX or on existing RINEX files), time-windowing and epoch decimation editing, and quality check (qc) analysis. Teqc is used extensively in GNSS pre-processing, and is designed to handle mixed satellite constellations, such as GPS, GLONASS, Galileo, and SBAS. The latest release of teqc adds GLONASS orbit calculations using GLONASS broadcast navigation messages, read from RINEX file format, during qc. The ephemerides for each GLONASS SV have time and orbit position in Earth-centered, Earth-fixed x, y, and z coordinates. Following Schenewerk [2003], we use trigonometric interpolation, essentially a fit of a partial sum of the Fourier series for each time-varying cartesian orbital component, allowing estimates of orbit positions at most GLONASS observation times. Tests show the interpolated GLONASS orbits made from the broadcast messages diverge from final orbits little more than the same differences using GPS orbits computed from their broadcast messages. Since GLONASS ephemerides do not use Keplerian orbital elements, GLONASS SV orbits can only be interpolated using this method for time intervals when an adequate sequence of ephemerides are available. For typical daily navigation messages collected at a single sit, when a GLONASS SV is in view less than three hours, that SV's signals are generally not used by teqc due to less precise orbit positions. Teqc quality control including SV position can now use GPS alone, GLONASS alone, or the joint solution. Future work will extend teqc to use SP3 format files, such as the IGS final orbit files, and SBAS data, which have broadcast ephemerides with elements similar to GLONASS.
International Nuclear Information System (INIS)
Bhatti, S.N.H.N.; Sadaf, S.; Sadaf, S.; Farrukh, Z.; Noreen, S.
2014-01-01
Pollution control is one of the leading issues of society today. The present study was designed to remove the Drimarine Yellow HF-3GL dye from aqueous solutions through biosorption. Sugarcane bagasse was used as biosorbent in native, acetic acid treated and immobilized form. Batch study was conducted to optimize different system variables like pH of solution, medium temperature, biosorbent concentration, initial dye concentration and contact time. Maximum dye removal was observed at pH 2, biosorbent dose of 0.05 g/50 mL and 40 degree C temperature. The equilibrium was achieved in 45-90 min. Different kinetic and equilibrium models were applied to the experimental results. The biosorption kinetic data was found to follow the pseudo second order kinetic model. Freundlich adsorption isotherm model showed a better fitness to the equilibrium data. The value of Gibbs free energy revealed that biosorption of Drimarine Yellow HF-3GL dye by native and pretreated sugarcane bagasse was a spontaneous process. Presence of salt and heavy metal ions in aqueous solution enhanced the biosorption capacity while presence of surfactants decreased the biosorption potential of biosorbent. Dye was desorbed by 1M NaOH solution. Fixed bed column study of Drimarine Yellow HF-3GL was carried out to optimize different parameters like bed height, flow rate and initial dye concentration. It was observed that biosorption capacity increases with increase in initial dye concentration and bed height but decreases with the increase in flow rate. The data of column study was explained very well by BDST model. FT-IR analysis confirmed the involvement of various functional groups, mainly hydroxyl, carboxyl and amine groups. The results proved that sugarcane bagasse waste biomass can be used as a favorable biosorbent for the removal of dyes from aqueous solutions. (author)
Warsitzka, Michael; Kley, Jonas; Jähne-Klingberg, Fabian; Kukowski, Nina
2017-01-01
The formation of salt structures exerted a major influence on the evolution of subsidence and sedimentation patterns in the Glückstadt Graben, which is part of the Central European Basin System and comprises a post-Permian sediment thickness of up to 11 km. Driven by regional tectonics and differential loading, large salt diapirs, salt walls and salt pillows developed. The resulting salt flow significantly influenced sediment distribution in the peripheral sinks adjacent to the salt structures and overprinted the regional subsidence patterns. In this study, we investigate the geometric and temporal evolution of salt structures and subsidence patterns in the central Glückstadt Graben. Along a key geological cross section, the post-Permian strata were sequentially decompacted and restored in order to reconstruct the subsidence history of minibasins between the salt structures. The structural restoration reveals that subsidence of peripheral sinks and salt structure growth were initiated in Early to Middle Triassic time. From the Late Triassic to the Middle Jurassic, salt movement and salt structure growth never ceased, but were faster during periods of crustal extension. Following a phase from Late Jurassic to the end of the early Late Cretaceous, in which minor salt flow occurred, salt movement was renewed, particularly in the marginal parts of the Glückstadt Graben. Subsidence rates and tectonic subsidence derived from backstripping of 1D profiles reveal that especially the Early Triassic and Middle Keuper times were periods of regional extension. Three specific types of salt structures and adjacent peripheral sinks could be identified: (1) Graben centre salt walls possessing deep secondary peripheral sinks on the sides facing away from the basin centre, (2) platform salt walls, whose main peripheral sinks switched multiple times from one side of the salt wall to the other, and (3) Graben edge pillows, which show only one peripheral sink facing the basin centre.
Nontraumatic orbital roof encephalocele.
Hoang, Amber; Maugans, Todd; Ngo, Thang; Ikeda, Jamie
2017-02-01
Intraorbital meningoencephaloceles occur most commonly as a complication of traumatic orbital roof fractures. Nontraumatic congenital orbital meningoncephaloceles are very rare, with most secondary to destructive processes affecting the orbit and primary skull defects. Treatment for intraorbital meningoencephaloceles is surgical repair, involving the excision of herniated brain parenchyma and meninges and reconstruction of the osseous defect. Most congenital lesions present in infancy with obvious globe and orbital deformities; we report an orbital meningoencephalocele in a 3-year-old girl who presented with ptosis. Copyright © 2017 American Association for Pediatric Ophthalmology and Strabismus. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Jiri Patera
2008-01-01
Full Text Available We review and further develop the theory of $E$-orbit functions. They are functions on the Euclidean space $E_n$ obtained from the multivariate exponential function by symmetrization by means of an even part $W_{e}$ of a Weyl group $W$, corresponding to a Coxeter-Dynkin diagram. Properties of such functions are described. They are closely related to symmetric and antisymmetric orbit functions which are received from exponential functions by symmetrization and antisymmetrization procedure by means of a Weyl group $W$. The $E$-orbit functions, determined by integral parameters, are invariant withrespect to even part $W^{aff}_{e}$ of the affine Weyl group corresponding to $W$. The $E$-orbit functions determine a symmetrized Fourier transform, where these functions serve as a kernel of the transform. They also determine a transform on a finite set of points of the fundamental domain $F^{e}$ of the group $W^{aff}_{e}$ (the discrete $E$-orbit function transform.
Congenital orbital encephalocele, orbital dystopia, and exophthalmos.
Hwang, Kun; Kim, Han Joon
2012-07-01
We present here an exceedingly rare variant of a nonmidline basal encephalocele of the spheno-orbital type, and this was accompanied with orbital dystopia in a 56-year-old man. On examination, his left eye was located more inferolaterally than his right eye, and the patient said this had been this way since his birth. The protrusion of his left eye was aggravated when he is tired. His naked visual acuity was 0.7/0.3, and the ocular pressure was 14/12 mm Hg. The exophthalmometry was 10/14 to 16 mm. His eyeball motion was not restricted, yet diplopia was present in all directions. The distance from the midline to the medial canthus was 20/15 mm. The distance from the midline to the midpupillary line was 35/22 mm. The vertical dimension of the palpebral fissure was 12/9 mm. The height difference of the upper eyelid margin was 11 mm, and the height difference of the lower eyelid margin was 8 mm. Facial computed tomography and magnetic resonance imaging showed left sphenoid wing hypoplasia and herniation of the left anterior temporal pole and dura mater into the orbit, and this resulted into left exophthalmos and encephalomalacia in the left anterior temporal pole. To the best of our knowledge, our case is the second case of basal encephalocele and orbital dystopia.
Measurement of orbital volume by computed tomography. Especially on the growth of orbit
Energy Technology Data Exchange (ETDEWEB)
Furuta, Minoru [Fukushima Medical Coll. (Japan)
2000-10-01
Using reconstructed X-ray computed tomography (CT) images of serial coronal sections, we measured the orbital volume and studied its changes with age. The subjects consisted of 109 patients (74 males, 35 females) who had undergone X-ray CT. After the reproducibility of orbital volume measurements and laterality in individuals were confirmed, the relation between the orbital volume and the age, sex, weight, and interlateral orbital rim distance were examined. The difference between two measurements in the same patients was 0.4% for measured volume, which showed the reproducibility of this measurement to be good. The laterality in individuals was 0.06 cm{sup 3}: this difference was very small and not significant. The orbital volume showed no unbalance between the right and left at any stage of growth. Both the height and the interlateral orbital rim distance had a strong correlation with the orbital volume. Referring to the relation between age and orbital volume, a strong correlation with an almost identical approximate equation was obtained for both sexes under 12 years of age. Presumably, the rapid growth of the orbit comes to an end by 15 years of age in males and 11 years in females. This means that more than 95% growth of adults has already been completed in the first half of the teens. The mean orbital volume in adult Japanese is 23.6{+-}2.0 (mean{+-}standard deviation) cm{sup 3} in males and 20.9{+-}1.3 cm{sup 3} in females. (author)
Measurement of orbital volume by computed tomography. Especially on the growth of orbit
International Nuclear Information System (INIS)
Furuta, Minoru
2000-01-01
Using reconstructed X-ray computed tomography (CT) images of serial coronal sections, we measured the orbital volume and studied its changes with age. The subjects consisted of 109 patients (74 males, 35 females) who had undergone X-ray CT. After the reproducibility of orbital volume measurements and laterality in individuals were confirmed, the relation between the orbital volume and the age, sex, weight, and interlateral orbital rim distance were examined. The difference between two measurements in the same patients was 0.4% for measured volume, which showed the reproducibility of this measurement to be good. The laterality in individuals was 0.06 cm 3 : this difference was very small and not significant. The orbital volume showed no unbalance between the right and left at any stage of growth. Both the height and the interlateral orbital rim distance had a strong correlation with the orbital volume. Referring to the relation between age and orbital volume, a strong correlation with an almost identical approximate equation was obtained for both sexes under 12 years of age. Presumably, the rapid growth of the orbit comes to an end by 15 years of age in males and 11 years in females. This means that more than 95% growth of adults has already been completed in the first half of the teens. The mean orbital volume in adult Japanese is 23.6±2.0 (mean±standard deviation) cm 3 in males and 20.9±1.3 cm 3 in females. (author)
Low-Cost 3D Printing Orbital Implant Templates in Secondary Orbital Reconstructions.
Callahan, Alison B; Campbell, Ashley A; Petris, Carisa; Kazim, Michael
Despite its increasing use in craniofacial reconstructions, three-dimensional (3D) printing of customized orbital implants has not been widely adopted. Limitations include the cost of 3D printers able to print in a biocompatible material suitable for implantation in the orbit and the breadth of available implant materials. The authors report the technique of low-cost 3D printing of orbital implant templates used in complex, often secondary, orbital reconstructions. A retrospective case series of 5 orbital reconstructions utilizing a technique of 3D printed orbital implant templates is presented. Each patient's Digital Imaging and Communications in Medicine data were uploaded and processed to create 3D renderings upon which a customized implant was designed and sent electronically to printers open for student use at our affiliated institutions. The mock implants were sterilized and used intraoperatively as a stencil and mold. The final implant material was chosen by the surgeons based on the requirements of the case. Five orbital reconstructions were performed with this technique: 3 tumor reconstructions and 2 orbital fractures. Four of the 5 cases were secondary reconstructions. Molded Medpor Titan (Stryker, Kalamazoo, MI) implants were used in 4 cases and titanium mesh in 1 case. The stenciled and molded implants were adjusted no more than 2 times before anchored in place (mean 1). No case underwent further revision. The technique and cases presented demonstrate 1) the feasibility and accessibility of low-cost, independent use of 3D printing technology to fashion patient-specific implants in orbital reconstructions, 2) the ability to apply this technology to the surgeon's preference of any routinely implantable material, and 3) the utility of this technique in complex, secondary reconstructions.
THE CALIFORNIA PLANET SURVEY. I. FOUR NEW GIANT EXOPLANETS
International Nuclear Information System (INIS)
Howard, Andrew W.; Marcy, Geoffrey W.; Peek, Kathryn M. G.; Johnson, John Asher; Fischer, Debra A.; Isaacson, Howard; Wright, Jason T.; Bernat, David; Henry, Gregory W.; Apps, Kevin; Endl, Michael; Cochran, William D.; Valenti, Jeff A.; Anderson, Jay; Piskunov, Nikolai E.
2010-01-01
We present precise Doppler measurements of four stars obtained during the past decade at Keck Observatory by the California Planet Survey (CPS). These stars, namely, HD 34445, HD 126614, HD 13931, and Gl 179, all show evidence for a single planet in Keplerian motion. We also present Doppler measurements from the Hobby-Eberly Telescope (HET) for two of the stars, HD 34445 and Gl 179, that confirm the Keck detections and significantly refine the orbital parameters. These planets add to the statistical properties of giant planets orbiting near or beyond the ice line, and merit follow-up by astrometry, imaging, and space-borne spectroscopy. Their orbital parameters span wide ranges of planetary minimum mass (M sin i = 0.38-1.9 M Jup ), orbital period (P = 2.87-11.5 yr), semimajor axis (a = 2.1-5.2 AU), and eccentricity (e = 0.02-0.41). HD 34445 b (P = 2.87 yr, M sin i = 0.79 M Jup , e = 0.27) is a massive planet orbiting an old, G-type star. We announce a planet, HD 126614 Ab, and an M dwarf, HD 126614 B, orbiting the metal-rich star HD 126614 (which we now refer to as HD 126614 A). The planet, HD 126614 Ab, has minimum mass M sin i = 0.38 M Jup and orbits the stellar primary with period P = 3.41 yr and orbital separation a = 2.3 AU. The faint M dwarf companion, HD 126614 B, is separated from the stellar primary by 489 mas (33 AU) and was discovered with direct observations using adaptive optics and the PHARO camera at Palomar Observatory. The stellar primary in this new system, HD 126614 A, has the highest measured metallicity ([Fe/H] = +0.56) of any known planet-bearing star. HD 13931 b (P = 11.5 yr, M sin i = 1.88 M Jup , e = 0.02) is a Jupiter analog orbiting a near solar twin. Gl 179 b (P = 6.3 yr, M sin i = 0.82 M Jup , e = 0.21) is a massive planet orbiting a faint M dwarf. The high metallicity of Gl 179 is consistent with the planet-metallicity correlation among M dwarfs, as documented recently by Johnson and Apps.
Stable low-altitude orbits around Ganymede considering a disturbing body in a circular orbit
Cardoso dos Santos, J.; Carvalho, J. P. S.; Vilhena de Moraes, R.
2014-10-01
Some missions are being planned to visit Ganymede like the Europa Jupiter System Mission that is a cooperation between NASA and ESA to insert the spacecraft JGO (Jupiter Ganymede Orbiter) into Ganymedes orbit. This comprehension of the dynamics of these orbits around this planetary satellite is essential for the success of this type of mission. Thus, this work aims to perform a search for low-altitude orbits around Ganymede. An emphasis is given in polar orbits and it can be useful in the planning of space missions to be conducted around, with respect to the stability of orbits of artificial satellites. The study considers orbits of artificial satellites around Ganymede under the influence of the third-body (Jupiter's gravitational attraction) and the polygenic perturbations like those due to non-uniform distribution of mass (J_2 and J_3) of the main body. A simplified dynamic model for these perturbations is used. The Lagrange planetary equations are used to describe the orbital motion of the artificial satellite. The equations of motion are developed in closed form to avoid expansions in eccentricity and inclination. The results show the argument of pericenter circulating. However, low-altitude (100 and 150 km) polar orbits are stable. Another orbital elements behaved variating with small amplitudes. Thus, such orbits are convenient to be applied to future space missions to Ganymede. Acknowledgments: FAPESP (processes n° 2011/05671-5, 2012/12539-9 and 2012/21023-6).
Titan Orbiter Aerorover Mission
Sittler Jr., E. C.; Acuna, M.; Burchell, M. J.; Coates, A.; Farrell, W.; Flasar, M.; Goldstein, B. E.; Gorevan, S.; Hartle, R. E.; Johnson, W. T. K.
2001-01-01
We propose a combined Titan orbiter and Titan Aerorover mission with an emphasis on both in situ and remote sensing measurements of Titan's surface, atmosphere, ionosphere, and magnetospheric interaction. The biological aspect of the Titan environment will be emphasized by the mission (i.e., search for organic materials which may include simple organics to 'amono' analogues of amino acids and possibly more complex, lightening detection and infrared, ultraviolet, and charged particle interactions with Titan's surface and atmosphere). An international mission is assumed to control costs. NASA will provide the orbiter, launch vehicle, DSN coverage and operations, while international partners will provide the Aerorover and up to 30% of the cost for the scientific instruments through collaborative efforts. To further reduce costs we propose a single PI for orbiter science instruments and a single PI for Aerorover science instruments. This approach will provide single command/data and power interface between spacecraft and orbiter instruments that will have redundant central DPU and power converter for their instruments. A similar approach could be used for the Aerorover. The mission profile will be constructed to minimize conflicts between Aerorover science, orbiter radar science, orbiter radio science, orbiter imaging science, and orbiter fields and particles (FP) science. Additional information is contained in the original extended abstract.
Harmonically excited orbital variations
International Nuclear Information System (INIS)
Morgan, T.
1985-01-01
Rephrasing the equations of motion for orbital maneuvers in terms of Lagrangian generalized coordinates instead of Newtonian rectangular cartesian coordinates can make certain harmonic terms in the orbital angular momentum vector more readily apparent. In this formulation the equations of motion adopt the form of a damped harmonic oscillator when torques are applied to the orbit in a variationally prescribed manner. The frequencies of the oscillator equation are in some ways unexpected but can nonetheless be exploited through resonant forcing functions to achieve large secular variations in the orbital elements. Two cases are discussed using a circular orbit as the control case: (1) large changes in orbital inclination achieved by harmonic excitation rather than one impulsive velocity change, and (2) periodic and secular changes to the longitude of the ascending node using both stable and unstable excitation strategies. The implications of these equations are also discussed for both artificial satellites and natural satellites. For the former, two utilitarian orbits are suggested, each exploiting a form of harmonic excitation. 5 refs
Dynamic and reduced-dynamic precise orbit determination of satellites in low earth orbits
International Nuclear Information System (INIS)
Swatschina, P.
2009-01-01
The precise positioning of satellites in Low Earth Orbits (LEO) has become a key technology for advanced space missions. Dedicated satellite missions, such as CHAMP, GRACE and GOCE, that aim to map the Earths gravity field and its variation over time with unprecedented accuracy, initiated the demand for highly precise orbit solutions of LEO satellites. Furthermore, a wide range of additional science opportunities opens up with the capability to generate accurate LEO orbits. For all considered satellite missions, the primary measurement system for navigation is a spaceborne GPS receiver. The goal of this thesis is to establish and implement methods for Precise Orbit Determination (POD) of LEO satellites using GPS. Striving for highest precision using yet efficient orbit generation strategies, the attained orbit solutions are aimed to be competitive with the most advanced solutions of other institutions. Dynamic and reduced-dynamic orbit models provide the basic concepts of this work. These orbit models are subsequently adjusted to the highly accurate GPS measurements. The GPS measurements are introduced at the zero difference level in the ionosphere free linear combination. Appropriate procedures for GPS data screening and editing are established to detect erroneous data and to employ measurements of good quality only. For the dynamic orbit model a sophisticated force model, especially designed for LEO satellites, has been developed. In order to overcome the limitations that are induced by the deficiencies of the purely dynamical model, two different types of empirical parameters are introduced into the force model. These reduced-dynamic orbit models allow for the generation of much longer orbital arcs while preserving the spacecraft dynamics to the most possible extent. The two methods for reduced-dynamic orbit modeling are instantaneous velocity changes (pulses) or piecewise constant accelerations. For both techniques highly efficient modeling algorithms are
On Parametrization of the Linear GL(4,C) and Unitary SU(4) Groups in Terms of Dirac Matrices
Red'Kov, Victor M.; Bogush, Andrei A.; Tokarevskaya, Natalia G.
2008-02-01
Parametrization of 4 × 4-matrices G of the complex linear group GL(4,C) in terms of four complex 4-vector parameters (k,m,n,l) is investigated. Additional restrictions separating some subgroups of GL(4,C) are given explicitly. In the given parametrization, the problem of inverting any 4 × 4 matrix G is solved. Expression for determinant of any matrix G is found: det G = F(k,m,n,l). Unitarity conditions G+ = G-1 have been formulated in the form of non-linear cubic algebraic equations including complex conjugation. Several simplest solutions of these unitarity equations have been found: three 2-parametric subgroups G1, G2, G3 - each of subgroups consists of two commuting Abelian unitary groups; 4-parametric unitary subgroup consis! ting of a product of a 3-parametric group isomorphic SU(2) and 1-parametric Abelian group. The Dirac basis of generators Λk, being of Gell-Mann type, substantially differs from the basis λi used in the literature on SU(4) group, formulas relating them are found - they permit to separate SU(3) subgroup in SU(4). Special way to list 15 Dirac generators of GL(4,C) can be used {Λk} = {μiÅνjÅ(μiVνj = KÅL ÅM )}, which permit to factorize SU(4) transformations according to S = eiaμ eibνeikKeilLeimM, where two first factors commute with each other and are isomorphic to SU(2) group, the three last ones are 3-parametric groups, each of them consisting of three Abelian commuting unitary subgroups. Besides, the structure of fifteen Dirac matrices Λk permits to separate twenty 3-parametric subgroups in SU(4) isomorphic to SU(2); those subgroups might be used as bigger elementary blocks in constructing of a general transformation SU(4). It is shown how one can specify the present approach for the pseudounitary group SU(2,2) and SU(3,1).
Spin-orbit torques from interfacial spin-orbit coupling for various interfaces
Kim, Kyoung-Whan; Lee, Kyung-Jin; Sinova, Jairo; Lee, Hyun-Woo; Stiles, M. D.
2017-09-01
We use a perturbative approach to study the effects of interfacial spin-orbit coupling in magnetic multilayers by treating the two-dimensional Rashba model in a fully three-dimensional description of electron transport near an interface. This formalism provides a compact analytic expression for current-induced spin-orbit torques in terms of unperturbed scattering coefficients, allowing computation of spin-orbit torques for various contexts, by simply substituting scattering coefficients into the formulas. It applies to calculations of spin-orbit torques for magnetic bilayers with bulk magnetism, those with interface magnetism, a normal-metal/ferromagnetic insulator junction, and a topological insulator/ferromagnet junction. It predicts a dampinglike component of spin-orbit torque that is distinct from any intrinsic contribution or those that arise from particular spin relaxation mechanisms. We discuss the effects of proximity-induced magnetism and insertion of an additional layer and provide formulas for in-plane current, which is induced by a perpendicular bias, anisotropic magnetoresistance, and spin memory loss in the same formalism.
Kikuchi, Shota; Howell, Kathleen C.; Tsuda, Yuichi; Kawaguchi, Jun'ichiro
2017-11-01
The motion of a spacecraft in proximity to a small body is significantly perturbed due to its irregular gravity field and solar radiation pressure. In such a strongly perturbed environment, the coupling effect of the orbital and attitude motions exerts a large influence that cannot be neglected. However, natural orbit-attitude coupled dynamics around small bodies that are stationary in both orbital and attitude motions have yet to be observed. The present study therefore investigates natural coupled motion that involves both a Sun-synchronous orbit and Sun-tracking attitude motion. This orbit-attitude coupled motion enables a spacecraft to maintain its orbital geometry and attitude state with respect to the Sun without requiring active control. Therefore, the proposed method can reduce the use of an orbit and attitude control system. This paper first presents analytical conditions to achieve Sun-synchronous orbits and Sun-tracking attitude motion. These analytical solutions are then numerically propagated based on non-linear coupled orbit-attitude equations of motion. Consequently, the possibility of implementing Sun-synchronous orbits with Sun-tracking attitude motion is demonstrated.
Tumores de glándula mamaria en caninos
Directory of Open Access Journals (Sweden)
Giovanni Torres
2005-10-01
Full Text Available De los animales de compañía, los caninos son los que sufren con mayor frecuencia tumores de glándula mamaria y dentro de ellos las hembras son las que contribuyen con el mayor número de casos. Cuando estos tumores se presentan en machos por lo general tienen características histológicas malignas. Para el diagnóstico histopatológico la clasificación que ha tenido mayor aceptación es la propuesta por Hampe and Misdorp. A través de muchos años de investigación en este campo se han descrito varios factores considerados como predisponentes, entre los cuales están: raza, sexo, edad, dentro de estos la que presenta mayor disparidad de conceptos es la raza ya que, según algunos autores, se puede ver influenciada por factores externos como la localización geográfica y el gusto de los propietarios por ciertas razas como animales de compañía. Otro hecho importante es la descripción de agentes causales: el invalance hormonal (estrógenos, progesterona, mutaciones genéticas, (gen supresor del tumor, protooncogenes y consumo de dietas ricas en grasas. Finalmente, es importante hacer énfasis en el hecho que del diagnóstico adecuado y pautas de tratamiento llevados a cabo por el médico veterinario clínico, depende el pronóstico y las expectativas de vida del paciente canino.
Directory of Open Access Journals (Sweden)
César Mora Hernández.
2000-06-01
Full Text Available El artículo presenta elementos de histología de las glándulas salivales de los artrópodos plagas. Se plantea que si bien las glándulas salivales han sido estudiadas en detalle, aún se sabe poco sobre los mecanismos de transmisión de agentes patógenos, y acerca de las sustancias biológicamente activas que mantienen al "huésped" altamente sensible y posibilitan de esta forma la entrada de otros patógenos no relacionados con vectores. El conocimiento que aportan el estudio de estos procesos permite la elaboración de programas de control epidemiológicos eficientes.
Aiyub, Shereen; Chan, Weng Onn; Szetu, John; Sullivan, Laurence J; Pater, John; Cooper, Peter; Selva, Dinesh
2013-01-01
We present a case of mature congenital orbital teratoma managed with lid-sparing exenteration and dermis fat graft. This is a case report on the management of congenital orbital teratoma. A full-term baby was born in Fiji with prolapsed right globe which was surrounded by a nonpulsatile, cystic mass. Clinical and imaging features were consistent with congenital orbital teratoma. Due to limited surgical expertise, the patient was transferred to Adelaide, Australia for further management. The p...
International Nuclear Information System (INIS)
Rome, J.A.; Peng, Y.K.M.
1978-09-01
Guiding center orbits in noncircular axisymmetric tokamak plasmas are studied in the constants of motion (COM) space of (v, zeta, psi/sub m/). Here, v is the particle speed, zeta is the pitch angle with respect to the parallel equilibrium current, J/sub parallels/, and psi/sub m/ is the maximum value of the poloidal flux function (increasing from the magnetic axis) along the guiding center orbit. Two D-shaped equilibria in a flux-conserving tokamak having β's of 1.3% and 7.7% are used as examples. In this space, each confined orbit corresponds to one and only one point and different types of orbits (e.g., circulating, trapped, stagnation and pinch orbits) are represented by separate regions or surfaces in the space. It is also shown that the existence of an absolute minimum B in the higher β (7.7%) equilibrium results in a dramatically different orbit topology from that of the lower β case. The differences indicate the confinement of additional high energy (v → c, within the guiding center approximation) trapped, co- and countercirculating particles whose orbit psi/sub m/ falls within the absolute B well
Lorenzo Martínez, R.; Chimenos Küstner, Eduardo
1996-01-01
La biopsia por punción aspiración con aguja fina es una técnica diagnóstica que, originada en los Estados Unidos, se ha venido desarrollando en Europa durante las últimas décadas. Se han descrito patrones citológicos característicos en la mayoría de los procesos patológicos, tanto tumorales como no tumorales, que acontecen en las glándulas salivales. En este trabajo se revisa la epidemiología de las lesiones que asientan en las glándulas salivales y se incide en los criterios citológicos de l...
Fernando Serra Guimarães
2014-01-01
A operação para aumento de glúteos com implantes teve início no fim da década de 1960, entretanto a técnica intramuscular, considerada padrão atualmente, foi descrita cerca de 30 anos depois. Cirurgiões e pacientes apresentam crescente interesse na realização do aumento de glúteos haja vista que sua frequência apresenta aumento nos últimos anos. A utilização de implantes intramusculares que superam o volume do músculo em mais de cinquenta por cento configura uma situação nova que deve ser est...
Directory of Open Access Journals (Sweden)
Jong Hyun Cha
2017-01-01
Full Text Available BackgroundThe purpose of this study was to assess the correlation between the 2-dimensional (2D extent of orbital defects and the 3-dimensional (3D volume of herniated orbital content in patients with an orbital wall fracture.MethodsThis retrospective study was based on the medical records and radiologic data of 60 patients from January 2014 to June 2016 for a unilateral isolated orbital wall fracture. They were classified into 2 groups depending on whether the fracture involved the inferior wall (group I, n=30 or the medial wall (group M, n=30. The 2D area of the orbital defect was calculated using the conventional formula. The 2D extent of the orbital defect and the 3D volume of herniated orbital content were measured with 3D image processing software. Statistical analysis was performed to evaluate the correlations between the 2D and 3D parameters.ResultsVarying degrees of positive correlation were found between the 2D extent of the orbital defects and the 3D herniated orbital volume in both groups (Pearson correlation coefficient, 0.568−0.788; R2=32.2%−62.1%.ConclusionsBoth the calculated and measured 2D extent of the orbital defects showed a positive correlation with the 3D herniated orbital volume in orbital wall fractures. However, a relatively large volume of herniation (>0.9 cm3 occurred not infrequently despite the presence of a small orbital defect (<1.9 cm2. Therefore, estimating the 3D volume of the herniated content in addition to the 2D orbital defect would be helpful for determining whether surgery is indicated and ensuring adequate surgical outcomes.
Directory of Open Access Journals (Sweden)
Khalil M Al-Salem
2014-01-01
Full Text Available Orbital complications due to ethmoiditis are rare in neonates. A case of orbital abscess due to acute ethmoiditis in a 28-day-old girl is presented. A Successful outcome was achieved following antimicrobial therapy alone; spontaneous drainage of the abscess occurred from the lower lid without the need for surgery. From this case report, we intend to emphasize on eyelid retraction as a sign of neonatal orbital abscess, and to review all the available literature of similar cases.
Johnson, Megan R.; Petersen, Jeremy D.
2014-01-01
The Earth Observing System (EOS) Afternoon Constellation consists of five member missions (GCOM-W1, Aqua, CALIPSO, CloudSat, and Aura), each of which maintain a frozen, sun-synchronous orbit with a 16-day repeating ground track that follows the Worldwide Reference System-2 (WRS-2). Under nominal science operations for Aura, the propulsion system is oriented such that the resultant thrust vector is aligned 13.493 degrees away from the velocity vector along the yaw axis. When performing orbit maintenance maneuvers, the spacecraft performs a yaw slew to align the thrust vector in the appropriate direction. A new Drag Make Up (DMU) maneuver operations scheme has been implemented for Aura alleviating the need for the 13.493 degree yaw slew. The focus of this investigation is to assess the impact that no-slew DMU maneuver operations will have on Aura's Mean Local Time (MLT) which drives the required along track separation between Aura and the constellation members, as well as Aura's frozen orbit properties, eccentricity and argument of perigee. Seven maneuver strategies were analyzed to determine the best operational approach. A mirror pole strategy, with maneuvers alternating at the North and South poles, was implemented operationally to minimize impact to the MLT. Additional analysis determined that the mirror pole strategy could be further modified to include frozen orbit maneuvers and thus maintain both MLT and the frozen orbit properties under noslew operations.
Update on orbital reconstruction.
Chen, Chien-Tzung; Chen, Yu-Ray
2010-08-01
Orbital trauma is common and frequently complicated by ocular injuries. The recent literature on orbital fracture is analyzed with emphasis on epidemiological data assessment, surgical timing, method of approach and reconstruction materials. Computed tomographic (CT) scan has become a routine evaluation tool for orbital trauma, and mobile CT can be applied intraoperatively if necessary. Concomitant serious ocular injury should be carefully evaluated preoperatively. Patients presenting with nonresolving oculocardiac reflex, 'white-eyed' blowout fracture, or diplopia with a positive forced duction test and CT evidence of orbital tissue entrapment require early surgical repair. Otherwise, enophthalmos can be corrected by late surgery with a similar outcome to early surgery. The use of an endoscope-assisted approach for orbital reconstruction continues to grow, offering an alternative method. Advances in alloplastic materials have improved surgical outcome and shortened operating time. In this review of modern orbital reconstruction, several controversial issues such as surgical indication, surgical timing, method of approach and choice of reconstruction material are discussed. Preoperative fine-cut CT image and thorough ophthalmologic examination are key elements to determine surgical indications. The choice of surgical approach and reconstruction materials much depends on the surgeon's experience and the reconstruction area. Prefabricated alloplastic implants together with image software and stereolithographic models are significant advances that help to more accurately reconstruct the traumatized orbit. The recent evolution of orbit reconstruction improves functional and aesthetic results and minimizes surgical complications.
Satellite laser ranging to low Earth orbiters: orbit and network validation
Arnold, Daniel; Montenbruck, Oliver; Hackel, Stefan; Sośnica, Krzysztof
2018-04-01
Satellite laser ranging (SLR) to low Earth orbiters (LEOs) provides optical distance measurements with mm-to-cm-level precision. SLR residuals, i.e., differences between measured and modeled ranges, serve as a common figure of merit for the quality assessment of orbits derived by radiometric tracking techniques. We discuss relevant processing standards for the modeling of SLR observations and highlight the importance of line-of-sight-dependent range corrections for the various types of laser retroreflector arrays. A 1-3 cm consistency of SLR observations and GPS-based precise orbits is demonstrated for a wide range of past and present LEO missions supported by the International Laser Ranging Service (ILRS). A parameter estimation approach is presented to investigate systematic orbit errors and it is shown that SLR validation of LEO satellites is not only able to detect radial but also along-track and cross-track offsets. SLR residual statistics clearly depend on the employed precise orbit determination technique (kinematic vs. reduced-dynamic, float vs. fixed ambiguities) but also reveal pronounced differences in the ILRS station performance. Using the residual-based parameter estimation approach, corrections to ILRS station coordinates, range biases, and timing offsets are derived. As a result, root-mean-square residuals of 5-10 mm have been achieved over a 1-year data arc in 2016 using observations from a subset of high-performance stations and ambiguity-fixed orbits of four LEO missions. As a final contribution, we demonstrate that SLR can not only validate single-satellite orbit solutions but also precise baseline solutions of formation flying missions such as GRACE, TanDEM-X, and Swarm.
International Nuclear Information System (INIS)
Kusmartsev, F.V.
1992-10-01
The physical reasons why the orbital glass may exist in granular high-temperature superconductors and the existing experimental data appeared recently are discussed. The orbital glass is characterized by the coexistence of the orbital paramagnetic state with the superconducting state and occurs at small magnetic fields H c0 c1 . The transition in orbital glass arises at the critical field H c0 which is inversely proportional to the surface cross-area S of an average grain. In connection with theoretical predictions the possible experiments are proposed. (author). 10 refs
The Mars Reconnaissance Orbiter Mission: 10 Years of Exploration from Mars Orbit
Johnston, M. Daniel; Zurek, Richard W.
2016-01-01
The Mars Reconnaissance Orbiter ( MRO ) entered Mars orbit on March 10, 2006. After five months of aerobraking, a series of propulsive maneuvers were used to establish the desired low -altitude science orbit. The spacecraft has been on station in its 255 x 320 k m, sun -synchronous (approximately 3 am -pm ), primary science orbit since September 2006 performing both scientific and Mars programmatic support functions. This paper will provide a summary of the major achievements of the mission to date and the major flight activities planned for the remainder of its third Extended Mission (EM3). Some of the major flight challenges the flight team has faced are also discussed.
Orbital Infarction due to Sickle Cell Disease without Orbital Pain
Directory of Open Access Journals (Sweden)
Cameron L. McBride
2016-01-01
Full Text Available Sickle cell disease is a hemoglobinopathy that results in paroxysmal arteriolar occlusion and tissue infarction that can manifest in a plurality of tissues. Rarely, these infarcted crises manifest in the bony orbit. Orbital infarction usually presents with acute onset of periorbital tenderness, swelling, erythema, and pain. Soft tissue swelling can result in proptosis and attenuation of extraocular movements. Expedient diagnosis of sickle cell orbital infarction is crucial because this is a potentially sight-threatening entity. Diagnosis can be delayed since the presentation has physical and radiographic findings mimicking various infectious and traumatic processes. We describe a patient who presented with sickle cell orbital crisis without pain. This case highlights the importance of maintaining a high index of suspicion in patients with known sickle cell disease or of African descent born outside the United States in a region where screening for hemoglobinopathy is not routine, even when the presentation is not classic.
International Nuclear Information System (INIS)
Panfilova, G.V.; Koval', G.Yu.
1984-01-01
Radioanatomy of eyes and orbit is described. Diseases of the orbit (developmental anomalies, inflammatory diseases, lacrimal apparatus deseases, toxoplasmosis, tumors and cysts et al.), methods of foreign body localization in the eye are considered. Roentgenograms of the orbit and calculation table for foreign body localization in spherical eyes of dissimilar diameter are presented
International Nuclear Information System (INIS)
Anon.
1991-01-01
Critically aligned experiments are sensitive to small changes in the electron beam orbit. At the NSLS storage rings, the electron beam and photon beam motions have been monitored over the past several years. In the survey conducted in 1986 by the NSLS Users Executive Committee, experimenters requested the vertical beam position variation and the vertical angle variation, within a given fill, remain within 10 μm and 10 μr, respectively. This requires improvement in the beam stability by about one order of magnitude. At the NSLS and SSRL storage rings, the beam that is originally centered on the position monitor by a dc orbit correction is observed to have two kinds of motion: a dc drift over a storage period of several hours and a beam bounce about its nominal position. These motions are a result of the equilibrium orbit not being held perfectly stable due to time-varying errors introduced into the magnetic guide field by power supplies, mechanical vibration of the magnets, cooling water temperature variations, etc. The approach to orbit stabilization includes (1) identifying and suppressing as many noise sources on the machine as possible, (2) correcting the beam position globally (see Section 6) by controlling a number of correctors around the circumference of the machine, and (3) correcting the beam position and angle at a given source location by position feedback using local detectors and local orbit bumps. The third approach, called Local Orbit Feedback will be discussed in this section
Sośnica, Krzysztof; Prange, Lars; Kaźmierski, Kamil; Bury, Grzegorz; Drożdżewski, Mateusz; Zajdel, Radosław; Hadas, Tomasz
2018-02-01
The space segment of the European Global Navigation Satellite System (GNSS) Galileo consists of In-Orbit Validation (IOV) and Full Operational Capability (FOC) spacecraft. The first pair of FOC satellites was launched into an incorrect, highly eccentric orbital plane with a lower than nominal inclination angle. All Galileo satellites are equipped with satellite laser ranging (SLR) retroreflectors which allow, for example, for the assessment of the orbit quality or for the SLR-GNSS co-location in space. The number of SLR observations to Galileo satellites has been continuously increasing thanks to a series of intensive campaigns devoted to SLR tracking of GNSS satellites initiated by the International Laser Ranging Service. This paper assesses systematic effects and quality of Galileo orbits using SLR data with a main focus on Galileo satellites launched into incorrect orbits. We compare the SLR observations with respect to microwave-based Galileo orbits generated by the Center for Orbit Determination in Europe (CODE) in the framework of the International GNSS Service Multi-GNSS Experiment for the period 2014.0-2016.5. We analyze the SLR signature effect, which is characterized by the dependency of SLR residuals with respect to various incidence angles of laser beams for stations equipped with single-photon and multi-photon detectors. Surprisingly, the CODE orbit quality of satellites in the incorrect orbital planes is not worse than that of nominal FOC and IOV orbits. The RMS of SLR residuals is even lower by 5.0 and 1.5 mm for satellites in the incorrect orbital planes than for FOC and IOV satellites, respectively. The mean SLR offsets equal -44.9, -35.0, and -22.4 mm for IOV, FOC, and satellites in the incorrect orbital plane. Finally, we found that the empirical orbit models, which were originally designed for precise orbit determination of GNSS satellites in circular orbits, provide fully appropriate results also for highly eccentric orbits with variable linear
Orbital preservation in a maxillectomy
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Katsuhiko; Nishikawa, Hitomi; Kumagai, Masahiko; Dosaka, Yoshihiro; Kuroda, Toru; Atago, Yoshihiro; Nishio, Masamichi [Sapporo National Hospital (Japan)
1999-07-01
In the past 9 years, 38 patients of the maxillary cancer were treated by a combination of radiation and surgery. Sixteen patients showed the orbital involvement as confirmed by a CT scan and/or MRI. An orbital excenteration was necessary in 6 patients, due mainly to deep intraorbital invasion, while in 10, the orbital contents were preserved despite the involvement of the orbital capsule. The local rate of the orbital region in the latter patients evaluated at 48 months after the initial surgery was 44%. For the treatment of the recurrence at the orbital capsule. The application of gold grain (Au{sup 198}) thus appeared to be a useful tool for further preserving the eye. (author)
Orbital preservation in a maxillectomy
International Nuclear Information System (INIS)
Tanaka, Katsuhiko; Nishikawa, Hitomi; Kumagai, Masahiko; Dosaka, Yoshihiro; Kuroda, Toru; Atago, Yoshihiro; Nishio, Masamichi
1999-01-01
In the past 9 years, 38 patients of the maxillary cancer were treated by a combination of radiation and surgery. Sixteen patients showed the orbital involvement as confirmed by a CT scan and/or MRI. An orbital excenteration was necessary in 6 patients, due mainly to deep intraorbital invasion, while in 10, the orbital contents were preserved despite the involvement of the orbital capsule. The local rate of the orbital region in the latter patients evaluated at 48 months after the initial surgery was 44%. For the treatment of the recurrence at the orbital capsule. The application of gold grain (Au 198 ) thus appeared to be a useful tool for further preserving the eye. (author)
Abdellah, Marwan; Eldeib, Ayman; Owis, Mohamed I
2015-01-01
This paper features an advanced implementation of the X-ray rendering algorithm that harnesses the giant computing power of the current commodity graphics processors to accelerate the generation of high resolution digitally reconstructed radiographs (DRRs). The presented pipeline exploits the latest features of NVIDIA Graphics Processing Unit (GPU) architectures, mainly bindless texture objects and dynamic parallelism. The rendering throughput is substantially improved by exploiting the interoperability mechanisms between CUDA and OpenGL. The benchmarks of our optimized rendering pipeline reflect its capability of generating DRRs with resolutions of 2048(2) and 4096(2) at interactive and semi interactive frame-rates using an NVIDIA GeForce 970 GTX device.
LHS 1610A: A Nearby Mid-M Dwarf with a Companion That Is Likely a Brown Dwarf
Winters, Jennifer G.; Irwin, Jonathan; Newton, Elisabeth R.; Charbonneau, David; Latham, David W.; Han, Eunkyu; Muirhead, Philip S.; Berlind, Perry; Calkins, Michael L.; Esquerdo, Gil
2018-03-01
We present the spectroscopic orbit of LHS 1610A, a newly discovered single-lined spectroscopic binary with a trigonometric distance placing it at 9.9 ± 0.2 pc. We obtained spectra with the TRES instrument on the 1.5 m Tillinghast Reflector at the Fred Lawrence Whipple Observatory located on Mt. Hopkins in AZ. We demonstrate the use of the TiO molecular bands at 7065–7165 Å to measure radial velocities and achieve an average estimated velocity uncertainty of 28 m s‑1. We measure the orbital period to be 10.6 days and calculate a minimum mass of 44.8 ± 3.2 M Jup for the secondary, indicating that it is likely a brown dwarf. We place an upper limit to 3σ of 2500 K on the effective temperature of the companion from infrared spectroscopic observations using IGRINS on the 4.3 m Discovery Channel Telescope. In addition, we present a new photometric rotation period of 84.3 days for the primary star using data from the MEarth-South Observatory, with which we show that the system does not eclipse.
Introducing Earth's Orbital Eccentricity
Oostra, Benjamin
2015-01-01
Most students know that planetary orbits, including Earth's, are elliptical; that is Kepler's first law, and it is found in many science textbooks. But quite a few are mistaken about the details, thinking that the orbit is very eccentric, or that this effect is somehow responsible for the seasons. In fact, the Earth's orbital eccentricity is…
International Nuclear Information System (INIS)
Li Guangyue; Liu Yulong; Wang Yongdong; Ding Dexin
2009-01-01
The sulphuric acid leaching and bacteria leaching by orbital shaker experiments were conducted for the low grade uranium ore from a uranium mine in Guangdong Province. The results show that, when the concentration of sulphuric acid and that of slurry were 30 g/L and 25%, respectively, the conditions were most favourable for sulphuric acid leaching and the rate of leaching reached 92.92%, that, when pH value was 1.5, inoculation amount, 10%, concentration of slurry, 10%, the conditions were most favourable for bacteria leaching and the rate of leaching reached 95.93%, that, compared with sulphuric acid leaching, bacteria leaching decreased sulphuric acid consumption by 17.2% and increased the rate of leaching by 3%, and that, under the most favourable conditions for suphuric acid leaching, if 1% natrium chlorate was added, the rate of leaching increased to 96.46%, but 10 kg of natrium chlorate was consumed for 1 ton of uranium ore. (authors)
The Coupled Orbit-Attitude Dynamics and Control of Electric Sail in Displaced Solar Orbits
Directory of Open Access Journals (Sweden)
Mingying Huo
2017-01-01
Full Text Available Displaced solar orbits for spacecraft propelled by electric sails are investigated. Since the propulsive thrust is induced by the sail attitude, the orbital and attitude dynamics of electric-sail-based spacecraft are coupled and required to be investigated together. However, the coupled dynamics and control of electric sails have not been discussed in most published literatures. In this paper, the equilibrium point of the coupled dynamical system in displaced orbit is obtained, and its stability is analyzed through a linearization. The results of stability analysis show that only some of the orbits are marginally stable. For unstable displaced orbits, linear quadratic regulator is employed to control the coupled attitude-orbit system. Numerical simulations show that the proposed strategy can control the coupled system and a small torque can stabilize both the attitude and orbit. In order to generate the control force and torque, the voltage distribution problem is studied in an optimal framework. The numerical results show that the control force and torque of electric sail can be realized by adjusting the voltage distribution of charged tethers.
Application of orbital strong magnet in the extraction of deep orbital magnetic foreign bodies
Directory of Open Access Journals (Sweden)
Jin-Chen Jia
2017-12-01
Full Text Available AIM: To investigate the surgical method and efficacy of extraction of deep orbital magnetic foreign bodies by mean of an orbital strong magnet. METHODS: A retrospective analysis of clinical data of patients with deep orbital magnetic foreign bodies(OMFBin Hebei Eye Hospital from June 2014 to May 2017 was processed. A total of 23 eyes were enrolled, among them, 14 eyes of extraorbital OMFB, 9 eyes of intraorbital OMFB. The rate of extraction of foreign bodies and the postoperative complications were observed. RESULTS: All eyes of intraorbital foreign bodies were successfully extracted with 100% success rate. Twelve of 14 eyes of extraorbital foreign bodies were extracted with 86% success rate. Mild orbital hemorrhage were found in 2 eyes. There was no other obvious complication such as visual loss, orbital massive hemorrhage or limited ocular movement. CONCLUSION: It's an ideal surgical method to extract the deep orbital magnetic foreign bodies by mean of an orbital strong magnet, with mini-injury, high success rate, short duration and few complications.
Simulator Posisi Matahari dan Bulan Berbasis Web dengan WebGL
Directory of Open Access Journals (Sweden)
Kamshory
2014-09-01
Full Text Available Moon as a satellite of the earth has an important role for the life of the earth. Apart from being a source of illumination, moon also has an effect on the earth both on land and at sea. The influence of the moon to the earth relate to the its position. This research aims to create a simulator of the sun and moon position to the earth based on the time and location of the observation. This simulator is web-based and made in 3-dimensional (3D using webGL technology. The position of the sun and moon expressed by latitude and longitude which is a position that is passed by the line connecting the earth to the sun or the line connecting the earth to the moon. The position of the sun and moon obtained from calculations based on previous research. Once the position is known, the earth, the sun, and the moon then described as a 3-D model. The position of the camera can be moved by dragging a web page so that the sun, earth, and moon can be seen from various positions. The camera always leads to the center of the earth to avoid user errors flipping the camera which causes the object is not visible.
Josephsen, Anna; Nilsson, Michael
2014-01-01
Hösten 2012 släppte organisationen Läkare Utan Gränser en rapport under titeln Kriserna Svenskarna Glömt. I denna uppmärksammas det faktum att det finns flera humanitära kriser i världen som allmänheten i Sverige inte känner till. Organisationen benämner dessa som “glömda kriser”. Anledningen till den låga kännedomen hos allmänheten är, enligt rapporten, en bristande mediebevakning av kriserna. Begreppet glömda kriser bygger till stor del på idén om att en kris eller en risk kan lida av ett o...
Aiyub, Shereen; Chan, Wengonn; Szetu, John; Sullivan, Laurence J; Pater, John; Cooper, Peter; Selva, Dinesh
2013-12-01
We present a case of mature congenital orbital teratoma managed with lid-sparing exenteration and dermis fat graft. This is a case report on the management of congenital orbital teratoma. A full-term baby was born in Fiji with prolapsed right globe which was surrounded by a nonpulsatile, cystic mass. Clinical and imaging features were consistent with congenital orbital teratoma. Due to limited surgical expertise, the patient was transferred to Adelaide, Australia for further management. The patient underwent a lid-sparing exenteration with frozen section control of the apical margin. A dermis fat graft from the groin was placed beneath the lid skin to provide volume. Histopathology revealed mature tissues from each of the three germ cell layers which confirmed the diagnosis of mature teratoma. We describe the successful use of demis fat graft in socket reconstruction following lid-sparing exenteration for congenital orbital teratoma.
Directory of Open Access Journals (Sweden)
Shereen Aiyub
2013-01-01
Full Text Available We present a case of mature congenital orbital teratoma managed with lid-sparing exenteration and dermis fat graft. This is a case report on the management of congenital orbital teratoma. A full-term baby was born in Fiji with prolapsed right globe which was surrounded by a nonpulsatile, cystic mass. Clinical and imaging features were consistent with congenital orbital teratoma. Due to limited surgical expertise, the patient was transferred to Adelaide, Australia for further management. The patient underwent a lid-sparing exenteration with frozen section control of the apical margin. A dermis fat graft from the groin was placed beneath the lid skin to provide volume. Histopathology revealed mature tissues from each of the three germ cell layers which confirmed the diagnosis of mature teratoma. We describe the successful use of demis fat graft in socket reconstruction following lid-sparing exenteration for congenital orbital teratoma.
Orbit Determination of Spacecraft in Earth-Moon L1 and L2 Libration Point Orbits
Woodard, Mark; Cosgrove, Daniel; Morinelli, Patrick; Marchese, Jeff; Owens, Brandon; Folta, David
2011-01-01
The ARTEMIS mission, part of the THEMIS extended mission, is the first to fly spacecraft in the Earth-Moon Lissajous regions. In 2009, two of the five THEMIS spacecraft were redeployed from Earth-centered orbits to arrive in Earth-Moon Lissajous orbits in late 2010. Starting in August 2010, the ARTEMIS P1 spacecraft executed numerous stationkeeping maneuvers, initially maintaining a lunar L2 Lissajous orbit before transitioning into a lunar L1 orbit. The ARTEMIS P2 spacecraft entered a L1 Lissajous orbit in October 2010. In April 2011, both ARTEMIS spacecraft will suspend Lissajous stationkeeping and will be maneuvered into lunar orbits. The success of the ARTEMIS mission has allowed the science team to gather unprecedented magnetospheric measurements in the lunar Lissajous regions. In order to effectively perform lunar Lissajous stationkeeping maneuvers, the ARTEMIS operations team has provided orbit determination solutions with typical accuracies on the order of 0.1 km in position and 0.1 cm/s in velocity. The ARTEMIS team utilizes the Goddard Trajectory Determination System (GTDS), using a batch least squares method, to process range and Doppler tracking measurements from the NASA Deep Space Network (DSN), Berkeley Ground Station (BGS), Merritt Island (MILA) station, and United Space Network (USN). The team has also investigated processing of the same tracking data measurements using the Orbit Determination Tool Kit (ODTK) software, which uses an extended Kalman filter and recursive smoother to estimate the orbit. The orbit determination results from each of these methods will be presented and we will discuss the advantages and disadvantages associated with using each method in the lunar Lissajous regions. Orbit determination accuracy is dependent on both the quality and quantity of tracking measurements, fidelity of the orbit force models, and the estimation techniques used. Prior to Lissajous operations, the team determined the appropriate quantity of tracking
Morales-Álvarez, Edwin D; Rivera-Hoyos, Claudia M; Poveda-Cuevas, Sergio A; Reyes-Guzmán, Edwin A; Pedroza-Rodríguez, Aura M; Reyes-Montaño, Edgar A; Poutou-Piñales, Raúl A
2018-03-01
Laccases catalyze the oxidation of various aromatic organic compounds concomitantly with molecular oxygen reduction to water. Triphenylmethane dyes are synthetic compounds widely used in diverse industries. Their removal from effluents is difficult, due to their high degree of structural complexity; hence, their high concentration in effluents cause a negative impact on the environment. In the present work, molecular docking was used to evaluate interactions between rGlLCC1 or rPOXA 1B enzymes with Crystal Violet (CV) or Malachite Green (MG) dyes. In addition, removal tests of the two dyes were performed. Van der Waals interactions were obtained for only the CV dye for both GlLCC1 and POXA 1B enzymes. Nevertheless, in the GlLCC1 model, two π-π interactions were observed. For the MG dye only, Van der Waals interactions were obtained. Moreover, amino acid composition interacting in each model with each dye was similar. It is important to highlight that by molecular docking, none of the estimated ligand configurations generated hydrogen bonds. Thus, explaining the difficulty to degrade CV and MG. Regarding CV, maximum decolorization percentage was 23.6 ± 1.0% using Ganoderma lucidum supernatant and 5.0 ± 0.5% with Pleurotus ostreatus supernatant. When using recombinant laccase enzyme concentrates, decolorization percentages were 9.9 ± 0.1 and 7.5 ± 1.0% for rGlLCC1 and rPOXA 1B, respectively. On the other hand, for the MG dye, maximum decolorization percentages were 52.1 ± 5.1 and 2.3 ± 0.2% using G. lucidum and P. ostreatus concentrates, respectively. Whereas with recombinant laccase enzymatic concentrates, values of 9.4 ± 0.8% were obtained, with rGlLCC1, and 2.1 ± 0.1% when using rPOXA 1B. These findings represent an important step in bioremediation processes improvement and efficiency of industry-generated products, using environmentally friendly alternatives.
Transplante de glândulas salivares labiais no tratamento de olho seco em cães pela autoenxertia
Directory of Open Access Journals (Sweden)
Leticia Séra Castanho
2013-12-01
Full Text Available OBJETIVO: Avaliar os efeitos clínicos da secreção das glândulas salivares labiais como alternativa de lubrificação ocular para alívio do olho seco, em casos moderados, severos e refratários ao tratamento clínico, através da técnica de transposição de glândulas salivares labiais para o fórnice conjuntival pela autoenxertia. MÉTODOS: Foram selecionados 17 cães os quais apresentavam olho seco autoimune sem reposta satisfatória ao tratamento clínico. O teste lacrimal de Schirmer e o tempo de ruptura do filme lacrimal foram realizados no pré-operatório para avaliar a quantidade e a qualidade da lágrima produzida. Os pacientes foram submetidos aos exames oftálmicos completos no pré-operatório, a cada 15 dias por dois meses e a cada 30 dias por mais dois meses, totalizando seis retornos pós-operatórios. No pré-operatório e em todos os pós-operatórios fotografias digitais foram tiradas para o arquivo fotográfico. Utilizou-se o programa photoshop para avaliação e marcação dos neovasos corneanos em todos os retornos. RESULTADOS: Houve redução em todos os casos da secreção mucopurulenta, hiperemia conjuntival e blefarospasmo, bem como estabilização de lesões pré-existentes e redução importante do número de neovasos corneanos. A transposição resultou na melhora do tempo de ruptura do filme lacrimal, porém sem alterações significativas no teste de Schirmer. CONCLUSÃO: O transplante das glândulas salivares labiais para o fórnice conjuntival é um procedimento de fácil execução, rápido, eficaz, acessível a qualquer cirurgião veterinário oftalmologista e de grande valia para casos moderados e severos de ceratoconjuntivite seca não responsivos às medicações existentes.
Correa-Fiz, Florencia; Fraile, Lorenzo; Aragon, Virginia
2016-05-26
The microbiota, the ensemble of microorganisms on a particular body site, has been extensively studied during the last few years, and demonstrated to influence the development of many diseases. However, these studies focused mainly on the human digestive system, while the populations in the respiratory tract have been poorly assessed, especially in pigs. The nasal mucosa of piglets is colonized by an array of bacteria, many of which are unknown. Among the early colonizers, Haemophilus parasuis also has clinical importance, since it is also the etiological agent of Glässer's disease. This disease produces economical losses in all the countries with pig production, and the factors influencing its development are not totally understood. Hence, the purpose of this work was to characterize the nasal microbiota composition of piglets, and its possible role in Glässer's disease development. Seven farms from Spain (4 with Glässer's disease and 3 control farms without any respiratory disease) and three farms from UK (all control farms) were studied. Ten piglets from each farm were sampled at 3-4 weeks of age before weaning. The total DNA extracted from nasal swabs was used to amplify the 16S RNA gene for sequencing in Illumina MiSeq. Sequencing data was quality filtered and analyzed using QIIME software. The diversity of the nasal microbiota was low in comparison with other body sites, showing a maximum number of operational taxonomic units (OTUs) per pig of 1,603, clustered in five phyla. Significant differences were found at various taxonomical levels, when the microbiota was compared regarding the farm health status. Healthy status was associated to higher species richness and diversity, and UK farms demonstrated the highest diversity. The composition of the nasal microbiota of healthy piglets was uncovered and different phylotypes were shown to be significantly altered in animals depending on the clinical status of the farm of origin. Several OTUs at genus level were
O'Donnell, Vivian; Holinka, Lauren G; Krug, Peter W; Gladue, Douglas P; Carlson, Jolene; Sanford, Brenton; Alfano, Marialexia; Kramer, Edward; Lu, Zhiqiang; Arzt, Jonathan; Reese, Bo; Carrillo, Consuelo; Risatti, Guillermo R; Borca, Manuel V
2015-08-01
African swine fever virus (ASFV) is the etiological agent of an often lethal disease of domestic pigs. Disease control strategies have been hampered by the unavailability of vaccines against ASFV. Since its introduction in the Republic of Georgia, a highly virulent virus, ASFV Georgia 2007 (ASFV-G), has caused an epizootic that spread rapidly into Eastern European countries. Currently no vaccines are available or under development to control ASFV-G. In the past, genetically modified ASFVs harboring deletions of virulence-associated genes have proven attenuated in swine, inducing protective immunity against challenge with homologous parental viruses. Deletion of the gene 9GL (open reading frame [ORF] B119L) in highly virulent ASFV Malawi-Lil-20/1 produced an attenuated phenotype even when administered to pigs at 10(6) 50% hemadsorption doses (HAD50). Here we report the construction of a genetically modified ASFV-G strain (ASFV-G-Δ9GLv) harboring a deletion of the 9GL (B119L) gene. Like Malawi-Lil-20/1-Δ9GL, ASFV-G-Δ9GL showed limited replication in primary swine macrophages. However, intramuscular inoculation of swine with 10(4) HAD50 of ASFV-G-Δ9GL produced a virulent phenotype that, unlike Malawi-Lil-20/1-Δ9GL, induced a lethal disease in swine like parental ASFV-G. Interestingly, lower doses (10(2) to 10(3) HAD50) of ASFV-G-Δ9GL did not induce a virulent phenotype in swine and when challenged protected pigs against disease. A dose of 10(2) HAD50 of ASFV-G-Δ9GLv conferred partial protection when pigs were challenged at either 21 or 28 days postinfection (dpi). An ASFV-G-Δ9GL HAD50 of 10(3) conferred partial and complete protection at 21 and 28 dpi, respectively. The information provided here adds to our recent report on the first attempts toward experimental vaccines against ASFV-G. The main problem for controlling ASF is the lack of vaccines. Studies on ASFV virulence lead to the production of genetically modified attenuated viruses that induce protection
International Nuclear Information System (INIS)
Kelly, J.K.; Lazo, A.; Metes, J.J.
1988-01-01
Computed tomography has become the gold standard against which to measure orbital imaging modalities. The simultaneous display of bone, soft tissues, paranasal sinuses, and intracranial structures is a unique advantage. Radiation dose and cost have been cited as disadvantages. These would suggest that CT be reserved for the patient with significant orbital injury or difficult diagnostic problems. Magnetic resonance is limited in the investigation of orbital trauma
Efeitos do som basal em fendas glóticas Effects of vocal fry incomplete glottal closure
Directory of Open Access Journals (Sweden)
Geovana de Paula Bolzan
2008-01-01
Full Text Available TEMA: som basal em fendas glóticas. PROCEDIMENTOS: participaram desta pesquisa dois sujeitos do sexo feminino, com idades entre 20 e 40 anos e diagnóstico otorrinolaringológico de fenda em ampulheta. Houve gravação da emissão sustentada da vogal /a/ e exame videolaringoestroboscópico, imediatamente a seguir, os sujeitos realizaram o som basal em três séries de 15 repetições, e foram submetidos a novo exame laríngeo e gravação da vogal. Os dados pré e pós-realização do som basal foram submetidos às analises acústica, perceptivo-auditiva e videolaringoestroboscópica, realizadas por juízes (três fonoaudiólogas e três otorrinolaringologistas, respectivamente. RESULTADOS: em ambos os sujeitos, houve melhora no fechamento glótico e amplitude de vibração da mucosa das pregas vocais; piora no tipo de voz; aumento das medidas de ruído e de Jitter. CONCLUSÃO: o som basal promoveu redução das fendas glóticas e aumento da amplitude de vibração da mucosa das pregas vocais; piora do tipo de voz, que ficou mais ruidoso; aumento das medidas de ruído e de Jitter, sugerindo irregularidade vibratória, provavelmente devido ao efeito do ajuste do som basal ao mobilizar intensamente a mucosa.BACKGROUND: vocal fry in incomplete glottal closure. PROCEDURE: two individuals aged between 20 and 40 years old presenting an otolaryngological diagnosis of ampoule chink were part of the study. A recording of the sustained emission of /a/ vowel took place, as well as a videostroboscopic examination. Right after, the individuals completed the vocal fry in three series of 15 repetitions, being submitted to a new laryngeal examination and to the vowel’s recording. Both pre-vocal and post vocal fry data were assessed through acoustic, perceptive-auditive and videostroboscopic analysis, carried out by judges (three speech and language pathologists and three otolaryngologists, respectively. RESULTS: for both individuals, there was an improvement
Ashengroph, Morahem
2017-01-01
The present study has been conducted towards isolation of moderately halophilic bacteria capable of transforming caffeine into theobromine. A total of 45 caffeine-degrading moderate halophiles were enriched from hypersaline lakes and examined for the biotransformation of caffeine to theobromine by thin-layer chromatography (TLC) and high-performance liquid chromatography analyses. Strain GL6, giving the highest yield of theobromine, was isolated from the Hoz Soltan Lake, 20 % w/v salinity, central Iran, and identified as Salinivibrio costicola based on morphological and biochemical features as well as its 16S rRNA gene sequence analysis (GeneBank Accession No. KT378066) and DNA-DNA relatedness. The biotransformation of caffeine with strain GL6 leads to the formation of two metabolites, identified as theobromine and paraxanthine, but the yield of paraxanthine was much lower. Further study on the production of theobromine from caffeine under resting cell experiment was carried out subsequently. The optimal yield of theobromine (56 %) was obtained after a 32-h incubation using 5 mM of caffeine and 15 g l -1 (wet weight) of biomass in 0.1 M saline phosphate buffer (pH 7.0 and 10 % w/v NaCl) under agitation 180 rpm at 30 °C. The biotransformed theobromine was purified by preparative TLC and subjected to FTIR and mass spectroscopy for chemical identification. This is the first evidence for biotransformation of caffeine into theobromine by strains of the genus Salinivibrio.
Manipulation and application of orbital ordering
International Nuclear Information System (INIS)
Sheng Zhigao; Sun Yuping
2014-01-01
Under certain conditions, the orbits of the outmost shell electrons in strong correlated materials can be localized in order, which gives birth to so-called orbital ordering. During the construction or destruction of the orbital ordering, strongly correlated materials show fruitful quantum critical phenomena with great potential for future applications. We first present the mechanism for the construction of orbital ordering. Then, some physical properties associated with orbits are discussed. Finally, we emphasize the key points and progress in the research of orbital ordering controlling. (authors)
Pictorial essay: Orbital tuberculosis
International Nuclear Information System (INIS)
Narula, Mahender K; Chaudhary, Vikas; Baruah, Dhiraj; Kathuria, Manoj; Anand, Rama
2010-01-01
Tuberculosis of the orbit is rare, even in places where tuberculosis is endemic. The disease may involve soft tissue, the lacrimal gland, or the periosteum or bones of the orbital wall. Intracranial extension, in the form of extradural abscess, and infratemporal fossa extension has been described. This pictorial essay illustrates the imaging findings of nine histopathologically confirmed cases of orbital tuberculosis. All these patients responded to antituberculous treatment
Directory of Open Access Journals (Sweden)
G. Avendaño-Valenzuela
2010-09-01
Full Text Available La mejora del contorno glúteo y de las regiones paraglúteas es un requerimiento frecuente por parte de las pacientes. Algunos autores han hecho contribuciones múltiples a este tema: cruroplastias, levantamiento glúteo, implantes de glúteo, flancoplastias, liposucción y lipoinyección, técnicas que logran mejoría del contorno glúteo, pero que generalmente requieren una combinación de procedimientos. Sugerimos una clasificación para facilitar la elección del tratamiento quirúrgico más adecuado para la remodelación de la región glútea. Esta clasificación se basa principalmente en la anatomía músculo-esquelética de la región glútea, la cadera y las zonas de deformidad o lipodistrofia. Analizamos un total de 800 mujeres entre 16 y 54 años de edad, a lo largo de un período de 7 años. A todas se les realizó estudio anatómico y fotográfico de la cadera. Analizamos las estructuras músculo-esqueléticas y las zonas con lipodistrofia o deformidad; éstas últimas fueron clasificadas según su frecuencia como zona I, II, III, IV y V. Las deformidades aparecieron con la frecuencia siguiente: tipo I: 5%. Tipo II: 30%. Tipo III: 40%. Tipo IV: 20%. Tipo V: 5%. El propósito de esta nueva clasificación de deformidades de la cadera y su tratamiento es actualizar los conceptos y evolucionar en el tratamiento estético de la cadera con un concepto global. Permite también obtener resultados estéticos más relevantes. La clasificación, aplicable a las mujeres latinas y anglosajonas, ofrece una guía para el estudio preoperatorio de los glúteos y evitar así secuelas tras la cirugía.An improvement in the contouring of gluteal and paragluteal regions has been frequently required by the patients. Some authors have made multiple contributions like cruroplasty, gluteal lift, gluteal implants, flancoplasty, liposuction and lipoinjection, because the improvement of the gluteal contouring requires a combination of procedures. We are
Traumatic orbital encephalocele: Presentation and imaging.
Wei, Leslie A; Kennedy, Tabassum A; Paul, Sean; Wells, Timothy S; Griepentrog, Greg J; Lucarelli, Mark J
2016-01-01
Traumatic orbital encephalocele is a rare but severe complication of orbital roof fractures. We describe 3 cases of orbital encephalocele due to trauma in children. Retrospective case series from the University of Wisconsin - Madison and Medical College of Wisconsin. Three cases of traumatic orbital encephalocele in pediatric patients were found. The mechanism of injury was motor vehicle accident in 2 patients and accidental self-inflicted gunshot wound in 1 patient. All 3 patients sustained orbital roof fractures (4 mm to 19 mm in width) and frontal lobe contusions with high intracranial pressure. A key finding in all 3 cases was progression of proptosis and globe displacement 4 to 11 days after initial injury. On initial CT, all were diagnosed with extraconal hemorrhage adjacent to the roof fractures, with subsequent enlargement of the mass and eventual diagnosis of encephalocele. Orbital encephalocele is a severe and sight-threatening complication of orbital roof fractures. Post-traumatic orbital encephalocele can be challenging to diagnose on CT as patients with this condition often have associated orbital and intracranial hematoma, which can be difficult to distinguish from herniated brain tissue. When there is a high index of suspicion for encephalocele, an MRI of the orbits and brain with contrast should be obtained for additional characterization. Imaging signs that should raise suspicion for traumatic orbital encephalocele include an enlarging heterogeneous orbital mass in conjunction with a roof fracture and/or widening fracture segments.
Chanel, M; Rumolo, G; Tomás, R; CERN. Geneva. AB Department
2008-01-01
At the end of the 2007 run, orbit measurements were carried out in the 4 rings of the PS Booster (PSB) for different working points and beam energies. The aim of these measurements was to provide the necessary input data for a PSB realignment campaign during the 2007/2008 shutdown. Currently, only very few corrector magnets can be operated reliably in the PSB; therefore the orbit correction has to be achieved by displacing (horizontally and vertically) and/or tilting some of the defocusing quadrupoles (QDs). In this report we first describe the orbit measurements, followed by a detailed explanation of the orbit correction strategy. Results and conclusions are presented in the last section.
Directory of Open Access Journals (Sweden)
MÍRIAM C. M. DE CASTRO
2000-06-01
Full Text Available As glândulas ceruminosas são glândulas apócrinas modificadas encontradas na região profunda da derme que reveste a porção cartilaginosa do meato acústico externo. Os tumores originados dessas glândulas são raros. Existem controvérsias em relação ao termo ceruminoma, que nos parece impróprio. Na verdade, esses tumores são atualmente classificados como adenoma, adenocarcinoma, carcinoma adenóide cístico e adenoma pleomórfico. Relatamos o caso de uma mulher de 39 anos, apresentado-se com cefaléia, hipoacusia e zumbidos à direita, além de vertigem e náuseas. A TC de crânio evidenciou tumoração do ouvido médio, invadindo os limites ósseos e cartilaginosos, com extensão intracraniana. Foi submetida a cirurgia, com exérese parcial do tumor, seguida de radioterapia (6000 cG. A histologia mostrou tratar-se de carcinoma adenóide cístico de glândulas ceruminosas. A paciente apresentou no pós-operatório paralisia facial periférica à direita, mantendo os déficits anteriores. Após um ano da cirurgia encontra-se estável clinicamente.Ceruminous glands are modified apocrine glands, confined to the skin lining of the cartilaginous part of the external auditory meatus. Tumors arising from these glands are rare. Controversy exists regarding the term "ceruminoma". Actually this neoplasia should be classified as adenoma, adenocarcinoma, adenoid cystic carcinoma and pleomorphic ceruminous adenoma. We report a 39-year-old woman first seen at Santa Casa of Belo Horizonte, in 1998, presenting with headache, nausea, vertigo, hearing loss and tinitus on the right for the past two years. CT scan showed a tumor eroding cartilaginous and bony limits with intracranial invasion. She was submitted to multidisciplinary treatment with surgery followed by radiotherapy (6000 cG. Histology showed a ceruminous adenoid cystic carcinoma. The patient manifested a right peripherical facial palsy and had no recovery of the previous deficits. After one
Effects of DeOrbitSail as applied to Lifetime predictions of Low Earth Orbit Satellites
Afful, Andoh; Opperman, Ben; Steyn, Herman
2016-07-01
Orbit lifetime prediction is an important component of satellite mission design and post-launch space operations. Throughout its lifetime in space, a spacecraft is exposed to risk of collision with orbital debris or operational satellites. This risk is especially high within the Low Earth Orbit (LEO) region where the highest density of space debris is accumulated. This paper investigates orbital decay of some LEO micro-satellites and accelerating orbit decay by using a deorbitsail. The Semi-Analytical Liu Theory (SALT) and the Satellite Toolkit was employed to determine the mean elements and expressions for the time rates of change. Test cases of observed decayed satellites (Iridium-85 and Starshine-1) are used to evaluate the predicted theory. Results for the test cases indicated that the theory fitted observational data well within acceptable limits. Orbit decay progress of the SUNSAT micro-satellite was analysed using relevant orbital parameters derived from historic Two Line Element (TLE) sets and comparing with decay and lifetime prediction models. This paper also explored the deorbit date and time for a 1U CubeSat (ZACUBE-01). The use of solar sails as devices to speed up the deorbiting of LEO satellites is considered. In a drag sail mode, the deorbitsail technique significantly increases the effective cross-sectional area of a satellite, subsequently increasing atmospheric drag and accelerating orbit decay. The concept proposed in this study introduced a very useful technique of orbit decay as well as deorbiting of spacecraft.
Colebeck, Amanda C.; Kase, Michael T.; Nichols, Cindy B.; Golden, Marjorie; Huryn, Joseph M.
2016-01-01
The basic objective in prosthetic restoration of confluent maxillary and orbital defects is to achieve a comfortable, cosmetically acceptable prosthesis that restores speech, deglutition, and mastication. It is a challenging task complicated by the size and shape of the defects. The maxillary obturator prosthesis often satisfies the objective of adequate deglutition; however, orbital defects that are not obturated in the medial septal or posterior walls allow air to escape, negatively impacting phonation. This article describes a technique to achieve favorable prosthetic rehabilitation in a patient with a maxillectomy and ipsilateral orbital exenteration. The prosthetic components include maxillary obturator, orbital conformer, and orbital prosthesis connected using rigid magnetic attachments. PMID:25953143
Robustness analysis method for orbit control
Zhang, Jingrui; Yang, Keying; Qi, Rui; Zhao, Shuge; Li, Yanyan
2017-08-01
Satellite orbits require periodical maintenance due to the presence of perturbations. However, random errors caused by inaccurate orbit determination and thrust implementation may lead to failure of the orbit control strategy. Therefore, it is necessary to analyze the robustness of the orbit control methods. Feasible strategies which are tolerant to errors of a certain magnitude can be developed to perform reliable orbit control for the satellite. In this paper, first, the orbital dynamic model is formulated by Gauss' form of the planetary equation using the mean orbit elements; the atmospheric drag and the Earth's non-spherical perturbations are taken into consideration in this model. Second, an impulsive control strategy employing the differential correction algorithm is developed to maintain the satellite trajectory parameters in given ranges. Finally, the robustness of the impulsive control method is analyzed through Monte Carlo simulations while taking orbit determination error and thrust error into account.
Namouchi, Amine; Mardassi, Helmi
2006-11-01
Evidence suggests that insertion of the IS6110 element is not without consequence to the biology of Mycobacterium tuberculosis complex strains. Thus, mapping of multiple IS6110 insertion sites in the genome of biomedically relevant clinical isolates would result in a better understanding of the role of this mobile element, particularly with regard to transmission, adaptability and virulence. In the present paper, we describe a versatile strategy, referred to as GL-PCR, that amplifies IS6110-flanking sequences based on the construction of a genomic library. M. tuberculosis chromosomal DNA is fully digested with HincII and then ligated into a plasmid vector between T7 and T3 promoter sequences. The ligation reaction product is transformed into Escherichia coli and selective PCR amplification targeting both 5' and 3' IS6110-flanking sequences are performed on the plasmid library DNA. For this purpose, four separate PCR reactions are performed, each combining an outward primer specific for one IS6110 end with either T7 or T3 primer. Determination of the nucleotide sequence of the PCR products generated from a single ligation reaction allowed mapping of 21 out of the 24 IS6110 copies of two 12 banded M. tuberculosis strains, yielding an overall sensitivity of 87,5%. Furthermore, by simply comparing the migration pattern of GL-PCR-generated products, the strategy proved to be as valuable as IS6110 RFLP for molecular typing of M. tuberculosis complex strains. Importantly, GL-PCR was able to discriminate between strains differing by a single IS6110 band.
Orbiter OMS and RCS technology
Boudreaux, R. A.
1982-01-01
Orbiter Orbital Maneuver Subsystem (OMS) and Reaction Control Subsystem (RCS) tankage has proved to be highly successful in shuttle flights on-orbit propellant transfer tests were done. Tank qualification tests along with flight demonstrations were carried out future uses of storable propellants are cited.
Directory of Open Access Journals (Sweden)
Jeferson João Soccol
2017-06-01
Full Text Available Propagation of noble dendrobium orchid (Dendrobium nobile Lindl. by cutting was studied in two experiments. In the first experiment we evaluated the effect stem age on propagation success: mature stems - from already bloomed stems; and young stems – yet to bloom; and Nitrogen fertilizer application, from two sources: as Nitrate and Ammonium (respectively as Calcium Nitrate at concentrations of: 5.81 gL-1; 11.61 gL-1; 17.42 gL-1; and Urea at concentrations of 2.00 gL-1; 4.00 gL-1 and 6.00 gL-1 plus control treatments. We evaluated the following parameters: the number of cuttings stalks that launched shoots and/or roots, vigor, number of roots per plant and root length per plant. Factorial analysis of variance (stems age x source of Nitrogen; and age of stem x Nitrogen level was applied using a Generalized Linear Model (GLM approach. Where significant differences were observed, averages were compared using post-hoc tests (Tukey. Propagation success was higher using cuttings from mature stems (60.2%, a value 1.6 times higher than obtained with stem cuttings from young stems (38.0%. Application of Nitrogen, in both forms, did not influence any of the evaluated parameters. In the second experiment we treated cuttings from mature stems with Salicylic acid in 3 concentrations (0.10 mM; 0.50 mM; 1.00 mM and plus a control treatment. Evaluated parameters included proportion of cuttings stalks that launched shoots and/or roots, leaf length, root length, and number of roots per stem cutting. Factorial analysis of variance was applied with post-hoc tests. Application of 0.50 mM of Salicylic acid increased the proportion of cuttings stalks that launched shoots and/or roots by 20.5% relative to the control treatment.
Basanta, I; Sevillano, C; Álvarez, M D
2015-09-01
A case is presented of an 85 year-old Caucasian female with lymphoma that recurred in the orbit (secondary ocular adnexal lymphoma). The orbital tumour was a diffuse large B-cell lymphoma according to the REAL classification (Revised European-American Lymphoma Classification). Orbital lymphomas are predominantly B-cell proliferations of a variety of histological types, and most are low-grade tumours. Patients are usually middle-aged or elderly, and it is slightly more common in women. A palpable mass, proptosis and blepharoptosis are the most common signs of presentation. Copyright © 2011 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.
JSC Orbital Debris Website Description
Johnson, Nicholas L.
2006-01-01
Purpose: The website provides information about the NASA Orbital Debris Program Office at JSC, which is the lead NASA center for orbital debris research. It is recognized world-wide for its leadership in addressing orbital debris issues. The NASA Orbital Debris Program Office has taken the international lead in conducting measurements of the environment and in developing the technical consensus for adopting mitigation measures to protect users of the orbital environment. Work at the center continues with developing an improved understanding of the orbital debris environment and measures that can be taken to control its growth. Major Contents: Orbital Debris research is divided into the following five broad efforts. Each area of research contains specific information as follows: 1) Modeling - NASA scientists continue to develop and upgrade orbital debris models to describe and characterize the current and future debris environment. Evolutionary and engineering models are described in detail. Downloadable items include a document in PDF format and executable software. 2) Measurements - Measurements of near-Earth orbital debris are accomplished by conducting ground-based and space-based observations of the orbital debris environment. The data from these sources provide validation of the environment models and identify the presence of new sources. Radar, optical and surface examinations are described. External links to related topics are provided. 3) Protection - Orbital debris protection involves conducting hypervelocity impact measurements to assess the risk presented by orbital debris to operating spacecraft and developing new materials and new designs to provide better protection from the environment with less weight penalty. The data from this work provides the link between the environment defined by the models and the risk presented by that environment to operating spacecraft and provides recommendations on design and operations procedures to reduce the risk as
Orbits in weak and strong bars
Contopoulos, George
1980-01-01
The authors study the plane orbits in simple bar models embedded in an axisymmetric background when the bar density is about 1% (weak), 10% (intermediate) or 100% (strong bar) of the axisymmetric density. Most orbits follow the stable periodic orbits. The basic families of periodic orbits are described. In weak bars with two Inner Lindblad Resonances there is a family of stable orbits extending from the center up to the Outer Lindblad Resonance. This family contains the long period orbits near corotation. Other stable families appear between the Inner Lindblad Resonances, outside the Outer Lindblad Resonance, around corotation (short period orbits) and around the center (retrograde). Some families become unstable or disappear in strong bars. A comparison is made with cases having one or no Inner Lindblad Resonance. (12 refs).
The Eccentric Behavior of Nearly Frozen Orbits
Sweetser, Theodore H.; Vincent, Mark A.
2013-01-01
Frozen orbits are orbits which have only short-period changes in their mean eccentricity and argument of periapse, so that they basically keep a fixed orientation within their plane of motion. Nearly frozen orbits are those whose eccentricity and argument of periapse have values close to those of a frozen orbit. We call them "nearly" frozen because their eccentricity vector (a vector whose polar coordinates are eccentricity and argument of periapse) will stay within a bounded distance from the frozen orbit eccentricity vector, circulating around it over time. For highly inclined orbits around the Earth, this distance is effectively constant over time. Furthermore, frozen orbit eccentricity values are low enough that these orbits are essentially eccentric (i.e., off center) circles, so that nearly frozen orbits around Earth are bounded above and below by frozen orbits.
GLONASS orbit/clock combination in VNIIFTRI
Bezmenov, I.; Pasynok, S.
2015-08-01
An algorithm and a program for GLONASS satellites orbit/clock combination based on daily precise orbits submitted by several Analytic Centers were developed. Some theoretical estimates for combine orbit positions RMS were derived. It was shown that under condition that RMS of satellite orbits provided by the Analytic Centers during a long time interval are commensurable the RMS of combine orbit positions is no greater than RMS of other satellite positions estimated by any of the Analytic Centers.
Directory of Open Access Journals (Sweden)
Tatiana Bellatine
2010-08-01
Full Text Available Para a descrição macro e microscópica das glândulas mamárias foram utilizadas três fêmeas de Mão Pelada (Procyon cancrivorus. As amostras das glândulas foram processadas conforme técnicas rotineiras para histologia. As fêmeas estudadas apresentaram 3 pares de glândulas mamárias, sendo um par de glândula mamária abdominal cranial, um par de abdominal caudal e um par de inguinal. As papilas mamárias apresentaram formato pendular, como os canídeos domésticos. Microscopicamente, a glândula mamária apresentou da porção externa para a interna: epiderme (epitélio estratificado pavimentoso queratinizado, derme (tecido conjuntivo frouxo e tecido conjuntivo denso não modelado, fibras musculares lisas e ductos papilíferos que abrem em vários ósteos papilares em formato de "chuveiro". A porção secretora glandular era caracteristicamente túbulo alveolar, com células cuboidais dispostas em camada simples. Os resultados indicam que o conjunto glandular estudado é semelhante ao da cadela (Cannis familiaris tanto em seu aspecto macroscópico quanto em seu aspecto microscópico, este fato sugere que podemos utilizar o Mão Pelada e o Cão como modelos similares de estudo, para identificação de patologias relacionadas a este sistema.Three Procyon cancrivorus females were studied with emphasis for gross and microscopical description of the mammary glands. Samples of the glands were processed with routine techniques for histology. The females studied presented three pairs of mammary glands: one pair of cranial abdominal mammary glands, a second pair of caudal abdominal and a third one, as inguinal mammary glands. Mammary papillae presented a pendulum shape, as in the domestic dogs. Microscopically, the mammary gland consisted from the external to the internal portion (1 of stratified squamous epithelium of the epidermis, (2 dense irregular connective tissue of the derma, and (3 smooth muscle fibers and papillary ducts that flowed
International Nuclear Information System (INIS)
Imanishi, B.; Misono, S.; von Oertzen, W.; Voit, H.
1988-08-01
The molecular orbitals of the nucleon(s) in nucleus-nucleus collisions are dynamically defined as a linear combination of nucleon single-particle orbits (LCNO) in a rotating frame by using the coupled-reaction-channel (CRC) theory. Nucleon molecular orbitals and the promotions of nucleon, - especially due to the Landau-Zener radial coupling are discussed with the method above mentioned. (author)
A case report of orbital Langerhans cell histiocytosis presenting as a orbital cellulitis.
Albert-Fort, M; González-Candial, M
2018-04-08
A 10-year-old girl was seen with a 3-week history of right upper lid swelling and with no other symptoms or fever. There was no recent history of sinusitis, trauma, or previous infection involving the periorbital area, or response to oral antibiotic treatment. Orbital computed tomography showed a lesion involving the upper margin of the orbit, and bone destruction at the orbital roof. Biopsy performed revealed the presence of Langerhans cell Histiocytosis. The lesion was surgically debulked and corticosteroids were used intra-operatively. The lesion responded to treatment. The orbital involvement of Langerhans cell histiocytosis, despite its low incidence, should be considered in the examination of acute peri-orbital swelling. It usually presents as an osteolytic lesion, and it is confirmed with a histological examination and immunohistochemical techniques for CD1a and S100. An interdisciplinary approach is recommended to rule out multifocal or multisystemic diseases, as well as to develop an appropriate treatment strategy. Copyright © 2018 Sociedad Española de Oftalmología. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Masato Ohnishi
2015-04-01
Full Text Available When a radial strain is applied to a carbon nanotube (CNT, the increase in local curvature induces orbital hybridization. The effect of the curvature-induced orbital hybridization on the electronic properties of CNTs, however, has not been evaluated quantitatively. In this study, the strength of orbital hybridization in CNTs under homogeneous radial strain was evaluated quantitatively. Our analyses revealed the detailed procedure of the change in electronic structure of CNTs. In addition, the dihedral angle, the angle between π-orbital axis vectors of adjacent atoms, was found to effectively predict the strength of local orbital hybridization in deformed CNTs.
Directory of Open Access Journals (Sweden)
Laura Ferrer-Font
2017-02-01
Full Text Available Glioblastoma (GBM causes poor survival in patients even with aggressive treatment. Temozolomide (TMZ is the standard chemotherapeutic choice for GBM treatment but resistance always ensues. Protein kinase CK2 (CK2 contributes to tumour development and proliferation in cancer, and it is overexpressed in human GBM. Accordingly, targeting CK2 in GBM may benefit patients. Our goal has been to evaluate whether CK2 inhibitors (iCK2s could increase survival in an immunocompetent preclinical GBM model. Cultured GL261 cells were treated with different iCK2s including CX-4945, and target effects evaluated in vitro. CX-4945 was found to decrease CK2 activity and Akt(S129 phosphorylation in GL261 cells. Longitudinal in vivo studies with CX-4945 alone or in combination with TMZ were performed in tumour-bearing mice. Increase in survival (p < 0.05 was found with combined CX-4945 and TMZ metronomic treatment (54.7 ± 11.9 days, n = 6 when compared to individual metronomic treatments (CX-4945: 24.5 ± 2.0 and TMZ: 38.7 ± 2.7, n = 6 and controls (22.5 ± 1.2, n = 6. Despite this, CX-4945 did not improve mice outcome when administered on every/alternate days, either alone or in combination with 3-cycle TMZ. The highest survival rate was obtained with the metronomic combined TMZ+CX-4945 every 6 days, pointing to the participation of the immune system or other ancillary mechanism in therapy response.
Ferrer-Font, Laura; Villamañan, Lucia; Arias-Ramos, Nuria; Vilardell, Jordi; Plana, Maria; Ruzzene, Maria; Pinna, Lorenzo A.; Itarte, Emilio; Arús, Carles; Candiota, Ana Paula
2017-01-01
Glioblastoma (GBM) causes poor survival in patients even with aggressive treatment. Temozolomide (TMZ) is the standard chemotherapeutic choice for GBM treatment but resistance always ensues. Protein kinase CK2 (CK2) contributes to tumour development and proliferation in cancer, and it is overexpressed in human GBM. Accordingly, targeting CK2 in GBM may benefit patients. Our goal has been to evaluate whether CK2 inhibitors (iCK2s) could increase survival in an immunocompetent preclinical GBM model. Cultured GL261 cells were treated with different iCK2s including CX-4945, and target effects evaluated in vitro. CX-4945 was found to decrease CK2 activity and Akt(S129) phosphorylation in GL261 cells. Longitudinal in vivo studies with CX-4945 alone or in combination with TMZ were performed in tumour-bearing mice. Increase in survival (p < 0.05) was found with combined CX-4945 and TMZ metronomic treatment (54.7 ± 11.9 days, n = 6) when compared to individual metronomic treatments (CX-4945: 24.5 ± 2.0 and TMZ: 38.7 ± 2.7, n = 6) and controls (22.5 ± 1.2, n = 6). Despite this, CX-4945 did not improve mice outcome when administered on every/alternate days, either alone or in combination with 3-cycle TMZ. The highest survival rate was obtained with the metronomic combined TMZ+CX-4945 every 6 days, pointing to the participation of the immune system or other ancillary mechanism in therapy response. PMID:28208677
The conservation of orbital symmetry
Woodward, R B
2013-01-01
The Conservation of Orbital Symmetry examines the principle of conservation of orbital symmetry and its use. The central content of the principle was that reactions occur readily when there is congruence between orbital symmetry characteristics of reactants and products, and only with difficulty when that congruence does not obtain-or to put it more succinctly, orbital symmetry is conserved in concerted reaction. This principle is expected to endure, whatever the language in which it may be couched, or whatever greater precision may be developed in its application and extension. The book ope
Similarity in Bilateral Isolated Internal Orbital Fractures.
Chen, Hung-Chang; Cox, Jacob T; Sanyal, Abanti; Mahoney, Nicholas R
2018-04-13
In evaluating patients sustaining bilateral isolated internal orbital fractures, the authors have observed both similar fracture locations and also similar expansion of orbital volumes. In this study, we aim to investigate if there is a propensity for the 2 orbits to fracture in symmetrically similar patterns when sustaining similar trauma. A retrospective chart review was performed studying all cases at our institution of bilateral isolated internal orbital fractures involving the medial wall and/or the floor at the time of presentation. The similarity of the bilateral fracture locations was evaluated using the Fisher's exact test. The bilateral expanded orbital volumes were analyzed using the Wilcoxon signed-rank test to assess for orbital volume similarity. Twenty-four patients with bilateral internal orbital fractures were analyzed for fracture location similarity. Seventeen patients (70.8%) had 100% concordance in the orbital subregion fractured, and the association between the right and the left orbital fracture subregion locations was statistically significant (P < 0.0001). Fifteen patients were analyzed for orbital volume similarity. The average orbital cavity volume was 31.2 ± 3.8 cm on the right and 32.0 ± 3.7 cm on the left. There was a statistically significant difference between right and left orbital cavity volumes (P = 0.0026). The data from this study suggest that an individual who suffers isolated bilateral internal orbital fractures has a statistically significant similarity in the location of their orbital fractures. However, there does not appear to be statistically significant similarity in the expansion of the orbital volumes in these patients.
Directory of Open Access Journals (Sweden)
Ciro A. Ávila
2006-09-01
Full Text Available The Glória quartz-monzodiorite, one of the mafic plutons of the Paleoproterozoic Mineiro belt, is intrusive into banded gneisses, amphibolites, schists and phyllites of the Rio das Mortes greenstone belt, in the southern portion of the São Francisco Craton, State of Minas Gerais, Brazil. The Glória quartz-monzodiorite yields a SHRIMP U-Pb zircon age of 2188 ± 29 Ma, suggesting a tectonic relationship with the pre-collisional phase of the Mineiro belt. According to the Nd isotopic evidence (epsilonNd(T = -3.4; T DM = 2.68 Ga the original magmas was formed by a mixture among Archean crustal material and Paleoproterozoic juvenile magma. The Glória quartz-monzodiorite shows metaluminous and calc-alkaline tendency with intermediate K content, comparable to that of volcanic-arc rocks. The primary mineralogical assemblage was partly modified by metamorphism, dated between 2131-2121 Ma in nearby coeval plutons. Such metamorphism is significantly older than the reported metamorphic episodes of the Mineiro belt in the Quadrilátero Ferrífero region (2059-2041 Ma in the eastern portion of the study area. This evidence, together with chemical and isotopic data from other mafic and felsic plutons coeval with the Glória quartz-monzodiorite, indicate a tectonic and magmatic migration within the Mineiro belt from west to east.O Quartzo Monzodiorito Glória é um corpo plutônicomáfico associado à evolução Paleoproterozóica do Cinturão Mineiro. Este é intrusivo em gnaisses bandados, anfibolitos, xistos e filitos do Greenstone Belt Rio das Mortes, na porção sudeste do Cráton São Francisco, Estado de Minas Gerais, Brasil. Este corpo possui idade de cristalização SHRIMP (em zircão de 2188 ± 29 Ma, enquanto os isótopos de Nd (épsilonNd(T = -3,4; T DM = 2,68 Ga apontam que sua fonte magmática envolveumaterial juvenil paleoproterozóico contaminada por protólitos arqueanos. As rochas do Quartzo Monzodiorito Glória são metaluminosas, c
Kaise, Tetsuo
1987-01-01
This monograph represents the first two parts of the author's research on the generalization of class field theory for the noncommutative case. Part I concentrates on the construction of all the irreducible representations of a multiplicative group B* of a quaternion algebra B over a local field k with residue field of characteristic 2. These results are of considerable significance in the light of the connections found by Jacquet-Langlands between representations of GL2 (k) and B* and although they concern GL2 they also provide a model for GLn. Part II deals with n > 2 unifying results previously obtained by Weil, Jacquet-Langlands, Bernstein-Zelevinskii, Deligne-Kazdan and others. More than a mere comparison of these results, it reveals an intrinsic correspondence found with the aid of the base restriction process of algebraic groups and the substitution of division of algebras for Cartan subalgebras. The approach is purely local and therefore may be applied also to other types of reductive groups, in parti...
Orbital Debris and NASA's Measurement Program
Africano, J. L.; Stansbery, E. G.
2002-05-01
Since the launch of Sputnik in 1957, the number of manmade objects in orbit around the Earth has dramatically increased. The United States Space Surveillance Network (SSN) tracks and maintains orbits on over nine thousand objects down to a limiting diameter of about ten centimeters. Unfortunately, active spacecraft are only a small percentage ( ~ 7%) of this population. The rest of the population is orbital debris or ``space junk" consisting of expended rocket bodies, dead payloads, bits and pieces from satellite launches, and fragments from satellite breakups. The number of these smaller orbital debris objects increases rapidly with decreasing size. It is estimated that there are at least 130,000 orbital debris objects between one and ten centimeters in diameter. Most objects smaller than 10 centimeters go untracked! As the orbital debris population grows, the risk to other orbiting objects, most importantly manned space vehicles, of a collision with a piece of debris also grows. The kinetic energy of a solid 1 cm aluminum sphere traveling at an orbital velocity of 10 km/sec is equivalent to a 400 lb. safe traveling at 60 mph. Fortunately, the volume of space in which the orbiting population resides is large, collisions are infrequent, but they do occur. The Space Shuttle often returns to earth with its windshield pocked with small pits or craters caused by collisions with very small, sub-millimeter-size pieces of debris (paint flakes, particles from solid rocket exhaust, etc.), and micrometeoroids. To get a more complete picture of the orbital-debris environment, NASA has been using both radar and optical techniques to monitor the orbital debris environment. This paper gives an overview of the orbital debris environment and NASA's measurement program.
Orbital structure in oscillating galactic potentials
Terzić, Balša; Kandrup, Henry E.
2004-01-01
Subjecting a galactic potential to (possibly damped) nearly periodic, time-dependent variations can lead to large numbers of chaotic orbits experiencing systematic changes in energy, and the resulting chaotic phase mixing could play an important role in explaining such phenomena as violent relaxation. This paper focuses on the simplest case of spherically symmetric potentials subjected to strictly periodic driving with the aim of understanding precisely why orbits become chaotic and under what circumstances they will exhibit systematic changes in energy. Four unperturbed potentials V0(r) were considered, each subjected to a time dependence of the form V(r, t) =V0(r)(1 +m0 sinωt). In each case, the orbits divide clearly into regular and chaotic, distinctions which appear absolute. In particular, transitions from regularity to chaos are seemingly impossible. Over finite time intervals, chaotic orbits subdivide into what can be termed `sticky' chaotic orbits, which exhibit no large-scale secular changes in energy and remain trapped in the phase-space region where they started; and `wildly' chaotic orbits, which do exhibit systematic drifts in energy as the orbits diffuse to different phase-space regions. This latter distinction is not absolute, transitions corresponding apparently to orbits penetrating a `leaky' phase-space barrier. The three different orbit types can be identified simply in terms of the frequencies for which their Fourier spectra have the most power. An examination of the statistical properties of orbit ensembles as a function of driving frequency ω allows us to identify the specific resonances that determine orbital structure. Attention focuses also on how, for fixed amplitude m0, such quantities as the mean energy shift, the relative measure of chaotic orbits and the mean value of the largest Lyapunov exponent vary with driving frequency ω and how, for fixed ω, the same quantities depend on m0.
Orbital roof encephalocele mimicking a destructive neoplasm.
Alsuhaibani, Adel H; Hitchon, Patrick W; Smoker, Wendy R K; Lee, Andrew G; Nerad, Jeffrey A
2011-01-01
The purpose of this case report is to report an orbital roof encephalocele mimicking a destructive orbital neoplasm. Orbital roof encephalocele is uncommon but can mimic neoplasm. One potential mechanism for the orbital roof destruction is a post-traumatic "growing orbital roof fracture." The growing fracture has been reported mostly in children but can occur in adults. Alternative potential etiologies for the encephalocele are discussed, including Gorham syndrome. Orbital roof encephalocele is uncommon in adults, and the findings can superficially resemble an orbital neoplasm. Radiographic and clinical features that might suggest the correct diagnosis include a prior history of trauma, overlying frontal lobe encephalomalacia without significant mass effect or edema, and an orbital roof defect. The "growing fracture" mechanism may be a potential explanation for the orbital roof destruction in some cases.
The globe and orbit in Laron syndrome.
Kornreich, L; Konen, O; Lilos, P; Laron, Z
2011-09-01
Patients with LS have an inborn growth hormone resistance, resulting in failure to generate IGF-1. The purpose of this study was to evaluate the size of the eye and orbit in LS. We retrospectively reviewed the MR imaging of the brain in 9 patients with LS for the following parameters: axial diameter of the globe, interzygomatic distance, perpendicular distance from the interzygomatic line to margins of the globe, medial-to-lateral diameter of the orbit at the anterior orbital rim, distance from the anterior orbital rim to the anterior globe, maximal distance between the medial walls of the orbits, lateral orbital wall angle, lateral orbital wall length, and mediolateral thickness of the intraorbital fat in the most cranial image of the orbit. All measurements were made bilaterally. Twenty patients referred for MR imaging for unrelated reasons served as control subjects. Compared with the control group, the patients with LS had a significantly smaller maximal globe diameter and shallower but wider orbits due to a shorter lateral wall, a smaller medial distance between the orbits, and a larger angle of the orbit. The ratio between the most anterior orbital diameter and the globe was greater than that in controls. The position of the globe was more anterior in relation to the interzygomatic line. Shallow and wide orbits and small globes relative to orbital size are seen in LS and may be secondary to IGF-1 deficiency.
Orbiting compressor for residential air-conditioners
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyun Jin; Kim, Woo Young; Ahn, Jong Min [Department of Mechanical Engineering, University of Incheon, 12-1 Songdo-dong, Yeonsu-gu, Incheon 406-840 (Korea)
2010-01-15
A new type of compressor, called an orbiting compressor, is introduced in this paper. The orbiting compressor is characterized by an orbiting piston, and the piston or orbiter consists of a circular base plate and a ring type vane protruding vertically from the base plate. The orbiter is made to orbit in an annular space formed between two concentric circular walls via an Oldham-ring mechanism, producing two sealed gas pockets on both sides of the vane wrap with a 180 phase difference. This operating mechanism leads to alternating compression and discharge processes, which results in low torque variation. The orbiting compressor has been designed for an R410A residential air conditioner with a cooling capacity of 10.0 kW. The performance of the orbiting compressor model has been analytically investigated, where the volumetric, adiabatic and mechanical efficiencies were calculated to be 94.8%, 90.4% and 93.4%, respectively for the ARI condition. The EER was estimated to be about 10.86 with a motor efficiency of 89%. (author)
Spacecraft contamination programs within the Air Force Systems Command Laboratories
Murad, Edmond
1990-01-01
Spacecraft contamination programs exist in five independent AFSC organizations: Geophysics Laboratory (GL), Arnold Engineering and Development Center (AEDC), Rome Air Development Center (RADC/OSCE), Wright Research and Development Center (MLBT), Armament Laboratory (ATL/SAI), and Space Systems Division (SSD/OL-AW). In addition, a sizable program exists at Aerospace Corp. These programs are complementary, each effort addressing a specific area of expertise: GL's effort is aimed at addressing the effects of on-orbit contamination; AEDC's effort is aimed at ground simulation and measurement of optical contamination; RADC's effort addresses the accumulation, measurement, and removal of contamination on large optics; MLBT's effort is aimed at understanding the effect of contamination on materials; ATL's effort is aimed at understanding the effect of plume contamination on systems; SSD's effort is confined to the integration of some contamination experiments sponsored by SSD/CLT; and Aerospace Corp.'s effort is aimed at supporting the needs of the using System Program Offices (SPO) in specific areas, such as contamination during ground handling, ascent phase, laboratory measurements aimed at understanding on-orbit contamination, and mass loss and mass gain in on-orbit operations. These programs are described in some detail, with emphasis on GL's program.
Experimentos de creación de contenidos gráficos para Realidad Virtual basadas en OpenGL
Casado Garfia, Alberto
2017-01-01
[ES]El proyecto consiste en el estudio de técnicas estereoscópicas dirigidas a su aplicación en realidad virtual, así como su implementación y evaluación a través de un demostrador que utiliza OpenGL y C++. La experiencia virtual generada por el demostrador es proyectada en un casco de realidad virtual, que además integra los movimiento de la cabeza que se obtienen a través de una aplicación Android que también se ha desarrollado. [EN]The project consists in the study of stereoscopic techn...
Svoren, J.; Neslusan, L.; Porubcan, V.
1993-07-01
It is evident that there is no uniform method of calculating meteor radiants which would yield reliable results for all types of cometary orbits. In the present paper an analysis of this problem is presented, together with recommended methods for various types of orbits. Some additional methods resulting from mathematical modelling are presented and discussed together with Porter's, Steel-Baggaley's and Hasegawa's methods. In order to be able to compare how suitable the application of the individual radiant determination methods is, it is necessary to determine the accuracy with which they approximate real meteor orbits. To verify the accuracy with which the orbit of a meteoroid with at least one node at 1 AU fits the original orbit of the parent body, we applied the Southworth-Hawkins D-criterion (Southworth, R.B., Hawkins, G.S.: 1963, Smithson. Contr. Astrophys 7, 261). D0.2 the fit is rather poor and the change of orbit unrealistic. The optimal methods with the smallest values of D for given types of orbits are shown in two series of six plots. The new method of rotation around the line of apsides we propose is very appropriate in the region of small inclinations. There is no doubt that Hasegawa's omega-adjustment method (Hasegawa, I.: 1990, Publ. Astron. Soc. Japan 42, 175) has the widest application. A comparison of the theoretical radiants with the observed radiants of seven known meteor showers is also presented.
International Nuclear Information System (INIS)
Shishesaz, Mohammad Reza; Nazarnezhad Bajestani, Mohammad; Hashemi, Seyed Javad; Shekari, Elahe
2013-01-01
To ensure mechanical integrity, all pressure vessels shall be inspected at the intervals provided in inspection codes or based on a risk-based inspection (RBI) assessment. The RBI assessment may allow previously established inspection intervals to be extended. This paper describes the methodology, analysis and results of two RBI studies conducted on 293 pressure vessel components in two crude oil distillation units. Based on API RBI methodology in API 581 (2008), risk target concept was used for determining inspection dates. It was shown that when thinning is the major active damage, the RBI recommended intervals are as long as twice the API 510 intervals. This paper summarizes that, as a fundamental step in the risk calculation, RBI has a more defined methodology for evaluating equipment for multiple damage mechanisms and a more defined approach to specify the use of other inspection technologies beyond the traditional visual, ultrasonic, and radiography tests. -- Highlights: • RBI calculated inspection intervals are as long as twice of API 510 inspection code. • Two case studies verified the advantage of RBI in inspection planning. • RBI is a more reliable methodology when evaluating multiple damage mechanisms. • Damage factor calculations can be used for determining RSFa value in FFS assessments
THE INFLUENCE OF THERMAL EVOLUTION IN THE MAGNETIC PROTECTION OF TERRESTRIAL PLANETS
Energy Technology Data Exchange (ETDEWEB)
Zuluaga, Jorge I.; Bustamante, Sebastian; Cuartas, Pablo A. [Instituto de Fisica-FCEN, Universidad de Antioquia, Calle 67 No. 53-108, Medellin (Colombia); Hoyos, Jaime H., E-mail: jzuluaga@fisica.udea.edu.co, E-mail: sbustama@pegasus.udea.edu.co, E-mail: p.cuartas@fisica.udea.edu.co, E-mail: jhhoyos@udem.edu.co [Departamento de Ciencias Basicas, Universidad de Medellin, Carrera 87 No. 30-65, Medellin (Colombia)
2013-06-10
Magnetic protection of potentially habitable planets plays a central role in determining their actual habitability and/or the chances of detecting atmospheric biosignatures. Here we develop a thermal evolution model of potentially habitable Earth-like planets and super-Earths (SEs). Using up-to-date dynamo-scaling laws, we predict the properties of core dynamo magnetic fields and study the influence of thermal evolution on their properties. The level of magnetic protection of tidally locked and unlocked planets is estimated by combining simplified models of the planetary magnetosphere and a phenomenological description of the stellar wind. Thermal evolution introduces a strong dependence of magnetic protection on planetary mass and rotation rate. Tidally locked terrestrial planets with an Earth-like composition would have early dayside magnetopause distances between 1.5 and 4.0 R{sub p} , larger than previously estimated. Unlocked planets with periods of rotation {approx}1 day are protected by magnetospheres extending between 3 and 8 R{sub p} . Our results are robust in comparison with variations in planetary bulk composition and uncertainties in other critical model parameters. For illustration purposes, the thermal evolution and magnetic protection of the potentially habitable SEs GL 581d, GJ 667Cc, and HD 40307g were also studied. Assuming an Earth-like composition, we found that the dynamos of these planets are already extinct or close to being shut down. While GL 581d is the best protected, the protection of HD 40307g cannot be reliably estimated. GJ 667Cc, even under optimistic conditions, seems to be severely exposed to the stellar wind, and, under the conditions of our model, has probably suffered massive atmospheric losses.
Directory of Open Access Journals (Sweden)
Fábio Camargo Abdalla
2004-03-01
Full Text Available The occurrence, morphology and ultrastructure of the Dufour gland in Melipona bicolor Lepeletier, 1836 are presented. The Dufour gland is not present in workers. In virgin queens the gland cells show characteristics of low activity, which are described in the text. In physogastric queens the gland epithelium is higher and the cells more active than in virgin queens, showing numerous basal plasmic membrane invaginations impregnated by an electrondense material, increased apical invaginations and accumulation of substances that will be released to the gland lumen in the subcuticular space. Therefore, the data show that the Dufour gland is more developed in physogastric than in virgin queens, indicating a possible involvement of the Dufour gland in the reproduction of this species.A ocorrência, morfologia e ultra-estrutura da glândula de Dufour em Melipona bicolor Lepeletier, 1836 são apresentados. A glândula de Dufour não está presente nas operárias. Nas rainhas virgens, as células glandulares mostram características de baixa atividade, as quais são descritas no texto. Nas rainhas fisogástricas, o epitélio glandular é mais alto e as células mais ativas do que nas rainhas virgens, mostrando numerosas invaginações da membrana plasmática basal impregnadas por material eletrondenso, além do aumento da freqüência de invaginações apicais e acúmulo de substâncias no espaço subcuticular, as quais serão posteriormente liberadas ao lúmen da glândula. Portanto, os dados mostram que a glândula de Dufour é mais desenvolvida nas rainhas fisogástricas do que nas virgens, indicando um possível envolvimento da glândula de Dufour na reprodução desta espécie.
Energy Technology Data Exchange (ETDEWEB)
Offenbacher, Hannes; Lüftner, Daniel; Ules, Thomas; Reinisch, Eva Maria; Koller, Georg, E-mail: georg.koller@uni-graz.at; Puschnig, Peter; Ramsey, Michael G., E-mail: michael.ramsey@uni-graz.at
2015-10-01
Highlights: • Orbital tomography within the plane wave final state approximation. • One electron orbital predictions versus angle resolved photoemission experiment. • Geometric and electronic structure of organic thin films elucidated by ARUPS. • Influence of molecular conformation and orientation on ARUPS. • Retrieval of sexiphenyl and pentacene orbitals in real space. - Abstract: The frontier orbitals of molecules are the prime determinants of their chemical, optical and electronic properties. Arguably, the most direct method of addressing the (filled) frontier orbitals is ultra-violet photoemission spectroscopy (UPS). Although UPS is a mature technique from the early 1970s on, the angular distribution of the photoemitted electrons was thought to be too complex to be analysed quantitatively. Recently angle resolved UPS (ARUPS) work on conjugated molecules both, in ordered thick films and chemisorbed monolayers, has shown that the angular (momentum) distribution of the photocurrent from orbital emissions can be simply understood. The approach, based on the assumption of a plane wave final state is becoming known as orbital tomography. Here we will demonstrate, with selected examples of pentacene (5A) and sexiphenyl (6P), the potential of orbital tomography. First it will be shown how the full angular distribution of the photocurrent (momentum map) from a specific orbital is related to the real space orbital by a Fourier transform. Examples of the reconstruction of 5A orbitals will be given and the procedure for recovering the lost phase information will be outlined. We then move to examples of sexiphenyl where we interrogate the original band maps of thick sexiphenyl in the light of our understanding of orbital tomography that has developed since then. With comparison to theoretical simulations of the molecular band maps, the molecular conformation and orientation will be concluded. New results for the sexiphenyl monolayer on Al(1 1 0) will then be
Quark Orbital Angular Momentum
Directory of Open Access Journals (Sweden)
Burkardt Matthias
2015-01-01
Full Text Available Definitions of orbital angular momentum based on Wigner distributions are used as a framework to discuss the connection between the Ji definition of the quark orbital angular momentum and that of Jaffe and Manohar. We find that the difference between these two definitions can be interpreted as the change in the quark orbital angular momentum as it leaves the target in a DIS experiment. The mechanism responsible for that change is similar to the mechanism that causes transverse single-spin asymmetries in semi-inclusive deep-inelastic scattering.
International Nuclear Information System (INIS)
Trippe, S; Gillessen, S; Ott, T; Eisenhauer, F; Paumard, T; Martins, F; Genzel, R; Schoedel, R; Eckart, A; Alexander, T
2006-01-01
In this article we present and discuss the latest results from the observations of stars (''S-stars'') orbiting Sgr A* . With improving data quality the number of observed S-stars has increased substantially in the last years. The combination of radial velocity and proper motion information allows an ever more precise determination of orbital parameters and of the mass of and the distance to the supermassive black hole in the centre of the Milky Way. Additionally, the orbital solutions allow us to verify an agreement between the NIR source Sgr A* and the dynamical centre of the stellar orbits to within 2 mas
Orbital and adnexal sarcoidosis
Prabhakaran, Venkatesh C.; Saeed, Perooz; Esmaeli, Bita; Sullivan, Timothy J.; Mcnab, Alan; Davis, Garry; Valenzuela, Alejandra; Leibovitch, Igal; Kesler, Anat; Sivak-Callcott, Jennifer; Hoyama, Erika; Selva, Dinesh
2007-01-01
To present the clinical features and management in a series of patients with orbital and adnexal sarcoidosis. This multicenter retrospective study included patients with biopsy-proven noncaseating granuloma involving the orbit or adnexa and evidence of systemic sarcoidosis. Clinical records were
Directory of Open Access Journals (Sweden)
Paula Dib de Carvalho
2005-06-01
Full Text Available Foi estudada uma população de Stigmaphyllon paralias (Malpighiaceae em Feira de Santana, Bahia, Brasil, visando analisar a variação do número de glândulas e sua produção de óleo nas flores. Dos indivíduos analisados, 76% não variaram o número de glândulas entre suas flores, ocorrendo 41% de indivíduos com flores que possuem 10 glândulas, 31% com oito glândulas e 4% com nove glândulas. Nas flores dos morfos que apresentam oito e nove glândulas, as glândulas ausentes são sempre as da sépala inferior. Centris leprieuri e Epicharis sp. (Apidae: Centridini foram as únicas espécies que visitaram S. paralias, coletando óleo como recompensa. A sépala inferior localiza-se sob o abdome do polinizador quando pousado na flor, tornando-se inacessível à coleta de óleo. Sugerimos que a incapacidade de utilização de algumas glândulas pelos polinizadores possa ter possibilitado o aparecimento de morfos nas populações que não apresentam estas glândulas como caráter adaptativo por gerar economia de recursos na produção de recompensa não utilizada pelo polinizador. Todas as glândulas de todos os morfos são funcionais. As flores dos dois morfos principais com oito e 10 glândulas, produzem a mesma quantidade total de óleo. As glândulas das flores com oito glândulas aumentam a produção em cerca de 20%, compensando a produção total de óleo por flor.A population of Stigmaphyllon paralias (Malpighiaceae was studied in Feira de Santana, Bahia, Brazil. Variation of the number of oil glands and oil production in the flowers were analized. 76% of the individuals did not present variation on the number of glands among their flowers, 41% presented flowers with 10 glands, 31% with eight glands and 4% with nine glands. In the flowers of the morphs with eight or nine glands, the absent glands were always associated to the inferior sepal. Only Centris leprieuri and Epicharis sp. (Apidae: Centridini visited flowers of S. paralias
Directory of Open Access Journals (Sweden)
Patrícia Meira Bento
2006-06-01
Full Text Available OBJECTIVES: To analyze the expression and distribution pattern of extracellular matrix components in pleomorphic adenomas of the major and minor salivary glands and to compare the morphological findings of these tumors with the immunohistochemical expression, considering the different types of stroma predominating in each case. METHODS AND RESULTS: The expression of tenascin (TN and fibronectin (FN was analyzed in 23 cases of pleomorphic adenomas, 11 major and 12 minor salivary gland tumors, by the streptavidin-biotin method using anti-tenascin and anti-fibronectin antibodies. In addition, the immunohistochemical results were correlated with the morphological findings of the lesions. All cases analyzed were immunoreactive for the antibodies used. Fibronectin showed strong labeling in fibrous and chondroid stroma, while labeling was weak in hyaline and myxoid stroma. Tenascin expression was more intense in fibrous and chondroid stroma and moderate in hyaline and myxoid stroma. CONCLUSIONS: No difference in the expression of these proteins was observed between major and minor salivary gland tumors.OBJETIVO: Analisar a expressão e o padrão de distribuição de componentes da matriz extracelular em adenomas pleomórficos de glândula salivar maior e menor e comparar os achados morfológicos destes tumores com a expressão imuno-histoquímica considerando os diferentes tipos de estromas presentes em cada caso. MÉTODOS E RESULTADOS: A expressão da tenascina (TN e fibronectina (FN foi analisada em 23 casos de adenomas pleomórficos, sendo 11 tumores em glândula salivar maior e 12 em glândula salivar menor, utilizando-se o método da estreptoavidina-biotina para os anticorpos anti-tenascina e anti-fibronectina. Os resultados imuno-histoquimicos foram correlacionados com os achados morfológicos das lesões. Todos os casos foram imunorreativos para a fibronectina mostrando forte expressão nos estromas fibrosos e condróides, embora fraca marca
Algorithms for orbit control on SPEAR
International Nuclear Information System (INIS)
Corbett, J.; Keeley, D.; Hettel, R.; Linscott, I.; Sebek, J.
1994-06-01
A global orbit feedback system has been installed on SPEAR to help stabilize the position of the photon beams. The orbit control algorithms depend on either harmonic reconstruction of the orbit or eigenvector decomposition. The orbit motion is corrected by dipole corrector kicks determined from the inverse corrector-to-bpm response matrix. This paper outlines features of these control algorithms as applied to SPEAR
Orbital Resonances in the Vinti Solution
Zurita, L. D.
As space becomes more congested, contested, and competitive, high-accuracy orbital predictions become critical for space operations. Current orbit propagators use the two-body solution with perturbations added, which have significant error growth when numerically integrated for long time periods. The Vinti Solution is a more accurate model than the two-body problem because it also accounts for the equatorial bulge of the Earth. Unfortunately, the Vinti solution contains small divisors near orbital resonances in the perturbative terms of the Hamiltonian, which lead to inaccurate orbital predictions. One approach to avoid the small divisors is to apply transformation theory, which is presented in this research. The methodology of this research is to identify the perturbative terms of the Vinti Solution, perform a coordinate transformation, and derive the new equations of motion for the Vinti system near orbital resonances. An analysis of these equations of motion offers insight into the dynamics found near orbital resonances. The analysis in this research focuses on the 2:1 resonance, which includes the Global Positioning System. The phase portrait of a nominal Global Positioning System satellite orbit is found to contain a libration region and a chaotic region. Further analysis shows that the dynamics of the 2:1 resonance affects orbits with semi-major axes ranging from -5.0 to +5.4 kilometers from an exactly 2:1 resonant orbit. Truth orbits of seven Global Positioning System satellites are produced for 10 years. Two of the satellites are found to be outside of the resonance region and three are found to be influenced by the libration dynamics of the resonance. The final satellite is found to be influenced by the chaotic dynamics of the resonance. This research provides a method of avoiding the small divisors found in the perturbative terms of the Vinti Solution near orbital resonances.
DEFF Research Database (Denmark)
Such-Sanmartín, Gerard; Bache, Nicolai; Callesen, Anne K
2015-01-01
aggravated when using fast high-throughput methods, which are necessary for analysis of hundreds and thousands of samples in clinical laboratories. The blood proteins IGF1, IGF2, IBP2, IBP3 and A2GL have been proposed as indirect biomarkers for detection of GH administration and as putative biomarkers...
Orbit determination for ISRO satellite missions
Rao, Ch. Sreehari; Sinha, S. K.
Indian Space Research Organisation (ISRO) has been successful in using the in-house developed orbit determination and prediction software for satellite missions of Bhaskara, Rohini and APPLE. Considering the requirements of satellite missions, software packages are developed, tested and their accuracies are assessed. Orbit determination packages developed are SOIP, for low earth orbits of Bhaskara and Rohini missions, ORIGIN and ODPM, for orbits related to all phases of geo-stationary missions and SEGNIP, for drift and geo-stationary orbits. Software is tested and qualified using tracking data of SIGNE-3, D5-B, OTS, SYMPHONIE satellites with the help of software available with CNES, ESA and DFVLR. The results match well with those available from these agencies. These packages have supported orbit determination successfully throughout the mission life for all ISRO satellite missions. Member-Secretary
Directory of Open Access Journals (Sweden)
Jean Nunes dos Santos
2008-06-01
Full Text Available Cystadenoma of salivary glands is an uncommon benign neoplasm that presents intraluminal papillary projections. The authors describe one case of cystadenoma located in the buccal mucosa and highlight its histomorphological features and differential diagnosis.O cistadenoma de glândula salivar é uma neoplasia benigna incomum, que exibe projeções papilíferas intraluminais. Os autores descrevem um caso de cistadenoma localizado na mucosa jugal, discutindo os aspectos histomorfológicos e o diagnóstico diferencial desse tumor.
Space Tourism: Orbital Debris Considerations
Mahmoudian, N.; Shajiee, S.; Moghani, T.; Bahrami, M.
2002-01-01
Space activities after a phase of research and development, political competition and national prestige have entered an era of real commercialization. Remote sensing, earth observation, and communication are among the areas in which this growing industry is facing competition and declining government money. A project like International Space Station, which draws from public money, has not only opened a window of real multinational cooperation, but also changed space travel from a mere fantasy into a real world activity. Besides research activities for sending man to moon and Mars and other outer planets, space travel has attracted a considerable attention in recent years in the form of space tourism. Four countries from space fairing nations are actively involved in the development of space tourism. Even, nations which are either in early stages of space technology development or just beginning their space activities, have high ambitions in this area. This is worth noting considering their limited resources. At present, trips to space are available, but limited and expensive. To move beyond this point to generally available trips to orbit and week long stays in LEO, in orbital hotels, some of the required basic transportations, living requirements, and technological developments required for long stay in orbit are already underway. For tourism to develop to a real everyday business, not only the price has to come down to meaningful levels, but also safety considerations should be fully developed to attract travelers' trust. A serious hazard to space activities in general and space tourism in particular is space debris in earth orbit. Orbiting debris are man-made objects left over by space operations, hazardous to space missions. Since the higher density of debris population occurs in low earth orbit, which is also the same orbit of interest to space tourism, a careful attention should be paid to the effect of debris on tourism activities. In this study, after a
López Pazos, Paula
2016-01-01
La patología de las glándulas salivales incluye anomalías en el desarrollo, alteraciones funcionales, inflamatorias, sialolitiasis, sialoadenosis y patología tumoral. Los tumores de glándulas salivales son un grupo muy heterogéneo, con patrones histológicos y pronósticos muy diferentes, consideramos por este motivo que conocer sus características epidemiológicas, histopatológicas, inmunohistoquímicas y pronósticas en nuestra área es el punto de partida para su correcto diagnóstico y plan de t...
International Nuclear Information System (INIS)
Boschi Oyhenart, J.; Tenyi, A.; Boschi Pau, J.
2002-01-01
Orbital varices are venous malformations produced by an abnormal dilatation of one or more orbital veins, probably associated with congenital weakness of the vascular wall. They are rare lesions, usually occurring in young patients, that produce intermittent proptosis related to the increase in the systemic venous pressure. The presence of hemorrhage or thrombosis is associated with rapid development of proptosis, pain and decreased ocular motility. We report the cases of two adult patients with orbital varices complicated by thrombosis in whom the diagnosis was based on computed tomography. The ultrasound and magnetic resonance findings are also discussed. (Author) 16 refs
International Nuclear Information System (INIS)
Suparta, W; Zulkeple, S K
2014-01-01
The space environment has grown intensively harmful to spacecraft and astronauts. Galactic cosmic rays (GCRs) are one of the radiation sources that composed of high energetic particles originated from space and capable of damaging electronic systems through single event upset (SEU) process. In this paper, we analyzed GCR fluxes at different altitudes by using Space Environment Information System (SPENVIS) software and the results are compared to determine their intensities with respect to distance in the Earth's orbit. The altitudes are set at low earth orbit (400 km and 685 km), medium earth orbit (19,100 km and 20,200 km) and high earth orbit (35,793 km and 1,000,000 km). Then, within Low Earth Orbit (LEO) near the equator (NEqO), we used altitude of 685 km to compare GCRs with the intensities of solar particles and trapped particles in the radiation belt to determine the significance of GCRs in the orbit itself.
Orbital and Landing Operations at Near-Earth
Scheeres, D. J.
1995-01-01
Orbital and landing operations about near-Earth asteroids are different than classical orbital operations about large bodies. The major differences lie with the small mass of the asteroid, the lower orbital velocities, the larger Solar tide and radiation pressure perturbations, the irregular shape of the asteroid and the potential for non-uniform rotation of the asteroid. These differences change the nature of orbits about an asteroid to where it is often common to find trajectories that evolve from stable, near-circular orbits to crashing or escaping orbits in a matter of days. The understanding and control of such orbits is important if a human or robotic presence at asteroids is to be commonplace in the future.
Metrics in Keplerian orbits quotient spaces
Milanov, Danila V.
2018-03-01
Quotient spaces of Keplerian orbits are important instruments for the modelling of orbit samples of celestial bodies on a large time span. We suppose that variations of the orbital eccentricities, inclinations and semi-major axes remain sufficiently small, while arbitrary perturbations are allowed for the arguments of pericentres or longitudes of the nodes, or both. The distance between orbits or their images in quotient spaces serves as a numerical criterion for such problems of Celestial Mechanics as search for common origin of meteoroid streams, comets, and asteroids, asteroid families identification, and others. In this paper, we consider quotient sets of the non-rectilinear Keplerian orbits space H. Their elements are identified irrespective of the values of pericentre arguments or node longitudes. We prove that distance functions on the quotient sets, introduced in Kholshevnikov et al. (Mon Not R Astron Soc 462:2275-2283, 2016), satisfy metric space axioms and discuss theoretical and practical importance of this result. Isometric embeddings of the quotient spaces into R^n, and a space of compact subsets of H with Hausdorff metric are constructed. The Euclidean representations of the orbits spaces find its applications in a problem of orbit averaging and computational algorithms specific to Euclidean space. We also explore completions of H and its quotient spaces with respect to corresponding metrics and establish a relation between elements of the extended spaces and rectilinear trajectories. Distance between an orbit and subsets of elliptic and hyperbolic orbits is calculated. This quantity provides an upper bound for the metric value in a problem of close orbits identification. Finally the invariance of the equivalence relations in H under coordinates change is discussed.
Posttraumatic Orbital Emphysema: A Numerical Model
Directory of Open Access Journals (Sweden)
Andrzej Skorek
2014-01-01
Full Text Available Orbital emphysema is a common symptom accompanying orbital fracture. The pathomechanism is still not recognized and the usually assumed cause, elevated pressure in the upper airways connected with sneezing or coughing, does not always contribute to the occurrence of this type of fracture. Observations based on the finite model (simulating blowout type fracture of the deformations of the inferior orbital wall after a strike in its lower rim. Authors created a computer numeric model of the orbit with specified features—thickness and resilience modulus. During simulation an evenly spread 14400 N force was applied to the nodular points in the inferior rim (the maximal value not causing cracking of the outer rim, but only ruptures in the inferior wall. The observation was made from 1·10-3 to 1·10-2 second after a strike. Right after a strike dislocations of the inferior orbital wall toward the maxillary sinus were observed. Afterwards a retrograde wave of the dislocation of the inferior wall toward the orbit was noticed. Overall dislocation amplitude reached about 6 mm. Based on a numeric model of the orbit submitted to a strike in the inferior wall an existence of a retrograde shock wave causing orbital emphysema has been found.
Hemangiopericitoma de órbita Orbital hemangiopericytoma
Directory of Open Access Journals (Sweden)
Ana Paula Ximenes Alves
2001-04-01
Full Text Available Objetivo: Descrever um raro caso de hemangiopericitoma orbital. Métodos: Relato de caso de associação entre hemangipericitoma orbital e blefaroptose. Resultados: A exérese da neoplasia normalizou o posicionamento palpebral. Conclusões: Lesões orbitais anteriores são causas de blefaroptose por compressão do músculo elevador palpebral.Purpose: To describe a rare case of orbital hemangiope- ricytoma. Methods: Case report of an association of blepha-roptosis with orbital hemangiopericytoma. Results: When the lesion was surgically removed the position of the upper eyelid returned to normal. Conclusions: Anterior orbital lesions can lead to blepharoptosis by compression of the levator palpebrae muscle.
Directory of Open Access Journals (Sweden)
Ana Maria Queiroz
2017-05-01
Full Text Available Resumo Os celíacos encontram dificuldades na adoção de uma dieta totalmente isenta de glúten e com qualidade nutricional. Para tanto, objetivou-se desenvolver e avaliar cookies sem glúten enriquecidos com farinha de coco. A farinha de coco com elevado teor de cinzas, proteínas e lipídios pode ser utilizada para enriquecer produtos alimentícios. Foram elaborados cookies com base na composição de uma mistura da Federação Nacional das Associações de Celíacos do Brasil - Fenacelbra (“mix de farinha preparada II” para cookies sem glúten: Padrão FP (formulação semelhante à composição do “mix de farinha preparada II” da Fenacelbra, F1 (modificação de FP com substituição da fécula de batata por 10% de farinha de coco, F2 (modificação de FP com adição de 5% de farinha de coco, F3 (modificação de FP com substituição do polvilho doce por 5% de farinha de coco. Os cookies foram avaliados quanto às características físicas (peso pós-cocção, diâmetro e espessura pós-cocção, fator de expansão, rendimento, Aw, dureza e cor – L*a*b*, físico-químicas (umidade, cinzas, proteínas, lipídios, carboidratos e valor calórico, aceitabilidade quanto aos atributos sensoriais (aceitação global, aparência, cor, aroma, sabor e textura e atitude de compra. A adição de farinha de coco às formulações melhorou as propriedades nutricionais dos cookies sem glúten, aumentando o teor de lipídios e proteínas, e reduzindo o teor de carboidratos. Os cookies desenvolvidos apresentaram boa aceitação sensorial e intenção de compra satisfatória., A adição de 10% de farinha de coco em substituição da fécula de batata na formulação F1 não alterou as características sensoriais do produto, porém proporcionou propriedades físicas e físico-químicas superiores. Dessa forma, cookies sem glúten enriquecidos com farinha de coco constituem uma alternativa viável de alimentos destinados para pessoas portadoras de
Theory and design methods of special space orbits
Zhang, Yasheng; Zhou, Haijun
2017-01-01
This book focuses on the theory and design of special space orbits. Offering a systematic and detailed introduction to the hovering orbit, spiral cruising orbit, multi-target rendezvous orbit, initiative approaching orbit, responsive orbit and earth pole-sitter orbit, it also discusses the concept, theory, design methods and application of special space orbits, particularly the design and control method based on kinematics and astrodynamics. In addition the book presents the latest research and its application in space missions. It is intended for researchers, engineers and postgraduates, especially those working in the fields of orbit design and control, as well as space-mission planning and research.
On the lunar node resonance of the orbital plane evolution of the Earth's satellite orbits
Zhu, Ting-Lei
2018-06-01
This paper aims to investigate the effects of lunar node resonance on the circular medium Earth orbits (MEO). The dynamical model is established in classical Hamiltonian systems with the application of Lie transform to remove the non-resonant terms. Resonant condition, stability and phase structures are studied. The lunar node resonance occurs when the secular changing rates of the orbital node (with respect to the equator) and the lunar node (with respect to the ecliptic) form a simple integer ratio. The resonant conditions are satisfied for both inclined and equatorial orbits. The orbital plane would have long period (with typical timescales of several centuries) fluctuation due to the resonance.
Meteoroid Orbits from Observations
Campbell-Brown, Margaret
2018-04-01
Millions of orbits of meteoroids have been measured over the last few decades, and they comprise the largest sample of orbits of solar system bodies which exists. The orbits of these objects can shed light on the distribution and evolution of comets and asteroids in near-Earth space (e.g. Neslusan et al. 2016). If orbits can be measured at sufficiently high resolution, individual meteoroids can be traced back to their parent bodies and, in principle, even to their ejection time (Rudawska et al. 2012). Orbits can be measured with multi-station optical observations or with radar observations.The most fundamental measured quantities are the speed of the meteor and the two angles of the radiant, or point in the sky from which the meteor appears to come. There are many methods used to determine these from observations, but not all produce the most accurate results (Egal et al. 2017). These three measured quantities, along with the time and location of the observation, are sufficient to obtain an orbit (see, e.g., Clark & Wiegert 2011), but the measurements must be corrected for the deceleration of the meteoroid in the atmosphere before it was detected, the rotation of the Earth, and the gravitational attraction of the Earth (including higher order moments if great precision is necessary).Once meteor orbits have been determined, studies of the age and origin of meteor showers (Bruzzone et al., 2015), the parent bodies of sporadic sources (Pokorny et al. 2014), and the dynamics of the meteoroid complex as a whole can be constrained.Bruzzone, J. S., Brown, P., Weryk, R., Campbell-Brown, M., 2015. MNRAS 446, 1625.Clark, D., Wiegert, P., 2011. M&PS 46, 1217.Egal, A., Gural, P., Vaubaillon, J., Colas, F., Thuillot, W., 2017. Icarus 294, 43.Neslusan, L., Vaubaillon, J., Hajdukova, M., 2016. A&A 589, id.A100.Pokorny, P., Vokrouhlicky, D., Nesvorny, D., Campbell-Brown, M., Brown, P., 2014. ApJ 789, id.25.Rudawska, R., Vaubaillon, J., Atreya, P., 2012. A&A 541, id.A2
Tarsitano, Achille; Badiali, Giovanni; Pizzigallo, Angelo; Marchetti, Claudio
2016-10-01
Enophthalmos is a severe complication of primary reconstruction of orbital floor fractures. The goal of secondary reconstruction procedures is to restore symmetrical globe positions to recover function and aesthetics. The authors propose a new method of orbital floor reconstruction using a mirroring technique and a customized titanium mesh, printed using a direct metal laser-sintering method. This reconstructive protocol involves 4 steps: mirroring of the healthy orbit at the affected site, virtual design of a patient-specific orbital floor mesh, CAM procedures for direct laser-sintering of the customized titanium mesh, and surgical insertion of the device. Using a computed tomography data set, the normal, uninjured side of the craniofacial skeleton was reflected onto the contralateral injured side, and a reconstructive orbital floor mesh was designed virtually on the mirrored orbital bone surface. The solid-to-layer files of the mesh were then manufactured using direct metal laser sintering, which resolves the shaping and bending biases inherent in the indirect method. An intraoperative navigation system ensured accuracy of the entire procedure. Clinical outcomes were assessed using 3dMD photogrammetry and computed tomography data in 7 treated patients. The technique described here appears to be a viable method to correct complex orbital floor defects needing delayed reconstruction. This study represents the first step in the development of a wider experimental protocol for orbital floor reconstruction using computer-assisted design-computer-assisted manufacturing technology.
Image Quality Improvement on OpenGL-Based Animations by Using CUDA Architecture
Directory of Open Access Journals (Sweden)
Taner UÇKAN
2016-04-01
Full Text Available 2D or 3D rendering technology is used for graphically modelling many physical phenomena occurring in real life by means of the computers. On the other hand, the ever-increasing intensity of the graphics applications require that the image quality of the so-called modellings is enhanced and they are performed more quickly. In this direction, a new software and hardware-based architecture called CUDA has been introduced by Nvidia at the end of 2006. Thanks to this architecture, larger number of graphics processors has started contributing towards the parallel solutions of the general-purpose problems. In this study, this new parallel computing architecture is taken into consideration and an animation application consisting of humanoid robots with different behavioral characteristics is developed using the OpenGL library in C++. This animation is initially implemented on a single serial CPU and then parallelized using the CUDA architecture. Eventually, the serial and the parallel versions of the same animation are compared against each other on the basis of the number of image frames per second. The results reveal that the parallel application is by far the best yielding high quality images.
Merriam, M. L.
2002-01-01
Traditional studies of Reusable Launch Vehicle (RLV) designs have focused on designs that are completely reusable except for the fuel. This may not be realistic with current technology . An alternate approach is to look at partially reusable launch vehicles. This raises the question of which parts should be reused and which parts should be expendable. One approach is to consider the cost/pound of returning these parts from orbit. With the shuttle, this cost is about three times the cost/pound of launching payload into orbit. A subtle corollary is that RLVs are much less practical for higher orbits, such as the one on which the International Space Station resides, than they are for low earth orbits.
Kibler, J. F.; Green, R. N.; Young, G. R.; Kelly, M. G.
1974-01-01
A method has previously been developed to satisfy terminal rendezvous and intermediate timing constraints for planetary missions involving orbital operations. The method uses impulse factoring in which a two-impulse transfer is divided into three or four impulses which add one or two intermediate orbits. The periods of the intermediate orbits and the number of revolutions in each orbit are varied to satisfy timing constraints. Techniques are developed to retarget the orbital transfer in the presence of orbit-determination and maneuver-execution errors. Sample results indicate that the nominal transfer can be retargeted with little change in either the magnitude (Delta V) or location of the individual impulses. Additonally, the total Delta V required for the retargeted transfer is little different from that required for the nominal transfer. A digital computer program developed to implement the techniques is described.
The Carter constant for inclined orbits about a massive Kerr black hole: I. Circular orbits
Energy Technology Data Exchange (ETDEWEB)
Komorowski, P G; Valluri, S R; Houde, M, E-mail: pkomorow@uwo.c, E-mail: valluri@uwo.c, E-mail: mhoude2@uwo.c [Department of Physics and Astronomy, University of Western Ontario, London, Ontario (Canada)
2010-11-21
In an extreme binary black hole system, an orbit will increase its angle of inclination ({iota}) as it evolves in Kerr spacetime. We focus our attention on the behaviour of the Carter constant (Q) for near-polar orbits, and develop an analysis that is independent of and complements radiation-reaction models. For a Schwarzschild black hole, the polar orbits represent the abutment between the prograde and retrograde orbits at which Q is at its maximum value for given values of the latus rectum ({tilde l}) and the eccentricity (e). The introduction of spin ({tilde S}={vert_bar}J{vert_bar}/M{sup 2}) to the massive black hole causes this boundary, or abutment, to be moved towards greater orbital inclination; thus, it no longer cleanly separates prograde and retrograde orbits. To characterize the abutment of a Kerr black hole (KBH), we first investigated the last stable orbit (LSO) of a test-particle about a KBH, and then extended this work to general orbits. To develop a better understanding of the evolution of Q we developed analytical formulae for Q in terms of {tilde l}, e and {tilde S} to describe elliptical orbits at the abutment, polar orbits and LSOs. By knowing the analytical form of {partial_derivative}Q/{partial_derivative}{tilde l} at the abutment, we were able to test a 2PN flux equation for Q. We also used these formulae to numerically calculate the {partial_derivative}{iota}/{partial_derivative}{tilde l} of hypothetical circular orbits that evolve along the abutment. From these values we have determined that {partial_derivative}{iota}/{partial_derivative}{tilde l} = -(122.7{tilde S} - 36{tilde S}{sup 3}){tilde l}{sup -11/2} - (63/2 {tilde S} + 35/4 {tilde S}{sup 3}){tilde l}{sup -9/2} - 15/2 {tilde S}{tilde l}{sup -7/2} - 9/2 {tilde S}{tilde l}{sup -5/2}. By taking the limit of this equation for {tilde l} {yields} {infinity}, and comparing it with the published result for the weak-field radiation reaction, we found the upper limit on
Romero, P.; Pablos, B.; Barderas, G.
2017-07-01
Areostationary satellites are considered a high interest group of satellites to satisfy the telecommunications needs of the foreseen missions to Mars. An areostationary satellite, in an areoequatorial circular orbit with a period of 1 Martian sidereal day, would orbit Mars remaining at a fixed location over the Martian surface, analogous to a geostationary satellite around the Earth. This work addresses an analysis of the perturbed orbital motion of an areostationary satellite as well as a preliminary analysis of the aerostationary orbit estimation accuracy based on Earth tracking observations. First, the models for the perturbations due to the Mars gravitational field, the gravitational attraction of the Sun and the Martian moons, Phobos and Deimos, and solar radiation pressure are described. Then, the observability from Earth including possible occultations by Mars of an areostationary satellite in a perturbed areosynchronous motion is analyzed. The results show that continuous Earth-based tracking is achievable using observations from the three NASA Deep Space Network Complexes in Madrid, Goldstone and Canberra in an occultation-free scenario. Finally, an analysis of the orbit determination accuracy is addressed considering several scenarios including discontinuous tracking schedules for different epochs and different areoestationary satellites. Simulations also allow to quantify the aerostationary orbit estimation accuracy for various tracking series durations and observed orbit arc-lengths.
Ahmed, Ahmed; Noureldin, Rehab; Gendy, Mohamed; Sakr, Sharif; Abdel Naby, Mahmoud
2013-06-01
Orbital meningoceles and encephaloceles are rare extracranial extensions of the brain and meninges with or without direct communication between the central nervous system and the abnormal mass. We reported a rare case of large fetal orbital encephalocele; the diagnosis was suspected initially by prenatal ultrasound and confirmed by postnatal MRI and CT scans. The differential diagnosis of an intrauterine fetal cystic orbital mass includes orbital teratoma, epidermoid inclusion cysts, hemangioma or lymphangioma, congenital cystic eye, dacryocystocele, and orbital cephalocele. Copyright © 2012 Wiley Periodicals, Inc.
Periodic orbits near the particle resonance in galaxies
Contopoulos, George
1978-01-01
Near the particle resonance of a spiral galaxy the almost circular periodic orbits that exist inside the resonance (direct) or outside it (retrograde) are replaced by elongated trapped orbits around the maxima of the potential L/sub 4/ and L/sub 5/. These are the long- period trapped periodic orbits. The long-period orbits shrink to the points L/sub 4/, L/sub 5/ for a critical value of the Hamiltonian h. For still larger h, a family of short-period trapped orbits appears, with continuously growing size. The evolution of the periodic orbits with h is followed, theoretically and numerically, from the untrapped orbits to the long-periodic orbits and then to the short-periodic orbits, mainly in the case of a bar. In a tight spiral case an explanation of the asymmetric periodic and banana orbits is given, and an example of short-period orbits not surrounding L/sub 4/ or L/sub 5/ is provided. Another family of periodic orbits reaching corotation is trapped at the inner Lindblad resonance. (5 refs).
International Nuclear Information System (INIS)
Baumann, M.; Petersen, C.; Schulz, P.; Baisch, H.
1999-01-01
Background and purpose: The impact of overall treatment time of fractionated irradiation on local control of slow growing human GL squamous cell carcinoma (SCC) was determined. Materials and methods: Moderately well differentiated and keratinizing human GL SCC with a volume doubling time of 8 days were transplanted subcutaneously into the right hindleg of NMRI (nu/nu) mice and irradiated with 30 fractions under ambient conditions over 2, 3, 4.5, 6 and 10 weeks. Endpoint of the experiments was local tumor control at day 180 after end of treatment.Results: The tumor control dose 50% (TCD 50) increased from 40 to 57 Gy when the treatment time was extended from 2 to 10 weeks. The data can be well described by a linear increase in TCD 50 with time. The recovered dose per day (D r ) was 0.28 Gy (95% confidence interval 0.06; 0.48). The fit to the data was not significantly improved by assuming a biphasic (dog-leg) time course with constant TCD 50 values in the initial part of treatment followed by a more rapid increase of TCD 50 thereafter.Conclusions: D r in GL SCC was significantly less than the value of 1.0 Gy (0.7; 1.3 ) previously reported for poorly differentiated, non-keratinizing and fast growing human FaDu SCC (Baumann M, Liertz C, Baisch H, Wiegel T, Lorenzen J, Arps H. Impact of overall treatment time of fractionated irradiation on local control of human FaDu squamous cell carcinoma in nude mice. Radiother. Oncol. 1994;32:137-143), indicating important heterogeneity of the time factor between different tumors of the same histological type. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
International Nuclear Information System (INIS)
Hattori, Kazumasa
2010-01-01
We investigate a two-orbital Anderson lattice model with Ising orbital intersite exchange interactions on the basis of a dynamical mean field theory combined with the static mean field approximation of intersite orbital interactions. Focusing on Ce-based heavy-fermion compounds, we examine the orbital crossover between two orbital states, when the total f-electron number per site n f is ∼1. We show that a 'meta-orbital' transition, at which the occupancy of two orbitals changes steeply, occurs when the hybridization between the ground-state f-electron orbital and conduction electrons is smaller than that between the excited f-electron orbital and conduction electrons at low pressures. Near the meta-orbital critical end point, orbital fluctuations are enhanced and couple with charge fluctuations. A critical theory of meta-orbital fluctuations is also developed by applying the self-consistent renormalization theory of itinerant electron magnetism to orbital fluctuations. The critical end point, first-order transition, and crossover are described within Gaussian approximations of orbital fluctuations. We discuss the relevance of our results to CeAl 2 , CeCu 2 Si 2 , CeCu 2 Ge 2 , and related compounds, which all have low-lying crystalline-electric-field excited states. (author)
DEFF Research Database (Denmark)
Ramos, Juan David Hincapie; Tabard, Aurélien; Bardram, Jakob
2010-01-01
We introduce GridOrbit, a public awareness display that visualizes the activity of a community grid used in a biology laboratory. This community grid executes bioin-formatics algorithms and relies on users to donate CPU cycles to the grid. The goal of GridOrbit is to create a shared awareness about...
[1012.5676] The Exoplanet Orbit Database
: The Exoplanet Orbit Database Authors: Jason T Wright, Onsi Fakhouri, Geoffrey W. Marcy, Eunkyu Han present a database of well determined orbital parameters of exoplanets. This database comprises parameters, and the method used for the planets discovery. This Exoplanet Orbit Database includes all planets
van Meer, R; Gritsenko, O V; Baerends, E J
2014-10-14
In recent years, several benchmark studies on the performance of large sets of functionals in time-dependent density functional theory (TDDFT) calculations of excitation energies have been performed. The tested functionals do not approximate exact Kohn-Sham orbitals and orbital energies closely. We highlight the advantages of (close to) exact Kohn-Sham orbitals and orbital energies for a simple description, very often as just a single orbital-to-orbital transition, of molecular excitations. Benchmark calculations are performed for the statistical average of orbital potentials (SAOP) functional for the potential [J. Chem. Phys. 2000, 112, 1344; 2001, 114, 652], which approximates the true Kohn-Sham potential much better than LDA, GGA, mGGA, and hybrid potentials do. An accurate Kohn-Sham potential does not only perform satisfactorily for calculated vertical excitation energies of both valence and Rydberg transitions but also exhibits appealing properties of the KS orbitals including occupied orbital energies close to ionization energies, virtual-occupied orbital energy gaps very close to excitation energies, realistic shapes of virtual orbitals, leading to straightforward interpretation of most excitations as single orbital transitions. We stress that such advantages are completely lost in time-dependent Hartree-Fock and partly in hybrid approaches. Many excitations and excitation energies calculated with local density, generalized gradient, and hybrid functionals are spurious. There is, with an accurate KS, or even the LDA or GGA potentials, nothing problematic about the "band gap" in molecules: the HOMO-LUMO gap is close to the first excitation energy (the optical gap).
Risk analysis of heat recovery steam generator with semi quantitative risk based inspection API 581
Prayogo, Galang Sandy; Haryadi, Gunawan Dwi; Ismail, Rifky; Kim, Seon Jin
2016-04-01
Corrosion is a major problem that most often occurs in the power plant. Heat recovery steam generator (HRSG) is an equipment that has a high risk to the power plant. The impact of corrosion damage causing HRSG power plant stops operating. Furthermore, it could be threaten the safety of employees. The Risk Based Inspection (RBI) guidelines by the American Petroleum Institute (API) 58 has been used to risk analysis in the HRSG 1. By using this methodology, the risk that caused by unexpected failure as a function of the probability and consequence of failure can be estimated. This paper presented a case study relating to the risk analysis in the HRSG, starting with a summary of the basic principles and procedures of risk assessment and applying corrosion RBI for process industries. The risk level of each HRSG equipment were analyzed: HP superheater has a medium high risk (4C), HP evaporator has a medium-high risk (4C), and the HP economizer has a medium risk (3C). The results of the risk assessment using semi-quantitative method of standard API 581 based on the existing equipment at medium risk. In the fact, there is no critical problem in the equipment components. Damage mechanisms were prominent throughout the equipment is thinning mechanism. The evaluation of the risk approach was done with the aim of reducing risk by optimizing the risk assessment activities.
Risk analysis of heat recovery steam generator with semi quantitative risk based inspection API 581
International Nuclear Information System (INIS)
Prayogo, Galang Sandy; Haryadi, Gunawan Dwi; Ismail, Rifky; Kim, Seon Jin
2016-01-01
Corrosion is a major problem that most often occurs in the power plant. Heat recovery steam generator (HRSG) is an equipment that has a high risk to the power plant. The impact of corrosion damage causing HRSG power plant stops operating. Furthermore, it could be threaten the safety of employees. The Risk Based Inspection (RBI) guidelines by the American Petroleum Institute (API) 58 has been used to risk analysis in the HRSG 1. By using this methodology, the risk that caused by unexpected failure as a function of the probability and consequence of failure can be estimated. This paper presented a case study relating to the risk analysis in the HRSG, starting with a summary of the basic principles and procedures of risk assessment and applying corrosion RBI for process industries. The risk level of each HRSG equipment were analyzed: HP superheater has a medium high risk (4C), HP evaporator has a medium-high risk (4C), and the HP economizer has a medium risk (3C). The results of the risk assessment using semi-quantitative method of standard API 581 based on the existing equipment at medium risk. In the fact, there is no critical problem in the equipment components. Damage mechanisms were prominent throughout the equipment is thinning mechanism. The evaluation of the risk approach was done with the aim of reducing risk by optimizing the risk assessment activities.
Risk analysis of heat recovery steam generator with semi quantitative risk based inspection API 581
Energy Technology Data Exchange (ETDEWEB)
Prayogo, Galang Sandy, E-mail: gasandylang@live.com; Haryadi, Gunawan Dwi; Ismail, Rifky [Department of Mechanical Engineering, Diponegoro University, Semarang (Indonesia); Kim, Seon Jin [Department of Mechanical & Automotive Engineering of Pukyong National University (Korea, Republic of)
2016-04-19
Corrosion is a major problem that most often occurs in the power plant. Heat recovery steam generator (HRSG) is an equipment that has a high risk to the power plant. The impact of corrosion damage causing HRSG power plant stops operating. Furthermore, it could be threaten the safety of employees. The Risk Based Inspection (RBI) guidelines by the American Petroleum Institute (API) 58 has been used to risk analysis in the HRSG 1. By using this methodology, the risk that caused by unexpected failure as a function of the probability and consequence of failure can be estimated. This paper presented a case study relating to the risk analysis in the HRSG, starting with a summary of the basic principles and procedures of risk assessment and applying corrosion RBI for process industries. The risk level of each HRSG equipment were analyzed: HP superheater has a medium high risk (4C), HP evaporator has a medium-high risk (4C), and the HP economizer has a medium risk (3C). The results of the risk assessment using semi-quantitative method of standard API 581 based on the existing equipment at medium risk. In the fact, there is no critical problem in the equipment components. Damage mechanisms were prominent throughout the equipment is thinning mechanism. The evaluation of the risk approach was done with the aim of reducing risk by optimizing the risk assessment activities.
Directory of Open Access Journals (Sweden)
Sonia Lucy Molinari
2012-01-01
Full Text Available The objective of this work was to study the effect of the aerobic physical training and the cafeteria diet introduced after weaning of Wistar rats and on the morphology of the main salivary glands (parotid, submandibular, sublingual. Male rats after weaning were subjected to the cafeteria diet or the standard rodent chow, and either performed aerobic physical training in a treadmill for 100 days, or did not performed any physical activity. Analyses were done considering the response in body weight, adipose tissues and salivary glands, and the data were submitted to statistical treatment (p O objetivo deste trabalho foi avaliar as características morfológicas das glândulas salivares (parótida, submandibular, sublingual apresentadas por ratos submetidos a treinamento físico aeróbio e dieta de cafeteria após o período de lactação. Ratos machos após a lactação consumiram dieta de cafeteria ou ração-padrão para roedores e realizaram treinamento físico aeróbio em esteira rolante por um período de 100 dias, ou não realizaram nenhuma atividade física. Foram feitas análises sobre a resposta do peso corporal, dos tecidos adiposos e das glândulas salivares e os dados submetidos a tratamento estatístico (p < 0,05. A análise morfológica e morfométrica das glândulas salivares foi realizada a partir de cortes histológicos corados com Hematoxilina e Eosina. Apesar do comportamento normofágico, os roedores alimentados com dieta de cafeteria apresentaram maior quantidade de gordura corporal, com repercussão sobre o peso da glândula parótida. A análise morfométrica das glândulas submandibulares indicou redução na proporção dos ácinos serosos como efeito da dieta de cafeteria e do treinamento físico. No entanto, excesso de gordura corporal, dieta de cafeteria e/ou treinamento físico não influenciou a organização histológica das glândulas salivares. Concluiu-se que as glândulas parótidas e submandibulares são mais
Energy Technology Data Exchange (ETDEWEB)
Gorbunova, S.A.; Akhverdyan, V.Z.; Krylov, V.N.
1986-06-01
The presence of a large number of clones, which have lost the ability to produce phase, is a feature of PpGl exconjugants, which have acquired markers of the hybrid plasmid containing the genome of the PAO1 phage transposon. Analysis of these clones indicates that they contain plasmids with different defects in the phage genome (point mutations and different deletion lengths which may have an effect on both the phage genome and also plasmid RP4). Mutations of a particular region are selected, the region of early prophage genes. The process of zygotic induction is an essential condition for the arisal of mutants (including deletion mutants). The results of the experiment, which was based on the Luria-Delbruik test, showed that a significant proportion of the mutations, including deletion mutations, arise in the recipient cells PpGl.
An Overview of the Jupiter Europa Orbiter Concept's Europa Science Phase Orbit Design
Lock, Robert E.; Ludwinski, Jan M.; Petropoulos, Anastassios E.; Clark, Karla B.; Pappalardo, Robert T.
2009-01-01
Jupiter Europa Orbiter (JEO), the proposed NASA element of the proposed joint NASA-ESA Europa Jupiter System Mission (EJSM), could launch in February 2020 and conceivably arrive at Jupiter in December of 2025. The concept is to perform a multi-year study of Europa and the Jupiter system, including 30 months of Jupiter system science and a comprehensive Europa orbit phase of 9 months. This paper provides an overview of the JEO concept and describes the Europa Science phase orbit design and the related science priorities, model pay-load and operations scenarios needed to conduct the Europa Science phase. This overview is for planning and discussion purposes only.
Methods of orbit correction system optimization
International Nuclear Information System (INIS)
Chao, Yu-Chiu.
1997-01-01
Extracting optimal performance out of an orbit correction system is an important component of accelerator design and evaluation. The question of effectiveness vs. economy, however, is not always easily tractable. This is especially true in cases where betatron function magnitude and phase advance do not have smooth or periodic dependencies on the physical distance. In this report a program is presented using linear algebraic techniques to address this problem. A systematic recipe is given, supported with quantitative criteria, for arriving at an orbit correction system design with the optimal balance between performance and economy. The orbit referred to in this context can be generalized to include angle, path length, orbit effects on the optical transfer matrix, and simultaneous effects on multiple pass orbits
Discrete symmetries in periodic-orbit theory
International Nuclear Information System (INIS)
Robbins, J.M.
1989-01-01
The application of periodic-orbit theory to systems which possess a discrete symmetry is considered. A semiclassical expression for the symmetry-projected Green's function is obtained; it involves a sum over classical periodic orbits on a symmetry-reduced phase space, weighted by characters of the symmetry group. These periodic orbits correspond to trajectories on the full phase space which are not necessarily periodic, but whose end points are related by symmetry. If the symmetry-projected Green's functions are summed, the contributions of the unperiodic orbits cancel, and one recovers the usual periodic-orbit sum for the full Green's function. Several examples are considered, including the stadium billiard, a particle in a periodic potential, the Sinai billiard, the quartic oscillator, and the rotational spectrum of SF 6
International Nuclear Information System (INIS)
Hoeschen, W.
2003-01-01
The TIG (Tungsten-inert gas) orbital welding technique is applied in all areas of pipe welding. The process is mainly used for austenitic and ferritic materials but also for materials like aluminium, nickel, and titanium alloys are commonly welded according to this technique. Thin-walled as well as thick-walled pipes are welded economically. The application of orbital welding is of particular interest in the area of maintenance of thick-walled pipes that is described in this article. (orig.) [de
Setty, Srinivas J.; Cefola, Paul J.; Montenbruck, Oliver; Fiedler, Hauke
2016-05-01
Catalog maintenance for Space Situational Awareness (SSA) demands an accurate and computationally lean orbit propagation and orbit determination technique to cope with the ever increasing number of observed space objects. As an alternative to established numerical and analytical methods, we investigate the accuracy and computational load of the Draper Semi-analytical Satellite Theory (DSST). The standalone version of the DSST was enhanced with additional perturbation models to improve its recovery of short periodic motion. The accuracy of DSST is, for the first time, compared to a numerical propagator with fidelity force models for a comprehensive grid of low, medium, and high altitude orbits with varying eccentricity and different inclinations. Furthermore, the run-time of both propagators is compared as a function of propagation arc, output step size and gravity field order to assess its performance for a full range of relevant use cases. For use in orbit determination, a robust performance of DSST is demonstrated even in the case of sparse observations, which is most sensitive to mismodeled short periodic perturbations. Overall, DSST is shown to exhibit adequate accuracy at favorable computational speed for the full set of orbits that need to be considered in space surveillance. Along with the inherent benefits of a semi-analytical orbit representation, DSST provides an attractive alternative to the more common numerical orbit propagation techniques.
Directory of Open Access Journals (Sweden)
Олена Миколаївна Жбанова
2017-07-01
Full Text Available The method of a crystallizing alloy processing which makes it possible to obtain high-quality castings from 35GL steel has been considered. It has been shown that the electro impulse treatment of the melt improves the structure and reduces the physical heterogeneity of the castings. Processing of the melt with a current substantially increases the dissolution rate of metallic impurities and other components in the melt, provides a fine-grained structure, increases the homogeneity of the cast metal as well. The structural heterogeneity decreases as a result of the change in morphology and disorientation and as a result of manganese carbides grinding the size and quantity of the grain ball decrease from 7 to 8. Physical heterogeneity reduces due to the changes in the location and size of pores and nonmetallic inclusions; the content of gases and non-metallic inclusions reduces as well. In this article, studies of the modification of certain parameters by the electric impulse current, have been made. It results in a significant increase in the basic mechanical properties of the 35GL cast structural steel: the tensile strength increases by 9%, the toughness increases by 21%, and the hardness by 6% without changing the chemical composition of the steel, due to the fine grain structure
Large orbit neoclassical transport
International Nuclear Information System (INIS)
Lin, Z.; Tang, W.M.; Lee, W.W.
1997-01-01
Neoclassical transport in the presence of large ion orbits is investigated. The study is motivated by the recent experimental results that ion thermal transport levels in enhanced confinement tokamak plasmas fall below the open-quotes irreducible minimum levelclose quotes predicted by standard neoclassical theory. This apparent contradiction is resolved in the present analysis by relaxing the basic neoclassical assumption that the ions orbital excursions are much smaller than the local toroidal minor radius and the equilibrium scale lengths of the system. Analytical and simulation results are in agreement with trends from experiments. The development of a general formalism for neoclassical transport theory with finite orbit width is also discussed. copyright 1997 American Institute of Physics
Closed orbit related problems: Correction, feedback, and analysis
International Nuclear Information System (INIS)
Bozoki, E.S.
1995-01-01
Orbit correction - moving the orbit to a desired orbit, orbit stability - keeping the orbit on the desired orbit using feedback to filter out unwanted noise, and orbit analysis - to learn more about the model of the machine, are strongly interrelated. They are the three facets of the same problem. The better one knows the model of the machine, the better the predictions that can be made on the behavior of the machine (inverse modeling) and the more accurately one can control the machine. On the other hand, one of the tools to learn more about the machine (modeling) is to study and analyze the orbit response to open-quotes kicks.close quotes
Real-time orbit feedback at the APS
International Nuclear Information System (INIS)
Carwardine, J.
1998-01-01
A real-time orbit feedback system has been implemented at the Advanced Photon Source in order to meet the stringent orbit stability requirements. The system reduces global orbit motion below 30Hz by a factor of four to below 5 microm rms horizontally and 2 microm rms vertically. This paper focuses on dynamic orbit stability and describes the all-digital orbit feedback system that has been implemented at the APS. Implementation of the global orbit feedback system is described and its latest performance is presented. Ultimately, the system will provide local feedback at each x-ray source point using installed photon BPMs to measure x-ray beam position and angle directly. Technical challenges associated with local feedback and with dynamics of the associated corrector magnets are described. The unique diagnostic capabilities provided by the APS system are discussed with reference to their use in identifying sources of the underlying orbit motion
Efeito da substituição da farinha de trigo no desenvolvimento de biscoitos sem glúten
Directory of Open Access Journals (Sweden)
Tamires dos Santos VIEIRA
2015-12-01
Full Text Available Resumo O glúten pode determinar a qualidade da farinha de trigo, conferindo às massas características como elasticidade e capacidade de absorver água, o que torna a elaboração de produtos de panificação isentos de glúten um desafio. Desse modo, o presente estudo buscou avaliar as características físico-químicas e sensoriais de biscoitos elaborados com ingredientes sucedâneos ao trigo, como fécula de mandioca, farinha de soja, de quinoa e de amaranto. Para a caracterização física foram determinados: peso, diâmetro, espessura, fator de expansão e volume específico. Quanto à composição química foram determinados: umidade, cinzas, proteínas, lipídios, fibras alimentares, carboidratos totais, energia, além de pH e acidez. A aceitabilidade foi determinada por meio de uma escala hedônica de nove pontos. As formulações contendo farinhas sucedâneas ao trigo apresentaram bom rendimento, maior teor de cinzas, de proteínas, de lipídios e de fibras alimentares. Também, essas apresentaram percentuais de aceitabilidade superiores a 70%, exceto para a avaliação do sabor da amostra com maior teor de soja (40 g/100g. Conclui-se que as formulações contendo farinhas sucedâneas ao trigo podem ser consideradas promissoras, disponibilizando alternativas alimentares àqueles que almejam produtos com valor nutricional superior e posicionamento único no mercado, visto que os produtos disponíveis muitas vezes possuem baixo valor nutritivo ao serem elaborados com farinhas amiláceas.
Directory of Open Access Journals (Sweden)
Gustavo Leporace
2012-09-01
Full Text Available O objetivo desse estudo foi comparar a atividade mioelétrica (EMG do glúteo máximo e bíceps femoral entre o agachamento com passada à frente e com pés paralelos. Sete indivíduos realizaram oito repetições do agachamento paralelo (AP e com passada à frente (AF deslocando sobrecarga relativa a 50% da massa corporal. O EMG do glúteo máximo e bíceps femoral foi capturado, filtrado por um filtro passa-banda Butterworth de 4ª ordem (20-400 Hz e obtido valores RMS. Utilizou-se o teste de Wilcoxon para comparar o EMG normalizado entre os dois exercícios. Tanto o bíceps femoral (p = 0,041 quanto o glúteo máximo (p = 0,0059 apresentaram maior ativação no AF (30,9% para glúteo; 42,6% para bíceps em comparação ao AP (21,2% para glúteo; 24,7% para bíceps. Apesar da ativação moderada durante a execução dos exercícios, girando em torno de 25% a 45%, a resposta foi maior, para os participantes do estudo, no AF.El objetivo de este estudio fue comparar la actividad mioeléctrica (EMG del músculo glúteo mayor y el bíceps femoral entre la sentadilla con los pies uno frente al otro y los pies paralelos. Siete sujetos realizaron ocho repeticiones de la sentadilla paralela (AP y con los pies uno frente al otro (FA desplazando una masa igual a 50% del peso corporal. El EMG del músculo glúteo mayor y el bíceps femoral fueron capturados, filtrada por un filtro de banda de 4 º orden Butterworth (20-400 Hz y los valores RMS obtenidos. Se utilizó el test de Wilcoxon para comparar la EMG normalizada entre los dos ejercicios. Tanto el bíceps femoral (p = 0,041 y el glúteo mayor (p = 0,0059 mostraron una mayor activación en la FA (30,9% para lo glúteo y 52% para lo bíceps en comparación con el AP (21,2% para lo glúteo y 24,7% para lo bíceps. Aunque la activación moderada durante la ejecución de los ejercicios fue moderado, situándose en torno a un 25% a 45%, la respuesta fue mayor en el FA para los participantes del estudio
Interrater reliability of sonographic examinations of orbital fractures
International Nuclear Information System (INIS)
Siegfried, Jank; Martina, Deibl; Heinrich, Strobl; Andreas, Oberrauch; Alessandro, Nicasi; Martin, Missmann; Gerd, Bodner
2005-01-01
Objective: The purpose of this study is to determine whether there are statistically significant variations among different observers when examining fractures of the orbital walls. Material and methods: From December 2003 to April 2004, 28 patients with clinically suspected orbital fractures were examined by ultrasound prospectively. The US images of the infra-orbital margins, the orbital floors, the medial and lateral orbital walls of each patient were reexamined by two independent investigators. Results: Computed tomography revealed fractures of the orbital floor in 28 out of 31 patients (90.3%). The infra-orbital margins showed fractures of 14 of 31 patients (45.2%). The ultrasound examinations of the orbits by the three examiners presented satisfactory correlation regarding sensitivity and specificity. There were no significant differences between investigators. There was good agreement among the ultrasound examiners regarding the infra-orbital margins. This was not the case for the orbital floors. Conclusions: If there are clear cut clinical findings ultrasound examination could represent an alternative to computed tomography. If the clinical findings were indeterminate, computed tomography was essential as implicated by this study. Accordingly, further evaluation of ultrasound examinations of fractures of the orbital margins and floors are necessary
Evolution of the Orbital Elements for Geosynchronous Orbit of Communications Satellite, II
Directory of Open Access Journals (Sweden)
Kyu-Hong Choi
1987-06-01
Full Text Available For a geostationary satellite north-south station keeping maneuver must control the inclination elements. The effects on the orbit plane of maneuvers and natural perturbations may be represented by a plane plot of Wc versus Ws, since these inclination elements represent the projection of the unit orbit normal onto the equatorial plane. The evolution of the semi-major axis and the inclination elements are obtained.
Olmstead, D.
1985-01-01
The 1985 Space WARC will examine and potentially modify the current geostationary orbit spectrum resource allocation methodology. Discussions in this international political environment could likely associate the geostationary orbital debris issue with the politicized issue of orbit spectrum allocation.
Advances in the management of orbital fractures.
Nguyen, P N; Sullivan, P
1992-01-01
Great progress has been made in both the basic science and the clinical knowledge base used in orbital reconstruction. With this, increasing complex orbital reconstructive problems are better managed. The diagnosis, treatment plan, and the actual reconstruction have evolved to a higher level. Several areas of progress are of note: the greater appreciation of the intimate relation between the bony orbit's shape and the position of the globe; application of computer technology in orbital injuries; effect of rigid fixation on autogenous and alloplastic graft; and the use of advanced biocompatible synthetic materials in orbital reconstruction. Although this progress has great impact on treatment of orbital injuries, there are many unanswered challenges in the treatment of the fragile frame of the window to the human soul.
Real-time orbit feedback at the APS
International Nuclear Information System (INIS)
Carwardine, J.A.; Lenkszus, F.R.
1998-01-01
A real-time orbit feedback system has been implemented at the Advanced Photon Source in order to meet the stringent orbit stability requirements. The system reduces global orbit motion below 30 Hz by a factor of four to below 5 μm rms horizontally and 2 μm rms vertically. This paper focuses on dynamic orbit stability and describes the all-digital orbit feedback system that has been implemented at the APS. Implementation of the global orbit feedback system is described and its latest performance is presented. Ultimately, the system will provide local feedback at each x-ray source point using installed photon BPMs to measure x-ray beam position and angle directly. Technical challenges associated with local feedback and with dynamics of the associated corrector magnets are described. The unique diagnostic capabilities provided by the APS system are discussed with reference to their use in identifying sources of the underlying orbit motion. copyright 1998 American Institute of Physics
Real-time orbit feedback at the APS.
Energy Technology Data Exchange (ETDEWEB)
Carwardine, J.
1998-06-18
A real-time orbit feedback system has been implemented at the Advanced Photon Source in order to meet the stringent orbit stability requirements. The system reduces global orbit motion below 30Hz by a factor of four to below 5{micro}m rms horizontally and 2{micro}m rms vertically. This paper focuses on dynamic orbit stability and describes the all-digital orbit feedback system that has been implemented at the APS. Implementation of the global orbit feedback system is described and its latest performance is presented. Ultimately, the system will provide local feedback at each x-ray source point using installed photon BPMs to measure x-ray beam position and angle directly. Technical challenges associated with local feedback and with dynamics of the associated corrector magnets are described. The unique diagnostic capabilities provided by the APS system are discussed with reference to their use in identifying sources of the underlying orbit motion.
Directory of Open Access Journals (Sweden)
Koert N J Burger
Full Text Available BACKGROUND: The associations of glycemic load (GL and glycemic index (GI with the risk of cardiovascular diseases (CVD are not well-established, particularly in men, and may be modified by gender. OBJECTIVE: To assess whether high dietary GL and GI increase the risk of CVD in men and women. METHODS: A large prospective cohort study (EPIC-MORGEN was conducted within the general Dutch population among 8,855 men and 10,753 women, aged 21-64 years at baseline (1993-1997 and free of diabetes and CVD. Dietary intake was assessed with a validated food-frequency questionnaire and GI and GL were calculated using Foster-Powell's international table of GI. Information on morbidity and mortality was obtained through linkage with national registries. Cox proportional hazards analysis was performed to estimate hazard ratios (HRs for incident coronary heart disease (CHD and stroke, while adjusting for age, CVD risk factors, and dietary factors. RESULTS: During a mean follow-up of 11.9 years, 581 CHD cases and 120 stroke cases occurred among men, and 300 CHD cases and 109 stroke cases occurred among women. In men, GL was associated with an increased CHD risk (adjusted HR per SD increase, 1.17 [95% CI, 1.02-1.35], while no significant association was found in women (1.09 [0.89-1.33]. GI was not associated with CHD risk in both genders, while it was associated with increased stroke risk in men (1.27 [1.02-1.58] but not in women (0.96 [0.75-1.22]. Similarly, total carbohydrate intake and starch intake were associated with a higher CHD risk in men (1.23 [1.04-1.46]; and 1.24 [1.07-1.45], but not in women. CONCLUSION: Among men, high GL and GI, and high carbohydrate and starch intake, were associated with increased risk of CVD.
Directory of Open Access Journals (Sweden)
Eduardo Jorge Carneiro Soares
2005-08-01
Full Text Available OBJETIVO: Estudar os efeitos clínicos da secreção das glândulas labiais como alternativa de lubrificação ocular para alívio do olho seco, avaliar a durabilidade dos resultados e simplificar a técnica. MÉTODOS: Estudo prospectivo de 37 cirurgias de enxerto glândulo-mucoso, composto pela mucosa labial e glândulas salivares subjacentes, colocado no fórnice conjuntival de 21 pacientes. Todas as cirurgias foram realizadas em olhos com grave xeroftalmia, sendo a técnica do procedimento descrita em todos os detalhes. Os parâmetros que serviram para a análise comparativa dos resultados foram o quadro clínico, o brilho ocular, o quadro biomicroscópico, a visão e o uso de colírios lubrificantes. RESULTADOS: A integração do enxerto ocorreu em 97,2% das cirurgias que foram realizadas durante o período de julho/2000 a janeiro/2004. Foi observado que em 91,9 % dos casos houve melhora dos parâmetros avaliados e a evolução (acompanhamento médio de 19,7 meses mostrou persistência e estabilidade dos resultados. As complicações observadas foram: um olho com infecção hospitalar e três pálpebras com ptose. CONCLUSÃO: A melhora clínica do olho seco grave observada após o enxerto das glândulas salivares labiais foi estatisticamente significativa. A lubrificação da superfície ocular produzida pela secreção salivar mostrou ser eficiente, bem tolerada e constante. O transplante das glândulas salivares labiais para o fórnice conjuntival demonstrou ser procedimento de fácil execução, acessível a qualquer cirurgião oftalmologista.PURPOSE: To study the clinical effects of the secretion of transplanted labial glands used as ocular lubricant to treat severe dry-eye cases, to evaluate the duration of the results and to simplify the surgical technique. METHODS: Thirty-seven surgeries were performed in twenty-one patients during the period of July 2000 to January 2004. The graft, consisting of labial mucosa and underlying salivary
International Nuclear Information System (INIS)
Howard, Andrew W.; Marcy, Geoffrey W.; Isaacson, Howard; Johnson, John Asher; Fischer, Debra A.; Wright, Jason T.; Henry, Gregory W.; Valenti, Jeff A.; Anderson, Jay; Piskunov, Nikolai E.
2011-01-01
We report the discovery of HD 156668 b, an extrasolar planet with a minimum mass of M P sin i = 4.15 M + . This planet was discovered through Keplerian modeling of precise radial velocities from Keck-HIRES and is the second super-Earth to emerge from the NASA-UC Eta-Earth Survey. The best-fit orbit is consistent with circular and has a period of P = 4.6455 days. The Doppler semi-amplitude of this planet, K = 1.89 m s -1 , is among the lowest ever detected, on par with the detection of GJ 581 e using HARPS. A longer period (P ∼ 2.3 years), low-amplitude signal of unknown origin was also detected in the radial velocities and was filtered out of the data while fitting the short-period planet. Additional data are required to determine if the long-period signal is due to a second planet, stellar activity, or another source. Photometric observations using the Automated Photometric Telescopes at Fairborn Observatory show that HD 156668 (an old, quiet K3 dwarf) is photometrically constant over the radial velocity period to 0.1 mmag, supporting the existence of the planet. No transits were detected down to a photometric limit of ∼3 mmag, ruling out transiting planets dominated by extremely bloated atmospheres, but not precluding a transiting solid/liquid planet with a modest atmosphere.
Theory of orbital magnetoelectric response
International Nuclear Information System (INIS)
Malashevich, Andrei; Souza, Ivo; Coh, Sinisa; Vanderbilt, David
2010-01-01
We extend the recently developed theory of bulk orbital magnetization to finite electric fields, and use it to calculate the orbital magnetoelectric (ME) response of periodic insulators. Working in the independent-particle framework, we find that the finite-field orbital magnetization can be written as a sum of three gauge-invariant contributions, one of which has no counterpart at zero field. The extra contribution is collinear with and explicitly dependent on the electric field. The expression for the orbital magnetization is suitable for first-principles implementations, allowing one to calculate the ME response coefficients by numerical differentiation. Alternatively, perturbation-theory techniques may be used, and for that purpose we derive an expression directly for the linear ME tensor by taking the first field-derivative analytically. Two types of terms are obtained. One, the 'Chern-Simons' term, depends only on the unperturbed occupied orbitals and is purely isotropic. The other, 'Kubo' terms, involve the first-order change in the orbitals and give isotropic as well as anisotropic contributions to the response. In ordinary ME insulators all terms are generally present, while in strong Z 2 topological insulators only the Chern-Simons term is allowed, and is quantized. In order to validate the theory, we have calculated under periodic boundary conditions the linear ME susceptibility for a 3D tight-binding model of an ordinary ME insulator, using both the finite-field and perturbation-theory expressions. The results are in excellent agreement with calculations on bounded samples.
Small Orbital Stereo Tracking Camera Technology Development
Gagliano, L.; Bryan, T.; MacLeod, T.
On-Orbit Small Debris Tracking and Characterization is a technical gap in the current National Space Situational Awareness necessary to safeguard orbital assets and crew. This poses a major risk of MOD damage to ISS and Exploration vehicles. In 2015 this technology was added to NASAs Office of Chief Technologist roadmap. For missions flying in or assembled in or staging from LEO, the physical threat to vehicle and crew is needed in order to properly design the proper level of MOD impact shielding and proper mission design restrictions. Need to verify debris flux and size population versus ground RADAR tracking. Use of ISS for In-Situ Orbital Debris Tracking development provides attitude, power, data and orbital access without a dedicated spacecraft or restricted operations on-board a host vehicle as a secondary payload. Sensor Applicable to in-situ measuring orbital debris in flux and population in other orbits or on other vehicles. Could enhance safety on and around ISS. Some technologies extensible to monitoring of extraterrestrial debris as well To help accomplish this, new technologies must be developed quickly. The Small Orbital Stereo Tracking Camera is one such up and coming technology. It consists of flying a pair of intensified megapixel telephoto cameras to evaluate Orbital Debris (OD) monitoring in proximity of International Space Station. It will demonstrate on-orbit optical tracking (in situ) of various sized objects versus ground RADAR tracking and small OD models. The cameras are based on Flight Proven Advanced Video Guidance Sensor pixel to spot algorithms (Orbital Express) and military targeting cameras. And by using twin cameras we can provide Stereo images for ranging & mission redundancy. When pointed into the orbital velocity vector (RAM), objects approaching or near the stereo camera set can be differentiated from the stars moving upward in background.
Orbital debris: a technical assessment
National Research Council Canada - National Science Library
Committee on Space Debris, National Research Council
..., and other debris created as a byproduct of space operations. Orbital Debris examines the methods we can use to characterize orbital debris, estimates the magnitude of the debris population, and assesses the hazard that this population poses to spacecraft...
Progress in reconstruction of orbital wall after fracture
Directory of Open Access Journals (Sweden)
Lu-Lu Xu
2018-04-01
Full Text Available At present, the orbital wall fracture is a very common facial trauma. The orbital contents are often incarcerated in the fracture cracks resulting in changes in the orbital eye position, then can bring a lifetime of diplopia and enophthalmos, which greatly affects the visual acuity and facial appearance. The purpose of repairing of orbital fracture is reconstructing orbital wall, repairing defect to correct eye position, avoiding enophthalmos and recovering visual function. The review will provide a comprehensive overview of orbital fracture reconstruction.
Schwaab, Douglas G.
1991-01-01
A mathematical programing model is presented to optimize the selection of Orbital Replacement Unit on-orbit spares for the Space Station. The model maximizes system availability under the constraints of logistics resupply-cargo weight and volume allocations.
Evseev, D. G.; Savrukhin, A. V.; Neklyudov, A. N.
2018-01-01
Computer simulation of the kinetics of thermal processes and structural and phase transformations in the wall of a bogie side frame produced from steel 20GL is performed with allowance for the differences in the cooling intensity under volume-surface hardening. The simulation is based on the developed method employing the diagram of decomposition of austenite at different cooling rates. The data obtained are used to make conclusion on the effect of the cooling intensity on propagation of martensite structure over the wall section.
International Nuclear Information System (INIS)
Handler, L.C.; Davey, I.C.; Hill, J.C.; Lauryssen, C.
1991-01-01
A series of 65 patients suffering from acute inflammatory disease of the orbit was studied by CT. Ethmoiditis was the cause in the vast majority; trauma and dental extraction played a lesser role in causation. Orbital cellulitis was diagnosed in 17 and subperiosteal abscess in the remaining 48. It was not possible to differentiate 33 pus-containing abscesses from the six with inflammatory masses (phlegmons). The satisfactory response to aggressive medical treatment in those patients with inflammatory masses that were not drained justifies a more conservative approach; surgical drainage being reserved for those with a deterioration in proptosis, ocular movements or vision. Six abscesses arose de novo, of which some were in the orbital fat rather than the subperiosteal space. (orig.)
BAEHAKI SUHERLAN EFFENDI; EKO HARI ISWANTO; AMIR HAMZAH
2016-01-01
Evaluation of ovicidal and nymphcidal properties of buprofezin 100 g/linsecticide to eggs and nymphs of brown planthopper, Nilaparvata lugens(Stal.) (Hemiptera: Delphacidae). Research was carried out in screen house ofSukamandi, Indonesian Center for Rice Research (ICRR) in the wet season of 2013. Theresearch used randomized block design with 5 doses levels insecticide treatment of buprofezin100 g/l and four replications. The buprofezin treatments were 250, 500, 750, 1000, and 1500ml/ha compa...
An Ontological Architecture for Orbital Debris Data
Rovetto, Robert J.
2017-01-01
The orbital debris problem presents an opportunity for inter-agency and international cooperation toward the mutually beneficial goals of debris prevention, mitigation, remediation, and improved space situational awareness (SSA). Achieving these goals requires sharing orbital debris and other SSA data. Toward this, I present an ontological architecture for the orbital debris domain, taking steps in the creation of an orbital debris ontology (ODO). The purpose of this ontological system is to ...
Study of orbit stability in the SSRF storage ring
International Nuclear Information System (INIS)
Dai Zhimin; Liu Guimin; Huang Nan
2003-01-01
In this paper, analysis of the beam orbit stability and conceptual study of the dynamic orbit feedback in the SSRF storage ring are presented. It is shown that beam orbit position movement at the photon source points is smaller than the orbit stability requirements in horizontal plane, but exceeds the orbit stability requirements in vertical plane. A dynamic global orbit feedback system, which consists of 38 high-bandwidth air-coil correctors and 40 high-precise BPMs, is proposed to suppress the vertical beam orbit position movement. Numerical simulations show that this dynamic orbit feedback system can stabilize the vertical beam orbit position movement in the frequency range up to 100 Hz
Cardoso dos Santos, Josué; Carvalho, Jean Paulo; Vilhena de Moraes, Rodolpho
Europa and Ganymede are two of the four Jupiter’s moons which compose the Galilean satellite. These ones are planetary satellites of greater interest at the present moment among the scientific community. There are some missions being planned to visit them and and the Jovian system. One of them is the cooperation between NASA and ESA for the Europa Jupiter System Mission (EJSM). In this mission are planned the insertion of the spacecrafts JEO (Jupiter Europa Orbiter) and JGO (Jupiter Ganymede Orbiter) into Europa and Ganymede’s orbit. Thus, there is a great necessity for having a better comprehension of the dynamics of the orbits around this planetary satellite. This comprehension is essential for the success of this type of mission. In this context, this work aims to perform a search for low-altitude orbits around these planetary satellites. An emphasis is given in polar orbits. These orbits can be useful in the planning of aerospace activities to be conducted around this planetary satellite, with respect to the stability of orbits of artificial satellites. The study considers orbits of an artificial satellite around Europa and Ganymede under the influence of the third-body perturbation (the gravitational attraction of Jupiter) and the polygenic perturbations. These last ones occur due to forces such as the non-uniform distribution of mass (J2 and J3) of the main (central) body. A simplified dynamic model for polygenic perturbations is used. A new model for the third-body disturbance is presented considering it in an elliptical orbit. The Lagrange planetary equations, which compose a system of nonlinear differential equations, are used to describe the orbital motion of the artificial satellite around Ganymede. The equations showed here are developed in closed form to avoid expansions in inclination and eccentricity.
Directory of Open Access Journals (Sweden)
Randall E. Chacón Castro
2009-11-01
Full Text Available Ulomoides dermestoides es un coleóptero tenebriónido reportado como plaga de granos almacenados, el cual presenta potencial biotecnológico para la bioprospección, al atribuírsele propiedades farmacológicas. Esta investigación se realizó con el objetivo de describir la anatomía de los órganos genitales y las glándulas secretoras abdominales del insecto criado en condiciones de laboratorio (dieta a base de maní, 70% HR, 23°C a 1300 msnm, en el Centro de Investigación en Biotecnología del ITCR, Cartago, Costa Rica. Los órganos genitales y las glándulas abdominales en ambos sexos fueron procesados para la observación macroscópica y para microscopía electrónica de barrido en la Unidad de Investigación en Estructuras Microscópicas de la Universidad de Costa Rica, San José, Costa Rica. En las hembras se observó la mecánica de la estructura ovipositora y se describió sus funciones reproductivas y de defensa, al igual que se encontró dos cercos apicales con acumulaciones sensoriales mecano y quimiorreceptoras. Se reportó estructuras internas esclerotizadas con función en la oviposición, así como las guías que junto con el tejido elástico del oviducto conforman el segmento final del ovipositor. En los machos se identificó el adeago, sus extensiones internas y la forma particular que permite su introducción y acoplamiento durante la cópula, sirviendo también de superficie guía de secreciones defensivas. Las micrografías evidenciaron la presencia de glándulas corrugadas secretoras en ambos sexos (de 1.05 mm de longitud por 350 mm de diámetro, de fuerte adhesión a la pared abdominal por el tejido musculoso de convergencia de los conductos secretores, asociados a la comunicación del gonoporo con el receptáculo glandular. Se encontró células al parecer bacterianas en el interior de las glándulas, esto como posible infección patológica o bien como organismos simbiontes, lo cual no se pudo diferenciar claramente
Bozkaya, Uǧur; Turney, Justin M.; Yamaguchi, Yukio; Schaefer, Henry F.; Sherrill, C. David
2011-09-01
Using a Lagrangian-based approach, we present a more elegant derivation of the equations necessary for the variational optimization of the molecular orbitals (MOs) for the coupled-cluster doubles (CCD) method and second-order Møller-Plesset perturbation theory (MP2). These orbital-optimized theories are referred to as OO-CCD and OO-MP2 (or simply "OD" and "OMP2" for short), respectively. We also present an improved algorithm for orbital optimization in these methods. Explicit equations for response density matrices, the MO gradient, and the MO Hessian are reported both in spin-orbital and closed-shell spin-adapted forms. The Newton-Raphson algorithm is used for the optimization procedure using the MO gradient and Hessian. Further, orbital stability analyses are also carried out at correlated levels. The OD and OMP2 approaches are compared with the standard MP2, CCD, CCSD, and CCSD(T) methods. All these methods are applied to H2O, three diatomics, and the O_4^+ molecule. Results demonstrate that the CCSD and OD methods give nearly identical results for H2O and diatomics; however, in symmetry-breaking problems as exemplified by O_4^+, the OD method provides better results for vibrational frequencies. The OD method has further advantages over CCSD: its analytic gradients are easier to compute since there is no need to solve the coupled-perturbed equations for the orbital response, the computation of one-electron properties are easier because there is no response contribution to the particle density matrices, the variational optimized orbitals can be readily extended to allow inactive orbitals, it avoids spurious second-order poles in its response function, and its transition dipole moments are gauge invariant. The OMP2 has these same advantages over canonical MP2, making it promising for excited state properties via linear response theory. The quadratically convergent orbital-optimization procedure converges quickly for OMP2, and provides molecular properties that
Institute of Scientific and Technical Information of China (English)
姚檀栋; 徐柏青; 蒲健辰
2001-01-01
Based on ice core records in the Tibetan Plateau and Greenland, the features and possible causes of climatic changes on orbital and sub-orbital time scale were discussed. Orbital time scale climatic change recorded in ice core from the Tibetan Plateau is typically ahead of that from polar regions, which indicates that climatic change in the Tibetan Plateau might be earlier than polar regions. The solar radiation change is a major factor that dominates the climatic change on orbital time scale. However, climatic events on sub-orbital time scale occurred later in the Tibetan Plateau than in the Arctic Region, indicating a different mechanism. For example, the Younger Dryas and Heinrich events took place earlier in Greenland ice core record than in Guliya ice core record. It is reasonable to propose the hypothesis that these climatic events were affected possibly by the Laurentide Ice Sheet. Therefore, ice sheet is critically important to climatic change on sub-orbital time scale in some ice ages.
Characteristics of pellet injuries to the orbit.
Kükner, A Sahap; Yilmaz, Turgut; Celebi, Serdal; Karslioğlu, Safak; Alagöz, Gürsoy; Serin, Didem; Acar, M Akif; Ozveren, M Faik
2009-01-01
To investigate the features of orbital injuries by pellets fired from the front. Retrospective, 4 cases of pellet injuries. Five orbits of 4 patients who sustained pellet injuries received from the front were reviewed retrospectively. The course of injury and results were assessed. Radiological examinations were reviewed. The patients were evaluated between December 1996 and June 2004. Five orbits of 4 patients sustained injuries caused by pellets fired from an anterior direction. The globe in the injured orbit was intact in 2 cases. Severe loss of vision was also present in these 2 globes due to optic nerve involvement. Final visual acuity was down to no light perception in 4 eyes and limited to light perception in 1 eye. The prognosis of orbital pellet injuries is, unfortunately, poor. A pellet passing through the floor of the orbit often causes double perforation of the globe and, once in the orbital aperture, it travels towards the apex as a result of the conical shape of the orbit and lodges in the optic canal or its entrance, severely damaging the optic nerve. Surgery or other treatments are usually unsuccessful. Even if the globe is intact, vision is usually severely impaired. Copyright 2009 S. Karger AG, Basel.
Spin-orbit beams for optical chirality measurement
Samlan, C. T.; Suna, Rashmi Ranjan; Naik, Dinesh N.; Viswanathan, Nirmal K.
2018-01-01
Accurate measurement of chirality is essential for the advancement of natural and pharmaceutical sciences. We report here a method to measure chirality using non-separable states of light with geometric phase-gradient in the circular polarization basis, which we refer to as spin-orbit beams. A modified polarization Sagnac interferometer is used to generate spin-orbit beams wherein the spin and orbital angular momentum of the input Gaussian beam are coupled. The out-of-phase interference between counter-propagating Gaussian beams with orthogonal spin states and lateral-shear or/and linear-phase difference between them results in spin-orbit beams with linear and azimuthal phase gradient. The spin-orbit beams interact efficiently with the chiral medium, inducing a measurable change in the center-of-mass of the beam, using the polarization rotation angle and hence the chirality of the medium are accurately calculated. Tunable dynamic range of measurement and flexibility to introduce large values of orbital angular momentum for the spin-orbit beam, to improve the measurement sensitivity, highlight the techniques' versatility.
NASA Orbital Debris Baseline Populations
Krisko, Paula H.; Vavrin, A. B.
2013-01-01
The NASA Orbital Debris Program Office has created high fidelity populations of the debris environment. The populations include objects of 1 cm and larger in Low Earth Orbit through Geosynchronous Transfer Orbit. They were designed for the purpose of assisting debris researchers and sensor developers in planning and testing. This environment is derived directly from the newest ORDEM model populations which include a background derived from LEGEND, as well as specific events such as the Chinese ASAT test, the Iridium 33/Cosmos 2251 accidental collision, the RORSAT sodium-potassium droplet releases, and other miscellaneous events. It is the most realistic ODPO debris population to date. In this paper we present the populations in chart form. We describe derivations of the background population and the specific populations added on. We validate our 1 cm and larger Low Earth Orbit population against SSN, Haystack, and HAX radar measurements.
Orbits of the inner satellites of Neptune
Brozovic, Marina; Showalter, Mark R.; Jacobson, Robert Arthur; French, Robert S.; de Pater, Imke; Lissauer, Jack
2018-04-01
We report on the numerically integrated orbits of seven inner satellites of Neptune, including S/2004 N1, the last moon of Neptune to be discovered by the Hubble Space Telescope (HST). The dataset includes Voyager imaging data as well as the HST and Earth-based astrometric data. The observations span time period from 1989 to 2016. Our orbital model accounts for the equatorial bulge of Neptune, perturbations from the Sun and the planets, and perturbations from Triton. The initial orbital integration assumed that the satellites are massless, but the residuals improved significantly as the masses adjusted toward values that implied that the density of the satellites is in the realm of 1 g/cm3. We will discuss how the integrated orbits compare to the precessing ellipses fits, mean orbital elements, current orbital uncertainties, and the need for future observations.
Influence of the Choice of Lunar Gravity Model on Orbit Determination for Lunar Orbiters
Directory of Open Access Journals (Sweden)
Young-Rok Kim
2018-01-01
Full Text Available We examine the influence of the lunar gravity model on the orbit determination (OD of a lunar orbiter operating in a 100 km high, lunar polar orbit. Doppler and sequential range measurements by three Deep Space Network antennas and one Korea Deep Space Antenna were used. For measurement simulation and OD analysis, STK11 and ODTK6 were utilized. GLGM2, LP100K, LP150Q, GRAIL420A, and GRAIL660B were used for investigation of lunar gravity model selection effect. OD results were assessed by position and velocity uncertainties with error covariance and an external orbit comparison using simulated true orbit. The effect of the lunar gravity models on the long-term OD, degree and order level, measurement-acquisition condition, and lunar altitude was investigated. For efficiency verification, computational times for the five lunar gravity models were compared. Results showed that significant improvements to OD accuracy are observed by applying a GRAIL-based model; however, applying a full order and degree gravity modeling is not always the best strategy, owing to the computational burden. Consequently, we consider that OD using GRAIL660B with 70 × 70 degree and order is the most efficient strategy for mission preanalysis. This study provides useful guideline for KPLO OD analysis during nominal mission operation.
Orbits 2nd order singularity-free solutions
Xu, Guochang
2014-01-01
In its 2nd edition, this book covers the theory of satellite orbits, derives the complete solutions of orbital disturbances, describes the algorithms of orbits determination and the applications of the theory to the phenomenon of physical satellite formation.
Single-stage-to-orbit versus two-stage-two-orbit: A cost perspective
Hamaker, Joseph W.
1996-03-01
This paper considers the possible life-cycle costs of single-stage-to-orbit (SSTO) and two-stage-to-orbit (TSTO) reusable launch vehicles (RLV's). The analysis parametrically addresses the issue such that the preferred economic choice comes down to the relative complexity of the TSTO compared to the SSTO. The analysis defines the boundary complexity conditions at which the two configurations have equal life-cycle costs, and finally, makes a case for the economic preference of SSTO over TSTO.
Dallan, Iacopo; Castelnuovo, Paolo; de Notaris, Matteo; Sellari-Franceschini, Stefano; Lenzi, Riccardo; Turri-Zanoni, Mario; Battaglia, Paolo; Prats-Galino, Alberto
2013-05-01
The superior orbital fissure is a critical three-dimensional space connecting the middle cranial fossa and the orbit. From an endoscopic viewpoint, only the medial aspect has a clinical significance. It presents a critical relationship with the lateral sellar compartment, the pterygopalatine fossa and the middle cranial fossa. The connective tissue layers and neural and vascular structures of this region are described. The role of Muller's muscle is confirmed, and the utility of the maxillary and optic strut is outlined. Muller's muscle extends for the whole length of the inferior orbital fissure, passes over the maxillary strut and enters the superior orbital fissure, representing a critical surgical landmark. Dividing the tendon between the medial and inferior rectus muscle allows the identification of the main trunk of the oculomotor nerve, and a little laterally, it is usually possible to visualize the first part of the ophthalmic artery. Based on a better knowledge of anatomy, we trust that this area could be readily addressed in clinical situations requiring an extended approach in proximity of the orbital apex.
Generating Animated Displays of Spacecraft Orbits
Candey, Robert M.; Chimiak, Reine A.; Harris, Bernard T.
2005-01-01
Tool for Interactive Plotting, Sonification, and 3D Orbit Display (TIPSOD) is a computer program for generating interactive, animated, four-dimensional (space and time) displays of spacecraft orbits. TIPSOD utilizes the programming interface of the Satellite Situation Center Web (SSCWeb) services to communicate with the SSC logic and database by use of the open protocols of the Internet. TIPSOD is implemented in Java 3D and effects an extension of the preexisting SSCWeb two-dimensional static graphical displays of orbits. Orbits can be displayed in any or all of the following seven reference systems: true-of-date (an inertial system), J2000 (another inertial system), geographic, geomagnetic, geocentric solar ecliptic, geocentric solar magnetospheric, and solar magnetic. In addition to orbits, TIPSOD computes and displays Sibeck's magnetopause and Fairfield's bow-shock surfaces. TIPSOD can be used by the scientific community as a means of projection or interpretation. It also has potential as an educational tool.
A retrograde object near Jupiter's orbit
Connors, M.; Wiegert, P.
2018-02-01
Asteroid 2007 VW266 is among the rare objects with a heliocentric retrograde orbit, and its semimajor axis is within a Hill sphere radius of that of Jupiter. This raised the interesting possibility that it could be in co-orbital retrograde resonance with Jupiter, a second "counter-orbital" object in addition to recently discovered 2015 BZ509. We find instead that the object is in 13/14 retrograde mean motion resonance (also referred to as 13/-14). The object is shown to have entered its present orbit about 1700 years ago, and it will leave it in about 8000 years, both through close approach to Jupiter. Entry and exit states both avoid 1:1 retrograde resonance, but the retrograde nature is preserved. The temporary stable state is due to an elliptic orbit with high inclination keeping nodal passages far from the associated planet. We discuss the motion of this unusual object based on modeling and theory, and its observational prospects.
Evaluation of the synchrotron close orbit
International Nuclear Information System (INIS)
Bashmakov, Yu.A.; Karpov, V.A.
1991-01-01
The knowledge of the closed orbit position is an essential condition for the effective work of any accelerator. Therefore questions of calculations, measurements and controls have great importance. For example, during injection of particles into a synchrotron, the amplitudes of their betatron oscillations may become commensurable with the working region of the synchrotron. This makes one pay attention at the problem of formation of the optimum orbit with use of correcting optical elements. In addition, it is often necessary to calculate such an orbit at the end of the acceleration cycle when particles are deposited at internal targets or removed from the synchrotron. In this paper, the computation of the close orbit is reduced to a determination at an arbitrarily chosen azimuth of the eigenvector of the total transfer matrix of the synchrotron ring and to tracing with this vector desired orbit. The eigenvector is found as a result of an iteration
Heparanase Expression in Malignant Salivary Gl, Tumors Inversely Correlates with Long-Term Survival
Directory of Open Access Journals (Sweden)
Ofer Ben-Izhak
2006-10-01
Full Text Available BACKGROUND: Upregulation of the endo-b-Dglucuronidase, heparanase, was noted in an increasing number of human malignancies. Heparanase expression correlated with enhanced local, distant metastatic spread, increased vascular density, reduced postoperative survival. PATIENTS, METHODS: We analyzed heparanase expression in 60 patients (aged 59 ± 17 years with malignant salivary tumors (39 males, 21 females using immunohistochemistry. We applied antiheparanase antibody 733, which has previously been shown to preferentially recognize a 50-kDa active heparanase subunit over a 65-kDa latent enzyme. Thus, immunostaining can directly be correlated with enzymatic activity. RESULTS: Heparanase staining was positive (> 0 in 70% of tumors (42 of 60 patients, was negative (0 in the remaining 30% (18 patients. The cumulative survival of patients diagnosed as heparanase-negative (n = 18 at 300 months was 70% (95% confidence interval = 35-88. In contrast, the cumulative survival of patients diagnosed as heparanase-positive (n = 42 at 300 months was 0% (statistically significant difference, P = .035. CONCLUSIONS: Heparanase expression levels inversely correlate with the survival rates of salivary gl, cancer patients, clearly indicating that heparanase is a reliable prognostic factor for this malignancy, an attractive target for anticancer drug development.
A new kinematical definition of orbital eccentricity
Directory of Open Access Journals (Sweden)
Ninković S.
2009-01-01
Full Text Available A new concept of orbital eccentricity is given. The dimensionless quantities proposed in the present paper to serve as orbital eccentricities have a kinematical nature. The purpose is to use them in describing the motion for the case of three-dimensional orbits. A comparison done for nearly planar orbits shows that the values of the eccentricities proposed here do not differ significantly from those corresponding to the eccentricities of geometric nature usually applied.
Directory of Open Access Journals (Sweden)
Andressa C. Souza
2014-09-01
Full Text Available As glândulas adrenais possuem funções endócrinas relacionadas a múltiplas funções vitais, estando intimamente relacionadas à capacidade do animal em se adaptar ao estresse. O exame ultrassonográfico é o método diagnóstico de escolha para avaliação das glândulas em diferentes espécies. Considerando a escassa literatura, questiona-se se as doenças adrenais em primatas não humanos são incomuns ou subdiagnosticadas, havendo a hipótese desse fato ser determinado pela falta de parâmetros. Objetivou-se descrever as características ultrassonográficas das glândulas adrenais para três espécies de primatas não humanos mantidas em cativeiro: Saimiri sciureus (mico-de-cheiro, Aotus azarae infulatus (macaco-da-noite e Alouatta guariba clamitans (bugio-ruivo. Conclui-se que é possível a identificação das glândulas adrenais por meio de exame ultrassonográfico, sendo que os padrões de referência foram estabelecidos com sucesso para as espécies em questão. Ressalta-se que a adequação de animais em ambientes estressantes é frequentemente acompanhada por uma hipertrofia das glândulas adrenais, portanto deve-se levar em consideração que as mensurações realizadas nesse estudo foram estabelecidas em animais de cativeiro.
Critical homoclinic orbits lead to snap-back repellers
International Nuclear Information System (INIS)
Gardini, Laura; Sushko, Iryna; Avrutin, Viktor; Schanz, Michael
2011-01-01
Highlights: → We consider critical homoclinic orbits in continuous and discontinuous maps. → Unbounded homoclinic orbits in maps on unbounded domains are considered as well. → We show that a snapback-repeller (SBR) with a non-critical homoclinic orbit implies chaos. → We show also that a SBR with a critical homoclinic orbit may or may not imply chaos. - Abstract: When nondegenerate homoclinic orbits to an expanding fixed point of a map f:X→X,X subset or equal R n , exist, the point is called a snap-back repeller. It is known that the relevance of a snap-back repeller (in its original definition) is due to the fact that it implies the existence of an invariant set on which the map is chaotic. However, when does the first homoclinic orbit appear? When can other homoclinic explosions, i.e., appearance of infinitely many new homoclinic orbits, occur? As noticed by many authors, these problems are still open. In this work we characterize these bifurcations, for any kind of map, smooth or piecewise smooth, continuous or discontinuous, defined in a bounded or unbounded closed set. We define a noncritical homoclinic orbit and a homoclinic orbit of an expanding fixed point is structurally stable iff it is noncritical. That is, only critical homoclinic orbits are responsible for the homoclinic explosions. The possible kinds of critical homoclinic orbits will be also investigated, as well as their dynamic role.
ExoMars Trace Gas Orbiter provides atmospheric data during Aerobraking into its final orbit
Svedhem, Hakan; Vago, Jorge L.; Bruinsma, Sean; Müller-Wodarg, Ingo; ExoMars 2016 Team
2017-10-01
After the arrival of the Trace Gas Orbiter (TGO) at Mars on 19 October 2016 a number of initial orbit change manoeuvres were executed and the spacecraft was put in an orbit with a 24 hour period and 74 degrees inclination. The spacecraft and its four instruments were thoroughly checked out after arrival and a few measurements and images were taken in November 2016 and in Feb-March 2017. The solar occultation observations have however not yet been possible due to lack of the proper geometry.On 15 March a long period of aerobraking to reach the final 400km semi-circular frozen orbit (370x430km, with a fixed pericentre latitude). This orbit is optimised for the payload observations and for the communication relay with the ExoMars Rover, due to arrive in 2021.The aerobraking is proceeding well and the final orbit is expected to be reached in April 2018. A large data set is being acquired for the upper atmosphere of Mars, from the limit of the sensitivity of the accelerometer, down to lowest altitude of the aerobraking at about 105km. Initial analysis has shown a highly variable atmosphere with a slightly lower density then predicted by existing models. Until the time of the abstract writing no dust storms have been observed.The ExoMars programme is a joint activity by the European Space Agency(ESA) and ROSCOSMOS, Russia. ESA is providing the TGO spacecraft and Schiaparelli (EDM) and two of the TGO instruments and ROSCOSMOS is providing the Proton launcher and the other two TGO instruments. After the arrival of the ExoMars 2020 mission, consisting of a Rover and a Surface platform also launched by a Proton rocket, the TGO will handle the communication between the Earth and the Rover and Surface Platform through its (NASA provided) UHF communication system.
Lee, Michael S; Shlofmitz, Evan; Shlofmitz, Richard; Sahni, Sheila; Martinsen, Brad; Chambers, Jeffrey
2016-09-01
The ORBIT II trial reported excellent outcomes in patients with severely calcified coronary lesions treated with orbital atherectomy. Severe calcification of the left main (LM) artery represents a complex coronary lesion subset. This study evaluated the safety and efficacy of coronary orbital atherectomy to prepare severely calcified protected LM artery lesions for stent placement. The ORBIT II trial was a prospective, multicenter clinical trial that enrolled 443 patients with severely calcified coronary lesions in the United States. The major adverse cardiac event (MACE) rate through 2 years post procedure, defined by cardiac death, myocardial infarction (CK-MB >3x upper limit of normal with or without a new pathologic Q-wave) and target-vessel revascularization, was compared in the LM and non-left main (NLM) groups. Among the 443 patients, a total of 10 underwent orbital atherectomy of protected LM artery lesions. At 2 years, there was no significant difference in the 2-year MACE rate in the LM and NLM groups (30.0% vs 19.1%, respectively; P=.36). Cardiac death was low in both groups (0% vs 4.4%, respectively; P=.99). Myocardial infarction occurred within 30 days in both groups (10.0% vs 9.7%, respectively; P=.99). Severe dissection, perforation, persistent slow flow, and persistent no reflow did not occur in the LM group. Abrupt closure occurred in 1 patient in the LM group. Orbital atherectomy for patients with heavily calcified LM coronary artery lesions is safe and feasible. Further studies are needed to assess the safety and efficacy of orbital atherectomy in patients with severely calcified LM artery lesions.
An analysis of near-circular lunar mapping orbits
Indian Academy of Sciences (India)
Numerical investigations have been carried out to analyse the evolution of lunar circular orbits and the influence of the higher order harmonics of the lunar gravity field. The aim is to select the appropriate near-circular orbit characteristics, which extend orbit life through passive orbit maintenance. The spherical harmonic ...
Diplopia and Orbital Wall Fractures
Boffano, P.; Roccia, F.; Gallesio, C.; Karagozoglu, K.H.; Forouzanfar, T.
2014-01-01
Diplopia is a symptom that is frequently associated with orbital wall fractures. The aim of this article was to present the incidence and patterns of diplopia after orbital wall blow-out fractures in 2 European centers, Turin and Amsterdam, and to identify any correlation between this symptom and
Diplopia and orbital wall fractures
Boffano, P.; Roccia, F.; Gallesio, C.; Karagozoglu, K.H.; Forouzanfar, T.
2014-01-01
Diplopia is a symptom that is frequently associated with orbital wall fractures. The aim of this article was to present the incidence and patterns of diplopia after orbital wall blow-out fractures in 2 European centers, Turin and Amsterdam, and to identify any correlation between this symptom and
Titan Orbiter with Aerorover Mission (TOAM)
Sittler, Edward C.; Cooper, J. F.; Mahaffey, P.; Esper, J.; Fairbrother, D.; Farley, R.; Pitman, J.; Kojiro, D. R.; TOAM Team
2006-12-01
We propose to develop a new mission to Titan called Titan Orbiter with Aerorover Mission (TOAM). This mission is motivated by the recent discoveries of Titan, its atmosphere and its surface by the Huygens Probe, and a combination of in situ, remote sensing and radar mapping measurements of Titan by the Cassini orbiter. Titan is a body for which Astrobiology (i.e., prebiotic chemistry) will be the primary science goal of any future missions to it. TOAM is planned to use an orbiter and balloon technology (i.e., aerorover). Aerobraking will be used to put payload into orbit around Titan. The Aerorover will probably use a hot air balloon concept using the waste heat from the MMRTG 500 watts. Orbiter support for the Aerorover is unique to our approach for Titan. Our strategy to use an orbiter is contrary to some studies using just a single probe with balloon. Autonomous operation and navigation of the Aerorover around Titan will be required, which will include descent near to the surface to collect surface samples for analysis (i.e., touch and go technique). The orbiter can provide both relay station and GPS roles for the Aerorover. The Aerorover will have all the instruments needed to sample Titan’s atmosphere, surface, possible methane lakes-rivers, use multi-spectral imagers for surface reconnaissance; to take close up surface images; take core samples and deploy seismometers during landing phase. Both active and passive broadband remote sensing techniques will be used for surface topography, winds and composition measurements.
Ricketts, Sophie; Chew, Hall F; Sunderland, Ian R P; Kiss, Alex; Fialkov, Jeffrey A
2014-03-01
Selective inferior orbital fissure (IOF) content transection for the purpose of surgical access to the posterior orbital floor is a technique that facilitates visualization of the posterior bony ledges of traumatic orbital floor defects. It also has potential advantages in achieving stable placement of reconstructive materials. Although not new, the surgical technique has not yet been described, and the morbidity of the technique has not been quantified. This article describes the procedure and assesses the morbidity specific to the division of related neural structures. The technique and surgical anatomy are described and illustrated with intraoperative photographs. Postoperative assessment of neural structures relevant to the division of IOF contents is performed. These values are compared with the nonoperated side to evaluate the morbidity of the technique. The technique, which is consistently used by the senior author in the repair of orbital floor defects with very small posterior ledges or which extend to and involve the IOF, facilitates better visualization of the posterior ledge and posterolateral ledge in such cases. Surgical outcomes including facial sensation and lacrimal function on the operated side remain within the reference range and are not significantly different when compared with the contralateral nonoperated side. Selective IOF transection aids in the direct visualization of the posterior bony ledges in the repair of posterior orbital floor defects. It therefore may facilitate the placement of reconstructive materials on bony ledges circumferentially, providing stable reconstruction, potentially reducing implant-related complications without causing increased morbidity.
Beam closed orbit feedback based on PID control
International Nuclear Information System (INIS)
Xuan Ke; Wang Lin; Liu Gongfa; Li Weimin; Li Chuan; Wang Jigang; Bao Xun; Xu Hongliang
2013-01-01
The algorithm in the feedback system has important influence on the performance of the beam orbit. Good feedback algorithm can greatly improve the beam orbit stability. In this paper, the theory of beam closed orbit correction, the principle of PID control and the beam closed orbit feedback correction using PID control were introduced. The simulation results were given. Compared with least-square method, the PID feedback algorithm makes the steady-state error smaller and more accurate, and enhances the beam orbit stability. (authors)
Man-Made Debris In and From Lunar Orbit
Johnson, Nicholas L.; McKay, Gordon A. (Technical Monitor)
1999-01-01
During 1966-1976, as part of the first phase of lunar exploration, 29 manned and robotic missions placed more than 40 objects into lunar orbit. Whereas several vehicles later successfully landed on the Moon and/or returned to Earth, others were either abandoned in orbit or intentionally sent to their destruction on the lunar surface. The former now constitute a small population of lunar orbital debris; the latter, including four Lunar Orbiters and four Lunar Module ascent stages, have contributed to nearly 50 lunar sites of man's refuse. Other lunar satellites are known or suspected of having fallen from orbit. Unlike Earth satellite orbital decays and deorbits, lunar satellites impact the lunar surface unscathed by atmospheric burning or melting. Fragmentations of lunar satellites, which would produce clouds of numerous orbital debris, have not yet been detected. The return to lunar orbit in the 1990's by the Hagoromo, Hiten, Clementine, and Lunar Prospector spacecraft and plans for increased lunar exploration early in the 21st century, raise questions of how best to minimize and to dispose of lunar orbital debris. Some of the lessons learned from more than 40 years of Earth orbit exploitation can be applied to the lunar orbital environment. For the near-term, perhaps the most important of these is postmission passivation. Unique solutions, e.g., lunar equatorial dumps, may also prove attractive. However, as with Earth satellites, debris mitigation measures are most effectively adopted early in the concept and design phase, and prevention is less costly than remediation.
Orbital manifestations in patients with acquired immunodeficiency syndrome.
Sodhi, Punita Kumari
2014-01-01
The orbital manifestations of acquired immunodeficiency syndrome(AIDS) are uncommon. To provide a review of orbital manifestations of AIDS, the predisposing factors, investigations, treatment and outcome. Meticulous and systematic literature search of Pubmed to identify manuscripts describing orbital manifestations of AIDS was done and the articles were reviewed.The keywords used in the search were “orbit and AIDS”, “HIV positive and orbit”,“orbit manifestations in AIDS”, “orbital disease and AIDS” and “orbital infections and AIDS”. The orbital involvement in AIDS may present with opportunistic infections from organisms like fungi, viruses, bacteria and protozoa or with malignancies like Kaposi’s sarcoma, squamous cell carcinoma, smooth muscle cell tumors and lymphoma.The predisposing factors for orbital involvement in AIDS are low CD4+ cell count and the immunosuppressive states like diabetes, diabetic ketoacidosis, intravenous drug abuse and neutropenia. A patient may present with fever, headache, nausea, vomiting,decreased vision, ocular pain, and, in cases of mass formation, there is periorbital swelling, axial proptosis, globe displacement and swollen optic disc. Radiologically,mass formation, orbital bony destruction, and spread of disease to contiguous structures including the central nervous system may be seen. The medical management includes therapy for infection and HIV-1 protease inhibitors (highly active antiretroviral therapy)to suppress HIV-1 replication. For tumors, radical surgery including debulking followed by postoperative radiotherapy is generally needed. Orbital involvements with AIDS in any form, infective or malignancy, causes significant morbidity and mortality and should be diagnosed and managed as early as possible.
Computed tomography of orbital myositis
International Nuclear Information System (INIS)
Dresner, S.C.; Rothfus, W.E.; Slamovits, T.L.; Kennerdell, J.S.; Curtin, H.D.
1984-01-01
The computerized tomographic (CT) scans of 11 consecutive patients with orbital myositis were reviewed to better characterize the CT appearance of this condition. The findings in this series differed from those of previous reports in several ways. Multiple muscle involvement predominated. Bilateral involvement was more frequent than previously reported. Enlargement of the tendon as well as the muscle was a frequent finding, but a normal tendinous insertion did not preclude the diagnosis of orbital myositis. Although the CT appearance of orbital myositis is often helpful, the findings are not pathognomonic; correlation with history, clinical findings, and therapeutic response must be considered in making the diagnosis
Alergia ao glúten: série de nove casos = Gluten allergy: series of nine cases
Directory of Open Access Journals (Sweden)
Maia, Estefânia Barrosa
2014-01-01
Conclusões: A alergia ao glúten é rara, explicando o pequeno número diagnosticado em 15 anos, em um hospital central de referência. Os nove casos tiveram início no primeiro ano de vida, sendo as manifestações cutâneas as mais frequentes. O eczema foi uma apresentação frequente e a sensibilização foi por via cutânea em alguns casos. A alergia alimentar múltipla também foi frequente nos casos descritos. Três das nove crianças resolveram a alergia até os seis anos, tendo em comum uma manifestação inicial cutânea. Nestes nove casos, o valor de IgE específica não foi preditivo da evolução clínica
Jaupart, Etienne; Charnoz, Sebatien; Moreira, Manuel
2017-09-01
The presence of Neon in terrestrial planet mantles may be attributed to the implantation of solar wind in planetary precursors or to the dissolution of primordial solar gases captured from the accretionary disk into an early magma ocean. This is suggested by the Neon isotopic ratio similar to those of the Sun observed in the Earth mantle. Here, we evaluate the second hypothesis. We use general considerations of planetary accretion and atmospheric science. Using current models of terrestrial planet formation, we study the evolution of standard planetary embryos with masses in a range of 0.1-0.2 MEarth, where MEarth is the Earth's mass, in an annular region at distances between 0.5 and 1.5 Astronomical Units from the star. We determine the characteristics of atmospheres that can be captured by such embryos for a wide range of parameters and calculate the maximum amount of Neon that can be dissolved in the planet. Our calculations may be directly transposed to any other planet. However, we only know of the amount of Neon in the Earth's solid mantle. Thus we use Earth to discuss our results. We find that the amount of dissolved Neon is too small to account for the present-day Neon contents of the Earth's mantle, if the nebular gas disk completely disappears before the largest planetary embryos grow to be ∼0.2 MEarth. This leaves solar irradiation as the most likely source of Neon in terrestrial planets for the most standard case of planetary formation models.
GPS Based Reduced-Dynamic Orbit Determination for Low Earth Orbiters with Ambiguity Fixing
Directory of Open Access Journals (Sweden)
Yang Yang
2015-01-01
Full Text Available With the ever-increasing number of satellites in Low Earth Orbit (LEO for scientific missions, the precise determination of the position and velocity of the satellite is a necessity. GPS (Global Positioning System based reduced-dynamic orbit determination (RPOD method is commonly used in the post processing with high precision. This paper presents a sequential RPOD strategy for LEO satellite in the framework of Extended Kalman Filter (EKF. Precise Point Positioning (PPP technique is used to process the GPS observations, with carrier phase ambiguity resolution using Integer Phase Clocks (IPCs products. A set of GRACE (Gravity Recovery And Climate Experiment mission data is used to test and validate the RPOD performance. Results indicate that orbit determination accuracy could be improved by 15% in terms of 3D RMS error in comparison with traditional RPOD method with float ambiguity solutions.
Orbital Evolution and Orbital Phase Resolved Spectroscopy of the ...
Indian Academy of Sciences (India)
binary. We have carried out orbital phase resolved spectroscopy to mea- ... agreement with a simple model of a spherically symmetric stellar wind from the .... has a set of Narrow Field Instruments (NFI) comprising one Low Energy Concen-.
Bilateral orbital bone infarction in sickle-cell disease.
Ghafouri, Roya H; Lee, Irene; Freitag, Suzanne K; Pira, Tony N
2011-01-01
This is a case of a 2-year-old boy with sickle cell disease who presented with bilateral eyelid swelling, limited extraocular motility, and lateral subperiosteal fluid collection associated with bilateral lateral orbital wall infarctions on MRI. The patient was managed medically with intravenous fluids, analgesics, broad-spectrum antibiotics, systemic steroids, and clinically improved. Patients with sickle cell disease are susceptible to infarction of the orbital bones during vaso-occlusive crises. Orbital wall infarction can lead to acute proptosis and restricted extraocular motility. Orbital wall infarction should be considered in sickle cell patients with orbital diseases so that appropriate treatment can be instituted promptly to prevent the serious sequelae of orbital compression syndrome.
Orbital selective spin-texture in a topological insulator
Energy Technology Data Exchange (ETDEWEB)
Singh, Bahadur, E-mail: bahadursingh24@gmail.com; Prasad, R. [Department of Physics, Indian Institute of Technology Kanpur, Kanpur 208016 (India)
2015-05-15
Three-dimensional topological insulators support a metallic non-trivial surface state with unique spin texture, where spin and momentum are locked perpendicular to each other. In this work, we investigate the orbital selective spin-texture associated with the topological surface states in Sb2Te{sub 3}, using the first principles calculations. Sb2Te{sub 3} is a strong topological insulator with a p-p type bulk band inversion at the Γ-point and supports a single topological metallic surface state with upper (lower) Dirac-cone has left (right) handed spin-texture. Here, we show that the topological surface state has an additional locking between the spin and orbitals, leading to an orbital selective spin-texture. The out-of-plane orbitals (p{sub z} orbitals) have an isotropic orbital texture for both the Dirac cones with an associated left and right handed spin-texture for the upper and lower Dirac cones, respectively. In contrast, the in-planar orbital texture (p{sub x} and p{sub y} projections) is tangential for the upper Dirac-cone and is radial for the lower Dirac-cone surface state. The dominant in-planar orbital texture in both the Dirac cones lead to a right handed orbital-selective spin-texture.
Efficient orbit integration by manifold correction methods.
Fukushima, Toshio
2005-12-01
Triggered by a desire to investigate, numerically, the planetary precession through a long-term numerical integration of the solar system, we developed a new formulation of numerical integration of orbital motion named manifold correct on methods. The main trick is to rigorously retain the consistency of physical relations, such as the orbital energy, the orbital angular momentum, or the Laplace integral, of a binary subsystem. This maintenance is done by applying a correction to the integrated variables at each integration step. Typical methods of correction are certain geometric transformations, such as spatial scaling and spatial rotation, which are commonly used in the comparison of reference frames, or mathematically reasonable operations, such as modularization of angle variables into the standard domain [-pi, pi). The form of the manifold correction methods finally evolved are the orbital longitude methods, which enable us to conduct an extremely precise integration of orbital motions. In unperturbed orbits, the integration errors are suppressed at the machine epsilon level for an indefinitely long period. In perturbed cases, on the other hand, the errors initially grow in proportion to the square root of time and then increase more rapidly, the onset of which depends on the type and magnitude of the perturbations. This feature is also realized for highly eccentric orbits by applying the same idea as used in KS-regularization. In particular, the introduction of time elements greatly enhances the performance of numerical integration of KS-regularized orbits, whether the scaling is applied or not.
Orbit stability of the ALS storage ring
International Nuclear Information System (INIS)
Keller, R.; Nishimura, H.; Biocca, A.
1997-05-01
The Advanced Light Source (ALS) storage ring, a synchrotron light source of the third generation, is specified to maintain its electron orbit stable within one tenth of the rms beam size. In the absence of a dedicated orbit feed-back system, several orbit-distorting effects were investigated, aided by a new interactive simulation tool, the code TRACY V. The effort has led to a better understanding of the behavior of a variety of accelerator subsystems and in consequence produced a substantial improvement in day-to-day orbit stability
Evaluation of the global orbit correction algorithm for the APS real-time orbit feedback system
International Nuclear Information System (INIS)
Carwardine, J.; Evans, K. Jr.
1997-01-01
The APS real-time orbit feedback system uses 38 correctors per plane and has available up to 320 rf beam position monitors. Orbit correction is implemented using multiple digital signal processors. Singular value decomposition is used to generate a correction matrix from a linear response matrix model of the storage ring lattice. This paper evaluates the performance of the APS system in terms of its ability to correct localized and distributed sources of orbit motion. The impact of regulator gain and bandwidth, choice of beam position monitors, and corrector dynamics are discussed. The weighted least-squares algorithm is reviewed in the context of local feedback
Reconstruction of Orbital Floor With Auricular Concha.
Seven, Ergin; Tellioglu, Ali Teoman; Inozu, Emre; Ozakpinar, Hulda Rifat; Horoz, Ugur; Eryilmaz, Avni Tolga; Karamursel, Sebat
2017-10-01
Orbital floor fractures of varying sizes commonly occur after orbital injuries and remain a serious challenge. Serious complications of such fractures include enopthalmos, restriction of extraocular movement, and diplopia. There is a dearth of literature that can be applied widely, easily, and successfully in all such situations, and therefore there is no consensus on the treatment protocol of this pathology yet. Autogenous grafts and alloplastic and allogenic materials with a wide variety of advantages and disadvantages have been discussed. The value of preoperative and postoperative ophthalmological examination should be standard of care in all orbital fracture patients. An ideal reconstructed orbital floor fracture should accelerate the restoration of orbital function with acceptable cosmetic results. Management parameters of orbital fractures such as timing of surgery, incision type, and implant materials, though widely discussed, remain controversial. In this study, 55 patients with orbital floor fractures surgically reconstructed with conchal cartilage grafts between 2008 and 2014 were retrospectively evaluated. Complications and long-time follow-up visit results have been reported with clinical and radiographic findings. The aim of this study was to present the authors' clinical experiences of reconstruction of blow-out fractures with auricular conchal graft and to evaluate the other materials available for use.
NanoSail - D Orbital and Attitude Dynamics
Heaton, Andrew F.; Faller, Brent F.; Katan, Chelsea K.
2013-01-01
NanoSail-D unfurled January 20th, 2011 and successfully demonstrated the deployment and deorbit capability of a solar sail in low Earth orbit. The orbit was strongly perturbed by solar radiation pressure, aerodynamic drag, and oblate gravity which were modeled using STK HPOP. A comparison of the ballistic coefficient history to the orbit parameters exhibits a strong relationship between orbital lighting, the decay rate of the mean semi-major axis and mean eccentricity. A similar comparison of mean solar area using the STK HPOP solar radiation pressure model exhibits a strong correlation of solar radiation pressure to mean eccentricity and mean argument of perigee. NanoSail-D was not actively controlled and had no capability on-board for attitude or orbit determination. To estimate attitude dynamics we created a 3-DOF attitude dynamics simulation that incorporated highly realistic estimates of perturbing forces into NanoSail-D torque models. By comparing the results of this simulation to the orbital behavior and ground observations of NanoSail-D, we conclude that there is a coupling between the orbit and attitude dynamics as well as establish approximate limits on the location of the NanoSail-D solar center of pressure. Both of these observations contribute valuable data for future solar sail designs and missions.
Orbital lymphoma masquerading as thyroid ophthalmopathy.
Boyce, P J
1998-10-01
Lymphoid tumors are known to originate within the lacrimal gland and orbital fat. Ocular findings commonly seen are a palpable mass with proptosis and downward displacement of the globe. Graves' ophthalmopathy is the most common orbital pathology occurring in the general population. Signs and symptoms of Graves' ophthalmopathy, such as unilateral or bilateral proptosis, double vision, limitation of movement of the extraocular muscles, are not specific for this condition. A 57-year-old man came to us with a chief symptom of "eye swelling" for the last 3 years. He had been diagnosed with hyperthyroidism and had received three surgical procedures for orbital decompression. Clinical findings included limitation of upward and downward gaze, exophthalmometry readings of 30 1/2 mm O.D. and 31 mm O.S. (with a base of 112), and profound proptosis with fatty tissue prolapse. Subsequent thyroid testing revealed euthyroid status and computed tomography scan revealed orbital lymphoma. Orbital involvement from a malignant nodular histiocytic lymphoma resulted in a proptosis similar to that observed in Graves' ophthalmopathy. This very unusual presentation of orbital lymphoma mimicked Graves' disease so closely that the true cause was overlooked. This case emphasizes the need to include space-occupying lesions in the differential diagnosis of proptosis and gaze restrictions. The disease process and controversial management strategies are discussed.
Effective orbital volume and eyeball position: an MRI study.
Detorakis, Efstathios T; Drakonaki, Eleni; Papadaki, Efrosini; Pallikaris, Ioannis G; Tsilimbaris, Miltiadis K
2010-10-01
Previous studies have examined factors affecting the position of the eyeball to the orbit. This study examined the role of effective orbital volume (EOV), defined as the difference between orbital and eyeball volume, as a determinant of eyeball position, using MRI scans. Forty-six patients were recruited from the Department of Ophthalmology of the University Hospital of Heraklion, Crete Greece. Patients with a history of orbital disease were excluded. Distances between eyeball poles and orbital landmarks were measured in T1 weighted transverse, sagittal and coronal orbital images. The protrusion of the eyeball in the sagittal and transverse planes was recorded. The volume of the eyeball and bony orbit, the EOV, the volume of the extraocular muscles as well as clinical information (age, gender, Hertel exophthalmometry) were also recorded. EOV was significantly associated with orbital volume but not with eyeball volume. EOV was also significantly associated with transverse and sagittal globe protrusions. Females displayed significantly lower orbital and eyeball volumes as well as EOV than males but higher transverse globe protrusion than males. Variations in EOV are associated with orbital volume rather than with eyeball volume. EOV is associated with globe protrusion and may be taken into account in the planning of various procedures, including orbital decompression, treatment of enophthalmos or the size of orbital implants following enucleation.
Continuation of Sets of Constrained Orbit Segments
DEFF Research Database (Denmark)
Schilder, Frank; Brøns, Morten; Chamoun, George Chaouki
Sets of constrained orbit segments of time continuous flows are collections of trajectories that represent a whole or parts of an invariant set. A non-trivial but simple example is a homoclinic orbit. A typical representation of this set consists of an equilibrium point of the flow and a trajectory...... that starts close and returns close to this fixed point within finite time. More complicated examples are hybrid periodic orbits of piecewise smooth systems or quasi-periodic invariant tori. Even though it is possible to define generalised two-point boundary value problems for computing sets of constrained...... orbit segments, this is very disadvantageous in practice. In this talk we will present an algorithm that allows the efficient continuation of sets of constrained orbit segments together with the solution of the full variational problem....
Prust, Chet D.; Haufler, W. A.; Marino, A. J.
1988-01-01
The results of the Independent Orbiter Assessment (IOA) of the Failure Modes and Effects Analysis (FMEA) and Critical Items List (CIL) are presented. The IOA effort first completed an analysis of the Orbital Maneuvering System (OMS) hardware and Electrical Power Distribution and Control (EPD and C), generating draft failure modes and potential critical items. To preserve independence, this analysis was accomplished without reliance upon the results contained within the NASA FMEA/CIL documentation. The IOA results were then compared to the proposed Post 51-L NASA FMEA/CIL baseline. This report documents the results of that comparison for the Orbiter OMS hardware. The IOA analysis defined the OMS as being comprised of the following subsystems: helium pressurization, propellant storage and distribution, Orbital Maneuvering Engine, and EPD and C. The IOA product for the OMS analysis consisted of 284 hardware and 667 EPD and C failure mode worksheets that resulted in 160 hardware and 216 EPD and C potential critical items (PCIs) being identified. A comparison was made of the IOA product to the NASA FMEA/CIL baseline which consisted of 101 hardware and 142 EPD and C CIL items.
Infected orbital cyst following exenteration.
Barak, A; Hirsh, A; Rosner, M; Rosen, N
1996-09-01
An orbital cyst is a rare complication of orbital trauma and exenteration. Infections of such cysts have not been described, and are potentially dangerous unless treated immediately. The authors describe a case of delayed treatment of such an infected cyst, which resolved following surgical drainage. The potentially hazardous outcome makes knowledge of such cases important.
Three Temperate Neptunes Orbiting Nearby Stars
Fulton, Benjamin J.; Howard, Andrew W.; Weiss, Lauren M.; Sinukoff, Evan; Petigura, Erik A.; Isaacson, Howard; Hirsch, Lea; Marcy, Geoffrey W.; Henry, Gregory W.; Grunblatt, Samuel K.; Huber, Daniel; von Braun, Kaspar; Boyajian, Tabetha S.; Kane, Stephen R.; Wittrock, Justin; Horch, Elliott P.; Ciardi, David R.; Howell, Steve B.; Wright, Jason T.; Ford, Eric B.
2016-10-01
We present the discovery of three modestly irradiated, roughly Neptune-mass planets orbiting three nearby Solar-type stars. HD 42618 b has a minimum mass of 15.4 ± 2.4 {M}\\oplus , a semimajor axis of 0.55 au, an equilibrium temperature of 337 K, and is the first planet discovered to orbit the solar analogue host star, HD 42618. We also discover new planets orbiting the known exoplanet host stars HD 164922 and HD 143761 (ρ CrB). The new planet orbiting HD 164922 has a minimum mass of 12.9 ± 1.6 {M}\\oplus and orbits interior to the previously known Jovian mass planet orbiting at 2.1 au. HD 164922 c has a semimajor axis of 0.34 au and an equilibrium temperature of 418 K. HD 143761 c orbits with a semimajor axis of 0.44 au, has a minimum mass of 25 ± 2 {M}\\oplus , and is the warmest of the three new planets with an equilibrium temperature of 445 K. It orbits exterior to the previously known warm Jupiter in the system. A transit search using space-based CoRoT data and ground-based photometry from the Automated Photometric Telescopes (APTs) at Fairborn Observatory failed to detect any transits, but the precise, high-cadence APT photometry helped to disentangle planetary-reflex motion from stellar activity. These planets were discovered as part of an ongoing radial velocity survey of bright, nearby, chromospherically inactive stars using the Automated Planet Finder (APF) telescope at Lick Observatory. The high-cadence APF data combined with nearly two decades of radial velocity data from Keck Observatory and gives unprecedented sensitivity to both short-period low-mass, and long-period intermediate-mass planets. Based on observations obtained at the W. M. Keck Observatory, which is operated jointly by the University of California and the California Institute of Technology. Keck time was granted for this project by the University of Hawai‘I, the University of California, and NASA.
Closed orbit analysis for RHIC
International Nuclear Information System (INIS)
Milutinovic, J.; Ruggiero, A.G.
1989-01-01
We examine the effects of four types of errors in the RHIC dipoles and quadrupoles on the on-momentum closed orbit in the machine. We use PATRIS both to handle statistically the effects of kick-modeled errors and to check the performance of the Fermilab correcting scheme in a framework of a more realistic modeling. On the basis of the accepted rms values of the lattice errors, we conclude that in about 40% of all studied cases the lattice must be to some extent pre-corrected in the framework of the so-called ''first turn around strategy,'' in order to get a closed orbit within the aperture limitations at all and, furthermore, for approximately 2/3 of the remaining cases we find that a single pass algorithm of the Fermilab scheme is not sufficient to bring closed orbit distortions down to acceptable levels. We have modified the scheme and have allowed repeated applications of the otherwise unchanged three bump method and in doing so we have been able to correct the orbit in a satisfactory manner. 4 refs., 2 figs., 3 tabs
Cholesterol granuloma of the orbit: An atypical presentation
Directory of Open Access Journals (Sweden)
Syed A R Rizvi
2014-01-01
Full Text Available Cholesterol granuloma is a rare, well-defined lesion of the orbit. In the orbit, diploe of the frontal bone is involved almost exclusively. We report an atypical case of cholesterol granuloma involving superomedial quadrant of orbit. A 42-year-old male presented with progressive, painless, proptosis with infero-temporal displacement of left eye. A large mass was felt beneath the bony orbital margin in the superomedial quadrant of the left orbit. Computerized tomography (CT scan revealed an extraconal superomedial, heterogeneous enhancing mass which was isodense with brain and pushing the globe inferolaterally and anteriorly. Excision biopsy of the tumor revealed the typical features of a cholesterol granuloma without any epithelial elements. Cholesterol granuloma of the orbit is a rare entity, but it can be diagnosed and differentiated from other lesions of the superior orbit by its characteristic clinical, radiological and histopathological features. An appropriate intervention in time carries a good prognosis with almost no recurrence.
Relativistic spin-orbit interactions of photons and electrons
Smirnova, D. A.; Travin, V. M.; Bliokh, K. Y.; Nori, F.
2018-04-01
Laboratory optics, typically dealing with monochromatic light beams in a single reference frame, exhibits numerous spin-orbit interaction phenomena due to the coupling between the spin and orbital degrees of freedom of light. Similar phenomena appear for electrons and other spinning particles. Here we examine transformations of paraxial photon and relativistic-electron states carrying the spin and orbital angular momenta (AM) under the Lorentz boosts between different reference frames. We show that transverse boosts inevitably produce a rather nontrivial conversion from spin to orbital AM. The converted part is then separated between the intrinsic (vortex) and extrinsic (transverse shift or Hall effect) contributions. Although the spin, intrinsic-orbital, and extrinsic-orbital parts all point in different directions, such complex behavior is necessary for the proper Lorentz transformation of the total AM of the particle. Relativistic spin-orbit interactions can be important in scattering processes involving photons, electrons, and other relativistic spinning particles, as well as when studying light emitted by fast-moving bodies.
Orbit Feedback Operation with RCBX (MD 1209)
Wenninger, Jorg; Nisbet, David; Ponce, Laurette; Louro Alves, Diogo Miguel; CERN. Geneva. ATS Department
2017-01-01
The LHC Orbit Feedback (OFB) is able to drive any orbit corrector circuit (COD) to steer the LHC orbit. But during the first feedback tests in 2010, all attempts to use the common triplet orbit correctors (MCBX) failed because the QPS system installed to protect those magnets triggered power aborts as soon as the OFB steered the beam with those CODs. The reason was most likely the violation of the RCBX circuit acceleration limits. For this reason the MCBX orbit correctors were never driven by the OFB in regular operation. Although the performance of the OFB is generally excellent, the quality of the beam steering around IRs could be improved if the OFB could correct the orbit with the MCBX to counteract locally triplet quadrupole movements. The aim of this MD was to make a new attempt to use the MCBX in the OFB. The test was successful at injection (no circuit trip) and failed during the ramp (QPS power abort). The PC voltages and QPS Ures signals revealed the presence of voltage spikes with a period of 10~s...
Otero, J A; Barrera, B; de la Fuente, A; Prieto, J G; Marqués, M; Álvarez, A I; Merino, G
2015-01-01
The ATP-binding cassette transporter ABCG2 restricts the exposure of certain drugs and natural compounds in different tissues and organs. Its expression in the mammary gland is induced during lactation and is responsible for the active secretion of many compounds into milk, including antimicrobial agents. This particular function of ABCG2 may affect drug efficacy against mastitis and the potential presence of drug residues in the milk. Previous in vitro and in vivo studies showed increased transport of several compounds, including fluoroquinolones, by the bovine ABCG2 Y581S polymorphism. Our main purpose was to study the potential effect of this bovine ABCG2 polymorphism on the secretion into milk of the antimicrobial danofloxacin administered at the therapeutic dose of 6mg/kg used for mastitis treatment. In addition, the effect of this polymorphism on the relative mRNA and protein levels of ABCG2 by quantitative real-time PCR and Western blot were studied. Danofloxacin 18% (6mg/kg) was administered to 6 Y/Y homozygous and 5 Y/S heterozygous cows. Danofloxacin levels in milk and milk-to-plasma concentration ratios were almost 1.5- and 2-fold higher, respectively, in Y/S cows compared with the Y/Y cows, showing a higher capacity of this variant to transport danofloxacin into milk. Furthermore, the higher activity of this polymorphism is not linked to higher ABCG2 mRNA or protein levels. These results demonstrate the relevant effect of the Y581S polymorphism of the bovine ABCG2 transporter in the secretion into milk of danofloxacin after administration of 6mg/kg, with potentially important consequences for mastitis treatment and for milk residue handling. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Retrieval of RTG'S in earth orbit
International Nuclear Information System (INIS)
Raab, B.; Frieder, M.A.; Skrabek, A.
1982-01-01
Since 1961, some ten Radioisotope Thermoelectric Generators (RTG's) have been placed into a variety of spacecraft which are now in earth orbit. All of these spacecraft are in orbits with lifetimes in excess of 100 years and pose no risk. However, since most of these spacecraft are no longer being actively used, these may be subject to an active removal program to reduce the population of objects in space. Therefore, a study was undertaken to evaluate the feasibility of retrieving or disposing of spacecraft with RTGs on board. Intervention scenarios are developed and an orbital rendezvous vehicle is conceptualized. The costs of RTG retrieval are derived and compared to the costs of RTG disposal, i.e., boost to a higher, multi-millenium-lifetime orbit, and are found to be not significantly different
Hurlbert, Eric A.
2001-01-01
This slide presentation reviews the Space Shuttle's On-Orbit Propulsion systems: the Orbital Maneuvering System (OMS) and the Reaction Control System (RCS). The functions of each of the systems is described, and the diagrams of the systems are presented. The OMS/RCS thruster is detailed and a trade study comparison of non-toxic propellants is presented.
Beam-beam-induced orbit effects at LHC
International Nuclear Information System (INIS)
Schaumann, M; Fernandez, R Alemany
2014-01-01
For high bunch intensities the long-range beam-beam interactions are strong enough to provoke effects on the orbit. As a consequence the closed orbit changes. The closed orbit of an unperturbed machine with respect to a machine where the beam-beam force becomes more and more important has been studied and the results are presented in this paper
Microscopic Stern-Gerlach effect and spin-orbit pendulum
International Nuclear Information System (INIS)
Rozmej, P.; Arvieu, R.
1996-01-01
The motion of a particle with spin in spherical harmonic oscillator potential with spin-orbit interaction is discussed. The attention is focused on the spatial motion of wave packets. The particular case of wave packets moving along the circular orbits for which the most transparent and pedagogical description is possible is considered. The splitting of the wave packets into two components moving differently along classical orbits reflects a strong analogy with the Stern-Gerlach experiment. The periodic transfer of average angular momentum between spin and orbital subspaces accompanying this time evolution is called the spin-orbit pendulum. (author). 6 refs, 3 figs
ESOC activities during the MIR de-orbit
Klinkrad, H.; Flury, W.; Hernández, C.; Landgraf, M.; Jehn, R.; Christ, U.; Sintoni, F.
2002-11-01
On March 23, 2001, MIR was de-orbited in a controlled fashion, following a successful mission of 15 years. The de-orbiting operations were conducted by the TsUP Mission Control Center, who also consulted entities outside Russia, in order to consolidate their knowledge on the MIR orbit and attitude prior to the initiation of the de-orbit sequence. The European Space Agency ESA through their operations centre ESOC was tasked to support the pre-entry analysis of TsUP by own results, and by routing of Russian and European data via a dedicated communications network. Analysis results produced by ESOC, and details on the data exchange will be highlighted in this paper. The MIR de-orbit and its assessed risk potential will also be compared with the re-entries of Skylab and Salyut-7/Kosmos-1686.
Primary Orbital Chondromyxoid Fibroma: A Rare Case.
Mullen, Martin G; Somogyi, Marie; Maxwell, Sean P; Prabhu, Vikram; Yoo, David K
A 56-year-old male with history of chronic sinusitis was found to have a 3 cm left orbital lesion on CT. Subsequent MRI demonstrated a multilobulated enhancing soft tissue lesion at the superotemporal region of the left orbit. Initial biopsy was reported as a low-grade sarcoma. On further evaluation, a consensus was made that the lesion was likely a benign mixed mesenchymal type tumor but should nonetheless be surgically removed. Left lateral orbitotomy was performed which revealed a tumor originating in the lateral orbital bone with segments eroding through the wall of the orbit. Intraoperative frozen sections revealed myoepitheliod tissue with locally aggressive features and the tumor was completely removed. The final histopathologic analysis of the tissue was consistent with a chondromyxoid fibroma. Chondomyxoid fibroma is a rare entity in the orbital bones and is more commonly seen in long bones.
AN EMPIRICAL CALIBRATION TO ESTIMATE COOL DWARF FUNDAMENTAL PARAMETERS FROM H-BAND SPECTRA
Energy Technology Data Exchange (ETDEWEB)
Newton, Elisabeth R.; Charbonneau, David; Irwin, Jonathan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Mann, Andrew W., E-mail: enewton@cfa.harvard.edu [Astronomy Department, University of Texas at Austin, Austin, TX 78712 (United States)
2015-02-20
Interferometric radius measurements provide a direct probe of the fundamental parameters of M dwarfs. However, interferometry is within reach for only a limited sample of nearby, bright stars. We use interferometrically measured radii, bolometric luminosities, and effective temperatures to develop new empirical calibrations based on low-resolution, near-infrared spectra. We find that H-band Mg and Al spectral features are good tracers of stellar properties, and derive functions that relate effective temperature, radius, and log luminosity to these features. The standard deviations in the residuals of our best fits are, respectively, 73 K, 0.027 R {sub ☉}, and 0.049 dex (an 11% error on luminosity). Our calibrations are valid from mid K to mid M dwarf stars, roughly corresponding to temperatures between 3100 and 4800 K. We apply our H-band relationships to M dwarfs targeted by the MEarth transiting planet survey and to the cool Kepler Objects of Interest (KOIs). We present spectral measurements and estimated stellar parameters for these stars. Parallaxes are also available for many of the MEarth targets, allowing us to independently validate our calibrations by demonstrating a clear relationship between our inferred parameters and the stars' absolute K magnitudes. We identify objects with magnitudes that are too bright for their inferred luminosities as candidate multiple systems. We also use our estimated luminosities to address the applicability of near-infrared metallicity calibrations to mid and late M dwarfs. The temperatures we infer for the KOIs agree remarkably well with those from the literature; however, our stellar radii are systematically larger than those presented in previous works that derive radii from model isochrones. This results in a mean planet radius that is 15% larger than one would infer using the stellar properties from recent catalogs. Our results confirm the derived parameters from previous in-depth studies of KOIs 961 (Kepler
Distant retrograde orbits and the asteroid hazard
Perozzi, Ettore; Ceccaroni, Marta; Valsecchi, Giovanni B.; Rossi, Alessandro
2017-08-01
Distant Retrograde Orbits (DROs) gained a novel wave of fame in space mission design because of their numerous advantages within the framework of the US plans for bringing a large asteroid sample in the vicinity of the Earth as the next target for human exploration. DROs are stable solutions of the three-body problem that can be used whenever an object, whether of natural or artificial nature, is required to remain in the neighborhood of a celestial body without being gravitationally captured by it. As such, they represent an alternative option to Halo orbits around the collinear Lagrangian points L1 and L2. Also known under other names ( e.g., quasi-satellite orbits, cis-lunar orbits, family- f orbits) these orbital configurations found interesting applications in several mission profiles, like that of a spacecraft orbiting around the small irregularly shaped satellite of Mars Phobos or the large Jovian moon Europa. In this paper a basic explanation of the DRO dynamics is presented in order to clarify some geometrical properties that characterize them. Their accessibility is then discussed from the point of view of mission analysis under different assumptions. Finally, their relevance within the framework of the present asteroid hazard protection programs is shown, stressing the significant increase in warning time they would provide in the prediction of impactors coming from the direction of the Sun.
Czech Academy of Sciences Publication Activity Database
Hermanussen, M.; Meitinger, T.; Veldhuis, J.D.; Low, M.J.; Pfäffle, R.; Staub, K.; Panczak, R.; Groth, D.; Brabec, Marek; von Salisch, M.; Loh, C.P.A.; Tassenaar, V.; Scheffler, C.; Mumm, R.; Godina, E.; Lehmann, A.; Tutkuviene, J.; Gervockaite, S.; Nierop, A.F.M; Holmgren, A.; Assmann, C.; van Buuren, S.; Koziel, S.; Zadzinska, E.; Varela-Silva, I.; Vignerová, J.; Salama, E.; El-Shabrawi, M.; Huijic, A.; Satake, T.; Bogin, B.
2014-01-01
Roč. 11, č. 3 (2014), s. 341-353 ISSN 1565-4753. [Aschauer Soiree /20./. Glücksburg castle, 15.11.2014-17.11.2013] Institutional support: RVO:67985807 Keywords : special statistics * Markov random field Subject RIV: FG - Pediatrics
Cephalic Tetanus from Penetrating Orbital Wound
Directory of Open Access Journals (Sweden)
Eloïse Guyennet
2009-01-01
Full Text Available Tetanus is a neurologic disorder caused by tetanospasmin, a protein toxin elaborated by Clostridium tetani. Cephalic tetanus is a localized form of the disease causing trismus and dysfunction of cranial nerves. We report the case of a man who presented with facial trauma, complete ophthalmoplegia, exophthalmos, areactive mydriasis, and periorbital hematoma. An orbital CT revealed air bubbles in the right orbital apex. The patient was given a tetanus toxoid booster and antibiotherapy. After extraction of a wooden foreign body, the patient developed right facial nerve palsy, disorders of swallowing, contralateral III cranial nerve palsy, and trismus. Only one case of cephalic tetanus from penetrating orbital wound has been reported in literature 20 years ago. When a patient presents with an orbital wound with ophthalmoplegia and signs of anaerobic infection, cephalic tetanus should be ruled out.
The relationship of the globe to the orbital rim.
Eckstein, Lauren A; Shadpour, Joseph M; Menghani, Ravi; Goldberg, Robert A
2011-01-01
To present a novel method for accurately characterizing the position of the globe relative to the orbital rim. The appearance and function of the eyelids are dependent on the underlying orbital bony architecture and globe position; however, no comprehensive language to describe these complex 3-dimensional relationships exists. Three-dimensional orbital reconstructions were generated from computed tomographic scans of 15 Occidental and 12 Oriental orbits without orbital pathologic disease. Globe and orbital rim anatomy were identified and outlined. Reference points were measured along 2 independent axes: (1) the distance between a plane defined by the corneal apex and the sagittal projection of the orbital rim and (2) the distance between the circumference of the globe and the coronal projection of the orbital rim. For Occidental orbits, the mean (SD) elevation of the sagittal projection of the orbital rim relative to the anterior projection of the globe was 4.6 (4.2) mm superiorly, 5.9 (3.0) mm nasally, 12.6 (3.7) mm inferiorly, and 20.6 (2.6) mm laterally. The mean (SD) radial distance between the coronal projection of the orbital rim and the circumference of the globe was 3.7 (2.1) mm superiorly, 7.6 (1.8) mm nasally, 6.6 (2.2) mm inferiorly, and 4.6 (2.3) mm laterally. For Oriental orbits, the mean (SD) elevation of the sagittal projection of the orbital rim relative to the anterior projection of the globe was 5.0 (4.5) mm superiorly, 6.8 (4.1) mm nasally, 11.1 (4.3) mm inferiorly, and 17.5 (3.3) mm laterally. The mean (SD) radial distance between the coronal projection of the orbital rim and the circumference of the globe was 2.1 (1.2) mm superiorly, 8.2 (2.0) mm nasally, 6.5 (1.9) mm inferiorly, and 4.5 (1.7) mm laterally. Comparison of Occidental and Oriental orbital rim and globe configurations revealed quantitative and qualitative differences. In addition to differences in soft-tissue anatomy, bony architectural variations may contribute substantially to
Orbital resonances of Taiwan's FORMOSAT-2 remote sensing satellite
Lin, Shin-Fa; Hwang, Cheinway
2018-06-01
Unlike a typical remote sensing satellite that has a global coverage and non-integral orbital revolutions per day, Taiwan's FORMOSAT-2 (FS-2) satellite has a non-global coverage due to the mission requirements of one-day repeat cycle and daily visit around Taiwan. These orbital characteristics result in an integer number of revolutions a day and orbital resonances caused by certain components of the Earth's gravity field. Orbital flight data indicated amplified variations in the amplitudes of FS-2's Keplerian elements. We use twelve years of orbital observations and maneuver data to analyze the cause of the resonances and explain the differences between the simulated (at the pre-launch stage) and real orbits of FS-2. The differences are quantified using orbital perturbation theories that describe secular and long-period orbital evolutions caused by resonances. The resonance-induced orbital rising rate of FS-2 reaches +1.425 m/day, due to the combined (modeled) effect of resonances and atmospheric drags (the relative modeling errors remote sensing mission similar to FS-2, especially in the early mission design and planning phase.
Feasibility analysis of cislunar flight using the Shuttle Orbiter
Haynes, Davy A.
1991-01-01
A first order orbital mechanics analysis was conducted to examine the possibility of utilizing the Space Shuttle Orbiter to perform payload delivery missions to lunar orbit. In the analysis, the earth orbit of departure was constrained to be that of Space Station Freedom. Furthermore, no enhancements of the Orbiter's thermal protection system were assumed. Therefore, earth orbit insertion maneuvers were constrained to be all propulsive. Only minimal constraints were placed on the lunar orbits and no consideration was given to possible landing sites for lunar surface payloads. The various phases and maneuvers of the mission are discussed for both a conventional (Apollo type) and an unconventional mission profile. The velocity impulses needed, and the propellant masses required are presented for all of the mission maneuvers. Maximum payload capabilities were determined for both of the mission profiles examined. In addition, other issues relating to the feasibility of such lunar shuttle missions are discussed. The results of the analysis indicate that the Shuttle Orbiter would be a poor vehicle for payload delivery missions to lunar orbit.
Directory of Open Access Journals (Sweden)
José Nicolau
2006-04-01
Full Text Available Although the influence of diabetes on salivary glands is well studied, it still presents conflicting results. In this work, the regulation of the phosphofructokinase-1 enzyme (PFK-1 was studied utilizing the salivary glands of rats. Diabetes was induced by a single intraperitoneal injection of streptozotocin (60 mg/Kg of body weight in rats (180-200 g. The animals were killed 30 days after the induction of diabetes and the submandibular and parotid salivary glands were used. Hyperglycemia was evaluated by blood sugar determination. The distribution of PFK-1 between the soluble and cytoskeleton fractions, the phosphate content of PFK-1, the content of fructose-2,6-bisphosphate and the activity of the PFK-2 enzyme were determined. The calculated relative glandular weight showed a higher value for the parotid gland in comparison with the control, but not for the submandibular gland. The activity of PFK-1 expressed per gland showed no variation between diabetic and control animals. However, considering the specific activity, the soluble enzyme presented a value 50% higher than that of the control and the cytoskeleton bound form increased by 84% compared to the control. For the parotid gland, no difference in the specific activity between diabetic and control animals was observed. On the other hand, the activity per gland of the soluble enzyme increased in the diabetic animals. The phosphate content of PFK-1 increased in the submandibular and parotid glands of diabetic rats. Both the content of fructose-2,6-bisphosphate and the active form of PFK-2 were reduced in the diabetic glands. In conclusion, the increase in the activity of PFK-1 observed in the salivary glands of rats with streptozotocin-induced diabetes does not seem to be due to its modulator fructose-2,6-bisphosphate.Apesar de existirem muitos estudos sobre a influência do diabetes nas glândulas salivares, esses apresentam resultados conflitantes. Neste estudo, a regulação da enzima
Parameningeal rhabdomyosarcoma (including the orbit): results of orbital irradiation
International Nuclear Information System (INIS)
Jereb, B.; Haik, B.G.; Ong, R.; Ghavimi, F.
1985-01-01
Twenty-three patients with parameningeal (including orbital rhabdomyosarcoma (RMS)) were treated at Memorial Sloan-Kettering Cancer Center (MSKCC) between July 1971 and January 1983. Twenty were children with a mean age of 6 and 3 were adults. In 6 patients, the primary tumor was from the orbit, whereas the remaining 17 had other parameningeal primary sites. The tumors were in a very progressive local stage, with extensive destruction of the facial bones in 19 patients. Eight patients were treated with T2 chemotherapy protocol and 15 received T6. Seven patients received 5,000 to 7,200 rad delivered to the primary tumor in 11-16 weeks, 15 patients received between 4,500 to 5,000 rad in 4-7 weeks, and 1 patient received 3,000 rad in 3 weeks for residual microscopic disease following surgery. Two patients were treated with radiation to the whole brain; no patients received radiation of the whole central nervous axis (CNA). Fifteen of the 23 patients (65%) are alive and well with a medical follow-up time of 5 years. Two patients died of therapeutic complications and six died of tumor spread. In five patients, involvement of the central nervous system (CNS) was the cause of death. The prognosis of orbital RMS with parameningeal involvement is no better than in other tumors of parameningeal sites. In those patients who had impaired vision because of optic nerve damage prior to treatment, the vision did not improve following treatment. There was no impaired vision seen due to radiation damage of eye structures except in the lens
Characterizing Longitude-Dependent Orbital Debris Congestion in the Geosynchronous Orbit Regime
Anderson, Paul V.
The geosynchronous orbit (GEO) is a unique commodity of the satellite industry that is becoming increasingly contaminated with orbital debris, but is heavily populated with high-value assets from the civil, commercial, and defense sectors. The GEO arena is home to hundreds of communications, data transmission, and intelligence satellites collectively insured for an estimated 18.3 billion USD. As the lack of natural cleansing mechanisms at the GEO altitude renders the lifetimes of GEO debris essentially infinite, conjunction and risk assessment must be performed to safeguard operational assets from debris collisions. In this thesis, longitude-dependent debris congestion is characterized by predicting the number of near-miss events per day for every longitude slot at GEO, using custom debris propagation tools and a torus intersection metric. Near-miss events with the present-day debris population are assigned risk levels based on GEO-relative position and speed, and this risk information is used to prioritize the population for debris removal target selection. Long-term projections of debris growth under nominal launch traffic, mitigation practices, and fragmentation events are also discussed, and latitudinal synchronization of the GEO debris population is explained via node variations arising from luni-solar gravity. In addition to characterizing localized debris congestion in the GEO ring, this thesis further investigates the conjunction risk to operational satellites or debris removal systems applying low-thrust propulsion to raise orbit altitude at end-of-life to a super-synchronous disposal orbit. Conjunction risks as a function of thrust level, miss distance, longitude, and semi-major axis are evaluated, and a guidance method for evading conjuncting debris with continuous thrust by means of a thrust heading change via single-shooting is developed.
Dynamic orbital textures in 3He-A
International Nuclear Information System (INIS)
Hall, H.E.; Hook, J.R.; Main, P.C.; Bagley, M.
1978-01-01
Three related pieces of work on the dynamic orbital texture of 3 He-A in a slab geometry have been carried out. (1) The non-linear equation of motion of the orbital axis has been studied analytically and numerically for heat flow normal to a slab. If the product of counter-flow velocity and slab thickness is greater than 5 π h/3 m, the lower energy uniform texture is unstable, and persistent orbital oscillation results in. (2) The torsion pendulum experiment has demonstrated the alignment of l by flow in a channel of width 380 μm. In this experiment, the oscillation was rapid as compared with the orbital relaxation time, so that the texture is controlled by the root mean square velocity. (3) In an attempt to observe directly the dissipation by orbital viscosity, the torsion pendulum experiment has been repeated with 17μm flow channels, for which orbital relaxation time and oscillation period should be comparable. Dissipation above a critical amplitude that occurs in the A-phase but not in the B-phase was observed. The dissipation is of the expected magnitude. (Kobatake, H
Orbital motion in pre-main sequence binaries
Energy Technology Data Exchange (ETDEWEB)
Schaefer, G. H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Prato, L. [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Simon, M. [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Patience, J., E-mail: schaefer@chara-array.org [Astrophysics Group, School of Physics, University of Exeter, Exeter, EX4 4QL (United Kingdom)
2014-06-01
We present results from our ongoing program to map the visual orbits of pre-main sequence (PMS) binaries in the Taurus star forming region using adaptive optics imaging at the Keck Observatory. We combine our results with measurements reported in the literature to analyze the orbital motion for each binary. We present preliminary orbits for DF Tau, T Tau S, ZZ Tau, and the Pleiades binary HBC 351. Seven additional binaries show curvature in their relative motion. Currently, we can place lower limits on the orbital periods for these systems; full solutions will be possible with more orbital coverage. Five other binaries show motion that is indistinguishable from linear motion. We suspect that these systems are bound and might show curvature with additional measurements in the future. The observations reported herein lay critical groundwork toward the goal of measuring precise masses for low-mass PMS stars.
CASA Uno GPS orbit and baseline experiments
Schutz, B. E.; Ho, C. S.; Abusali, P. A. M.; Tapley, B. D.
1990-01-01
CASA Uno data from sites distributed in longitude from Australia to Europe have been used to determine orbits of the GPS satellites. The characteristics of the orbits determined from double difference phase have been evaluated through comparisons of two-week solutions with one-week solutions and by comparisons of predicted and estimated orbits. Evidence of unmodeled effects is demonstrated, particularly associated with the orbit planes that experience solar eclipse. The orbit accuracy has been assessed through the repeatability of unconstrained estimated baseline vectors ranging from 245 km to 5400 km. Both the baseline repeatability and the comparison with independent space geodetic methods give results at the level of 1-2 parts in 100,000,000. In addition, the Mojave/Owens Valley (245 km) and Kokee Park/Ft. Davis (5409 km) estimates agree with VLBI and SLR to better than 1 part in 100,000,000.
Beam-beam diagnostics from closed-orbit distortion
International Nuclear Information System (INIS)
Furman, M.; Chin, Y.H.; Eden, J.; Kozanecki, W.; Tennyson, J.; Ziemann, V.
1992-07-01
We study the applicability of beam-beam deflection techniques as a tuning tool for asymmetric B factories, focusing on PEP-II as an example. Assuming that the closed orbits of the two beams are separated vertically at the interaction point by a local orbit bump that is nominally closed, we calculate the residual beam orbit distortions due to the beam-beam interaction. Difference orbit measurements, performed at points conveniently distant from the interaction point (IP), provide distinct signatures that can be used to maintain the beams in collision and perform detailed optical diagnostics at the IP. A proposal to test this method experimentally at the TRISTAN ring is briefly discussed
Cranio-orbital primary intraosseous haemangioma.
Gupta, T; Rose, G E; Manisali, M; Minhas, P; Uddin, J M; Verity, D H
2013-11-01
Primary intraosseous haemangioma (IOH) is a rare benign neoplasm presenting in the fourth and fifth decades of life. The spine and skull are the most commonly involved, orbital involvement is extremely rare. We describe six patients with cranio-orbital IOH, the largest case series to date. Retrospective review of six patients with histologically confirmed primary IOH involving the orbit. Clinical characteristics, imaging features, approach to management, and histopathological findings are described. Five patients were male with a median age of 56. Pain and diplopia were the most common presenting features. A characteristic 'honeycomb' pattern on CT imaging was demonstrated in three of the cases. Complete surgical excision was performed in all cases with presurgical embolisation carried out in one case. In all the cases, histological studies identified cavernous vascular spaces within the bony tissue. These channels were lined by single layer of cytologically normal endothelial cells. IOCH of the cranio-orbital region is rare; in the absence of typical imaging features, the differential diagnosis includes chondroma, chondrosarcoma, bony metastasis, and lymphoma. Surgical excision may be necessary to exclude more sinister pathology. Intraoperative haemorrhage can be severe and may be reduced by preoperative embolisation.
Periodic orbits around areostationary points in the Martian gravity field
International Nuclear Information System (INIS)
Liu Xiaodong; Baoyin Hexi; Ma Xingrui
2012-01-01
This study investigates the problem of areostationary orbits around Mars in three-dimensional space. Areostationary orbits are expected to be used to establish a future telecommunication network for the exploration of Mars. However, no artificial satellites have been placed in these orbits thus far. The characteristics of the Martian gravity field are presented, and areostationary points and their linear stability are calculated. By taking linearized solutions in the planar case as the initial guesses and utilizing the Levenberg-Marquardt method, families of periodic orbits around areostationary points are shown to exist. Short-period orbits and long-period orbits are found around linearly stable areostationary points, but only short-period orbits are found around unstable areostationary points. Vertical periodic orbits around both linearly stable and unstable areostationary points are also examined. Satellites in these periodic orbits could depart from areostationary points by a few degrees in longitude, which would facilitate observation of the Martian topography. Based on the eigenvalues of the monodromy matrix, the evolution of the stability index of periodic orbits is determined. Finally, heteroclinic orbits connecting the two unstable areostationary points are found, providing the possibility for orbital transfer with minimal energy consumption.
Verifying black hole orbits with gravitational spectroscopy
International Nuclear Information System (INIS)
Drasco, Steve
2009-01-01
Gravitational waves from test masses bound to geodesic orbits of rotating black holes are simulated, using Teukolsky's black hole perturbation formalism, for about ten thousand generic orbital configurations. Each binary radiates power exclusively in modes with frequencies that are integer-linear combinations of the orbit's three fundamental frequencies. General spectral properties are found with a survey of orbits about a black hole taken to be rotating at 80% of the maximal spin. The orbital eccentricity is varied from 0.1 to 0.9. Inclination ranges from 20 deg. to 160 deg. and comes to within 20 deg. of polar. Semilatus rectum is varied from 1.2 to 3 times the value at the innermost stable circular orbits. The following general spectral properties are found: (i) 99% of the radiated power is typically carried by a few hundred modes, and at most by about a thousand modes, (ii) the dominant frequencies can be grouped into a small number of families defined by fixing two of the three integer frequency multipliers, and (iii) the specifics of these trends can be qualitatively inferred from the geometry of the orbit under consideration. Detections using triperiodic analytic templates modeled on these general properties would constitute a verification of radiation from an adiabatic sequence of black hole orbits and would recover the evolution of the fundamental orbital frequencies. In an analogy with ordinary spectroscopy, this would compare to observing the Bohr model's atomic hydrogen spectrum without being able to rule out alternative atomic theories or nuclei. The suitability of such a detection technique is demonstrated using snapshots computed at 12-hour intervals throughout the last three years before merger of a kludged inspiral. The system chosen is typical of those thought to occur in galactic nuclei and to be observable with space-based gravitational wave detectors like LISA. Because of circularization, the number of excited modes decreases as the binary
Van Meer, R.; Gritsenko, O. V.; Baerends, E. J.
2017-01-01
Straightforward interpretation of excitations is possible if they can be described as simple single orbital-to-orbital (or double, etc.) transitions. In linear response time-dependent density functional theory (LR-TDDFT), the (ground state) Kohn-Sham orbitals prove to be such an orbital basis. In
Environmental studies using earth orbital photography
Energy Technology Data Exchange (ETDEWEB)
Wobber, F J
1969-01-01
Orbital remote sensing, and particularly orbital photography, can provide immediately useful data for scientists familiar with applying aerial photographic techniques to environmental problems. Despite the expansion of analytical techniques in the earth sciences, the environmental data base has remained relatively static compared with increased information needs because of the difficulty of effective worldwide surveys and the high cost of timely data collection. Color, color infrared and black and white space photographs obtained incident to the Gemini and Apollo programs provide unique synoptic tools for analyzing modern environments and processes, and data that cannot be duplicated by aerial photographic mosaics. Principal advantages of orbital surveys include repetitious worldwide coverage promising environmental synthesis within the full spectrum of seasonal contrasts, and synoptic observations on a scale generally impossible from aircraft. The general categories of environmental data that can be extracted from orbital photography are summarized. 26 references, 37 figures, 3 tables.
Slow Orbit Feedback at the ALS Using Matlab
International Nuclear Information System (INIS)
Portmann, G.
1999-01-01
The third generation Advanced Light Source (ALS) produces extremely bright and finely focused photon beams using undulatory, wigglers, and bend magnets. In order to position the photon beams accurately, a slow global orbit feedback system has been developed. The dominant causes of orbit motion at the ALS are temperature variation and insertion device motion. This type of motion can be removed using slow global orbit feedback with a data rate of a few Hertz. The remaining orbit motion in the ALS is only 1-3 micron rms. Slow orbit feedback does not require high computational throughput. At the ALS, the global orbit feedback algorithm, based on the singular valued decomposition method, is coded in MATLAB and runs on a control room workstation. Using the MATLAB environment to develop, test, and run the storage ring control algorithms has proven to be a fast and efficient way to operate the ALS
Orbital Dynamics of Exomoons During Planet–Planet Scattering
Hong, Yu-Cian; Lunine, Jonathan I.; Nicholson, Philip; Raymond, Sean N.
2018-04-01
Planet–planet scattering is the leading mechanism to explain the broad eccentricity distribution of observed giant exoplanets. Here we study the orbital stability of primordial giant planet moons in this scenario. We use N-body simulations including realistic oblateness and evolving spin evolution for the giant planets. We find that the vast majority (~80%–90% across all our simulations) of orbital parameter space for moons is destabilized. There is a strong radial dependence, as moons past are systematically removed. Closer-in moons on Galilean-moon-like orbits (system, be captured by another planet, be ejected but still orbiting its free-floating host planet, or survive on heliocentric orbits as "planets." The survival rate of moons increases with the host planet mass but is independent of the planet's final (post-scattering) orbits. Based on our simulations, we predict the existence of an abundant galactic population of free-floating (former) moons.
Solar Radiation Pressure Binning for the Geosynchronous Orbit
Hejduk, M. D.; Ghrist, R. W.
2011-01-01
Orbital maintenance parameters for individual satellites or groups of satellites have traditionally been set by examining orbital parameters alone, such as through apogee and perigee height binning; this approach ignored the other factors that governed an individual satellite's susceptibility to non-conservative forces. In the atmospheric drag regime, this problem has been addressed by the introduction of the "energy dissipation rate," a quantity that represents the amount of energy being removed from the orbit; such an approach is able to consider both atmospheric density and satellite frontal area characteristics and thus serve as a mechanism for binning satellites of similar behavior. The geo-synchronous orbit (of broader definition than the geostationary orbit -- here taken to be from 1300 to 1800 minutes in orbital period) is not affected by drag; rather, its principal non-conservative force is that of solar radiation pressure -- the momentum imparted to the satellite by solar radiometric energy. While this perturbation is solved for as part of the orbit determination update, no binning or division scheme, analogous to the drag regime, has been developed for the geo-synchronous orbit. The present analysis has begun such an effort by examining the behavior of geosynchronous rocket bodies and non-stabilized payloads as a function of solar radiation pressure susceptibility. A preliminary examination of binning techniques used in the drag regime gives initial guidance regarding the criteria for useful bin divisions. Applying these criteria to the object type, solar radiation pressure, and resultant state vector accuracy for the analyzed dataset, a single division of "large" satellites into two bins for the purposes of setting related sensor tasking and orbit determination (OD) controls is suggested. When an accompanying analysis of high area-to-mass objects is complete, a full set of binning recommendations for the geosynchronous orbit will be available.
Orbital computed tomography for exophthalmos
International Nuclear Information System (INIS)
Kim, Ok Keun; Lee, Hyun; Sol, Chang Hyo; Kim, Byung Soo
1987-01-01
Since exophthalmos is caused by any decrease in the size of bony orbit or occurrence of mass within the rigid orbit, the accurate diagnosis of its causes are essential in determining the therapeutic aims. Exophthalmos is one of the important signs being the indication for orbital computed tomography along with periorbital swelling, visual loss, orbital trauma and diplopia. CT as the diagnostic tool for the cause of exophthalmos not only displays a superb role with uncomparable quality in comparison to any conventional diagnostic methods but also has a decisive role in determining the therapeutic aims and the appropriate operative method when the operation is indicated. The orbital CT was performed from May in 1983 to May in 1985 whose with chief complaints were exophthalmos and 23 cases were confirmed by operation, biopsy, clinical progression or other diagnostic procedures. Here was report thoroughly analyzed 23 cases. The results were as follows : 1. The etiologic disease of exophthalmos were 6 cases of pseudotumor, 4 cases of thyroid ophthalmopathy, 4 cases of maxill ary sinus and nasal cavity Ca., 3 cases of mucocele and 1 case of alveolar soft part sarcoma, osteoma, dermoid cyst, pleomorphic adenoma, meningioma, and C.C.F. each. 2. The origin of the etiologic diseases of exophthalmos were 13 cases of primary within bony orbit and 10 cases of secondary from adjacent structure. 3. The site of lesions were 11 cases of intraconal and extraconal, 10 cases of extraconal, and 2 cases of intraconal origin. 4. The degree of exophthalmos in CT scan was in proportion to the volume of the mass except in the case of thyroid ophthalmopathy. The upper limit of normal range by CT scan using regression line equation was 16.2 mm in approximation. 5. CT was a very useful diagnostic tool in the accurate assessment of the kinds of lesion, its location, and its relationship to adjacent structures in the diagnosis of etiologic diseases of exophthalmos
Orbital computed tomography for exophthalmos
Energy Technology Data Exchange (ETDEWEB)
Kim, Ok Keun; Lee, Hyun; Sol, Chang Hyo; Kim, Byung Soo [College of Medicine, Pusan National University, Busan (Korea, Republic of)
1987-06-15
Since exophthalmos is caused by any decrease in the size of bony orbit or occurrence of mass within the rigid orbit, the accurate diagnosis of its causes are essential in determining the therapeutic aims. Exophthalmos is one of the important signs being the indication for orbital computed tomography along with periorbital swelling, visual loss, orbital trauma and diplopia. CT as the diagnostic tool for the cause of exophthalmos not only displays a superb role with uncomparable quality in comparison to any conventional diagnostic methods but also has a decisive role in determining the therapeutic aims and the appropriate operative method when the operation is indicated. The orbital CT was performed from May in 1983 to May in 1985 whose with chief complaints were exophthalmos and 23 cases were confirmed by operation, biopsy, clinical progression or other diagnostic procedures. Here was report thoroughly analyzed 23 cases. The results were as follows : 1. The etiologic disease of exophthalmos were 6 cases of pseudotumor, 4 cases of thyroid ophthalmopathy, 4 cases of maxill ary sinus and nasal cavity Ca., 3 cases of mucocele and 1 case of alveolar soft part sarcoma, osteoma, dermoid cyst, pleomorphic adenoma, meningioma, and C.C.F. each. 2. The origin of the etiologic diseases of exophthalmos were 13 cases of primary within bony orbit and 10 cases of secondary from adjacent structure. 3. The site of lesions were 11 cases of intraconal and extraconal, 10 cases of extraconal, and 2 cases of intraconal origin. 4. The degree of exophthalmos in CT scan was in proportion to the volume of the mass except in the case of thyroid ophthalmopathy. The upper limit of normal range by CT scan using regression line equation was 16.2 mm in approximation. 5. CT was a very useful diagnostic tool in the accurate assessment of the kinds of lesion, its location, and its relationship to adjacent structures in the diagnosis of etiologic diseases of exophthalmos.
Frozen orbit realization using LQR analogy
Nagarajan, N.; Rayan, H. Reno
In the case of remote sensing orbits, the Frozen Orbit concept minimizes altitude variations over a given region using passive means. This is achieved by establishing the mean eccentricity vector at the orbital poles i.e., by fixing the mean argument of perigee at 90 deg with an appropriate eccentricity to balance the perturbations due to zonal harmonics J2 and J3 of the Earth's potential. Eccentricity vector is a vector whose magnitude is the eccentricity and direction is the argument of perigee. The launcher dispersions result in an eccentricity vector which is away from the frozen orbit values. The objective is then to formulate an orbit maneuver strategy to optimize the fuel required to achieve the frozen orbit in the presence of visibility and impulse constraints. It is shown that the motion of the eccentricity vector around the frozen perigee can be approximated as a circle. Combining the circular motion of the eccentricity vector around the frozen point and the maneuver equation, the following discrete equation is obtained. X(k+1) = AX(k) + Bu(k), where X is the state (i.e. eccentricity vector components), A the state transition matrix, u the scalar control force (i.e. dV in this case) and B the control matrix which transforms dV into eccentricity vector change. Based on this, it is shown that the problem of optimizing the fuel can be treated as a Linear Quadratic Regulator (LQR) problem in which the maneuver can be solved by using control system design tools like MATLAB by deriving an analogy LQR design.
Janches, D.; Close, S.; Hormaechea, J. L.; Swarnalingam, N.; Murphy, A.; O'Connor, D.; Vandepeer, B.; Fuller, B.; Fritts, D. C.; Brunini, C.
2015-01-01
We present an initial survey in the southern sky of the sporadic meteoroid orbital environment obtained with the Southern Argentina Agile MEteor Radar (SAAMER) Orbital System (OS), in which over three-quarters of a million orbits of dust particles were determined from 2012 January through 2015 April. SAAMER-OS is located at the southernmost tip of Argentina and is currently the only operational radar with orbit determination capability providing continuous observations of the southern hemisphere. Distributions of the observed meteoroid speed, radiant, and heliocentric orbital parameters are presented, as well as those corrected by the observational biases associated with the SAAMER-OS operating parameters. The results are compared with those reported by three previous surveys performed with the Harvard Radio Meteor Project, the Advanced Meteor Orbit Radar, and the Canadian Meteor Orbit Radar, and they are in agreement with these previous studies. Weighted distributions for meteoroids above the thresholds for meteor trail electron line density, meteoroid mass, and meteoroid kinetic energy are also considered. Finally, the minimum line density and kinetic energy weighting factors are found to be very suitable for meteoroid applications. The outcomes of this work show that, given SAAMERs location, the system is ideal for providing crucial data to continuously study the South Toroidal and South Apex sporadic meteoroid apparent sources.
A retrograde co-orbital asteroid of Jupiter.
Wiegert, Paul; Connors, Martin; Veillet, Christian
2017-03-29
Recent theoretical work in celestial mechanics has revealed that an asteroid may orbit stably in the same region as a planet, despite revolving around the Sun in the sense opposite to that of the planet itself. Asteroid 2015 BZ 509 was discovered in 2015, but with too much uncertainty in its measured orbit to establish whether it was such a retrograde co-orbital body. Here we report observations and analysis that demonstrates that asteroid 2015 BZ 509 is indeed a retrograde co-orbital asteroid of the planet Jupiter. We find that 2015 BZ 509 has long-term stability, having been in its current, resonant state for around a million years. This is long enough to preclude precise calculation of the time or mechanism of its injection to its present state, but it may be a Halley-family comet that entered the resonance through an interaction with Saturn. Retrograde co-orbital asteroids of Jupiter and other planets may be more common than previously expected.
Directory of Open Access Journals (Sweden)
Márcio Luiz Benevides
2006-08-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A cirurgia bariátrica tornou-se rotineira e muitas complicações têm sido relatadas. O objetivo deste relato foi apresentar um caso de síndrome compartimental glútea que evoluiu para insuficiência renal aguda após cirurgia bariátrica e discutir aspectos do diagnóstico e condutas profilática e terapêutica. RELATO DO CASO: Paciente do sexo masculino, 42 anos, branco, índice de massa corporal (IMC 43, estado físico ASA II, submetido à cirurgia bariátrica tipo duodenal switch, sob anestesia geral associada à anestesia peridural. O procedimento transcorreu sem intercorrências. O tempo anestésico-cirúrgico foi de 3 horas e 30 minutos. No primeiro dia do pós-operatório o paciente apresentou dor na região lombossacral e nas nádegas, além de parestesia nos membros inferiores na distribuição do nervo isquiático. Durante o exame, as nádegas apresentavam discreta palidez, tensas, edemaciadas, dolorosas à palpação e à movimentação. Foi diagnosticada síndrome compartimental glútea que evoluiu com rabdomiólise e insuficiência renal aguda. Houve recuperação da função renal e nenhuma seqüela motora ou sensitiva foi detectada. CONCLUSÕES: Os pacientes obesos mórbidos submetidos à cirurgia bariátrica podem apresentar síndrome compartimental glútea. Quando não diagnosticada e tratada precocemente, podem evoluir com rabdomiólise e insuficiência renal aguda que representam grave ameaça à vida.JUSTIFICATIVA Y OBJETIVOS: La cirugía bariátrica se convirtió en rutina y en algo muy complicado para ser relatada. El objetivo de este relato fue el de presentar un caso de síndrome compartimental glútea que evolucionó para la insuficiencia renal aguda después de la cirugía bariátrica y discutir aspectos del diagnóstico y conductas profiláctica y terapéutica. RELATO DEL CASO: Paciente del sexo masculino, 42 años, blanco, índice de masa corporal (IMC 43, estado físico ASA II, sometido
International Nuclear Information System (INIS)
Fujisawa, Takashi; Hattori, Toshiyuki
2006-01-01
One of the present inventions provides a spiral orbit charged particle accelerator in which the magnetic field increases as the radius increases more rapidly than an isochronous magnetic field distribution, and the distribution of fixed-frequency accelerating RF voltage is formed so that a harmonic number changes in integer for every particle revolution. The other invention realizes to make the closed orbit charged particle accelerator having a fixed frequency amplitude modulator that is able to modulate amplitude of the RF voltage so that a harmonic number decreases in integer in an every particle revolution. (author)
Reducing orbital eccentricity in binary black hole simulations
International Nuclear Information System (INIS)
Pfeiffer, Harald P; Brown, Duncan A; Kidder, Lawrence E; Lindblom, Lee; Lovelace, Geoffrey; Scheel, Mark A
2007-01-01
Binary black hole simulations starting from quasi-circular (i.e., zero radial velocity) initial data have orbits with small but nonzero orbital eccentricities. In this paper, the quasi-equilibrium initial-data method is extended to allow nonzero radial velocities to be specified in binary black hole initial data. New low-eccentricity initial data are obtained by adjusting the orbital frequency and radial velocities to minimize the orbital eccentricity, and the resulting (∼5 orbit) evolutions are compared with those of quasi-circular initial data. Evolutions of the quasi-circular data clearly show eccentric orbits, with eccentricity that decays over time. The precise decay rate depends on the definition of eccentricity; if defined in terms of variations in the orbital frequency, the decay rate agrees well with the prediction of Peters (1964 Phys. Rev. 136 1224-32). The gravitational waveforms, which contain ∼8 cycles in the dominant l = m = 2 mode, are largely unaffected by the eccentricity of the quasi-circular initial data. The overlap between the dominant mode in the quasi-circular evolution and the same mode in the low-eccentricity evolution is about 0.99
Displaced Electric Sail Orbits Design and Transition Trajectory Optimization
Directory of Open Access Journals (Sweden)
Naiming Qi
2014-01-01
Full Text Available Displaced orbits for spacecraft propelled by electric sails are investigated as an alternative to the use of solar sails. The orbital dynamics of electric sails based spacecraft are studied within a spherical coordinate system, which permits finding the solutions of displaced electric sail orbits and optimize transfer trajectory. Transfer trajectories from Earth's orbit to displaced orbit are also studied in an optimal framework, by using genetic algorithm and Gauss pseudospectral method. The initial guesses for the state and control histories used in the Gauss pseudospectral method are interpolated from the best solution of a genetic algorithm. Numerical simulations show that the electric sail is able to perform the transfer from Earth’s orbit to displaced orbit in acceptable time, and the hybrid optimization method has the capability to search the feasible and optimal solution without any initial value guess.
Orbital fractures due to domestic violence: an epidemiologic study.
Goldberg, Stuart H.; McRill, Connie M.; Bruno, Christopher R.; Ten Have, Tom; Lehman, Erik
2000-09-01
Domestic violence is an important cause of orbital fractures in women. Physicians who treat patients with orbital fractures may not suspect this mechanism of injury. The purpose of this study was to assess the association between domestic violence and orbital fractures. A medical center-based case-control study with matching on age and site of admission was done. Medical center databases were searched using ICD-9 codes to identify all cases of orbital fractures encountered during a three-year period. Medical records of female patients age 13 and older were reviewed along with those of age, gender and site of admission matched controls. A stratified exact test was employed to test the association between domestic violence and orbital fracture. Among 41 adult female cases with orbital fractures treated at our medical center, three (7.3%) reported domestic violence compared to zero among the matched controls (p = 0.037). We believe that domestic violence may be under-reported in both orbital fracture cases and controls. This may result in an underestimate of the orbital fracture versus domestic violence association. Domestic violence is a serious women's health and societal problem. Domestic violence may have a variety of presentations, including illnesses and injuries. Orbital fracture is an identifiable manifestation of domestic violence. Domestic violence is more likely to be detected in adult female hospital patients with orbital fracture than in matched controls with any other diagnosis. Physicians who treat patients with orbital fractures should be familiar with this mechanism of injury.
Carcinoma da glândula supra-renal Adrenal gland carcinoma
Directory of Open Access Journals (Sweden)
Alexandre Coutinho Teixeira de Freitas
2007-09-01
Full Text Available RACIONAL: A neoplasia da glândula supra-renal pode ser oriunda de diversos tipos histológicos. O carcinoma é raro, correspondendo à 0,02% de todas as neoplasias. OBJETIVOS: Revisar os últimos avanços relacionados ao diagnóstico e ao tratamento do carcinoma da glândula supra-renal. MÉTODOS:Foi realizada revisão da literatura no Medline, livros texto de autores consagrados e referências obtidas de artigos considerados de maior relevância. CONCLUSÕES: Aproximadamente 79% dos carcinomas supra-renais são funcionantes. O hormônio mais comumente secretado é o cortisol causando síndrome de Cushing. Portadores de lesões não-funcionantes podem apresentar queixas relacionadas com o crescimento local da lesão. Ele está presente em uma série de síndromes neoplásicas de origem familiar. Ainda não está definido se o carcinoma esporádico tem origem em lesões benignas. De acordo com os sintomas, a investigação diagnóstica inicial envolve dosagens de cortisol urinário e nível sérico de aldosterona e renina. A tomografia abdominal ou a ressonância magnética são os exames de imagem de primeira linha. O PET scan com fluorodeoxiglicose apresenta potencial para diferenciação entre lesão benigna e maligna. A biópsia com agulha fina não está indicada devido à sua alta taxa de complicações. O tratamento de eleição é o cirúrgico com ressecção em bloco de órgãos adjacentes se necessário. Linfadenectomia aórtica e retroperitoneal deve ser realizada. Recorrência local ou metástases ocorrem em 80% dos casos. Procedimentos cirúrgicos citoredutores beneficiam os casos de doença avançada. Na presença de metástases, nos submetidos à cirurgia citoredutora e nos com recorrência local à quimioterapia com mitotano está indicada. Radioterapia é o tratamento de escolha no caso de metástases ósseas e tratamento adjuvante em alguns casos de risco elevado para recorrência. Em adultos a sobrevida média geral em 5 anos
Directory of Open Access Journals (Sweden)
Young-Joo Song
2016-12-01
Full Text Available In this study, the uncertainty requirements for orbit, attitude, and burn performance were estimated and analyzed for the execution of the 1st lunar orbit insertion (LOI maneuver of the Korea Pathfinder Lunar Orbiter (KPLO mission. During the early design phase of the system, associate analysis is an essential design factor as the 1st LOI maneuver is the largest burn that utilizes the onboard propulsion system; the success of the lunar capture is directly affected by the performance achieved. For the analysis, the spacecraft is assumed to have already approached the periselene with a hyperbolic arrival trajectory around the moon. In addition, diverse arrival conditions and mission constraints were considered, such as varying periselene approach velocity, altitude, and orbital period of the capture orbit after execution of the 1st LOI maneuver. The current analysis assumed an impulsive LOI maneuver, and two-body equations of motion were adapted to simplify the problem for a preliminary analysis. Monte Carlo simulations were performed for the statistical analysis to analyze diverse uncertainties that might arise at the moment when the maneuver is executed. As a result, three major requirements were analyzed and estimated for the early design phase. First, the minimum requirements were estimated for the burn performance to be captured around the moon. Second, the requirements for orbit, attitude, and maneuver burn performances were simultaneously estimated and analyzed to maintain the 1st elliptical orbit achieved around the moon within the specified orbital period. Finally, the dispersion requirements on the B-plane aiming at target points to meet the target insertion goal were analyzed and can be utilized as reference target guidelines for a mid-course correction (MCC maneuver during the transfer. More detailed system requirements for the KPLO mission, particularly for the spacecraft bus itself and for the flight dynamics subsystem at the ground
Angular dependence of spin-orbit spin-transfer torques
Lee, Ki-Seung
2015-04-06
In ferromagnet/heavy-metal bilayers, an in-plane current gives rise to spin-orbit spin-transfer torque, which is usually decomposed into fieldlike and dampinglike torques. For two-dimensional free-electron and tight-binding models with Rashba spin-orbit coupling, the fieldlike torque acquires nontrivial dependence on the magnetization direction when the Rashba spin-orbit coupling becomes comparable to the exchange interaction. This nontrivial angular dependence of the fieldlike torque is related to the Fermi surface distortion, determined by the ratio of the Rashba spin-orbit coupling to the exchange interaction. On the other hand, the dampinglike torque acquires nontrivial angular dependence when the Rashba spin-orbit coupling is comparable to or stronger than the exchange interaction. It is related to the combined effects of the Fermi surface distortion and the Fermi sea contribution. The angular dependence is consistent with experimental observations and can be important to understand magnetization dynamics induced by spin-orbit spin-transfer torques.
Angular dependence of spin-orbit spin-transfer torques
Lee, Ki-Seung; Go, Dongwook; Manchon, Aurelien; Haney, Paul M.; Stiles, M. D.; Lee, Hyun-Woo; Lee, Kyung-Jin
2015-01-01
In ferromagnet/heavy-metal bilayers, an in-plane current gives rise to spin-orbit spin-transfer torque, which is usually decomposed into fieldlike and dampinglike torques. For two-dimensional free-electron and tight-binding models with Rashba spin-orbit coupling, the fieldlike torque acquires nontrivial dependence on the magnetization direction when the Rashba spin-orbit coupling becomes comparable to the exchange interaction. This nontrivial angular dependence of the fieldlike torque is related to the Fermi surface distortion, determined by the ratio of the Rashba spin-orbit coupling to the exchange interaction. On the other hand, the dampinglike torque acquires nontrivial angular dependence when the Rashba spin-orbit coupling is comparable to or stronger than the exchange interaction. It is related to the combined effects of the Fermi surface distortion and the Fermi sea contribution. The angular dependence is consistent with experimental observations and can be important to understand magnetization dynamics induced by spin-orbit spin-transfer torques.
International Nuclear Information System (INIS)
Dinev, D.
1999-01-01
A new computer program ORBIT-3.0 for simulation and correction of the closed orbit and first turn in synchrotrons is described. The program works under WINDOWS 95/98/NT and is a full object of oriented applications. It has an interactive interface, enhanced graphical capabilities and on-line printing. The original algorithms DINAM - for closed orbit correction and FTURN - for first turn steering are described as well
Satellite orbits in Levi-Civita space
Humi, Mayer
2018-03-01
In this paper we consider satellite orbits in central force field with quadratic drag using two formalisms. The first using polar coordinates in which the satellite angular momentum plays a dominant role. The second is in Levi-Civita coordinates in which the energy plays a central role. We then merge these two formalisms by introducing polar coordinates in Levi-Civita space and derive a new equation for satellite orbits which unifies these two paradigms. In this equation energy and angular momentum appear on equal footing and thus characterize the orbit by its two invariants. Using this formalism we show that equatorial orbits around oblate spheroids can be expressed analytically in terms of Elliptic functions. In the second part of the paper we derive in Levi-Civita coordinates a linearized equation for the relative motion of two spacecrafts whose trajectories are in the same plane. We carry out also a numerical verification of these equations.