WorldWideScience

Sample records for max main electronics

  1. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Science.gov (United States)

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  2. Activity of flavonoids through λ sub max and electron cross-section

    International Nuclear Information System (INIS)

    Murthy, V.R.; Sreenivasulu, M.

    1997-01-01

    Flavonoids are widespread groups of natural constituents and present in the drugs in the form of mono or diglycosides. Being physiologically active, flavonoids are important in the field of pharmacological and clinical applications. Not many physical properties of flavonoids have been studied so far excepting UV and NMR studies. This paper deals with the evaluation of electron ionization cross section through λ sub max, a parameter available from UV studies. Electron ionization cross section was primarily conceived to be of use in radiation chemical data, mass spectroscopic and thermodynamic studies. But later attempts to correlate electron ionization cross-section with structural and related parameters prompted the authors to derive an explicit expression relating λ sub max and electron ionization cross-section (Q). The application of this method to correlate Q through λ sub max and interpret the results in terms of chemical activity are discussed

  3. Undulator physics and coherent harmonic generation at the MAX-lab electron storage ring

    International Nuclear Information System (INIS)

    Werin, Sverker.

    1991-01-01

    This work presents the undulator and harmonic generation project at the electron storage ring MAX-lab at University of Lund. The theory of undulator radiation, laser coherent harmonic generation, optical klystron amplifiers and FELs is treated in one uniform way, with complete solutions of the necessary equations. The permanent magnet undulator is described in some detail, along with the installation of the undulator in the storage ring. Details regarding the emitted radiation, the electron beam path in the undulator and other results are analysed. Finally harmonic generation using a Nd:YAG laser and the creation of coherent photons at the third harmonic (355 nm) is described. (author)

  4. Electron-Cloud Build-up in the FNAL Main Injector

    International Nuclear Information System (INIS)

    Furman, M.A.

    2007-01-01

    We present a summary on ongoing simulation results for the electron-cloud buildup in the context of the proposed FNAL Main Injector (MI) intensity upgrade [1] in a fieldfree region at the location of the RFA electron detector [2]. By combining our simulated results for the electron flux at the vacuum chamber wall with the corresponding measurements obtained with the RFA we infer that the peak secondary electron yield (SEY) (delta) max is ∼> 1.4, and the average electron density is n e ∼> 10 10 m -3 at transition energy for the specific fill pattern and beam intensities defined below. The sensitivity of our results to several variables remains to be explored in order to reach more definitive results. Effects from the electron cloud on the beam are being investigated separately [3

  5. Electron Cloud Measurements in Fermilab Main Injector and Recycler

    Energy Technology Data Exchange (ETDEWEB)

    Eldred, Jeffrey Scott [Indiana U.; Backfish, M. [Fermilab; Tan, C. Y. [Fermilab; Zwaska, R. [Fermilab

    2015-06-01

    This conference paper presents a series of electron cloud measurements in the Fermilab Main Injector and Recycler. A new instability was observed in the Recycler in July 2014 that generates a fast transverse excitation in the first high intensity batch to be injected. Microwave measurements of electron cloud in the Recycler show a corresponding depen- dence on the batch injection pattern. These electron cloud measurements are compared to those made with a retard- ing field analyzer (RFA) installed in a field-free region of the Recycler in November. RFAs are also used in the Main Injector to evaluate the performance of beampipe coatings for the mitigation of electron cloud. Contamination from an unexpected vacuum leak revealed a potential vulnerability in the amorphous carbon beampipe coating. The diamond-like carbon coating, in contrast, reduced the electron cloud signal to 1% of that measured in uncoated stainless steel beampipe.

  6. Main Issues on Electronic Commerce and Policy Recommendations

    OpenAIRE

    Chongwha Lee; Seongbong Lee

    1998-01-01

    "Electronic Commerce" means that people sell and buy commodity, labor service and information through internet and now is mainly be used in commercial intercourse. The core of the international research related to Electronic Commerce is a tax-exemption, land tax, liberalization of encrypted technology and privacy protection policy, etc. Meanwhile, intellectual property, consumer protection and limitation of packing specification are also researched together with the business activeness. The r...

  7. Tests of the Monte Carlo simulation of the photon-tagger focal-plane electronics at the MAX IV Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Preston, M.F. [Lund University, SE-221 00 Lund (Sweden); Myers, L.S. [Duke University, Durham, NC 27708 (United States); Annand, J.R.M. [University of Glasgow, Glasgow G12 8QQ, Scotland (United Kingdom); Fissum, K.G., E-mail: kevin.fissum@nuclear.lu.se [Lund University, SE-221 00 Lund (Sweden); Hansen, K.; Isaksson, L. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Jebali, R. [Arktis Radiation Detectors Limited, 8045 Zürich (Switzerland); Lundin, M. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden)

    2014-04-21

    Rate-dependent effects in the electronics used to instrument the tagger focal plane at the MAX IV Laboratory were recently investigated using the novel approach of Monte Carlo simulation to allow for normalization of high-rate experimental data acquired with single-hit time-to-digital converters (TDCs). The instrumentation of the tagger focal plane has now been expanded to include multi-hit TDCs. The agreement between results obtained from data taken using single-hit and multi-hit TDCs demonstrate a thorough understanding of the behavior of the detector system.

  8. Tests of the Monte Carlo simulation of the photon-tagger focal-plane electronics at the MAX IV Laboratory

    International Nuclear Information System (INIS)

    Preston, M.F.; Myers, L.S.; Annand, J.R.M.; Fissum, K.G.; Hansen, K.; Isaksson, L.; Jebali, R.; Lundin, M.

    2014-01-01

    Rate-dependent effects in the electronics used to instrument the tagger focal plane at the MAX IV Laboratory were recently investigated using the novel approach of Monte Carlo simulation to allow for normalization of high-rate experimental data acquired with single-hit time-to-digital converters (TDCs). The instrumentation of the tagger focal plane has now been expanded to include multi-hit TDCs. The agreement between results obtained from data taken using single-hit and multi-hit TDCs demonstrate a thorough understanding of the behavior of the detector system

  9. Main Issues on Electronic Commerce and Policy Recommendations

    Directory of Open Access Journals (Sweden)

    Chongwha Lee

    1998-03-01

    Full Text Available "Electronic Commerce" means that people sell and buy commodity, labor service and information through internet and now is mainly be used in commercial intercourse. The core of the international research related to Electronic Commerce is a tax-exemption, land tax, liberalization of encrypted technology and privacy protection policy, etc. Meanwhile, intellectual property, consumer protection and limitation of packing specification are also researched together with the business activeness. The reason why questions related to Electronic Commerce are in the back of the spotlight is that US and major countries in EU lead the international research to maximize their own benefits. These researches are related to rectify legal system framework for protecting development of Electronic Commerce and to work out international standards. Also, enlarging Electronic Commerce on online resources is also regarded as the core issue by OECD, APEC and other international organization and it is inevitable to have multilateral negotiation regarding this issue. Based on the opinion above mentioned, we collect all the problems brought by Electronic Commerce Activeness in each area in this paper and try to find out corresponding solutions to face these problems.

  10. New Electron Cloud Detectors for the PS Main Magnets

    CERN Document Server

    Yin Vallgren, Ch; Gilardoni, S; Taborelli, M; Neupert, H; Ferreira Somoza, J

    2014-01-01

    Electron cloud (EC) has already been observed during normal operation of the PS, therefore it is necessary to study its in fluence on any beam instability for the future LHC Injector Upgrade (LIU). Two new electron cloud detectors have been discussed, developed and installed during the Long Shutdown (LS1) in one of the PS main magnets. The first measurement method is based on current measurement by using a shielded button-type pick-up. Due to the geometry and space limitation in the PS magnet, the button-type pick-up made of a 96%Al2O3 block coated with a thin layer of solvent-based Ag painting, placed 30 degrees to the bottom part of the vacuum chamber was installed in the horizontal direction where the only opening of the magnet coil is. The other newly developed measurement method is based on detection of photons emitted by the electrons from the electron cloud impinging on the vacuum chamber walls. The emitted photons are reected to a quartz window. A MCP-PMT (Micro-Channel Plate Photomultiplier Tube) wit...

  11. Electronic tongue system to evaluate flavor of soybean (Glycine Max (L. Merrill genotypes

    Directory of Open Access Journals (Sweden)

    Sandra Maria Zoldan

    2014-10-01

    Full Text Available An electronic tongue system was tested as a fast and efficient analytical tool for flavor evaluation of soybean genotypes. Grain samples of 25 soybean lines were analyzed using 0.25 g of milled samples added to 100 mL of distilled water and mixing for one minute on a magnetic stirrer. An aliquot (50 mL from the filtered liquid was used for the analysis on a pre-fixed frequency of 1 kHz and alternate tension of 50 mV. Two analyses were conducted in a complete randomized design with three replicates. Electrical response (capacitance of eight polymeric chemical sensors used to analyze the soybean lines were submitted to Principal Component Analysis (PCA. In the spatial distribution of the PCA graphic, the lines close to each other were similar, while the distant ones showed different characteristics. The electronic tongue system was efficient in discriminating flavor of soybean lines.

  12. Origin of the main deep electron trap in electron irradiated InP

    International Nuclear Information System (INIS)

    Sibille, A.

    1986-01-01

    The electrical activity and annealing behavior of the main electron trap in electron irradiated InP p + n junctions has been investigated. A very marked depth dependence of the annealing rate has been found. Moreover, this center apparently acts as if it were a deep donor, leading to an increase of carrier concentration on the n side. All these results are coherently interpreted with a model in terms of radiation defect D(P) (phosphorus interstitial or vacancy), residual shallow acceptor complexing, the final annealing resulting from a dissociation of the complex followed by a diffusion and either recapture or annihilation of D(P)

  13. Structural, elastic, and electronic properties of new 211 MAX phase Nb{sub 2}GeC from first-principles calculations

    Energy Technology Data Exchange (ETDEWEB)

    Shein, I.R. [Institute of Solid State Chemistry, Ural Branch of the Russian Academy of Sciences, Ekaterinburg 620990 (Russian Federation); Ivanovskii, A.L., E-mail: ivanovskii@ihim.uran.ru [Institute of Solid State Chemistry, Ural Branch of the Russian Academy of Sciences, Ekaterinburg 620990 (Russian Federation)

    2013-02-01

    Very recently (2012, Phys. Rev Lett., 109, 035502) a new hexagonal (s.g. P63/mmc, Music-Sharp-Sign 194) ternary phase Nb{sub 2}GeC, which belongs to so-called 211-like MAX phases, was discovered. In order to get a systematic insight into the structural, elastic, and electronic properties of Nb{sub 2}GeC, we used two complementary DFT-based first-principles approaches (as implemented in the VASP and Wien2k packages) to calculate the optimized structural parameters, band structure, densities of state, Fermi surface, and a set of elastic parameters: elastic constants (C{sub ij}), bulk modulus (B), compressibility ({beta}), shear modulus (G), Young's modulus (Y), and elastic anisotropy indexes, which were discussed in comparison with available data. Besides, the inter-atomic bonding picture for Nb{sub 2}GeC was discussed using electron density maps and Bader's charge analysis.

  14. Accurate simulation of the electron cloud in the Fermilab Main Injector with VORPAL

    Energy Technology Data Exchange (ETDEWEB)

    Lebrun, Paul L.G.; Spentzouris, Panagiotis; /Fermilab; Cary, John R.; Stoltz, Peter; Veitzer, Seth A.; /Tech-X, Boulder

    2010-05-01

    Precision simulations of the electron cloud at the Fermilab Main Injector have been studied using the plasma simulation code VORPAL. Fully 3D and self consistent solutions that includes E.M. field maps generated by the cloud and the proton bunches have been obtained, as well detailed distributions of the electron's 6D phase space. We plan to include such maps in the ongoing simulation of the space charge effects in the Main Injector. Simulations of the response of beam position monitors, retarding field analyzers and microwave transmission experiments are ongoing.

  15. Remembering Max Boisot

    DEFF Research Database (Denmark)

    Sanchez, Ron

    2013-01-01

    This chapter offers some reflections on Max Boisot and his extraordinary intellect drawn from our 15 years of exchanging and crafting ideas together. I first comment on the process of working with Max, and then suggest some of the remarkable qualities of thought that I believe distinguished Max's...... these qualities of thought are also reflected in Max's individual work and especially in his crowning achievement, the Information-Space Model....

  16. Simulations of Electron Cloud Effects on the Beam Dynamics for the FNAL Main Injector Upgrade

    International Nuclear Information System (INIS)

    Sonnad Kiran G.; Furman, Miguel; Vay, Jean-Luc; Venturini, Marco; Celata, Christine M.; Grote, David

    2006-01-01

    The Fermilab main injector (MI) is being considered for an upgrade as part of the high intensity neutrino source (HINS) effort. This upgrade will involve a significant increasing of the bunch intensity relative to its present value. Such an increase will place the MI in a regime in which electron-cloud effects are expected to become important. We have used the electrostatic particle-in-cell code WARP, recently augmented with new modeling capabilities and simulation techniques, to study the dynamics of beam-electron cloud interaction. This work in progress involves a systematic assessment of beam instabilities due to the presence of electron clouds

  17. Computation of electron cloud diagnostics and mitigation in the main injector

    International Nuclear Information System (INIS)

    Veitzer, S A; Cary, J R; Stoltz, P H; LeBrun, P; Spentzouris, P; Amundson, J F

    2009-01-01

    High-performance computations on Blue Gene/P at Argonne's Leadership Computing Facility have been used to determine phase shifts induced in injected RF diagnostics as a function of electron cloud density in the Main Injector. Inversion of the relationship between electron cloud parameters and induced phase shifts allows us to predict electron cloud density and evolution over many bunch periods. Long time-scale simulations using Blue Gene have allowed us to measure cloud evolution patterns under the influence of beam propagation with realistic physical parameterizations, such as elliptical beam pipe geometry, self-consistent electromagnetic fields, space charge, secondary electron emission, and the application of arbitrary external magnetic fields. Simultaneously, we are able to simulate the use of injected microwave diagnostic signals to measure electron cloud density, and the effectiveness of various mitigation techniques such as surface coating and the application of confining magnetic fields. These simulations provide a baseline for both RF electron cloud diagnostic design and accelerator fabrication in order to measure electron clouds and mitigate the adverse effects of such clouds on beam propagation.

  18. THE MAIN PROBLEMS OF THE STUDENTS’ ELECTRONIC PORTFOLIO FORMATION IN TERMS OF THE HIGHER EDUCATIONAL PROGRAMS

    Directory of Open Access Journals (Sweden)

    Yulia V. Dementieva

    2016-01-01

    Full Text Available The aim of the study is the description of the main problems of formation of the student’s electronic portfolio in the conditions of realization of Federal State Educational Standards of the Higher Education (FSES of HE.Methods.Theoretical analysis of scientific literature concerning the subject under discussion; monitoring of existing practices in modern Russian Universities procedures for the formation and maintenance of students electronic portfolio.Results. The author describes the main problems of the electronic students’ portfolio formation; some ways of solving described problems are offered.Scientific novelty concludes in the formation of key ideas of the electronic students’ portfolio based on the understanding of requirements of Federal State Educational Standards of Higher Education for the results of mastering educational programs. They are the formation of general cultural, general professional and professional competences.Practical significance. The researching results will become the theoretical basis for the systematic organization of the process of creating and maintaining an electronic students’ portfolio during the whole period of their studying at the university; the researching results can become a basis for methodological developments.

  19. Main error sources in sorbtion technique and plasma electron component parameter definition by continuous X radiation

    International Nuclear Information System (INIS)

    Gavrilov, V.V.; Torokhova, N.V.; Fasakhov, I.K.

    1986-01-01

    Recombination radiation effect on the relation of signals behind the filters depending on the plasma temperature(sorption method for T determination) is demonstrated. This factor produces the main effect on the method accuracy (100-400%), the other factors analysed in combination make an error in temperature at the level of 50%. Method of plasma electron distribution function reconstruction by continuous x-radiation spectrum, based on the correctness (under certain limitations for the required function) of the equation, linking the electron distribution function with bremmsstrahlung spectral density is presented

  20. Progress on electron cloud effects calculations for the FNAL main injector

    International Nuclear Information System (INIS)

    Furman, Miguel A; Sonnad, Kiran G.; Furman, Miguel A.; Vay, Jean-Luc

    2008-01-01

    We have studied the response of the beam to an electron cloud for the Fermilab Main Injector using the Quasistatic Model [1] implemented into the particle-in-cell code Warp [2]. Specifically, we have addressed the effects due to varying the beam intensity, electron cloud density and chromaticity. In addition, we have estimated the contribution to emittance evolution due to beam space-charge effects. We have carried out a comparison between how the beam responds at injection energy and at top energy. We also present some results on the validation of the computational model, and report on progress towards improving the computational model

  1. Shared responsibility for managing electronic waste: A case study of Maine, USA

    International Nuclear Information System (INIS)

    Wagner, Travis P.

    2009-01-01

    Based on high disposal and low recycling rates of electronic waste (e-waste) and continued exportation to developing countries, reliance on municipal responsibility for e-waste management has been unsuccessful in the United States. This case study examines Maine's program, which was the first US state to mandate producer responsibility for recycling household e-waste. Maine's program established a shared cost responsibility among producers, municipalities, and consumers. The study found that Maine's program resulted in a significant reduction in disposal and a corresponding increase in environmentally sound recycling. In the first 3 years of the program, 6.406 million kg of household e-waste was collected and recycled for a population of 1.32 million. The new program, implemented in 2006, increased the number of e-waste items collected and recycled by 108% in the first year, 170% in the second year, and 221% in the third year. The program decreased direct economic costs to municipalities and households because of the shared cost approach and for the first time established costs for producers. There was no empirical evidence indicating that producers have or will improve the recyclability of electronic products to reduce recycling costs. While other weaknesses were that found potentially limit the adoption of Maine's program, its positive aspects warrant consideration by other governments.

  2. Origin and behavior of main electron traps in Si-implanted GaAs

    International Nuclear Information System (INIS)

    Fang, Z.Q.; Yamamoto, H.; Look, D.C.

    1990-01-01

    The electron traps in Si-implanted active layers (n ∼ 10 17 cm -3 ) have been studied by capacitance and conductance DLTS techniques in conjunction with different anneal conditions, which include rapid thermal anneals at different temperatures and furnace anneals with Si 3 N 4 cap or capless in an AsH 3 atmosphere. As compared to the electron traps in as-grown bulk n-GaAs (n ∼ 4 x 10 16 cm -3 ), nearly the same electron traps, i.e. EL2, EL3, EL4, EL5, EL6, and EL9 can be observed in the Si-implanted layers. Through a comparison with the annealing behavior of the main electron traps in bulk n-GaAs, the processing associated origins of some of the traps (EL2, EL3, EL4, EL5 and EL9) observed in Si-implanted GaAs layers have been determined. For some Si-implanted capped with Si 3 N 4 and furnace annealed, traps EL3 and EL4 dominate the trap EL2. In such layers it is found that emission due to EL3 is reduced while emission from EL12 is augmented by increasing the filling pulse width from 10 μs to 5 x 10 3 μs. In this paper phenomenon is explained in terms of a defect reaction enhanced by electron capture, showing a metastability or bistability

  3. Light-Enhanced Antibacterial Activity of Graphene Oxide, Mainly via Accelerated Electron Transfer.

    Science.gov (United States)

    Chong, Yu; Ge, Cuicui; Fang, Ge; Wu, Renfei; Zhang, He; Chai, Zhifang; Chen, Chunying; Yin, Jun-Jie

    2017-09-05

    Before graphene derivatives can be exploited as next-generation antimicrobials, we must understand their behavior under environmental conditions. Here, we demonstrate how exposure to simulated sunlight significantly enhances the antibacterial activity of graphene oxide (GO) and reveal the underlying mechanism. Our measurements of reactive oxygen species (ROS) showed that only singlet oxygen ( 1 O 2 ) is generated by GO exposed to simulated sunlight, which contributes only slightly to the oxidation of antioxidant biomolecules. Unexpectedly, we find the main cause of oxidation is light-induced electron-hole pairs generated on the surface of GO. These light-induced electrons promote the reduction of GO, introducing additional carbon-centered free radicals that may also enhance the antibacterial activities of GO. We conclude that GO-mediated oxidative stress mainly is ROS-independent; simulated sunlight accelerates the transfer of electrons from antioxidant biomolecules to GO, thereby destroying bacterial antioxidant systems and causing the reduction of GO. Our insights will help support the development of graphene for antibacterial applications.

  4. Physical reason for quantum behaviour of the electron and stability of the main state of the hydrogen atom

    International Nuclear Information System (INIS)

    Rangelov, J.M.

    1986-01-01

    An electron model is proposed explaining the physical reasons for its nonrelativistic quantum-mechanical behaviour, the origin of its own mechanical and magnetic momentum and field energy. As an example the main electron state in hydrogen atom is obtained

  5. Design of a pulsed angular selective electron gun for the KATRIN main spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Winzen, Daniel; Hannen, Volker; Ortjohann, Hans-Werner; Zacher, Michael; Weinheimer, Christian [Institut fuer Kernphysik, Westfaelische Wilhelms-Universitaet, Muenster (Germany); Collaboration: KATRIN-Collaboration

    2012-07-01

    The KATRIN (KArlsruhe TRItium Neutrino mass) experiment will study the tritium {beta}-spectrum near the endpoint of 18.6 keV, aiming to measure the mass of the electron antineutrino. Using an electrostatic retarding spectrometer (MAC-E-Filter), the projected sensitivity for m{sub ve} is 200 meV/c{sup 2} at 90% C.L. In order to map out the electric and magnetic fields in the main spectrometer, an angular selective electron gun is currently being developed. The e-gun uses an UV-Laser to produce electrons via the photo-electric effect from a copper substrate which are then accelerated electrostatically. It features a small energy spread of approx. 0.1 eV, a sharp emission angle and will be able to cover the whole magnetic flux tube of KATRIN. Using a pulsed laser it is also possible to investigate the time of flight (TOF) of electrons through the spectrometer, offering enhanced sensitivity to spectrometer properties far away from the analysing plane. By comparing information from transmission function measurements and TOF data with Monte Carlo simulations of the setup, one will be able to achieve a detailed understanding of the spectrometer properties.

  6. An analysis of main factors in electron beam flue gas purification

    International Nuclear Information System (INIS)

    Zhang Ming; Xu Guang

    2003-01-01

    Electron beam flue gas purification method is developing very quickly in recent years. Based on the experiment setting for electron beam flue gas purification in Institute of Nuclear Energy and Technology, Tsinghua University, how the technique factors affect the ratio of desulphurization and denitrogenation are described. Radiation dose (D), temperature (T), humidity (H), pour ammonia quantity (α) and initial concentration of SO 2 (C SO 2 ) and NO x (C NO x ) are main factors influencing flue gas purification. Using the methods of correlation analysis and regression analysis, the primary effect factors are found out and the regression equations are set to optimize the system process, predigest the system structure and to forecast the experimental results. (authors)

  7. Mini MAX - Medicaid Sample

    Data.gov (United States)

    U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...

  8. MAX and Survey Linkages

    Data.gov (United States)

    U.S. Department of Health & Human Services — CMS is interested in linking MAX files with survey data, including four surveys conducted by the National Center for Health Statistics (NCHS) - the National Health...

  9. MAX Provider Characteristics

    Data.gov (United States)

    U.S. Department of Health & Human Services — The MAX Provider Characteristics (PC) File Implementation Report describes the design, implementation, and results of the MAXPC prototype, which was based on three...

  10. Commissioning and First Results of the Electron Beam Profiler in the Main Injector at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Thurman-Keup, R. [Fermilab; Alvarez, M. [Fermilab; Fitzgerald, J. [Fermilab; Lundberg, C. [Fermilab; Prieto, P. [Fermilab; Zagel, J. [Fermilab; Blokland, W. [Oak Ridge

    2017-08-01

    The planned neutrino program at Fermilab requires large proton beam intensities in excess of 2 MW. Measuring the transverse profiles of these high intensity beams is challenging and often depends on non-invasive techniques. One such technique involves measuring the deflection of a probe beam of electrons with a trajectory perpendicular to the proton beam. A device such as this is already in use at the Spallation Neutron Source at ORNL and a similar device has been installed in the Main Injector at Fermilab. Commissioning of the device is in progress with the goal of having it operational by the end of the year. The status of the commissioning and initial results will be presented

  11. Main refurbishment activities on electronic and electrical equipment for the FRG-1 research reactor

    International Nuclear Information System (INIS)

    Blom, K.H.; Krull, W.

    1997-01-01

    As GKSS intends to operate the research reactor FRG-1 safely and reliably for many years to come, the plant is constantly refurbished and upgraded both in the interests of safety and operational reasons. The following electronic and electrical systems have been replaced or improved since 1990: Information and signalling systems; Emergency power plant (permit applied for); External and internal lightning protection system; Reactor protection system (in part); Safety lighting; Alarm and staff locating system; Control room telephone system; Closed-circuit television system; Beam tube controls; Storage plant for radioactive liquid waste; Ambient dose rate measuring system; Meteorological measuring system; Control and measuring system for the primary cooling circuit; Control rod drives; Control rod control system; Soft start for the secondary pumps; Control and switching devices for the emergency power plant; Trailing cable installation for the reactor bridge; Main-voltage distribution systems/cable routes. (author). 13 figs, 1 tab

  12. Identification and Hierarchy of Main Electronic Health Record Components in Occupational Medicine

    Directory of Open Access Journals (Sweden)

    Dorin TRIFF

    2010-12-01

    Full Text Available Starting from the legal requirements relating to structuring of medical records in occupational medicine and international requirements regarding the certification of electronic health records we have focused on structuring and then evaluating an EHR model in occupational medicine that integrates the main functions and certification criteria required by the European and US certification bodies. The application we designed, called Medmun, structured for use in occupational medicine practices based on the model of medical file provided by the Romanian legislation, integrates both necessary components of occupational medicine practice for administration of characteristic information related to socio-economic unit, work place, health surveillance as well as components of specific EHR functionality. The application has been submitted for free evaluation by specialist physicians of five counties over a period of nine months and subsequently assessed using a questionnaire on the usefulness of specific functional components in the EHR occupational medicine practice. The model was positively evaluated after experimental employment by occupational health practitioners. They consider that absence of legislative support for EHR implementation in medical practice is the main obstacle to the use of such applications in occupational medicine practice.

  13. AuroraMAX!

    Science.gov (United States)

    Donovan, E.; Spanswick, E. L.; Chicoine, R.; Pugsley, J.; Langlois, P.

    2011-12-01

    AuroraMAX is a public outreach and education initiative that brings auroral images to the public in real time. AuroraMAX utilizes an observing station located just outside Yellowknife, Canada. The station houses a digital All-Sky Imager (ASI) that collects full-colour images of the night sky every six seconds. These images are then transmitted via satellite internet to our web server, where they are made instantly available to the public. Over the last two years this program has rapidly become one of the most successful outreach programs in the history of Space Science in Canada, with hundreds of thousands of distinct visitors to the CSA AuroraMAX website, thousands of followers on social media, and hundreds of newspaper, magazine, radio, and television spots. Over the next few years, the project will expand to include a high-resolution SLR delivering real-time auroral images (also from Yellowknife), as well as a program where astronauts on the ISS will take pictures of the aurora with a handheld SLR. The objectives of AuroraMAX are public outreach and education. The ASI design, operation, and software were based on infrastructure that was developed for the highly successful ASI component of the NASA THEMIS mission as well as the Canadian Space Agency (CSA) Canadian GeoSpace Monitoring (CGSM) program. So from an education and public outreach perspective, AuroraMAX is a single camera operating in the Canadian north. On the other hand, AuroraMAX is one of nearly 40 All-Sky Imagers that are operating across North America. The AuroraMAX camera produces data that is seamlessly integrated with the CGSM ASI data, and made widely available to the Space Science community through open-access web and FTP sites. One of our objectives in the next few years is to incorporate some of the data from the THEMIS and CGSM imagers into the AuroraMAX system, to maximize viewing opportunities and generate more real-time data for public outreach. This is an exemplar of a program that

  14. WiMax taking wireless to the max

    CERN Document Server

    Pareek, Deepak

    2006-01-01

    With market value expected to reach 5 billion by 2007 and the endorsement of some of the biggest names in telecommunications, World Interoperability for Microwave Access (WiMAX) is poised to change the broadband wireless landscape. But how much of WiMAX's touted potential is merely hype? Now that several pre-WiMAX networks have been deployed, what are the operators saying about QoS and ROI? How and when will device manufacturers integrate WiMAX into their products? What is the business case for using WiMAX rather than any number of other established wireless alternatives?WiMAX: Taking Wireless

  15. Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2002-01-01

    President Rüütel andis Soome tuntud diplomaadile ja Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni (IKURK) esimehele Max Jakobsonile Maarjamaa Risti I klassi teenetemärgi. Tseremooniajärgne intervjuu Max Jakobsoniga

  16. Compositions of (max, +) automata

    Czech Academy of Sciences Publication Activity Database

    Lahaye, S.; Komenda, Jan; Boimond, J.-L.

    2015-01-01

    Roč. 25, 1-2 (2015), s. 323-344 ISSN 0924-6703 R&D Projects: GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : (max,+) automata * synchronous product * asynchronous product Subject RIV: BA - General Mathematics Impact factor: 1.268, year: 2015 http://link.springer.com/article/10.1007/s10626-014-0186-6

  17. Recommended connections between the main ionizing radiation sensors and their electronic sub-assemblies

    International Nuclear Information System (INIS)

    Lefevre, Roger; Roquefort, Henri

    1970-02-01

    The authors report the study of several typical and simple connections which are present between an ionizing radiation detector and the electronic sub-assembly, and can be adequate in most of the cases. They also study recommended outputs of the different types of detectors and their possible connections with electronic functional elements. Thus, they address connections for general use, detector outputs, inputs and outputs of amplifiers and of sub-assemblies, amplifier inputs, commonly used connectors

  18. Max Algebraic Complementary Basic Matrices

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Hall, F.J.

    2014-01-01

    Roč. 457, 15 September (2014), s. 287-292 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : CB-matrix * Max algebra * Max permanent * Max eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  19. Electron Cloud induced instabilities in the Fermilab Main Injector(MI) for the High Intensity Neutrino Source (HINS) project

    International Nuclear Information System (INIS)

    Sonnad, Kiran G.; Furman, Miguel A.; Vay, Jean-Luc; Venturini, Marco; Celata, Christine; Grote, David

    2006-01-01

    The electrostatic particle-in-cell codeWARP is currently being expanded in order to study electron cloud effects on the dynamics of the beam in storage rings. Results for the Fermilab main injector (MI) show the existence of a threshold in the electron density beyond which there is rapid emittance growth. The Fermilab MI is being considered for an upgrade as part of the high intensity neutrino source (HINS) effort, which will result in a significant increasing of the bunch intensity relative to its present value, placing it in a regime where electron-cloud effects are expected to become important. Various results from the simulations using WARP are discussed here

  20. Main trends in FSC member organisations' use of electronic communications technologies: responses to the questionnaire

    International Nuclear Information System (INIS)

    Aebersold, M.

    2006-01-01

    The questionnaire about the experience with electronic, web tools for communicating on radioactive waste management (RWM) was sent to a number of RWM organisations and 5 contributions were received and analysed. All responding organisations indicate that ideas and plans involving electronic media are in constant active development. In each organisation there is usually a small, specialised team to run the web, often in close cooperation with the media department of the Organisation and technical units, but the technical implementation of electronic tools may be out-sourced. On the whole, the use of web systems is seen as very efficient, as an instrument for passing information and maintaining a link with active stakeholders, but less appropriate to create the confidence you can develop in a person to person communication

  1. Electron spectroscopy measurements with a shifted analyzing plane setting in the KATRIN main spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Dyba, Stephan [Institut fuer Kernphysik, Uni Muenster (Germany); Collaboration: KATRIN-Collaboration

    2016-07-01

    With the KATRIN (KArlsruhe TRItium Neutrino) experiment the endpoint region of the tritium beta decay will be measured to determine the electron-neutrino mass with a sensitivity of 200 meV/c{sup 2} (90% C.L.). For the high precision which is needed to achieve the sub-eV range a MAC-E filter type spectrometer is used to analyze the electron energy. To understand the various background contributions inside the spectrometer vessel different electric and magnetic field settings were investigated during the last commissioning phase. This talk will focus on the so called shifted analyzing plane measurement in which the field settings were tuned in a way to provide non standard potential barriers within the spectrometer. The different settings allowed to perform a spectroscopic measurement, determining the energy spectrum of background electrons born within the spectrometer.

  2. 78 FR 24386 - Electronic Fund Transfers; Determination of Effect on State Laws (Maine and Tennessee)

    Science.gov (United States)

    2013-04-25

    ... property as early as two years after purchase. Once a gift card has been deemed abandoned, some or all of... obtain merchandise, not cash, from the purchase of gift cards. A handful of commenters urged the Bureau... unclaimed gift cards are inconsistent with and preempted by the Electronic Fund Transfer Act and Regulation...

  3. Recent electron-cloud simulation results for the main damping rings of the NLC and TESLA linear colliders

    International Nuclear Information System (INIS)

    Pivi, M.; Raubenheimer, T.O.; Furman, M.A.

    2003-01-01

    In the beam pipe of the Main Damping Ring (MDR) of the Next Linear Collider (NLC), ionization of residual gases and secondary emission give rise to an electron-cloud which stabilizes to equilibrium after few bunch trains. In this paper, we present recent computer simulation results for the main features of the electron cloud at the NLC and preliminary simulation results for the TESLA main damping rings, obtained with the code POSINST that has been developed at LBNL, and lately in collaboration with SLAC, over the past 7 years. Possible remedies to mitigate the effect are also discussed. We have recently included the possibility to simulate different magnetic field configurations in our code including solenoid, quadrupole, sextupole and wiggler

  4. maxAlike

    DEFF Research Database (Denmark)

    Menzel, Karl Peter; Stadler, Peter F.; Gorodkin, Jan

    2011-01-01

    MOTIVATION: The task of reconstructing a genomic sequence from a particular species is gaining more and more importance in the light of the rapid development of high-throughput sequencing technologies and their limitations. Applications include not only compensation for missing data in unsequenced...... genomic regions and the design of oligonucleotide primers for target genes in species with lacking sequence information but also the preparation of customized queries for homology searches. RESULTS: We introduce the maxAlike algorithm, which reconstructs a genomic sequence for a specific taxon based...... on sequence homologs in other species. The input is a multiple sequence alignment and a phylogenetic tree that also contains the target species. For this target species, the algorithm computes nucleotide probabilities at each sequence position. Consensus sequences are then reconstructed based on a certain...

  5. Electron density as the main parameter influencing the formation of fullerenes in a carbon plasma

    International Nuclear Information System (INIS)

    Churilov, G.N.; Bulina, N.V.; Novikov, P.V.; Lopatin, V.A.; Vnukova, N.G.; Bachilo, S.M.; Tsyboulski, D.; Weisman, R.B.

    2002-01-01

    Thermodynamic estimates are presented for the formation of spheroidal and flat carbon clusters from reactant species of different charges. Charge is shown to strongly influence the geometry and stability of flat clusters. Changes in the charge of flat clusters can promote both their folding to spheroidal structures and their dissociation. It is concluded that the fluctuations of electron concentration in carbon plasma can result in the accumulation of fullerene clusters and the dissociation of flat clusters. Computer simulations of fullerene C 60 formation from carbon clusters having different charges are carried out using the program HyperChem 5 to calculate the optimal geometry of molecules and their molecular dynamics at different temperatures [ru

  6. Electron Flux Dropouts at L ˜ 4.2 From Global Positioning System Satellites: Occurrences, Magnitudes, and Main Driving Factors

    Science.gov (United States)

    Boynton, R. J.; Mourenas, D.; Balikhin, M. A.

    2017-11-01

    Dropouts in electron fluxes at L ˜ 4.2 were investigated for a broad range of energies from 120 keV to 10 MeV, using 16 years of electron flux data from Combined X-ray Dosimeter on board Global Positioning System (GPS) satellites. Dropouts were defined as flux decreases by at least a factor 4 in 12 h, or 24 h during which a decrease by at least a factor of 1.5 must occur during each 12 h time bin. Such fast and strong dropouts were automatically identified from the GPS electron flux data and statistics of dropout magnitudes, and occurrences were compiled as a function of electron energy. Moreover, the Error Reduction Ratio analysis was employed to search for nonlinear relationships between electron flux dropouts and various solar wind and geomagnetic activity indices, in order to identify potential external causes of dropouts. At L ˜ 4.2, the main driving factor for the more numerous and stronger 1-10 MeV electron dropouts turns out to be the southward interplanetary magnetic field Bs, suggesting an important effect from precipitation loss due to combined electromagnetic ion cyclotron and whistler mode waves in a significant fraction of these events, supplementing magnetopause shadowing and outward radial diffusion which are also effective at lower energies.

  7. Main-ion temperature and plasma rotation measurements based on scattering of electron cyclotron heating waves in ASDEX Upgrade

    DEFF Research Database (Denmark)

    Pedersen, Morten Stejner; Rasmussen, Jesper; Nielsen, Stefan Kragh

    2017-01-01

    We demonstrate measurements of spectra of O-mode electron cyclotron resonance heating (ECRH) waves scattered collectively from microscopic plasma fluctuations in ASDEX Upgrade discharges with an ITER-like ECRH scenario. The measured spectra are shown to allow determination of the main ion...... temperature and plasma rotation velocity. This demonstrates that ECRH systems can be exploited for diagnostic purposes alongside their primary heating purpose in a reactor relevant scenario....

  8. Electron beam irradiation of poly(perfluoro ethers): Identification of gaseous products as a result of main chain scission

    International Nuclear Information System (INIS)

    Pacansky, J.; Waltman, R.J.

    1991-01-01

    Several poly(perfluoro ethers) are exposed to electron beams to study the mechanism for main chain scission. Electron beam exposures were performed with the viscous poly(perfluoro ethers) under argon gas, and also at 9 K under vacuum, to determine mechanistic details for the chemical degradation. Here the authors report that, after main chain scission of the bulk poly(perfluoro ethers), sample weight loss is observed concomitant with evolution of gaseous products. Since this suggests that some unzipping of the polymer chain occurs, the products were identified and, most importantly, the efficiency for their formation was determined in terms of G values, and compared to known G values for main chain scission. The results show that COF 2 is the major gaseous product produced from unbranched ethers while CF 4 and COF 2 are the major products from branched polymers. The gaseous products were also exposed to the high-energy electron beam and the G values for decomposition are given

  9. Research on the electromagnetic radiation characteristics of the gas main switch of a capacitive intense electron-beam accelerator

    Directory of Open Access Journals (Sweden)

    Yongfeng Qiu

    2017-11-01

    Full Text Available Strong electromagnetic fields are radiated during the operation of the intense electron-beam accelerator (IEBA, which may lead to the nearby electronic devices out of order. In this paper, the research on the electromagnetic radiation characteristic of the gas main switch of a capacitive IEBA is carried out by the methods of theory analysis and experiment investigation. It is obtained that the gas main switch is the dominating radiation resource. In the absence of electromagnetic shielding for the gas main switch, when the pulse forming line of the IEBA is charged to 700 kV, the radiation field with amplitude of 3280 V/m, dominant frequency of 84 MHz and high frequency 100 MHz is obtained at a distance of 10 meters away from the gas main switch. The experimental results of the radiation field agree with the theoretical calculations. We analyze the achievements of several research groups and find that there is a relationship between the rise time (T of the transient current of the gas main switch and the dominant frequency (F of the radiation field, namely, F*T=1. Contrast experiment is carried out with a metal shield cover for the gas main switch. Experimental results show that for the shielded setup the radiation field reduces to 115 V/m, the dominant frequency increases to 86.5 MHz at a distance of 10 away meters from the gas main switch. These conclusions are beneficial for further research on the electromagnetic radiation and protection of the IEBA.

  10. New features of the MAX IV thermionic pre-injector

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, J., E-mail: joel.andersson@maxiv.lu.se; Olsson, D., E-mail: david.olsson@maxiv.lu.se; Curbis, F.; Malmgren, L.; Werin, S.

    2017-05-21

    The MAX IV facility in Lund, Sweden consists of two storage rings for production of synchrotron radiation. The smaller 1.5 GeV ring is presently under construction, while the larger 3 GeV ring is being commissioned. Both rings will be operating with top-up injections from a full-energy injector. During injection, the electron beam is first delivered to the main injector from a thermionic pre-injector which consists of a thermionic RF gun, a chopper system, and an energy filter. In order to reduce losses of high-energy electrons along the injector and in the rings, the electron beam provided by the thermionic pre-injector should have the correct time structure and energy distribution. In this paper, the design of the MAX IV thermionic pre-injector with all its sub components is presented. The electron beam delivered by the pre-injector and its dependence on parameters such as optics, cathode temperature, and RF power are studied. Measurements are here compared with simulation results obtained by particle tracking and electromagnetic codes. The chopper system is described in detail, and different driving schemes that optimize the injection efficiency for the two storage rings are investigated. During operation, it was discovered that the structure of the beam delivered by the gun is affected by mode beating between the accelerating and a low-order mode. This mode beating is also studied in detail. Finally, initial measurements of the electron beam delivered to the 3 GeV ring during commissioning are presented.

  11. 3ds Max 2012 Bible

    CERN Document Server

    Murdock, Kelly L

    2011-01-01

    Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav

  12. A short period undulator for MAX

    International Nuclear Information System (INIS)

    Ahola, H.; Meinander, T.

    1992-01-01

    A hybrid undulator for generation of high brilliance synchrotron radiation in the photon energy range of 60--600 eV at the 550 MeV electron storage ring MAX in Lund, Sweden has been designed and built at the Technical Research Centre of Finland in close collaboration with MAX-lab of Lund University. At the rather modest electron energy of MAX this photon energy range can be reached only by an undulator featuring a fairly short period and the smallest possible magnetic gap. Even then, higher harmonics (up to the 13th) of the radiation spectrum must be utilized. An optimization of the magnetic design resulted in a hybrid configuration of NdFeB magnets and soft iron poles with a period of 24 mm and a minimum magnetic gap of 7--10 mm. A variable-gap vacuum chamber allows reduction of the vacuum gap from a maximum of 20 mm, needed for injection, down to 6 mm during stored beam operation. A special design of this chamber permits a magnetic gap between pole tips that is only 1 mm larger than the vacuum gap. Adequate field uniformity was ensured by calibration of magnets to equal strength at their true operating point and verification of the homogeneity of their magnetization. Magnetic measurements included Hall probe scans of the undulator field and flip coil evaluations of the field integral

  13. 1.5-V-threshold-voltage Schottky barrier normally-off AlGaN/GaN high-electron-mobility transistors with f T/f max of 41/125 GHz

    Science.gov (United States)

    Hou, Bin; Ma, Xiaohua; Yang, Ling; Zhu, Jiejie; Zhu, Qing; Chen, Lixiang; Mi, Minhan; Zhang, Hengshuang; Zhang, Meng; Zhang, Peng; Zhou, Xiaowei; Hao, Yue

    2017-07-01

    In this paper, a normally-off AlGaN/GaN high-electron-mobility transistors (HEMT) fabricated using inductively coupled plasma (ICP) CF4 plasma recessing and an implantation technique is reported. A gate-to-channel distance of ˜10 nm and an equivalent negative fluorine sheet charge density of -1.21 × 1013 cm-2 extracted using a simple threshold voltage (V th) analytical model result in a high V th of 1.5 V, a peak transconductance of 356 mS/mm, and a subthreshold slope of 133 mV/decade. A small degradation of channel mobility leads to a high RF performance with f T/f max of 41/125 GHz, resulting in a record high f T × L g product of 10.66 GHz·µm among Schottky barrier AlGaN/GaN normally-off HEMTs with V th exceeding 1 V, to the best of our knowledge.

  14. Max Scheler's Phenomenology of Interrelation

    African Journals Online (AJOL)

    denise

    German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy .... process of deliberation or ask myself how the other person might be feeling .... Scheler believes that Nietzsche mistakenly identifies.

  15. President Ilves kohtus Max Jakobsoniga

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilves ja Soome tuntud diplomaat Max Jakobson arutasid 16. septembril 2008 Tallinnas toimunud kohtumisel julgeolekuolukorda Euroopas pärast Venemaa-Gruusia sõda, Euroopa Liidu suhteid Venemaaga ja NATO tulevikku

  16. Max Planck and modern physics

    International Nuclear Information System (INIS)

    Hoffmann, Dieter

    2010-01-01

    Max Planck (1858-1947) is according to the words of Max von Laue the ''father of quantum physics''. This characteristic has until today continuance, although Planck stood for long time sceptically in front of his quantum hypothesis and so became a revolutionary in spite of his wishes. Eclipted by this pioneer role of the scholar for the foundation of the quantum theory are the numerous further works of the scholer, by which he has in many other fields provided eminent things. Starting with his fundamental contribution to thermodynamics, which make him to an excellent researcher of the field, until the works in the early history of relativity theory and the promotion of the young Einstein, which let him become also to a pioneer of the second central pillar of modern physics. The present collection attempts to show the whole spectrum of the physical works of Max Planck and his role in the formation of modern physics. [de

  17. Analysis list: Max [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Max Blood,Muscle,Pluripotent stem cell + mm9 http://dbarchive.biosciencedbc.jp/kyus...hu-u/mm9/target/Max.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Max.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/target/Max.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Blood....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Muscle.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Max.Pluripotent_stem_cell.tsv http://dbarchive.biosciencedbc.jp/k

  18. Max Weber and Robert Michels.

    Science.gov (United States)

    Scaff, Lawrence A.

    1981-01-01

    This paper investigates the unique intellectual partnership of Max Weber and Robert Michels, with particular emphasis on Weber's influence on Michel's inquiry into the sociology of parties and organization. Concludes with an evaluation of the import of Weber's critique of Michels' work. (DB)

  19. De Max-Planck medaille

    NARCIS (Netherlands)

    Heijmans, H.G.; van Woerkom, P.Th.L.M.; Ankersmit, W.; Hagman, R.; Heijmans, H.G.; Olsder, G.J.; van de Schootbrugge, G.

    2017-01-01

    De Max-Planck-Medaille is een onderscheiding die sinds 1929 jaarlijks wordt uitgereikt door de toentertijd grootste vereniging van natuurkundigen ter wereld: de Deutsche Physikalische Gesellschaft. Het is als het ware de Nobelprijs voor de theoretische natuurkunde, volgens de natuurkundigen zelf. In

  20. Max Weber - bedaget og aktuel

    DEFF Research Database (Denmark)

    Eistrup, Jens

    2010-01-01

    undervisningsartiklen introducerer en række af Max Webers centrale begreber om herredømme, bureaukrati, social handlen, rationalitet og profession. dernæst illustreres hvorledes Webers begreber kan tjene til at belyse spændingsfeltet mellem politik og profession i en socialfaglig kontekst....

  1. O pensamento de Max Weber

    Directory of Open Access Journals (Sweden)

    Maurício Tragtenberg

    1966-06-01

    Full Text Available Max Weber inicia sua carreira universitária em 1893, como professor extraordinário de Direito Mercantil e Romano, na Universidade de Berlim. Em 1894 assume a Cadeira de Economia Política na Universidade de Hamburgo e em 1897 leciona na Universidade de Heidelberg.

  2. Novel Approaches to Enhance Mobile WiMAX Security

    Directory of Open Access Journals (Sweden)

    Taeshik Shon

    2010-01-01

    Full Text Available The IEEE 802.16 Working Group on Broadband Wireless Access Standards released IEEE 802.16-2004 which is a standardized technology for supporting broadband and wireless communication with fixed and nomadic access. After the IEEE 802.16-2004 standard, a new advanced and revised standard was released as the IEEE 802.16e-2005 amendment which is foundation of Mobile WiMAX network supporting handover and roaming capabilities. In the area of security aspects, compared to IEEE 802.16-2004, IEEE 802.16e, called Mobile WiMAX, adopts improved security architecture—PKMv2 which includes EAP authentication, AES-based authenticated encryption, and CMAC or HMAC message protection. However, there is no guarantee that PKMv2-based Mobile WiMAX network will not have security flaws. In this paper, we investigate the current Mobile WiMAX security architecture focusing mainly on pointing out new security vulnerabilities such as a disclosure of security context in network entry, a lack of secure communication in network domain, and a necessity of efficient handover supporting mutual authentication. Based on the investigation results, we propose a novel Mobile WiMAX security architecture, called RObust and Secure MobilE WiMAX (ROSMEX, to prevent the new security vulnerabilities.

  3. A min-max variational principle

    International Nuclear Information System (INIS)

    Georgiev, P.G.

    1995-11-01

    In this paper a variational principle for min-max problems is proved that is of the same spirit as Deville-Godefroy-Zizler's variational principle for minimization problems. A localization theorem in which the mini-max points for the perturbed function with respect top a given ε-min-max point are localized is presented. 3 refs

  4. Max Reinharz (1923-2012)

    CERN Multimedia

    2013-01-01

    Max Reinharz was born in Vienna, Austria, in 1923. In 1939 he was obliged to emigrate to the UK. At the beginning of the Second World War he was interned as an enemy alien and then deported to Australia at a time when the British feared an invasion by Germany. He returned to the UK in 1943 and joined the British Army. After he was demobbed in 1947, he studied physics in Vienna, where he took his doctorate in 1953.   Max Reinharz (centre) with Gordon Munday (left) and Henri Laporte (right) in 1979. After working in Brussels, at the physics Institute of Genoa and the University of Pisa, he joined CERN in 1960 as a fellow and in 1964 became a senior physicist in the NP Division. His name is associated with many publications, such as those of the CERN neutrino experiment and the CERN-Geneva-Lund collaboration to verify T symmetry conservation in lambda decays. He then joined a small team in the Proton Synchrotron Division (MPS) responsible for assisting external physics groups to prepare and i...

  5. Max Planck et les quanta

    CERN Document Server

    Boudenot, Jean-Claude

    2016-01-01

    « Les atomes, dit Jean Perrin en 1913, ne sont pas ces éléments éternels et insécables dont l'irréductible simplicité donnait au possible une borne, et, dans leur inimaginable petitesse, nous commençons à pressentir un fourmillement prodigieux de mondes nouveaux ». C'est bien dans un monde totalement nouveau, le monde quantique, que nous a fait pénétrer la découverte des quanta par Max Planck. Son article de 1900 est le déclencheur de l'une des plus grandes révolutions scientifiques de tous les temps. Les trente années qui suivent sont les plus riches de la physique ; Planck, Einstein, Bohr, Sommerfeld, de Broglie, Schrödinger, Heisenberg, Dirac, Born, Pauli… reconstruisent la physique sur de nouvelles bases sur fond de conflit des générations. Le monde est par ailleurs secoué par la guerre, Max Planck est tourmenté et vit des épreuves personnelles dramatiques. C'est l'homme, aussi bien que l'oeuvre, que les auteurs ont tenté de dépeindre dans cet ouvrage. Ils ont également souhait�...

  6. Beyond NextGen: AutoMax Overview and Update

    Science.gov (United States)

    Kopardekar, Parimal; Alexandrov, Natalia

    2013-01-01

    Main Message: National and Global Needs - Develop scalable airspace operations management system to accommodate increased mobility needs, emerging airspace uses, mix, future demand. Be affordable and economically viable. Sense of Urgency. Saturation (delays), emerging airspace uses, proactive development. Autonomy is Needed for Airspace Operations to Meet Future Needs. Costs, time critical decisions, mobility, scalability, limits of cognitive workload. AutoMax to Accommodate National and Global Needs. Auto: Automation, autonomy, autonomicity for airspace operations. Max: Maximizing performance of the National Airspace System. Interesting Challenges and Path Forward.

  7. Toughening Mechanisms in Nanolayered MAX Phase Ceramics—A Review

    Directory of Open Access Journals (Sweden)

    Xinhua Chen

    2017-03-01

    Full Text Available Advanced engineering and functional ceramics are sensitive to damage cracks, which delay the wide applications of these materials in various fields. Ceramic composites with enhanced fracture toughness may trigger a paradigm for design and application of the brittle components. This paper reviews the toughening mechanisms for the nanolayered MAX phase ceramics. The main toughening mechanisms for these ternary compounds were controlled by particle toughening, phase-transformation toughening and fiber-reinforced toughening, as well as texture toughening. Based on the various toughening mechanisms in MAX phase, models of SiC particles and fibers toughening Ti3SiC2 are established to predict and explain the toughening mechanisms. The modeling work provides insights and guidance to fabricate MAX phase-related composites with optimized microstructures in order to achieve the desired mechanical properties required for harsh application environments.

  8. Main Achievements 2003-2004 - Condensed Matter Studies - Electronic structure of disordered alloys studied by Compton scattering

    International Nuclear Information System (INIS)

    2005-01-01

    3D momentum density and the Fermi surface of disordered Cu 0.86 Al 0.16 alloy were reconstructed from high-resolution Compton profiles. The effect known as ''nesting'' of the Fermi surface was revealed (cooperation with KEK, Tsukuba, Japan). This feature of the Fermi surface, when present, is believed to lead to local ordering phenomena in disordered systems. Our electron diffraction studies showed that a short-range order was indeed present in the alloy. Moreover, the character of the diffuse scattering (the four-fold splitting of the diffuse spots) pointed to the ''nesting'' of the Fermi surface as the origin of this ordering. The results lend support to the notion that the formation of the short-range order in nondiluted, disordered alloys can be driven by their electronic properties like the shape of the Fermi surface

  9. HuMax-CD4

    DEFF Research Database (Denmark)

    Skov, Lone; Kragballe, Knud; Zachariae, Claus

    2003-01-01

    BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE......: To test safety and efficacy of a fully human monoclonal anti-CD4 antibody (HuMax-CD4) in the treatment of psoriasis. DESIGN: Multicenter, double-blind, placebo-controlled, randomized clinical trial. Patients Eighty-five patients with moderate to severe psoriasis. INTERVENTIONS: Subcutaneous infusions...... dose level, 6 (38%) of 16 patients obtained more than 25% reduction of PASI and 3 (19%) obtained more than 50% reduction of PASI. A dose-dependent decrease in total lymphocyte count was seen and was parallel to a dose-dependent decrease in CD4+ T cells. This decrease was due to a decrease in the memory...

  10. Theoretical study of physical properties and oxygen incorporation effect in nanolaminated ternary carbides 211-MAX phases

    KAUST Repository

    Kanoun, Mohammed; Goumri-Said, Souraya

    2012-01-01

    In this chapter, we employ ab initio approaches to review some important physical properties of nanolaminated ternary carbides MAX phases. We fi rstly use an all electron full-potential linearized augmented plane-wave method within the generalized

  11. German science. Max Planck charts new path.

    Science.gov (United States)

    Koenig, R

    2000-06-09

    Germany's premier basic research organization, the Max Planck Society, released a long-awaited blueprint for change during its annual meeting this week, recommending that the society's nearly 3000 scientists embrace more interdisciplinary and international projects in a range of new research priorities. The report, called Max Planck 2000-Plus, is the product of an 18-month-long internal review. Its recommendations were formulated by some two dozen Max Planck researchers and administrators, who sought input from every institute.

  12. Mastering Autodesk 3ds Max 2013

    CERN Document Server

    Harper, Jeffrey

    2012-01-01

    Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides

  13. Electron Cloud in Steel Beam Pipe vs Titanium Nitride Coated and Amorphous Carbon Coated Beam Pipes in Fermilab's Main Injector

    Energy Technology Data Exchange (ETDEWEB)

    Backfish, Michael

    2013-04-01

    This paper documents the use of four retarding field analyzers (RFAs) to measure electron cloud signals created in Fermilab’s Main Injector during 120 GeV operations. The first data set was taken from September 11, 2009 to July 4, 2010. This data set is used to compare two different types of beam pipe that were installed in the accelerator. Two RFAs were installed in a normal steel beam pipe like the rest of the Main Injector while another two were installed in a one meter section of beam pipe that was coated on the inside with titanium nitride (TiN). A second data run started on August 23, 2010 and ended on January 10, 2011 when Main Injector beam intensities were reduced thus eliminating the electron cloud. This second run uses the same RFA setup but the TiN coated beam pipe was replaced by a one meter section coated with amorphous carbon (aC). This section of beam pipe was provided by CERN in an effort to better understand how an aC coating will perform over time in an accelerator. The research consists of three basic parts: (a) continuously monitoring the conditioning of the three different types of beam pipe over both time and absorbed electrons (b) measurement of the characteristics of the surrounding magnetic fields in the Main Injector in order to better relate actual data observed in the Main Injector with that of simulations (c) measurement of the energy spectrum of the electron cloud signals using retarding field analyzers in all three types of beam pipe.

  14. Behavior of lithium ions in the turbulent near-wall tokamak plasma under heating of ions and electrons of the main plasma

    International Nuclear Information System (INIS)

    Shurygin, R. V.; Morozov, D. Kh.

    2014-01-01

    Turbulent dynamics of the near-wall tokamak plasma is simulated by numerically solving the nonlinear reduced Braginskii magnetohydrodynamic equations with allowance for a lithium ion admixture. The effects of turbulence and radiation of the admixture are analyzed in the framework of a self-consistent approach. The radial distributions of the radiative loss power and the density of Li 0 atoms and Li +1 ions are obtained as functions of the electron and ion temperatures of the main plasma in the near-wall layer. The results of numerical simulations show that supply of lithium ions into the low-temperature near-wall plasma substantially depends on whether the additional power is deposited into the electron or ion component of the main plasma. If the electron temperature in the layer increases (ECR heating), then the ion density drops. At the same time, an increase in the temperature of the main ions (ICR heating) leads to an increase in the density of Li +1 ions. The results of numerical simulations are explained by the different influence of the electron and ion temperatures on the atomic processes governing the accumulation and loss of particles in the balance equations for neutral Li 0 atoms and Li +1 ions in the admixture. The radial profile of the electron temperature and the corresponding distribution of the radiative loss power for different densities of neutral Li 0 atoms on the wall are obtained. The calculations show that the presence of Li +1 ions affects turbulent transport of the main ions. In this case, the electron heat flux increases by 20–30% with increasing Li +1 density, whereas the flux of the main ions drops by nearly the same amount. The radial profile of the turbulent flux of lithium ions is obtained. It is demonstrated that the appearance of the pinch effect is related to the positive density gradient of lithium ions across the calculation layer. For the parameters of the T-10 tokamak, the effect of radiative cooling of the near-wall plasma

  15. Max Jakobson õiendab arveid ajalooga / Imbi Paju

    Index Scriptorium Estoniae

    Paju, Imbi, 1959-

    2003-01-01

    Soome politoloogi ja diplomaadi Max Jakobsoni raamatust "Tilinpäätos" ("Arve sulgemine"), milles ta käsitleb Eesti ja Soome suhteid 20. sajandil. Vt samas: Lennart Meri meelitas Jakobsoni sõjakuritegusid uurima; lühiintervjuu Max Jakobsoniga

  16. Veteranpoliitik Max Jakobson õpetab ajalugu / Sirje Kiin

    Index Scriptorium Estoniae

    Kiin, Sirje, 1949-

    1998-01-01

    Soome sõltumatu välispoliitika konsultant ja ajakirjanik Max Jakobson. Ülevaade Max Jakobsoni intervjuust soomerootsi majandusajakirjale "Forum för ekonomi och teknik" 1998. aasta aprillinumbris Venemaa Baltimaade-vastasest propagandast ning EL-i ja NATO laienemisest

  17. WiMax network planning and optimization

    CERN Document Server

    Zhang, Yan

    2009-01-01

    This book offers a comprehensive explanation on how to dimension, plan, and optimize WiMAX networks. The first part of the text introduces WiMAX networks architecture, physical layer, standard, protocols, security mechanisms, and highly related radio access technologies. It covers system framework, topology, capacity, mobility management, handoff management, congestion control, medium access control (MAC), scheduling, Quality of Service (QoS), and WiMAX mesh networks and security. Enabling easy understanding of key concepts and technologies, the second part presents practical examples and illu

  18. Introducing Autodesk 3ds Max 2011

    CERN Document Server

    Derakhshani, Dariush

    2010-01-01

    An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c

  19. Microspectroscopy At Beamline 73 MAX-lab

    International Nuclear Information System (INIS)

    Engdahl, Anders

    2010-01-01

    Presentation of some projects at the infrared microspectroscopy experimental station at beamline 73 MAX-lab. Among the subjects are found identification of organic residues in fossil material and examination of the chemistry in an old oak wood wreck.

  20. Approximation by max-product type operators

    CERN Document Server

    Bede, Barnabás; Gal, Sorin G

    2016-01-01

    This monograph presents a broad treatment of developments in an area of constructive approximation involving the so-called "max-product" type operators. The exposition highlights the max-product operators as those which allow one to obtain, in many cases, more valuable estimates than those obtained by classical approaches. The text considers a wide variety of operators which are studied for a number of interesting problems such as quantitative estimates, convergence, saturation results, localization, to name several. Additionally, the book discusses the perfect analogies between the probabilistic approaches of the classical Bernstein type operators and of the classical convolution operators (non-periodic and periodic cases), and the possibilistic approaches of the max-product variants of these operators. These approaches allow for two natural interpretations of the max-product Bernstein type operators and convolution type operators: firstly, as possibilistic expectations of some fuzzy variables, and secondly,...

  1. Max Reinhardt Haus Berliini / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    1998-01-01

    Arhitekt Peter Eisenmani projekteeritud multifunktsionaalne maja on planeeritud II maailmasõjas hävinud Max Reinhardti teatrihoone kohale. Ühte hoonetahukasse kui uude maamärki on 'volditud' kokku aktiivse linnaelu kõik aspektid.

  2. WiMAX technology and network evolution

    CERN Document Server

    Etemad, Kamran

    2010-01-01

    WiMAX, the Worldwide Interoperability for Microwave Access, represents a paradigm shift in telecommunications technology. It offers the promise of cheaper, smaller, and simpler technology compared to existing broadband options such as DSL, cable, fiber, and 3G wireless.

  3. Tukey max-stable processes for spatial extremes

    KAUST Repository

    Xu, Ganggang; Genton, Marc G.

    2016-01-01

    We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max

  4. Examination of returned solar-max surfaces for impacting orbital debris and meteoroids

    Science.gov (United States)

    Kessler, D. J.; Zook, H. A.; Potter, A. E.; Mckay, D. S.; Clanton, U. S.; Warren, J. L.; Watts, L. A.; Schultz, R. A.; Schramm, L. S.; Wentworth, S. J.

    1985-01-01

    Previous theoretical studies predicted that in certain regions of earth orbit, the man-made earth orbiting debris environment will soon exceed the interplanetary meteoroid environment for sizes smaller than 1 cm. The surfaces returned from the repaired Solar Max Mission (SMM) by STS 41-C on April 12, 1984, offered an excellent opportunity to examine both the debris and meteoroid environments. To date, approximately 0.7 sq. met. of the thermal insulation and 0.05 sq. met of the aluminum louvers have been mapped by optical microscope for crater diameters larger than 40 microns. Craters larger in diameter than about 100 microns found on the initial 75 micron thick Kapton first sheet on the MEB (Main Electronics Box) blanket are actually holes and constitute perforations through that blanket. The following populations have been found to date in impact sites on these blankets: (1) meteoritic material; (2) thermal paint particles; (3) aluminum droplets; and (4) waste particles.

  5. PENGEMBANGAN PERSAMAAN VO2 MAX DAN EVALUASI HR MAX (STUDI AWAL PADA PEKERJA PRIA

    Directory of Open Access Journals (Sweden)

    Purnawan Adi Wicaksono

    2012-10-01

    Full Text Available Kapasitas fisik maksimum seseorang direpresentasikan dengan nilai konsumsi oksigen maksimum (VO2 Max dan denyut nadi maksimum (HR Max yang memberikan suatu informasi batasan kemampuan fisik maksimum seseorang dalam melakukan pekerjaan. Penelitian kali ini mempunyai tujuan untuk mencari nilai VO2 Max pekerja pria Indonesia untuk nantinya akan dikembangkan suatu persamaan prediksi VO2 Max yang didekati dengan hubungan linier antara denyut nadi (Heart Rate seperti yang dilakukan Astrand (2003, tinggi badan (Chatterjee et al, 2006, berat badan (Akalan et al, 2008, usia (Magrani et al, 2009 dan mengevaluasi persamaan HR Max manakah yang dapat diaplikasikan untuk mendekati nilai denyut nadi maksimum pekerja Indonesia. Responden dalam penelitian kali ini adalah 12  pekerja industri pria yang diambil dari beberapa industri di Depok dan sekitarnya. Kriteria responden yang berpartisipasi dalam penelitian kali ini adalah: berusia 20-40 tahun, bukan perokok baik aktif maupun pasif, sehat , tidak mengkonsumsi makanan, kafein, alkohol minimal 2 jam sebelum eksperimen (Balderrama et. al, 2007.Eksperimen yang dilakukan menggunakan metode maximal test dengan protokol treadmill. Adapun peralatan yang digunakan adalah seperangkat alat pengukur kondisi fisiologi Fitmate MED (COSMED srl-Italy terdiri dari Heart Rate Transmitter, Heart Rate Receiver, V mask (Hans Rudolph Inc,dan treadmill SportArt@60.  Eksperimen dilakukan menjadi dua bagian, yaitu istirahat dan tahap bekerja.Aktivitas istirahat terdiri dari tidur selama 20 menit, duduk selama 20 menit dan berdiri selama 10 menit. Eksperimen tahap kedua yaitu tahap kerja yang terdiri dari latihan selama 5 menit. Responden dipersilakan beristirahat selama 15 menit, setelah itu responden melaksanakan maximal test detik hingga responden merasa tidak sanggup lagi melanjutkan eksperimen. Hasil penelitian model prediksi VO2 max untuk pekerja industri pria mempunyai nilai 2,78 ± 0,5 liter/menit dan dengan regresi linier

  6. 77 FR 14504 - Max Planck Florida Institute, et al.; Notice of Consolidated Decision on Applications for Duty...

    Science.gov (United States)

    2012-03-12

    ... DEPARTMENT OF COMMERCE International Trade Administration Max Planck Florida Institute, et al.; Notice of Consolidated Decision on Applications for Duty-Free Entry of Electron Microscope This is a... Constitution Avenue NW., Washington, DC. Docket Number: 11-061. Applicant: Max Planck Florida Institute...

  7. Min-Max Spaces and Complexity Reduction in Min-Max Expansions

    Energy Technology Data Exchange (ETDEWEB)

    Gaubert, Stephane, E-mail: Stephane.Gaubert@inria.fr [Ecole Polytechnique, INRIA and CMAP (France); McEneaney, William M., E-mail: wmceneaney@ucsd.edu [University of California San Diego, Dept. of Mech. and Aero. Eng. (United States)

    2012-06-15

    Idempotent methods have been found to be extremely helpful in the numerical solution of certain classes of nonlinear control problems. In those methods, one uses the fact that the value function lies in the space of semiconvex functions (in the case of maximizing controllers), and approximates this value using a truncated max-plus basis expansion. In some classes, the value function is actually convex, and then one specifically approximates with suprema (i.e., max-plus sums) of affine functions. Note that the space of convex functions is a max-plus linear space, or moduloid. In extending those concepts to game problems, one finds a different function space, and different algebra, to be appropriate. Here we consider functions which may be represented using infima (i.e., min-max sums) of max-plus affine functions. It is natural to refer to the class of functions so represented as the min-max linear space (or moduloid) of max-plus hypo-convex functions. We examine this space, the associated notion of duality and min-max basis expansions. In using these methods for solution of control problems, and now games, a critical step is complexity-reduction. In particular, one needs to find reduced-complexity expansions which approximate the function as well as possible. We obtain a solution to this complexity-reduction problem in the case of min-max expansions.

  8. Quantum Max-flow/Min-cut

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Shawn X., E-mail: xingshan@math.ucsb.edu [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Quantum Architectures and Computation Group, Microsoft Research, Redmond, Washington 98052 (United States); Freedman, Michael H., E-mail: michaelf@microsoft.com [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Microsoft Research, Station Q, University of California, Santa Barbara, California 93106 (United States); Sattath, Or, E-mail: sattath@gmail.com [Computer Science Division, University of California, Berkeley, California 94720 (United States); Stong, Richard, E-mail: stong@ccrwest.org; Minton, Greg, E-mail: gtminto@ccrwest.org [Center for Communications Research, La Jolla, California 92121 (United States)

    2016-06-15

    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  9. Quantum Max-flow/Min-cut

    Science.gov (United States)

    Cui, Shawn X.; Freedman, Michael H.; Sattath, Or; Stong, Richard; Minton, Greg

    2016-06-01

    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  10. FLECH PowerMax Service Requirement Specification

    DEFF Research Database (Denmark)

    It is expected that in the future, ancillary services will be required at distribution level. This work describes how one of these ancillary services, the PowerMax service, must be spec ified within a market framework. The basis of this work is the Flexibility Clearing House (FLE CH) platform...... and the Distribution System Operator (DSO) services defined in [1]. The PowerMax service has been further discussed in [2], and this technical report seeks to clarify the implementation details first discussed in that paper. The aim of the PowerMax service it to relieve congestion issue s in the distribution system...... by establishing a maximum power that a cluster of consumer devices may draw from the syste m. The consumers will receive a payment for providing this service, and the DSO will be able to postpone grid reinfo rcement...

  11. WiMAX network performance monitoring & optimization

    DEFF Research Database (Denmark)

    Zhang, Qi; Dam, H

    2008-01-01

    frequency reuse, capacity planning, proper network dimensioning, multi-class data services and so on. Furthermore, as a small operator we also want to reduce the demand for sophisticated technicians and man labour hours. To meet these critical demands, we design a generic integrated network performance......In this paper we present our WiMAX (worldwide interoperability for microwave access) network performance monitoring and optimization solution. As a new and small WiMAX network operator, there are many demanding issues that we have to deal with, such as limited available frequency resource, tight...... this integrated network performance monitoring and optimization system in our WiMAX networks. This integrated monitoring and optimization system has such good flexibility and scalability that individual function component can be used by other operators with special needs and more advanced function components can...

  12. Autodesk 3ds Max 2013 essentials

    CERN Document Server

    Derakhshani, Dariush

    2012-01-01

    A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.

  13. Autodesk 3ds Max 2012 Essentials

    CERN Document Server

    Derakhshani, Randi L

    2011-01-01

    Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,

  14. Autodesk 3ds Max 2014 bible

    CERN Document Server

    Murdock, Kelly L

    2013-01-01

    A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty

  15. Human mitochondrial haplogroup H: the highest VO2max consumer--is it a paradox?

    Science.gov (United States)

    Martínez-Redondo, Diana; Marcuello, Ana; Casajús, José A; Ara, Ignacio; Dahmani, Yahya; Montoya, Julio; Ruiz-Pesini, Eduardo; López-Pérez, Manuel J; Díez-Sánchez, Carmen

    2010-03-01

    Mitochondrial background has been demonstrated to influence maximal oxygen uptake (VO(2max), in mLkg(-1)min(-1)), but this genetic influence can be compensated for by regular exercise. A positive correlation among electron transport chain (ETC) coupling, ATP and reactive oxygen species (ROS) production has been established, and mitochondrial variants have been reported to show differences in their ETC performance. In this study, we examined in detail the VO(2max) differences found among mitochondrial haplogroups. We recruited 81 healthy male Spanish Caucasian individuals and determined their mitochondrial haplogroup. Their VO(2max) was determined using incremental cycling exercise (ICE). VO(2max) was lower in J than in non-J haplogroup individuals (P=0.04). The H haplogroup was responsible for this difference (VO(2max); J vs. H; P=0.008) and this group also had significantly higher mitochondrial oxidative damage (mtOD) than the J haplogroup (P=0.04). In agreement with these results, VO(2max) and mtOD were positively correlated (P=0.01). Given that ROS production is the major contributor to mtOD and consumes four times more oxygen per electron than the ETC, our results strongly suggest that ROS production is responsible for the higher VO(2max) found in the H variant. These findings not only contribute to a better understanding of the mechanisms underneath VO(2max), but also help to explain some reported associations between mitochondrial haplogroups and mtOD with longevity, sperm motility, premature aging and susceptibility to different pathologies.

  16. The Statue of Liberty Peter Max Style!

    Science.gov (United States)

    Cunningham, Kathy

    2012-01-01

    The author's school is only 30 minutes from New York City, so every year when second-graders study towns and cities, the students do a project based on New York City landmarks. This year was the Statue of Liberty. The author introduced Peter Max's famous Pop art to her students, and explained that, as the art world kept changing, artists decided…

  17. Max Roach's Adventures in Higher Music Education.

    Science.gov (United States)

    Hentoff, Nat

    1980-01-01

    Max Roach and the author discuss Roach's efforts to gain recognition of the complexity and importance of American musical forms, particularly jazz, by American university music departments. In addition, Roach describes his approach to marketing his music, an approach which avoids the economic exploitation often suffered by American jazz musicians.…

  18. Exact simulation of max-stable processes.

    Science.gov (United States)

    Dombry, Clément; Engelke, Sebastian; Oesting, Marco

    2016-06-01

    Max-stable processes play an important role as models for spatial extreme events. Their complex structure as the pointwise maximum over an infinite number of random functions makes their simulation difficult. Algorithms based on finite approximations are often inexact and computationally inefficient. We present a new algorithm for exact simulation of a max-stable process at a finite number of locations. It relies on the idea of simulating only the extremal functions, that is, those functions in the construction of a max-stable process that effectively contribute to the pointwise maximum. We further generalize the algorithm by Dieker & Mikosch (2015) for Brown-Resnick processes and use it for exact simulation via the spectral measure. We study the complexity of both algorithms, prove that our new approach via extremal functions is always more efficient, and provide closed-form expressions for their implementation that cover most popular models for max-stable processes and multivariate extreme value distributions. For simulation on dense grids, an adaptive design of the extremal function algorithm is proposed.

  19. Teaching Financial Literacy with Max and Ruby

    Science.gov (United States)

    Brown, Natalya; Ferguson, Kristen

    2017-01-01

    Teaching financial literacy is important at all stages of life, but is often neglected with elementary students. In this article, the authors describe a strategy for teaching financial literacy using the books about Max and Ruby by Rosemary Wells. These books can help introduce the five key concepts of financial literacy: scarcity, exchange,…

  20. On the spectrum in max algebra

    Czech Academy of Sciences Publication Activity Database

    Müller, Vladimír; Peperko, A.

    2015-01-01

    Roč. 485, November (2015), s. 250-266 ISSN 0024-3795 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : non-negativ matrices * max algebra * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015 http://www.sciencedirect.com/science/article/pii/S0024379515004139

  1. Diversity of endophytic fungi in Glycine max.

    Science.gov (United States)

    Fernandes, Elio Gomes; Pereira, Olinto Liparini; da Silva, Cynthia Cânedo; Bento, Claudia Braga Pereira; de Queiroz, Marisa Vieira

    2015-12-01

    Endophytic fungi are microorganisms that live within plant tissues without causing disease during part of their life cycle. With the isolation and identification of these fungi, new species are being discovered, and ecological relationships with their hosts have also been studied. In Glycine max, limited studies have investigated the isolation and distribution of endophytic fungi throughout leaves and roots. The distribution of these fungi in various plant organs differs in diversity and abundance, even when analyzed using molecular techniques that can evaluate fungal communities in different parts of the plants, such as denaturing gradient gel electrophoresis (DGGE). Our results show there is greater species richness of culturable endophytic filamentous fungi in the leaves G. max as compared to roots. Additionally, the leaves had high values for diversity indices, i.e. Simpsons, Shannon and Equitability. Conversely, dominance index was higher in roots as compared to leaves. The fungi Ampelomyces sp., Cladosporium cladosporioides, Colletotrichum gloeosporioides, Diaporthe helianthi, Guignardia mangiferae and Phoma sp. were more frequently isolated from the leaves, whereas the fungi Fusarium oxysporum, Fusarium solani and Fusarium sp. were prevalent in the roots. However, by evaluating the two communities by DGGE, we concluded that the species richness was higher in the roots than in the leaves. UPGMA analysis showed consistent clustering of isolates; however, the fungus Leptospora rubella, which belongs to the order Dothideales, was grouped among species of the order Pleosporales. The presence of endophytic Fusarium species in G. max roots is unsurprising, since Fusarium spp. isolates have been previously described as endophyte in other reports. However, it remains to be determined whether the G. max Fusarium endophytes are latent pathogens or non-pathogenic forms that benefit the plant. This study provides a broader knowledge of the distribution of the fungal

  2. Main Memory

    NARCIS (Netherlands)

    P.A. Boncz (Peter); L. Liu (Lei); M. Tamer Özsu

    2008-01-01

    htmlabstractPrimary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random

  3. Main Memory

    OpenAIRE

    Boncz, Peter; Liu, Lei; Özsu, M.

    2008-01-01

    htmlabstractPrimary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random Access Memory (RAM), to indicate that load/store instructions can access data at any location at the same cost, is usually implemented using DRAM chips, which are connected to the CPU and other per...

  4. Direct growth of vertically aligned carbon nanotubes on silicon substrate by spray pyrolysis of Glycine max oil

    Directory of Open Access Journals (Sweden)

    K. T. Karthikeyan

    2017-11-01

    Full Text Available Vertically aligned carbon nanotubes have been synthesized by spray pyrolysis from Glycine max oil on silicon substrate using ferrocene as catalyst at 650 °C. Glycine max oil, a plant-based hydrocarbon precursor was used as a source of carbon and argon as a carrier gas. The as-grown vertically aligned carbon nanotubes were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, X-ray diffraction, thermogravimetric analysis, and Raman spectroscopy. Scanning electron microscopic images reveal that the dense bundles of aligned carbon nanotubes. High resolution transmission electron microscopy and Raman spectroscopy observations indicate that as-grown aligned carbon nanotubes are well graphitized.

  5. Toxicity of the main electronic cigarette components, propylene glycol, glycerin, and nicotine, in Sprague-Dawley rats in a 90-day OECD inhalation study complemented by molecular endpoints.

    Science.gov (United States)

    Phillips, Blaine; Titz, Bjoern; Kogel, Ulrike; Sharma, Danilal; Leroy, Patrice; Xiang, Yang; Vuillaume, Grégory; Lebrun, Stefan; Sciuscio, Davide; Ho, Jenny; Nury, Catherine; Guedj, Emmanuel; Elamin, Ashraf; Esposito, Marco; Krishnan, Subash; Schlage, Walter K; Veljkovic, Emilija; Ivanov, Nikolai V; Martin, Florian; Peitsch, Manuel C; Hoeng, Julia; Vanscheeuwijck, Patrick

    2017-11-01

    While the toxicity of the main constituents of electronic cigarette (ECIG) liquids, nicotine, propylene glycol (PG), and vegetable glycerin (VG), has been assessed individually in separate studies, limited data on the inhalation toxicity of them is available when in mixtures. In this 90-day subchronic inhalation study, Sprague-Dawley rats were nose-only exposed to filtered air, nebulized vehicle (saline), or three concentrations of PG/VG mixtures, with and without nicotine. Standard toxicological endpoints were complemented by molecular analyses using transcriptomics, proteomics, and lipidomics. Compared with vehicle exposure, the PG/VG aerosols showed only very limited biological effects with no signs of toxicity. Addition of nicotine to the PG/VG aerosols resulted in effects in line with nicotine effects observed in previous studies, including up-regulation of xenobiotic enzymes (Cyp1a1/Fmo3) in the lung and metabolic effects, such as reduced serum lipid concentrations and expression changes of hepatic metabolic enzymes. No toxicologically relevant effects of PG/VG aerosols (up to 1.520  mg PG/L + 1.890 mg VG/L) were observed, and no adverse effects for PG/VG/nicotine were observed up to 438/544/6.6 mg/kg/day. This study demonstrates how complementary systems toxicology analyses can reveal, even in the absence of observable adverse effects, subtoxic and adaptive responses to pharmacologically active compounds such as nicotine. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  6. Sensor development at the semiconductor laboratory of the Max-Planck-Society

    Science.gov (United States)

    Bähr, A.; Lechner, P.; Ninkovic, J.

    2017-12-01

    For more than twenty years the semiconductor laboratory of the Max-Planck Society (MPG-HLL) is developing high-performing, specialised, scientific silicon sensors including the integration of amplifying electronics on the sensor chip. This paper summarises the actual status of these devices like pnCCDs and DePFET Active Pixel Sensors and their applications.

  7. Medicaid Analytic eXtract (MAX) General Information

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Medicaid Analytic eXtract (MAX) data is a set of person-level data files on Medicaid eligibility, service utilization, and payments. The MAX data are created to...

  8. Main findings

    International Nuclear Information System (INIS)

    2014-01-01

    Licensing regimes vary from country to country. When the license regime involves several regulators and several licenses, this may lead to complex situations. Identifying a leading organisation in charge of overall coordination including preparation of the licensing decision is a useful practice. Also, if a stepwise licensing process is implemented, it is important to fix in legislation decisions and/or time points and to identify the relevant actors. There is considerable experience in civil and mining engineering that can be applied when constructing a deep geological disposal facility. Specific challenges are, however, the minimization of disturbances to the host rock and the understanding of its long-term behavior. Construction activities may affect the geo-hydraulic and geochemical properties of the various system components which are important safety features of the repository system. Clearly defined technical specifications and an effective quality management plan are important in ensuring successful repository implementation which is consistent with safety requirements. Monitoring plan should also be defined in advance. The regulatory organization should prepare itself to the licensing review before construction by allocating sufficient resources. It should increase its competence, e.g., by interacting early with the implementer and through its own R and D. This will allow the regulator to define appropriate technical conditions associated to the construction license and to elaborate a relevant inspection plan of the construction work. After construction, obtaining the operational license is the most important and crucial step. Main challenges include (a) establishing sufficient confidence so that the methods for closing the individual disposal units comply with the safety objectives and (b) addressing the issue of ageing of materials during a 50-100 years operational period. This latter challenge is amplified when reversibility/retrievability is required

  9. Neutron Damage and MAX Phase Ternary Compounds

    Energy Technology Data Exchange (ETDEWEB)

    Barsoum, Michael [Drexel Univ., Philadelphia, PA (United States); Hoffman, Elizabeth [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Sindelar, Robert [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Garcua-Duaz, Brenda [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Kohse, Gordon [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)

    2014-06-17

    The Demands of Gen IV nuclear power plants for long service life under neutron radiation at high temperature are severe. Advanced materials that would withstand high temperatures (up to 1000+ C) to high doses in a neutron field would be ideal for reactor internal structures and would add to the long service life and reliability of the reactors. The objective of this work is to investigate the response of a new class of machinable, conductive, layered, ternary transition metal carbides and nitrides - the so-called MAX phases - to low and moderate neutron dose levels.

  10. Neutron Damage and MAX Phase Ternary Compounds

    International Nuclear Information System (INIS)

    Barsoum, Michael; Hoffman, Elizabeth; Sindelar, Robert; Garcua-Diaz, Brenda; Kohse, Gordon

    2014-01-01

    The Demands of Gen IV nuclear power plants for long service life under neutron radiation at high temperature are severe. Advanced materials that would withstand high temperatures (up to 1000+ C) to high doses in a neutron field would be ideal for reactor internal structures and would add to the long service life and reliability of the reactors. The objective of this work is to investigate the response of a new class of machinable, conductive, layered, ternary transition metal carbides and nitrides - the so-called MAX phases - to low and moderate neutron dose levels.

  11. Max Raphael, dialectics and Greek art

    OpenAIRE

    Healy, P.

    2007-01-01

    The article outlines what is required for a theory of art in the late work of Max Raphael, by showing that it is a response to a problematic first formulated, but left unanswered, by Marx, and which can be seen as developed by Raphael in his writing, especially the text he devoted to a dialectic interpretation of Greek art, with special reference to temple architecture. In detailing this latter study it is possible to see how Raphael’s understanding and analysis is guided by his account of an...

  12. Max Raphael: Dialectics and Greek Art

    Directory of Open Access Journals (Sweden)

    Patrick Healy

    2014-07-01

    Full Text Available The article outlines what is required for a theory of art in the late work of Max Raphael, by showing that it is a response to a problematic first formulated, but left unanswered, by Marx, and which can be seen as developed by Raphael in his writing, especially the text he devoted to a dialectic interpretation of Greek art, with special reference to temple architecture. In detailing this latter study it is possible to see how Raphael’s understanding and analysis is guided by his account of an empirical theory of art, and contributes to its further elaboration.

  13. Multivariate Max-Stable Spatial Processes

    KAUST Repository

    Genton, Marc G.

    2014-01-06

    Analysis of spatial extremes is currently based on univariate processes. Max-stable processes allow the spatial dependence of extremes to be modelled and explicitly quantified, they are therefore widely adopted in applications. For a better understanding of extreme events of real processes, such as environmental phenomena, it may be useful to study several spatial variables simultaneously. To this end, we extend some theoretical results and applications of max-stable processes to the multivariate setting to analyze extreme events of several variables observed across space. In particular, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. Then, we define a Poisson process construction in the multivariate setting and introduce multivariate versions of the Smith Gaussian extremevalue, the Schlather extremal-Gaussian and extremal-t, and the BrownResnick models. Inferential aspects of those models based on composite likelihoods are developed. We present results of various Monte Carlo simulations and of an application to a dataset of summer daily temperature maxima and minima in Oklahoma, U.S.A., highlighting the utility of working with multivariate models in contrast to the univariate case. Based on joint work with Simone Padoan and Huiyan Sang.

  14. Multivariate Max-Stable Spatial Processes

    KAUST Repository

    Genton, Marc G.

    2014-01-01

    Analysis of spatial extremes is currently based on univariate processes. Max-stable processes allow the spatial dependence of extremes to be modelled and explicitly quantified, they are therefore widely adopted in applications. For a better understanding of extreme events of real processes, such as environmental phenomena, it may be useful to study several spatial variables simultaneously. To this end, we extend some theoretical results and applications of max-stable processes to the multivariate setting to analyze extreme events of several variables observed across space. In particular, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. Then, we define a Poisson process construction in the multivariate setting and introduce multivariate versions of the Smith Gaussian extremevalue, the Schlather extremal-Gaussian and extremal-t, and the BrownResnick models. Inferential aspects of those models based on composite likelihoods are developed. We present results of various Monte Carlo simulations and of an application to a dataset of summer daily temperature maxima and minima in Oklahoma, U.S.A., highlighting the utility of working with multivariate models in contrast to the univariate case. Based on joint work with Simone Padoan and Huiyan Sang.

  15. Associations between VO2max and vitality in older workers: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    van der Beek Allard J

    2010-11-01

    Full Text Available Abstract Background To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. Methods In 427 older workers (aged 45 + years participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. Results The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673. There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006, after adjusting for age, gender and chronic disease status. Conclusions VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale, but not with occupational health related vitality (measured with the UWES Vitality Scale. The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. Trial registration NTR1240

  16. Associations between VO2max and vitality in older workers: a cross-sectional study.

    Science.gov (United States)

    Strijk, Jorien E; Proper, Karin I; Klaver, Linda; van der Beek, Allard J; van Mechelen, Willem

    2010-11-09

    To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. In 427 older workers (aged 45 + years) participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673). There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006), after adjusting for age, gender and chronic disease status. VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale), but not with occupational health related vitality (measured with the UWES Vitality Scale). The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. NTR1240.

  17. Min-max optimal public service system design

    Directory of Open Access Journals (Sweden)

    Marek Kvet

    2015-03-01

    Full Text Available This paper deals with designing a fair public service system. To achieve fairness, various schemes are be applied. The strongest criterion in the process is minimization of disutility of the worst situated users and then optimization of disutility of the better situated users under the condition that disutility of the worst situated users does not worsen, otherwise called lexicographical minimization. Focusing on the first step, this paper endeavours to find an effective solution to the weighted p-median problem based on radial formulation. Attempts at solving real instances when using a location-allocation model often fail due to enormous computational time or huge memory demands. Radial formulation can be implemented using commercial optimisation software. The main goal of this study is to show that the suitability solving of the min-max optimal public service system design can save computational time.

  18. Bureaucracy and Education: an analysis since Max Weber

    Directory of Open Access Journals (Sweden)

    João Alfredo Costa de Campos Melo Júnior

    2010-06-01

    Full Text Available This paper aims at providing a discussion on bureaucracy and education based on the comprehensive sociology developed by Weber. The choice of Max Weber seems to be the most appropriate due the diversity and depth of his intellectual production, what includes the issue of bureaucracy. The use of Weber should serve as a precise instrument of conceptual analysis on the theme addressed here. Certainly, this thinker has been one of the main scholars on bureaucracy, with focus on Germany at the time of the First World War (1914-1918. It is within such a productive theoretical framework that we intend to provide a few reflections about education and bureaucracy from a Weberian epistemological base.

  19. Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson ; interv. Kai Tänavsuu

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2002-01-01

    Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni esimees Max Jakobson oma suhtumisest talle Maarjamaa Risti I klassi teenetemärgi andmisse, tema juhitava komisjoni tööst, eestlaste püüdlusest ühineda NATOga, kommunismi ja natsismi hukkamõistust

  20. MAXED, a computer code for the deconvolution of multisphere neutron spectrometer data using the maximum entropy method

    International Nuclear Information System (INIS)

    Reginatto, M.; Goldhagen, P.

    1998-06-01

    The problem of analyzing data from a multisphere neutron spectrometer to infer the energy spectrum of the incident neutrons is discussed. The main features of the code MAXED, a computer program developed to apply the maximum entropy principle to the deconvolution (unfolding) of multisphere neutron spectrometer data, are described, and the use of the code is illustrated with an example. A user's guide for the code MAXED is included in an appendix. The code is available from the authors upon request

  1. Multivariate max-stable spatial processes

    KAUST Repository

    Genton, Marc G.; Padoan, S. A.; Sang, H.

    2015-01-01

    Max-stable processes allow the spatial dependence of extremes to be modelled and quantified, so they are widely adopted in applications. For a better understanding of extremes, it may be useful to study several variables simultaneously. To this end, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. We define a Poisson process construction and introduce multivariate versions of the Smith Gaussian extreme-value, the Schlather extremal-Gaussian and extremal-t, and the Brown–Resnick models. We develop inference for the models based on composite likelihoods. We present results of Monte Carlo simulations and an application to daily maximum wind speed and wind gust.

  2. Multivariate max-stable spatial processes

    KAUST Repository

    Genton, Marc G.

    2015-02-11

    Max-stable processes allow the spatial dependence of extremes to be modelled and quantified, so they are widely adopted in applications. For a better understanding of extremes, it may be useful to study several variables simultaneously. To this end, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. We define a Poisson process construction and introduce multivariate versions of the Smith Gaussian extreme-value, the Schlather extremal-Gaussian and extremal-t, and the Brown–Resnick models. We develop inference for the models based on composite likelihoods. We present results of Monte Carlo simulations and an application to daily maximum wind speed and wind gust.

  3. Un manuscrito del taller de Max Aub

    Directory of Open Access Journals (Sweden)

    Javier Lluch Prats

    2002-11-01

    Full Text Available Max Aub's legacy has recently helped to find some of the author's autograph testimonies than enlighten his printed work. The manuscript of the historical novel Campo del Moro (1963 is here described and the contributions of a modern manuscript to a critical-genetic edition are also appreciated. The composition elements of Campo del Moro are particularly analyzed the title, the quotations, the working plan and the notes about the characters. All this results in a better knowledge of the novel, gíving us the possibility of describing the process of its writing so as to facilitate the narration of its editorial vicissitiudes. i.e. genesis, preparation, edition and, publication.

  4. Max Weber entre liberalismo y republicanismo

    Directory of Open Access Journals (Sweden)

    Villacañas Berlanga, José Luis

    2005-12-01

    Full Text Available This article attempts to analyze the differences between social democracy and political democracy as modern processes, as these were understood by Max Weber. The archetype of modernity resides, from this point of view, in a convergence of both processes, as occurred in countries like the USA and Great Britain. Weber's diagnosis is that, whereas social democracy can be organized around liberal arguments, political democracy cannot advance without republican concepts like those of virtue, rigour, responsability and representation. For Weber, these values could only become present in Germany thanks to an adequate and democratic reception of Nietzsche, and in some way this reception could make sense of the former's work.

    Este artículo pretende analizar las diferencias entre democracia social y democracia política como procesos modernos, tal y como fueron comprendidos por Max Weber. Lo arquetípico de la modernidad reside, desde este punto de vista, en una convergencia de ambos procesos, tal y como se dio en países como USA y Gran Bretaña. El diagnóstico de Weber es que, mientras la democracia social puede organizarse sobre argumentos liberales, la democracia política no puede avanzar sin conceptos republicanos como el de virtud, rigor, responsabilidad y representación. Para Weber, estos valores sólo podrían hacerse presentes en Alemania a partir de una recepción adecuada y democrática de Nietzsche y en cierto modo esta recepción daría sentido a su obra.

  5. Modcomp MAX IV System Processors reference guide

    Energy Technology Data Exchange (ETDEWEB)

    Cummings, J.

    1990-10-01

    A user almost always faces a big problem when having to learn to use a new computer system. The information necessary to use the system is often scattered throughout many different manuals. The user also faces the problem of extracting the information really needed from each manual. Very few computer vendors supply a single Users Guide or even a manual to help the new user locate the necessary manuals. Modcomp is no exception to this, Modcomp MAX IV requires that the user be familiar with the system file usage which adds to the problem. At General Atomics there is an ever increasing need for new users to learn how to use the Modcomp computers. This paper was written to provide a condensed Users Reference Guide'' for Modcomp computer users. This manual should be of value not only to new users but any users that are not Modcomp computer systems experts. This Users Reference Guide'' is intended to provided the basic information for the use of the various Modcomp System Processors necessary to, create, compile, link-edit, and catalog a program. Only the information necessary to provide the user with a basic understanding of the Systems Processors is included. This document provides enough information for the majority of programmers to use the Modcomp computers without having to refer to any other manuals. A lot of emphasis has been placed on the file description and usage for each of the System Processors. This allows the user to understand how Modcomp MAX IV does things rather than just learning the system commands.

  6. Spanish genetic admixture is associated with larger V(O2) max decrement from sea level to 4338 m in Peruvian Quechua.

    Science.gov (United States)

    Brutsaert, Tom D; Parra, Esteban J; Shriver, Mark D; Gamboa, Alfredo; Palacios, Jose-Antonio; Rivera, Maria; Rodriguez, Ivette; León-Velarde, Fabiola

    2003-08-01

    Quechua in the Andes may be genetically adapted to altitude and able to resist decrements in maximal O2 consumption in hypoxia (DeltaVo2 max). This hypothesis was tested via repeated measures of Vo2 max (sea level vs. 4338 m) in 30 men of mixed Spanish and Quechua origins. Individual genetic admixture level (%Spanish ancestry) was estimated by using ancestry-informative DNA markers. Genetic admixture explained a significant proportion of the variability in DeltaVo2 max after control for covariate effects, including sea level Vo2 max and the decrement in arterial O2 saturation measured at Vo2 max (DeltaSpO2 max) (R2 for admixture and covariate effects approximately 0.80). The genetic effect reflected a main effect of admixture on DeltaVo2 max (P = 0.041) and an interaction between admixture and DeltaSpO2 max (P = 0.018). Admixture predicted DeltaVo2 max only in subjects with a large DeltaSpO2 max (P = 0.031). In such subjects, DeltaVo2 max was 12-18% larger in a subgroup of subjects with high vs. low Spanish ancestry, with least squares mean values (+/-SE) of 739 +/- 71 vs. 606 +/- 68 ml/min, respectively. A trend for interaction (P = 0.095) was also noted between admixture and the decrease in ventilatory threshold at 4338 m. As previously, admixture predicted DeltaVo2 max only in subjects with a large decrease in ventilatory threshold. These findings suggest that the genetic effect on DeltaVo2 max depends on a subject's aerobic fitness. Genetic effects may be more important (or easier to detect) in athletic subjects who are more likely to show gas-exchange impairment during exercise. The results of this study are consistent with the evolutionary hypothesis and point to a better gas-exchange system in Quechua.

  7. Max Weber Visits America: A Review of the Video

    OpenAIRE

    Michael Wise

    2006-01-01

    The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976) to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided...

  8. Tukey max-stable processes for spatial extremes

    KAUST Repository

    Xu, Ganggang

    2016-09-21

    We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max-stable process are demonstrated theoretically and numerically. Simulation studies and an application to Swiss rainfall data indicate the effectiveness of the proposed process. © 2016 Elsevier B.V.

  9. Max Weber Visits America: A Review of the Video

    Directory of Open Access Journals (Sweden)

    Michael Wise

    2006-11-01

    Full Text Available The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976 to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided using the .mp4 format. The video should appeal to students and professors interested in Max Weber. It can be included in courses ranging from introductory sociology to theory.

  10. Synthesis and Characterization of MAX Ceramics (MAXCERs)

    Science.gov (United States)

    Nelson, Johnny Carl

    This research has focused on the design and development of novel multifunctional MAX reinforced ceramics (MAXCERs). These MAXCERs were manufactured with 1-50 vol% ratios of ceramics to MAX phases. Chapter II reports on the synthesis and tribological behavior of Ti3SiC2 matrix composites by incorporating (1 and 6 vol%) Al2O3, (1 and 5 vol%) BN, and (1 and 5 vol%) B4C ceramic particulate additives in the matrix. All the composites were fabricated by pressureless sintering by using 1 wt% Ni as a sintering agent at 1550 °C for 2 hours. SEM and XRD studies showed that Al2O3 is relatively inert in the Ti3SiC 2 matrix whereas BN and B4C reacted significantly with the Ti3 SiC2 matrix to form TiB2. Detailed tribological studies showed that Ti3SiC2-1wt%Ni (baseline) samples showed dual type tribological behavior where the friction coefficient (micro) was low ( 0.2) during stage 1, thereafter micro increased sharply and transitioned into stage 2 ( 0.8). The addition of Al2O3 as an additive had little effect on the tribological behavior, but the addition of B4C and BN was able to enhance the tribological behavior by increasing the transition distance (TD). Chapter III reports on the synthesis and tribological behavior of TiB2 matrix composites by incorporating (10, 30, and 50 vol%) Ti3SiC2 ceramic particulate additives in the matrix. The fabrication parameters were similar to the Ti3SiC2 samples from Chapter II. There was minimal reaction between the TiB2 and the Ti3SiC2. Detailed tribological studies showed that TiB2 (baseline) and TiB2-10%Ti 3SiC2 samples showed an average micro of 0.29 and 0.28, respectively. TiB2-30%Ti3SiC2 and TiB 2-50%Ti3SiC2 showed dual-type tribological behavior where micro was low ( 0.25) during stage 1, thereafter micro increased gradually and transitioned into stage 2 ( 0.6). Low wear rates were seen for all samples.

  11. Annealing study of main electron irradiation-induced defects (H4 and H5) in P-In P using DLTS technique

    International Nuclear Information System (INIS)

    Massarani, B.; Awad, F.; Kaaka, M.

    1992-12-01

    Thermal annealing of the two hole traps H 4 and H 5 in room-temperature electron-irradiated In P Schottky diodes was investigated. Electron-irradiation energy ranging between 0.15 and 1.5 MeV with doses ranging between 5 x 10 14 and 10 16 e/cm 2 . DLTS technique with double-phase detector was used in this study. Contrary to what is generally admitted, we found that H 5 anneals out at about 150 C o with an activation energy of 1 eV. We have shown that H 4 is a complex defect having two components that we could resolve. While the first one, having lower emission cross section and higher capture cross section with ΔE = 0.37 eV anneals out at about 110 C o . The other component, with ΔE = 0.50 eV is thermally stable even above 170 C o . (author). 13 refs., 17 figs., 2 tabs

  12. Unusual bonding and properties in main group element chemistry: rational synthesis, characterization, and experimental electron density determination of mixed-valent tetraphosphetes.

    Science.gov (United States)

    Breuers, Verena; Lehmann, Christian W; Frank, Walter

    2015-03-16

    Five dispirocyclic λ(3),λ(5)-tetraphosphetes [{R2Si(NR(1))(NR(2))P2}2] (R(1) = R(2) and R(1) ≠ R(2)) are easily prepared in almost quantitative yields via photolysis of the respective bis(trimethylsilyl)phosphanyldiazaphosphasiletidines with intense visible light. These deep-yellow low-coordinate phosphorus compounds can be considered as the first higher congeners of the well-known cyclodiphosphazenes. The tetraphosphetes are remarkably stable in air and show unexpected molecular properties related to the unique bonding situation of the central four-π-electron four-membered phosphorus ring. The extent of rhombic distortion of the central P4 ring is remarkable due to an unusually acute angle at the σ(2)-phosphorus atoms. All of the P-P bonds are approximately equal in length. The distances are in the middle of the range given by phosphorus single and double bonds. The anisotropic absorption of visible light that can easily be observed in the case of the yellow/colorless dichroic crystals of [{Me2Si(NtBu)(NtBu)P2}2] and the exceptional (31)P NMR chemical shift of the σ(2)-phosphorus atoms are the most remarkable features of the λ(3),λ(5)-tetraphosphetes. In the case of [{Me2Si(NtBu)(NtBu)P2}2], the Hansen-Coppens multipole model is applied to extract the electron density from high-resolution X-ray diffraction data obtained at 100 K. Static deformation density and topological analysis reveal a unique bonding situation in the central unsaturated P4 fragment characterized by polar σ-bonding, pronounced out-of-ring non-bonding lone pair density on the σ(2)-phosphorus atoms, and an additional non-classical three-center back-bonding contribution. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Intertextuality and Television Discourse: The Max Headroom Story.

    Science.gov (United States)

    Braddlee

    Max Headroom, the computer-generated media personality, presents a good opportunity for an investigation of the degree of intertextuality in television. Max combines narrative genres (science fiction and film noir), television program types (prime-time episodic narrative, made-for-TV movie, talkshows), advertising and programming, and electronic…

  14. Max Weber's Critique of the Bureaucratisation of Education

    Science.gov (United States)

    Madan, Amman

    2014-01-01

    In this commentary, the author discusses the critique by Max Weber and his views on bureaucratisation of education. The modern school, said Max Weber (1864-1920) over a hundred years ago, has as its educational ideal the bureaucrat and no longer the cultivated elite of older times. The shift to modernity and to its characteristic institution, the…

  15. Reachability analysis for timed automata using max-plus algebra

    DEFF Research Database (Denmark)

    Lu, Qi; Madsen, Michael; Milata, Martin

    2012-01-01

    We show that max-plus polyhedra are usable as a data structure in reachability analysis of timed automata. Drawing inspiration from the extensive work that has been done on difference bound matrices, as well as previous work on max-plus polyhedra in other areas, we develop the algorithms needed...

  16. Max Jakobsoni saatuseaastad, soomlased ja meie / Imbi Paju

    Index Scriptorium Estoniae

    Paju, Imbi, 1959-

    2008-01-01

    Soome politoloogist ja diplomaadist Max Jakobsonist ja tema uuest raamatust "Saatuseaastad. Soome tõusis, andis Venemaale järele ja pääses". Artiklis on juttu ka Max Jakobsoni suhetest Eesti presidentide Lennart Meri ja Toomas Hendrik Ilvesega

  17. Deterministic algorithms for multi-criteria Max-TSP

    NARCIS (Netherlands)

    Manthey, Bodo

    2012-01-01

    We present deterministic approximation algorithms for the multi-criteria maximum traveling salesman problem (Max-TSP). Our algorithms are faster and simpler than the existing randomized algorithms. We devise algorithms for the symmetric and asymmetric multi-criteria Max-TSP that achieve ratios of

  18. Max Weber in the United States

    Directory of Open Access Journals (Sweden)

    Lawrence A. Scaff

    2014-05-01

    Full Text Available In his contribution L. Scaff outlines the reception history of Max Weber’s work from its beginnings down to the present. It highlights the importance of the first translations, including those by prominent American authors and particularly those who had studied in Germany; and then in the post-war years the role of emigrants familiar with Weber’s work. The establishment of Weber texts as compulsory reading in the curricula of American colleges also played a significant role. The striking readiness, even ease, with which Weber was received in America is something Scaff deduces from three “narratives that captured the imagination of the American audience”. The first is the narrative of voluntarism, i.e. “the way in which Weber developed his conception of the sect and its effects on the individual and society”. Next is the narrative of achievement, in the sense of “mastery of the world”, preceded by “mastery of the self”, which “when put into practice entailed the conquest of the New World’s primordial wilderness”. Finally there is the narrative of redemption as “the most potent founding myth of the American experience”: “The quest for salvation that began as a religiously inspired message became transformed into a secularized cultural theme: the search for the possibility of breaking free from constraints in order to create a better life, to renew the self, to gain a second chance by atoning for moral failures, and to find reconciliation with God, humankind, and the world.”

  19. Development of constraint algorithm for the number of electrons in molecular orbitals consisting mainly 4f atomic orbitals of rare-earth elements and its introduction to tight-binding quantum chemical molecular dynamics method

    International Nuclear Information System (INIS)

    Endou, Akira; Onuma, Hiroaki; Jung, Sun-ho

    2007-01-01

    Our original tight-binding quantum chemical molecular dynamics code, Colors', has been successfully applied to the theoretical investigation of complex materials including rare-earth elements, e.g., metal catalysts supported on a CeO 2 surface. To expand our code so as to obtain a good convergence for the electronic structure of a calculation system including a rare-earth element, we developed a novel algorithm to provide a constraint condition for the number of electrons occupying the selected molecular orbitals that mainly consist of 4f atomic orbitals of the rare-earth element. This novel algorithm was introduced in Colors. Using Colors, we succeeded in obtaining the classified electronic configurations of the 4f atomic orbitals of Ce 4+ and reduced Ce ions in a CeO 2 bulk model with one oxygen defect, which makes it difficult to obtain a good convergence using a conventional first-principles quantum chemical calculation code. (author)

  20. A Fast Numerical Method for Max-Convolution and the Application to Efficient Max-Product Inference in Bayesian Networks.

    Science.gov (United States)

    Serang, Oliver

    2015-08-01

    Observations depending on sums of random variables are common throughout many fields; however, no efficient solution is currently known for performing max-product inference on these sums of general discrete distributions (max-product inference can be used to obtain maximum a posteriori estimates). The limiting step to max-product inference is the max-convolution problem (sometimes presented in log-transformed form and denoted as "infimal convolution," "min-convolution," or "convolution on the tropical semiring"), for which no O(k log(k)) method is currently known. Presented here is an O(k log(k)) numerical method for estimating the max-convolution of two nonnegative vectors (e.g., two probability mass functions), where k is the length of the larger vector. This numerical max-convolution method is then demonstrated by performing fast max-product inference on a convolution tree, a data structure for performing fast inference given information on the sum of n discrete random variables in O(nk log(nk)log(n)) steps (where each random variable has an arbitrary prior distribution on k contiguous possible states). The numerical max-convolution method can be applied to specialized classes of hidden Markov models to reduce the runtime of computing the Viterbi path from nk(2) to nk log(k), and has potential application to the all-pairs shortest paths problem.

  1. MAX-DOAS measurements of NO2 column densities in Vienna

    Science.gov (United States)

    Schreier, Stefan; Weihs, Philipp; Peters, Enno; Richter, Andreas; Ostendorf, Mareike; Schönhardt, Anja; Burrows, John P.; Schmalwieser, Alois

    2017-04-01

    In the VINDOBONA (VIenna horizontal aNd vertical Distribution OBservations Of Nitrogen dioxide and Aerosols) project, two Multi AXis Differential Optical Absorption Spectroscopy (MAX-DOAS) systems will be set up at two different locations and altitudes in Vienna, Austria. After comparison measurements in Bremen, Germany, and Cabauw, The Netherlands, the first of the two MAX-DOAS instruments was set up at the University of Veterinary Medicine in the northeastern part of Vienna in December 2016. The instrument performs spectral measurements of visible scattered sunlight at defined horizontal and vertical viewing directions. From these measurements, column densities of NO2 and aerosols are derived by applying the DOAS analysis. First preliminary results are presented. The second MAX-DOAS instrument will be set up in April/May 2017 at the University of Natural Resources and Life Sciences in the northwestern part of Vienna. Once these two instruments are measuring simultaneously, small campaigns including car DOAS zenith-sky and tower DOAS off-axis measurements are planned. The main emphasis of this project will be on the installation and operation of two MAX-DOAS instruments, the improvement of tropospheric NO2 and aerosol retrieval, and the characterization of the horizontal, vertical, and temporal variations of tropospheric NO2 and aerosols in Vienna, Austria.

  2. Electronics

    Science.gov (United States)

    2001-01-01

    International Acer Incorporated, Hsin Chu, Taiwan Aerospace Industrial Development Corporation, Taichung, Taiwan American Institute of Taiwan, Taipei, Taiwan...Singapore and Malaysia .5 - 4 - The largest market for semiconductor products is the high technology consumer electronics industry that consumes up...Singapore, and Malaysia . A new semiconductor facility costs around $3 billion to build and takes about two years to become operational

  3. Renovating the Main Building

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    CERN's "Main Building" is exactly that. The Organization's central hub, with hundreds of staff and visitors passing through its doors every day, will soon be getting a well-earned facelift. Refurbishment work will proceed in phases, starting with the Salle des Pas Perdus, the concourse between the Council Chamber and the Main Auditorium. By the end of August, informal seating areas will be installed, electronic display panels will provide practical information and improved sound insulation will enhance conditions in the auditoria and surrounding meeting rooms.   In light green the area that will undergo the facelift. Work will start in July. The ground floor is home to the entrance to Restaurant No. 1, the bank, the post office, the travel agent, the Users Office, the Staff Association, the notice boards etc. Step up to the first floor to access CERN's largest lecture theatre, the Council Chamber and its "Pas Perdus" lobby. Everyone who works at or visits CERN i...

  4. Digital logic circuit design with ALTERA MAX+PLUS II

    International Nuclear Information System (INIS)

    Lee, Seung Ho; Park, Yong Su; Lee, Ju Heon

    2006-03-01

    Contents of this book are the kinds of integrated circuit, design process of integrated circuit, introduction of ALTERA MAX+PLUS II, designing logic circuit with VHDL of ALTERA MAX+PLUS II, grammar and practice of VHDL of ALTERA MAX+PLUS II, design for adder, subtractor, parallel binary subtractor, BCD design, CLA design, code converter design, ALU design, register design, counter design, accumulator design, state machine design, frequency divider design, circuit design with TENMILLION counter, LCD module, circuit design for control the outside RAM in training kit and introduction for HEB-DTK-20K-240/HBE-DTK-IOK.

  5. Eight-component retrievals from ground-based MAX-DOAS observations

    Directory of Open Access Journals (Sweden)

    H. Irie

    2011-06-01

    Full Text Available We attempt for the first time to retrieve lower-tropospheric vertical profile information for 8 quantities from ground-based Multi-Axis Differential Optical Absorption Spectroscopy (MAX-DOAS observations. The components retrieved are the aerosol extinction coefficients at two wavelengths, 357 and 476 nm, and NO2, HCHO, CHOCHO, H2O, SO2, and O3 volume mixing ratios. A Japanese MAX-DOAS profile retrieval algorithm, version 1 (JM1, is applied to observations performed at Cabauw, the Netherlands (51.97° N, 4.93° E, in June–July 2009 during the Cabauw Intercomparison campaign of Nitrogen Dioxide measuring Instruments (CINDI. Of the retrieved profiles, we focus here on the lowest-layer data (mean values at altitudes 0–1 km, where the sensitivity is usually highest owing to the longest light path. In support of the capability of the multi-component retrievals, we find reasonable overall agreement with independent data sets, including a regional chemical transport model (CHIMERE and in situ observations performed near the surface (2–3 m and at the 200-m height level of the tall tower in Cabauw. Plumes of enhanced HCHO and SO2 were likely affected by biogenic and ship emissions, respectively, and an improvement in their emission strengths is suggested for better agreement between CHIMERE simulations and MAX-DOAS observations. Analysis of air mass factors indicates that the horizontal spatial representativeness of MAX-DOAS observations is about 3–15 km (depending mainly on aerosol extinction, comparable to or better than the spatial resolution of current UV-visible satellite observations and model calculations. These demonstrate that MAX-DOAS provides multi-component data useful for the evaluation of satellite observations and model calculations and can play an important role in bridging different data sets having different spatial resolutions.

  6. Is Recreational Soccer Effective for Improving VO2max A Systematic Review and Meta-Analysis.

    Science.gov (United States)

    Milanović, Zoran; Pantelić, Saša; Čović, Nedim; Sporiš, Goran; Krustrup, Peter

    2015-09-01

    Soccer is the most popular sport worldwide, with a long history and currently more than 500 million active participants, of whom 300 million are registered football club members. On the basis of scientific findings showing positive fitness and health effects of recreational soccer, FIFA (Fédération Internationale de Football Association) introduced the slogan "Playing football for 45 min twice a week-best prevention of non-communicable diseases" in 2010. The objective of this paper was to perform a systematic review and meta-analysis of the literature to determine the effects of recreational soccer on maximal oxygen uptake (VO2max). Six electronic databases (MEDLINE, PubMed, SPORTDiscus, Web of Science, CINAHL and Google Scholar) were searched for original research articles. A manual search was performed to cover the areas of recreational soccer, recreational physical activity, recreational small-sided games and VO2max using the following key terms, either singly or in combination: recreational small-sided games, recreational football, recreational soccer, street football, street soccer, effect, maximal oxygen uptake, peak oxygen uptake, cardiorespiratory fitness, VO2max. The inclusion criteria were divided into four sections: type of study, type of participants, type of interventions and type of outcome measures. Probabilistic magnitude-based inferences for meta-analysed effects were based on standardised thresholds for small, moderate and large changes (0.2, 0.6 and 1.2, respectively) derived from between-subject standard deviations for baseline fitness. Seventeen studies met the inclusion criteria and were included in the systematic review and meta-analysis. Mean differences showed that VO2max increased by 3.51 mL/kg/min (95 % CI 3.07-4.15) over a recreational soccer training programme in comparison with other training models. The meta-analysed effects of recreational soccer on VO2max compared with the controls of no exercise, continuous running and strength

  7. Max plus at work modeling and analysis of synchronized systems a course on max-plus algebra and its applications

    CERN Document Server

    Heidergott, Bernd; van der Woude, Jacob

    2014-01-01

    Trains pull into a railroad station and must wait for each other before leaving again in order to let passengers change trains. How do mathematicians then calculate a railroad timetable that accurately reflects their comings and goings? One approach is to use max-plus algebra, a framework used to model Discrete Event Systems, which are well suited to describe the ordering and timing of events. This is the first textbook on max-plus algebra, providing a concise and self-contained introduction to the topic. Applications of max-plus algebra abound in the world around us. Traffic systems, compu

  8. Turg Tallinnas = A market for Tallinn / Max Rink

    Index Scriptorium Estoniae

    Rink, Max

    2007-01-01

    Hollandi arhitektuurikoolide lõputööde preemia Archiprix võitis 2007. a. Max Rink Delfti Tehnikaülikoolist Tallinna Balti jaama turu asemele kavandatud mitmefunktsioonilise turuhoone projektiga "Maja-turg". Juhendaja Klaske Havik

  9. Digital logic circuit design with ALTERA MAX+PLUS II

    International Nuclear Information System (INIS)

    Lee, Seung Ho; Park, Yong Su; Park, Gun Jong; Lee, Ju Heon

    2006-09-01

    This book is composed of five parts. The first part has introduction of ALTERA MAX+PLUS II and graphic editor, text editor, compiler, waveform editor simulator and timing analyzer of it. The second part is about direction of digital logic circuit design with training kit. The third part has grammar and practice of VHDL in ALTERA MAX+PLUS II including example and history of VHDL. The fourth part shows the design example of digital logic circuit by VHDL of ALTERA MAX+PLUS II which lists designs of adder and subtractor, code converter, counter, state machine and LCD module. The last part explains design example of digital logic circuit by graphic editor in ALTERA MAX+PLUS II.

  10. Projekti Min-E-Max kohtumine Saksamaal / Katrin Arge

    Index Scriptorium Estoniae

    Arge, Katrin

    2005-01-01

    Oktoobri keskel toimus Lõuna-Saksamaa väikelinnas Oberderdingenis Hispaania, Portugali, Ungari, Leedu, Eesti ja Saksamaa õpetajate kohtumine seoses Euroopa Liidu poolt rahastatava Comenius1 projektiga Min-E-Max (minimum energy input maximum output)

  11. Availability and Usability of BHO Encounter Data in MAX 2009

    Data.gov (United States)

    U.S. Department of Health & Human Services — Availability and Usability of Behavioral Health Organization Encounter Data in MAX 2009, published in Volume 4, Issue 2 of Medicare and Medicaid Research Review,...

  12. Maks Kaur : "Uverenno idti dalshe!" / Max Kaur ; interv. Viktor Volohhov

    Index Scriptorium Estoniae

    Kaur, Max, 1969-

    2006-01-01

    Noor ja poliitikas aktiivselt tegev olnud Max Kaur jätkab Majandus- ja juhtimisinstituudi prorektorina. Senisest poliitilisest tegevusest, vene kultuuri arengust ja probleemidest Eestis, poliitikas osalejate keskmise vanuse langusest, isiklikest plaanidest

  13. Efficient production of transgenic soybean (Glycine max [L] Merrill ...

    African Journals Online (AJOL)

    Efficient production of transgenic soybean (Glycine max [L] Merrill) plants mediated via whisker-supersonic (WSS) method. MM Khalafalla, HA El-Shemy, SM Rahman, M Teraishi, H Hasegawa, T Terakawa, M Ishimoto ...

  14. ELA-max: A new topical lidocaine formulation.

    Science.gov (United States)

    Goldman, Ran D

    2004-05-01

    To evaluate the role of a new formulation of lidocaine (ELA-max) in local anesthesia in children and compare it with the eutectic mixture of local anesthetics (EMLA). Relevant literature was identified by a MEDLINE search (1966-November 2003) using the search terms ELA-max and EMLA. Bibliographies of selected articles were also examined to include all relevant investigations. The product manufacturer was contacted for inclusion of the most recent data available. Topical anesthesia in children is clinically challenging. ELA-max has been shown to be as effective as EMLA for venipuncture in children, but with faster onset. Adverse effects, such as transient blanching with redness and erythema, have been reported. Further investigation is needed to determine the effectiveness of ELA-max on other painful procedures in children, as well as its safety.

  15. Knowledge, organization, and management building on the work of Max Boisot

    CERN Document Server

    Ihrig, Martin

    2013-01-01

    Max Boisot was one of the most original thinkers in management and organization studies. An independent scholar with an independent, enquiring, and innovative mind, his work ranged over a number of different areas from early attempts to understand contemporary developments in China to the role of information in organizations, and later the management of Big Science. Yet, as this book shows, there was a central strand that ran through these apparently diverse areas, which was the attempt to understand the relationship between knowledge and information, and its organization -- in firms, organizations, and societies -- by means of the model Boisot developed, the 'I-Space'. Knowledge, Organization, and Management brings together key examples of Max Boisot's work into a single volume, setting these alongside original, extended commentaries and reflections by his academic collaborators. Structured under five core sections, it covers the main areas in which he forged new understandings: analyses of the Chinese syste...

  16. Electron Cloud Parameterization Studies in the LHC

    CERN Document Server

    Dominguez, O; Baglin, V; Bregliozzi, G; Jimenez, J M; Metral, E; Rumolo, G; Schulte, D; Zimmermann, F

    2011-01-01

    During LHC beam commissioning with 150, 75 and 50-ns bunch spacing, important electron-cloud effects, like pressure rise, cryogenic heat load, beam instabilities or emittance growth, were observed. The main strategy to combat the LHC electron cloud, defined about ten years ago, relies on the surface conditioning arising from the chamber-surface bombardment with cloud electrons. In a standard model, the conditioning state of the beam-pipe surface is characterized by three parameters: 1. most importantly, the secondary emission yield δmax; 2. the incident electron energy at which the yield is maximum, ε_max; and 3. the probability of elastic reflection of low-energy primary electrons hitting the chamber wall, R. Since at the LHC no in-situ secondary-yield measurements are available, we compare the relative local pressure-rise measurements taken for different beam configurations against simulations in which surface parameters are scanned. This benchmarking of measurements and simulations is used to infer the s...

  17. Max Jakobson : Vene ohtu täna veel pole / Max Jakobson ; interv. Vallo Toomet, Urmet Kook, Kaarel Tarand

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2003-01-01

    Balti riikide NATOga liitumise mõjust julgeolekule Läänemere regioonis, Euroopa Liidu kaitsepoliitikast ning Venemaa ja islamiterrorismi ohust julgeolekule. Vt. samas: Toomas Hiio ülevaade Max Jakobsoni elust ja tegevusest

  18. Ford C-Max plug-in hybrid; Ford C-Max mit Plug-in-Hybridtechnik

    Energy Technology Data Exchange (ETDEWEB)

    Schamel, Andreas; D' Annunzio, Julie; Iorio, Rob [Ford Motor Company, Dearborn, MI (United States); Schmitz, Peter [Ford-Forschungszentrum Aachen GmbH, Aachen (Germany)

    2013-03-01

    Ford provides consumers a broad choice of electrified vehicles globally, including full hybrids, plug-in hybrids and all-electric vehicles. The all-new 2013 model year C-Max Energi Plug-in Hybrid utilises the third generation of Ford hybrid technology. This article discusses the hybrid powersplit architecture and components, as well as the charging capability and human-machine interfaces, used in the C-Max Energi Plug-In Hybrid. (orig.)

  19. Validation of masks for determination of V̇O2 max in horses exercising at high intensity.

    Science.gov (United States)

    Sides, R H; Kirkpatrick, R; Renner, E; Gough, K; Katz, L M; Evans, D L; Bayly, W M

    2018-01-01

    The need for a horse to be ridden while wearing a measurement device that allows unrestricted ventilation and gas exchange has hampered accurate measurement of its maximal oxygen consumption (V̇O 2 max) under field conditions. Design and validate a facemask with the potential to measure V̇O 2 max accurately in the field. Experiment with 6 × 6 Latin square design. Two variations of a mask and associated electronic control module (ECM) were designed to enable breath-by-breath measurement of airflows through two 7.8 cm diameter pneumotachometers located 7.5 cm in front of each narus. The ECM was comprised of an analogue-to-digital converter and a lithium-ion battery that provided power and signal filtering to the pneumotachometers and an oxygen sensing cell, and powered a pump connected to gas sampling ports between the nares and pneumotachometers. Airflow and oxygen content of inspired and expired gases were recorded through the ECM and electronically transferred to a notebook. V̇O 2 was determined from these recordings using a customised software program. Mask B encased the lower jaw. Mask R left the jaw free so the horse could wear a bit if ridden. V̇O 2 max and arterial blood gases were measured in 6 horses during multiple treadmill tests. Each mask was worn twice and results compared to those from an established open flow-through system (O) by ANOVA-RM (Pmasks. V̇O 2 max measures were reproducible for each mask. Intraclass correlation coefficient between raters = 0.99. Some rebreathing of expired air from mask dead space. Masks capable of measuring V̇O 2 max during treadmill exercise were developed, tested and found to be accurate. Mask R has potential application to measurement of V̇O 2 max under field conditions. © 2017 EVJ Ltd.

  20. Studies of E-Cloud Build up for the FNAL Main Injector and for the LHC

    International Nuclear Information System (INIS)

    Furman, M.A.

    2006-01-01

    We present a summary of recent simulation studies of the electron-cloud (EC) build-up for the FNAL MI and for the LHC. In the first case we pay particular attention to the dependence on bunch intensity N b at injection energy assuming the nominal bunch spacing t b = 19 ns, and we focus on the dipole magnets and field-free regions. The saturated value of the average EC density shows a clear threshold in N b beyond which the beam will be approximately neutralized on average. For the case of the LHC we limit our discussion to arc dipoles at collision energy, and bunch spacings t b = 25 ns or t b = 75 ns. The main variables exercised in this study are N b and the peak value of the secondary emission yield (SEY) (delta) max . For t b = 25 ns we conclude that the EC power deposition is comfortably below the available cooling capacity of the cryogenic system if (delta) max is below ∼ 1.2 at nominal N b . For t b = 75 ns, the EC power deposition is insignificant. As a byproduct of this exercise, we reach a detailed understanding of the significant role played by the backscattered secondary electrons. This article summarizes the results, an slightly extends the discussions, presented in Refs. 1 and 2

  1. Microstructure and Oxidation of a MAX Phase/Superalloy Hybrid Interface

    Science.gov (United States)

    Smialek, James L.; Garg, Anita

    2014-01-01

    Corrosion resistant, strain tolerant MAX phase coatings are of interest for turbine applications. Thin Cr2AlC MAX phase wafers were vacuum diffusion bonded to an advanced turbine disk alloy, LSHR, at 1100 C. The interface, examined by optical and scanning electron microscopy, revealed a primary diffusion zone consisting of 10 micrometers of beta-Ni(Co)Al, decorated with various NiCoCrAl, MC and M3B2 precipitates. On the Cr2AlC side, an additional 40 micrometers Al-depletion zone of Cr7C3 formed in an interconnected network with the beta-Ni(Co)Al. Oxidation of an exposed edge at 800 C for 100 h produced a fine-grained lenticular alumina scale over Cr2AlC and beta-Ni(Co)Al, with coarser chromia granules over the Cr7C3 regions. Subsequent growth of the diffusion layers was only 5 micrometers in total. A residual stress of 500 MPa was estimated for the MAX phase layer, but no interfacial damage was observed. Subsequent tests for 1000 h reveal similar results.

  2. Max-Planck-Institut fuer Plasmaphysik. Annual report 1993

    International Nuclear Information System (INIS)

    1993-01-01

    In 1993 the first particle injector of the ASDEX Upgrade divertor tokamak was put into operation up to 6 MW of heating power. The main diagnostics were put into operation as also was a newly developed pellet centrifuge. At the Wendelstein 7-AS stellarator experiment the cooperation with Russian and German research institutes an electron cyclotron resonance heating was successful. The works of the Berlin Division of IPP and the coordination of research efforts with Kernforschungszentrum Karlsruhe are reported. (DG)

  3. Research on 3D virtual campus scene modeling based on 3ds Max and VRML

    Science.gov (United States)

    Kang, Chuanli; Zhou, Yanliu; Liang, Xianyue

    2015-12-01

    With the rapid development of modem technology, the digital information management and the virtual reality simulation technology has become a research hotspot. Virtual campus 3D model can not only express the real world objects of natural, real and vivid, and can expand the campus of the reality of time and space dimension, the combination of school environment and information. This paper mainly uses 3ds Max technology to create three-dimensional model of building and on campus buildings, special land etc. And then, the dynamic interactive function is realized by programming the object model in 3ds Max by VRML .This research focus on virtual campus scene modeling technology and VRML Scene Design, and the scene design process in a variety of real-time processing technology optimization strategy. This paper guarantees texture map image quality and improve the running speed of image texture mapping. According to the features and architecture of Guilin University of Technology, 3ds Max, AutoCAD and VRML were used to model the different objects of the virtual campus. Finally, the result of virtual campus scene is summarized.

  4. E2GPR - Edit your geometry, Execute GprMax2D and Plot the Results!

    Science.gov (United States)

    Pirrone, Daniele; Pajewski, Lara

    2015-04-01

    In order to predict correctly the Ground Penetrating Radar (GPR) response from a particular scenario, Maxwell's equations have to be solved, subject to the physical and geometrical properties of the considered problem and to its initial conditions. Several techniques have been developed in computational electromagnetics, for the solution of Maxwell's equations. These methods can be classified into two main categories: differential and integral equation solvers, which can be implemented in the time or spectral domain. All of the different methods present compromises between computational efficiency, stability, and the ability to model complex geometries. The Finite-Difference Time-Domain (FDTD) technique has several advantages over alternative approaches: it has inherent simplicity, efficiency and conditional stability; it is suitable to treat impulsive behavior of the electromagnetic field and can provide either ultra-wideband temporal waveforms or the sinusoidal steady-state response at any frequency within the excitation spectrum; it is accurate and highly versatile; and it has become a mature and well-researched technique. Moreover, the FDTD technique is suitable to be executed on parallel-processing CPU-based computers and to exploit the modern computer visualisation capabilities. GprMax [1] is a very well-known and largely validated FDTD software tool, implemented by A. Giannopoulos and available for free public download on www.gprmax.com, together with examples and a detailled user guide. The tool includes two electromagnetic wave simulators, GprMax2D and GprMax3D, for the full-wave simulation of two-dimensional and three-dimensional GPR models. In GprMax, everything can be done with the aid of simple commands that are used to define the model parameters and results to be calculated. These commands need to be entered in a simple ASCII text file. GprMax output files can be stored in ASCII or binary format. The software is provided with MATLAB functions, which

  5. iamxt: Max-tree toolbox for image processing and analysis

    Directory of Open Access Journals (Sweden)

    Roberto Souza

    2017-01-01

    Full Text Available The iamxt is an array-based max-tree toolbox implemented in Python using the NumPy library for array processing. It has state of the art methods for building and processing the max-tree, and a large set of visualization tools that allow to view the tree and the contents of its nodes. The array-based programming style and max-tree representation used in the toolbox make it simple to use. The intended audience of this toolbox includes mathematical morphology students and researchers that want to develop research in the field and image processing researchers that need a toolbox simple to use and easy to integrate in their applications.

  6. Max Aub, crítico e historiador literario

    Directory of Open Access Journals (Sweden)

    Francisco Caudet

    2002-11-01

    Full Text Available On the basis of similarities and dissimilarities in the consideration of authors dealt with in Discurso de la novela española contemporánea, Francisco Caudet points out Max Aub's poetics of realism stated in both his critical studies and fiction. This essay shows that Aub's contribution to the study of Mexican and Spanish literature is outstanding, not only because of his socio-historical approach, but also because of a specific perspective. This does not mean writing a "history" of literature but rather connecting creative processes. Committed during his youth to the avant-garde, Max Aub shifts after the Civil War to a type of new realistic writing. The author highlights Max Aub's activity as a critic discussing and commenting his sources. Aub's critical essays cannot be detached from his personal ideas about literary theory and practice.

  7. Max-Plus Stochastic Control and Risk-Sensitivity

    International Nuclear Information System (INIS)

    Fleming, Wendell H.; Kaise, Hidehiro; Sheu, Shuenn-Jyi

    2010-01-01

    In the Maslov idempotent probability calculus, expectations of random variables are defined so as to be linear with respect to max-plus addition and scalar multiplication. This paper considers control problems in which the objective is to minimize the max-plus expectation of some max-plus additive running cost. Such problems arise naturally as limits of some types of risk sensitive stochastic control problems. The value function is a viscosity solution to a quasivariational inequality (QVI) of dynamic programming. Equivalence of this QVI to a nonlinear parabolic PDE with discontinuous Hamiltonian is used to prove a comparison theorem for viscosity sub- and super-solutions. An example from mathematical finance is given, and an application in nonlinear H-infinity control is sketched.

  8. The interactional foundations of MaxEnt: Open questions

    Energy Technology Data Exchange (ETDEWEB)

    Harré, Michael S., E-mail: michael.harre@sydney.edu.au [Complex Systems Research Group, School of Civil Engineering, The University of Sydney, Sydney NSW 2006 (Australia)

    2014-12-05

    One of the simplest and potentially most useful techniques to be developed in the 20{sup th} century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals.

  9. The interactional foundations of MaxEnt: Open questions

    International Nuclear Information System (INIS)

    Harré, Michael S.

    2014-01-01

    One of the simplest and potentially most useful techniques to be developed in the 20 th century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals

  10. Optimal resampling for the noisy OneMax problem

    OpenAIRE

    Liu, Jialin; Fairbank, Michael; Pérez-Liébana, Diego; Lucas, Simon M.

    2016-01-01

    The OneMax problem is a standard benchmark optimisation problem for a binary search space. Recent work on applying a Bandit-Based Random Mutation Hill-Climbing algorithm to the noisy OneMax Problem showed that it is important to choose a good value for the resampling number to make a careful trade off between taking more samples in order to reduce noise, and taking fewer samples to reduce the total computational cost. This paper extends that observation, by deriving an analytical expression f...

  11. Max Tech and Beyond: Fluorescent Lamps

    Energy Technology Data Exchange (ETDEWEB)

    Scholand, Michael

    2012-04-01

    contains less material (i.e., glass, fill gas and phosphor), and has a higher luminance, enabling fixtures to take advantage of the smaller lamp size to improve the optics and provide more efficient overall system illuminance. In addition to offering the market a high-quality efficacious light source, another strong value proposition of fluorescent lighting is its long operating life. In today's market, one manufacturer is offering fluorescent lamps that have a rated life of 79,000 hours - which represents 18 years of service at 12 hours per day, 365 days per year. These lamps, operated using a long-life ballast specified by the manufacturer, take advantage of improvements in cathode coatings, fill gas chemistry and pressure to extend service life by a factor of four over conventional fluorescent lamps. It should be noted that this service life is also longer (approximately twice as long) as today's high-quality LED products. The fluorescent market is currently focused on the T5 and T8 lamp diameters, and it is not expected that other diameters would be introduced. Although T8 is a more optimal diameter from an efficacy perspective, the premium efficiency and optimization effort has been focused on T5 lamps because they are 40% smaller than T8, and are designed to operate at a higher temperature using high-frequency electronic ballasts. The T5 lamp offers savings in terms of materials, packaging and shipping, as well as smaller fixtures with improved optical performance. Manufacturers are actively researching improvements in four critical areas that are expected to yield additional efficacy improvements of approximately 10 to 14 percent over the next five years, ultimately achieving approximately 130 lumens per watt by 2015. The active areas of research where these improvements are anticipated include: (1) Improved phosphors which continue to be developed and patented, enabling higher efficacies as well as better color rendering and lumen maintenance; (2

  12. THE EFFECT OF SOME RHIZOBACTERIAN STRAINS ON SOLUBLE PROTEINS CONTENT IN SOYBEANS (GLYCINE MAX L. MERR.

    Directory of Open Access Journals (Sweden)

    Marius Stefan

    2007-08-01

    Full Text Available Now it is an accepted fact that plant growth-promoting rhizobacteria (PGPR can increase the productivity of several crops. The main objective of the present study was to find if there are any differences in protein content in the seeds of soybean (Glycine max L. MERR.. Using spectrophotometric methods for analyzing the protein contents and electrophoretic methods for qualitative analysis it was observed that no major modifications occur in protein spectrum. Looking at the quantitative side there was a small improvement in protein quantity.

  13. Albert Einstein and his mentor Max Talmey. The seventh Charles B. Snyder Lecture.

    Science.gov (United States)

    Ravin, J G

    1997-01-01

    While he was a student at the Munich medical school, Max Talmey strongly influenced the education of Albert Einstein. Their association occurred during five years of Einstein's second decade. They lost contact for many years after each left Munich. Talmey emigrated to the United States and practiced medicine, mainly ophthalmology, in New York City. He made significant contributions to medicine, to the popularization of Einstein's work, and to the development of international languages. The relationship of Talmey and Einstein was rekindled when Einstein visited and later moved to the United States.

  14. An optimal dynamic interval stabbing-max data structure?

    DEFF Research Database (Denmark)

    Agarwal, Pankaj Kumar; Arge, Lars; Yi, Ke

    2005-01-01

    In this paper we consider the dynamic stabbing-max problem, that is, the problem of dynamically maintaining a set S of n axis-parallel hyper-rectangles in Rd, where each rectangle s ∈ S has a weight w(s) ∈ R, so that the rectangle with the maximum weight containing a query point can be determined...

  15. Portrait Face-Off: Gilbert Stuart vs. Peter Max

    Science.gov (United States)

    Crumpecker, Cheryl

    2012-01-01

    When art classes are short and infrequent, it is always a challenge to meet required state and national standards. A unit comparing and contrasting Peter Max's Pop art portraits with the realistic style of Gilbert Stuart's presidential portraits provides an opportunity to address a huge number of these requirements. Focus can change with the age…

  16. IPP Max Planck Institute of Plasma of Physics at Garching

    International Nuclear Information System (INIS)

    1979-01-01

    The cost accounting system of the IPP Max Planck Institute of Plasma Physics at Garching is described with all details as there are cost class accounting, cost centers, cost units and resulting overall cost summary. Detailed instructions are given about the implementation of this cost accounting system into the organisational structure of the IPP. (A.N.)

  17. Elastic and Mechanical Properties of the MAX Phases

    Science.gov (United States)

    Barsoum, Michel W.; Radovic, Miladin

    2011-08-01

    The more than 60 ternary carbides and nitrides, with the general formula Mn+1AXn—where n = 1, 2, or 3; M is an early transition metal; A is an A-group element (a subset of groups 13-16); and X is C and/or N—represent a new class of layered solids, where Mn+1Xn layers are interleaved with pure A-group element layers. The growing interest in the Mn+1AXn phases lies in their unusual, and sometimes unique, set of properties that can be traced back to their layered nature and the fact that basal dislocations multiply and are mobile at room temperature. Because of their chemical and structural similarities, the MAX phases and their corresponding MX phases share many physical and chemical properties. In this paper we review our current understanding of the elastic and mechanical properties of bulk MAX phases where they differ significantly from their MX counterparts. Elastically the MAX phases are in general quite stiff and elastically isotropic. The MAX phases are relatively soft (2-8 GPa), are most readily machinable, and are damage tolerant. Some of them are also lightweight and resistant to thermal shock, oxidation, fatigue, and creep. In addition, they behave as nonlinear elastic solids, dissipating 25% of the mechanical energy during compressive cycling loading of up to 1 GPa at room temperature. At higher temperatures, they undergo a brittle-to-plastic transition, and their mechanical behavior is a strong function of deformation rate.

  18. Nuclear norm regularized convolutional Max Pos@Top machine

    KAUST Repository

    Li, Qinfeng; Zhou, Xiaofeng; Gu, Aihua; Li, Zonghua; Liang, Ru-Ze

    2016-01-01

    , named as Pos@Top. Our proposed classification model has a convolutional structure that is composed by four layers, i.e., the convolutional layer, the activation layer, the max-pooling layer and the full connection layer. In this paper, we propose

  19. Max Weber and the Iron Cage of Technology

    Science.gov (United States)

    Maley, Terry

    2004-01-01

    Max Weber is seen by mainstream social scientists as a sociologist, social theorist, and theorist of bureaucracy. In this reassessment of Weber's social science and its methodology, it is suggested that Weber can also be seen as a compelling early 20th-century critic of science and technology. The theme of technology, and Webers ambivalence about…

  20. MaxAlign: maximizing usable data in an alignment

    DEFF Research Database (Denmark)

    Oliveira, Rodrigo Gouveia; Sackett, Peter Wad; Pedersen, Anders Gorm

    2007-01-01

    Align. In this paper we also introduce a new simple measure of tree similarity, Normalized Symmetric Similarity (NSS) that we consider useful for comparing tree topologies. CONCLUSION: We demonstrate how MaxAlign is helpful in detecting misaligned or defective sequences without requiring manual inspection. We also...

  1. Multimedia programming using Max/MSP and TouchDesigner

    CERN Document Server

    Lechner, Patrik

    2014-01-01

    If you want to learn how to use Max 6 and/or TouchDesigner, or work in audio-visual real-time processing, this is the book for you. It is intended for intermediate users of both programs and can be helpful for artists, designers, musicians, VJs, and researchers. A basic understanding of audio principles is advantageous.

  2. Min-max event-triggered computation tree logic

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Temporal logic model-checking (Clarkeet al1986) is one of the most popular and well studied ... Min-max CTL, for reasoning about such extremal timing properties and showed .... A control flow decision is taken based on the value of one or more variables (like a ... We first present a few examples to informally explain the.

  3. Supervisory control of (max,+) automata: extensions towards applications

    Czech Academy of Sciences Publication Activity Database

    Lahaye, S.; Komenda, Jan; Boimond, J.-L.

    2015-01-01

    Roč. 88, č. 12 (2015), s. 2523-2537 ISSN 0020-7179 Institutional support: RVO:67985840 Keywords : discrete event systems * logical and time d behaviors * (max,+) automata * supervisory control Subject RIV: BA - General Mathematics Impact factor: 1.880, year: 2015 http://www.tandfonline.com/doi/full/10.1080/00207179.2015.1048295

  4. Supervisory control of (max,+) automata: extensions towards applications

    Czech Academy of Sciences Publication Activity Database

    Lahaye, S.; Komenda, Jan; Boimond, J.-L.

    2015-01-01

    Roč. 88, č. 12 (2015), s. 2523-2537 ISSN 0020-7179 Institutional support: RVO:67985840 Keywords : discrete event systems * logical and timed behaviors * (max,+) automata * supervisory control Subject RIV: BA - General Mathematics Impact factor: 1.880, year: 2015 http://www.tandfonline.com/doi/full/10.1080/00207179.2015.1048295

  5. RRM Strategies in LTE&WiMAX Interworking System

    DEFF Research Database (Denmark)

    Zakrzewska, Anna; Ruepp, Sarah Renée; Berger, Michael Stübert

    , that could be applied in 4G systems (LTE interworking with WiMAX is considered). Furthermore, it will also discuss the Radio Resource Management (RRM) problem addressing the challenges of designing a RRM system for such a multi-RAT wireless environment. Different functionalities and possibilities...

  6. Nurgapoliitik kavandab kasiinode alatut riigistamist / Max Kaur ; interv. Sulev Vedler

    Index Scriptorium Estoniae

    Kaur, Max, 1969-

    2007-01-01

    Edgar Savisaare endine nõunik Max Kaur esitleb röövkapitalismi ideed, et Eesti riik ei pikenda kasiinode tegevuslubasid ja võtab seejärel nende tegevuse odavalt üle. Kaart: Tallinna mängupõrgud 2007. Lisa

  7. Max Kaur vassib oma diplomitega / Ralf-Martin Soe

    Index Scriptorium Estoniae

    Soe, Ralf-Martin

    2008-01-01

    Eraülikooli prorektor Max Kaur kinnitas kohalikel valimistel allkirjaga, et on lõpetanud Moskva Riikliku Ülikooli, kuid pärast Äripäeva järelpärimist tunnistas selle info ekslikuks. Vt. samas: Vene ülikooli diplom 1200 dollariga; Ka Reimann valetas hariduse kohta

  8. Max-plus algebraic throughput analysis of synchronous dataflow graphs

    NARCIS (Netherlands)

    de Groote, Robert; Kuper, Jan; Broersma, Haitze J.; Smit, Gerardus Johannes Maria

    2012-01-01

    In this paper we present a novel approach to throughput analysis of synchronous dataflow (SDF) graphs. Our approach is based on describing the evolution of actor firing times as a linear time-invariant system in max-plus algebra. Experimental results indicate that our approach is faster than

  9. Supervisory Control of (max,+) automata: a behavioral approach

    Czech Academy of Sciences Publication Activity Database

    Komenda, Jan; Lahaye, S.; Boimond, J.-L.

    2009-01-01

    Roč. 19, č. 4 (2009), s. 525-549 ISSN 0924-6703 Grant - others:EU Projekt(XE) EU.ICT.DISC 224498 Institutional research plan: CEZ:AV0Z10190503 Keywords : timed discrete-event systems * supervisory control * formal power series * (max,+) * automata Subject RIV: BA - General Mathematics Impact factor: 0.921, year: 2009

  10. Sympathy and the Non-human: Max Scheler's Phenomenology of ...

    African Journals Online (AJOL)

    German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy, arguing that sympathy enables not only ethical behaviour, but also knowledge of animate and inanimate others. Influenced by Catholicism and especially St Francis, Scheler envisioned a broad, cosmic sympathy ...

  11. Reaction of some selected soybean varieties ( Glycine max (L) Merril)

    African Journals Online (AJOL)

    In nematode endemic ecological zones, TGX-1985 – 8F is therefore recommended as it proved to contain some specialized genes that conferred a higher level of tolerance against root- knot nematode, Meloidogyne incognita. Key Words: Glycine max, root – knot nematode, Dominant loci, Mi – 1.2, leucine zipper and R ...

  12. Soybean ( Glycine max ) as a versatile biocatalyst for organic ...

    African Journals Online (AJOL)

    A series of aliphatic and aromatic aldehydes and ketones were reduced using plant cell preparations of Glycine max seeds (soybean). The biotransformation of five aromatic aldehydes in water, at room temperature afforded the corresponding alcohols in excellent yields varying from 89 to 100%. Two prochiral aromatic ...

  13. The design of a 3 GHz thermionic RF-gun and energy filter for MAX-lab

    CERN Document Server

    Anderberg, B; Demirkan, M; Eriksson, M; Malmgren, L; Werin, S

    2002-01-01

    A new pre-injector has been designed for the MAX-laboratory. It consists of an RF-gun and a magnetic energy filter. The newly designed RF-gun geometry will be operated at 3 GHz in the thermionic mode using a BaO cathode. The pre-injector will provide a 2.3 MeV electron beam in 3 ps micro pulses to a new injector system currently under construction.

  14. 1-Chloronaphthalene decomposition in air using electron beam irradiation

    International Nuclear Information System (INIS)

    Chmielewski, A.G.; Sun, Y.; Bulka, S.; Zimek, Z.

    2006-01-01

    A method for the preparation of model gas containing 1-chloronaphthalene can be referred to 1,1-DCE (dichloroethene). A pulsed electron beam (EB) accelerator ILU-6 (2.0 MeV max., 20 kW max.) was used as an irradiation source. The absorbed dose rate inside the irradiation vessel was 10.835 kGy/min. Total absorbed dose was adjusted by changing irradiation time of the Pyrex glass vessels. 1-Chloronaphthalene concentration was analyzed using gas-chromatography. It has been found, that 1-chloronaphthalene can be decomposed in air or N 2 using EB irradiation. Decomposition efficiency of 1-chloronaphthalene in air is higher than that in N 2 . Positive charge transfer reactions and OH radicals' reaction may play a main role in 1-chloronaphthalene decomposition process

  15. Inoculation with Bradyrhizobium japonicum enhances the organic and fatty acids content of soybean (Glycine max (L.) Merrill) seeds.

    Science.gov (United States)

    Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B

    2013-12-15

    Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. [Psychiatry as cultural science: considerations following Max Weber].

    Science.gov (United States)

    Bormuth, M

    2010-11-01

    Psychiatry can be seen as a natural and cultural science. According to this the postulate of freedom is its strong value judgment. Since the times of enlightenment it has been described metaphorically by the myth of the expulsion from Paradise. Following Max Weber and Wilhelm Dilthey, Karl Jaspers has introduced this perspective into psychiatry. His strict dichotomy between explaining and understanding has later been critically revised by Werner Janzarik and Hans Heimann. Their concepts of structure dynamic, of pathography and of anthropology are closer to Max Weber who connected natural and cultural sciences in a much stronger way. Especially the pathographic example of Nietzsche allows to demonstrate the differences between Jaspers and the later psychopathologists of the Heidelberg and Tübingen schools.

  17. Evaluating the Performance of IPTV over Fixed WiMAX

    Science.gov (United States)

    Hamodi, Jamil; Salah, Khaled; Thool, Ravindra

    2013-12-01

    IEEE specifies different modulation techniques for WiMAX; namely, BPSK, QPSK, 16 QAM and 64 QAM. This paper studies the performance of Internet Protocol Television (IPTV) over Fixed WiMAX system considering different combinations of digital modulation. The performance is studied taking into account a number of key system parameters which include the variation in the video coding, path-loss, scheduling service classes different rated codes in FEC channel coding. The performance study was conducted using OPNET simulation. The performance is studied in terms of packet lost, packet jitter delay, end-to-end delay, and network throughput. Simulation results show that higher order modulation and coding schemes (namely, 16 QAM and 64 QAM) yield better performance than that of QPSK.

  18. IMPROVEMENT OF THE RICHNESS ESTIMATES OF maxBCG CLUSTERS

    International Nuclear Information System (INIS)

    Rozo, Eduardo; Rykoff, Eli S.; Koester, Benjamin P.; Hansen, Sarah; Becker, Matthew; Bleem, Lindsey; McKay, Timothy; Hao Jiangang; Evrard, August; Wechsler, Risa H.; Sheldon, Erin; Johnston, David; Annis, James; Scranton, Ryan

    2009-01-01

    Minimizing the scatter between cluster mass and accessible observables is an important goal for cluster cosmology. In this work, we introduce a new matched filter richness estimator, and test its performance using the maxBCG cluster catalog. Our new estimator significantly reduces the variance in the L X -richness relation, from σ lnLx 2 = (0.86±0.02) 2 to σ lnLx 2 = (0.69±0.02) 2 . Relative to the maxBCG richness estimate, it also removes the strong redshift dependence of the L X -richness scaling relations, and is significantly more robust to photometric and redshift errors. These improvements are largely due to the better treatment of galaxy color data. We also demonstrate the scatter in the L X -richness relation depends on the aperture used to estimate cluster richness, and introduce a novel approach for optimizing said aperture which can easily be generalized to other mass tracers.

  19. MAX: Development of a Laue diffraction lens for nuclear astrophysics

    International Nuclear Information System (INIS)

    Barriere, N.; Ballmoos, P. von; Skinner, G.; Smither, B.; Bastie, P.; Hinglais, E.; Abrosimov, N.; Alvarez, J.M.; Andersen, K.; Courtois, P.; Halloin, H.; Harris, M.; Isern, J.; Jean, P.; Knoedlseder, J.; Ubertini, P.; Vedrenne, G.; Weidenspointner, G.; Wunderer, C.

    2006-01-01

    The next generation of instrumentation for nuclear astrophysics will have to achieve an improvement in sensitivity by a factor of 10-100 over present technologies. With the focusing gamma-ray telescope MAX we take up this challenge and propose to combine the required sensitivity with high spectral and angular resolution, and the capability to measure the polarization of the photons. MAX is a space-borne crystal diffraction telescope, featuring a broad-band Laue lens optimized for the observation of compact sources in two wide energy bands of high astrophysical relevance. Gamma rays will be focused from the large collecting area of a crystal diffraction lens onto a very small detector volume. As a consequence, the signal to background ratio is greatly enhanced, leading to unprecedented sensitivities

  20. Sending Safety Video over WiMAX in Vehicle Communications

    Directory of Open Access Journals (Sweden)

    Jun Steed Huang

    2013-10-01

    Full Text Available This paper reports on the design of an OPNET simulation platform to test the performance of sending real-time safety video over VANET (Vehicular Adhoc NETwork using the WiMAX technology. To provide a more realistic environment for streaming real-time video, a video model was created based on the study of video traffic traces captured from a realistic vehicular camera, and different design considerations were taken into account. A practical controller over real-time streaming protocol is implemented to control data traffic congestion for future road safety development. Our driving video model was then integrated with the WiMAX OPNET model along with a mobility model based on real road maps. Using this simulation platform, different mobility cases have been studied and the performance evaluated in terms of end-to-end delay, jitter and visual experience.

  1. Max Aub revisitado: Lugares en (torno a La gallina ciega

    Directory of Open Access Journals (Sweden)

    Federico Gerhardt

    2006-11-01

    Full Text Available In La gallina ciega, Max Aub recollects and re-elaborates impressions (of his own and of others caused by his returning to Spain in 1969, after thirty years of exile in Mexico. This article analyses some of the manifestations of the dynamic relation between memory and literature, within La gallina ciega (in Aub's trips through the peninsular geography and also in the (rereadings of Aub's work, that show its position in the Spanish modern canon.

  2. A alquimia em "Uma semana de bondade" de Max Ernst

    Directory of Open Access Journals (Sweden)

    Bernadette Lyra

    1994-12-01

    Full Text Available Neste trabalho, a minha tentativa de estabelecer liames intertextuais entre Uma Semana de Bondade ou Os Sete Elementos Capitais -livro de colagens de Max Ernst - e os procedimentos alquimícos parte de estudos sobre a intertextualidade, tal como esse processo se encaixa no espaço semiótico, tomado este último como " um mecanismo único (senão como um organismo"(LOTMAN, 1991, p. 5.

  3. Architectural visualisation toolkit for 3D Studio Max users

    OpenAIRE

    Cooper , Neil

    2012-01-01

    Architectural Visualisation has become a vital part of the design process for architects and engineers. The process of modelling and rendering an architectural visualisation can be complex and time consuming with only a few tools available to assist novice modellers. This paper looks at available solutions for visualisation specialists including AutoCAD, 3D Studio Max and Google SketchUp as well as available solutions which attempt to automate the process including Batzal Roof ...

  4. On the likelihood function of Gaussian max-stable processes

    KAUST Repository

    Genton, M. G.; Ma, Y.; Sang, H.

    2011-01-01

    We derive a closed form expression for the likelihood function of a Gaussian max-stable process indexed by ℝd at p≤d+1 sites, d≥1. We demonstrate the gain in efficiency in the maximum composite likelihood estimators of the covariance matrix from p=2 to p=3 sites in ℝ2 by means of a Monte Carlo simulation study. © 2011 Biometrika Trust.

  5. Induced mutation in soybean (Glycine max L.) breeding

    International Nuclear Information System (INIS)

    Tulmann Neto, A.; Menten, J.O.M.; Ando, A.

    1984-01-01

    The induced mutation in soybean (Glycine max, L.) breeding is studied. Seed treatment with gamma-rays or methanesulfonic acid ethyl ester (EMs) is used in the following varieties: Parana, Santa Rosa, UFV-1, Foscarin 31 and IAC-8. The study to obtain resistance to the soybean bud blight virus and mutants resistant to rust was done. Early mutants are also researched. (M.A.C.) [pt

  6. O historiador Max Weber: indologia e historicismo na obra weberiana

    Directory of Open Access Journals (Sweden)

    Arilson Silva de Oliveira

    2010-06-01

    Full Text Available Max Weber assumed the methodological requirements of German historicism against all natural illuminist philosophy and all the idealistic philosophy of history. He improved them in order to prevent the conclusions of the romanticism and the psychological deviations of the neo-historicism. Here, we observe how he equipped himself with a particular method, rescued rationality and applied it as a parameter to historically understand Indian society in opposition to the disenchanted historicism of his time.

  7. On the Hitting Probability of Max-Stable Processes

    OpenAIRE

    Hofmann, Martin

    2012-01-01

    The probability that a max-stable process {\\eta} in C[0, 1] with identical marginal distribution function F hits x \\in R with 0 < F (x) < 1 is the hitting probability of x. We show that the hitting probability is always positive, unless the components of {\\eta} are completely dependent. Moreover, we consider the event that the paths of standard MSP hit some x \\in R twice and we give a sufficient condition for a positive probability of this event.

  8. Analisis Throughput Varian TCP Pada Model Jaringan WiMAX

    Directory of Open Access Journals (Sweden)

    Medi Taruk

    2016-07-01

    Full Text Available Transmission Control Protocol (TCP is a protocol that works at the transport layer of the OSI model. TCP was originally designed more destined for a wired network. However, to meet the need for the development of a very fast network technology based on the needs of the use by the user, it needs further development to the use of TCP on wireless devices. One implementation of a wireless network based on Worldwide Interoperability for Microwave Access (WiMAX network is a model that offers a variety advantage, particularly in terms of access speed. In this case, use NS-2 to see throughput at TCP variants tested, namely TCP-Tahoe, TCP-Reno, TCP-Vegas, and TCP-SACK over WiMAX network model, with few observations scenarios. The first is a look at each of these variants throughput of TCP when only one particular variant of the work in the network. Second observe all variants of TCP throughput at the same time and have the equivalent QoS, but with the possibility of a small congestion based on the capacity of the link is made sufficient. Third observed throughput with multi congestion. In WiMAX network has scheduling services are UGS, rtPS and ertPS using UDP protocol and nrtPS and BE using the TCP Protocol. By using the software network simulator (NS-2 to obtain performance comparison TCP protocol-based services on the WiMAX network with QoS parameters are throughput, packet loss, fairness and time delay.

  9. NiMax system for hadronic event generators in HEP

    International Nuclear Information System (INIS)

    Amelin, N.S.; Komogorov, M.E.

    2001-01-01

    We have suggested a new approach to the development and use of Monte Carlo event generators in high-energy physics (HEP). It is a component approach, when a complex numerical model is composed of standard components. Our approach opens a way to organize a library of HEP model components and provides a great flexibility for the construction of very powerful and realistic numerical models. To support this approach we have designed the NiMax software system (framework) written in C++

  10. On the likelihood function of Gaussian max-stable processes

    KAUST Repository

    Genton, M. G.

    2011-05-24

    We derive a closed form expression for the likelihood function of a Gaussian max-stable process indexed by ℝd at p≤d+1 sites, d≥1. We demonstrate the gain in efficiency in the maximum composite likelihood estimators of the covariance matrix from p=2 to p=3 sites in ℝ2 by means of a Monte Carlo simulation study. © 2011 Biometrika Trust.

  11. Machine Composition - Between Lisp and Max : Between AI and Music. Lisp, Max, maxlisp and other recombinations

    OpenAIRE

    Marschall, Olav-Andreas

    2007-01-01

    This paper consists of three complementary parts. First, there are the fundamental problems and challenges about the foundations [1,2,9] of Machine Composition (MC), especially in relation to human composition. Second, there is the background of existing theory and experimental results from main areas of Machine Compositional Research and their constructions of prototypes [4,5,7]. And finally, the most practical part introduces two important environments or tools [3,6,8] for the construction ...

  12. Main Memory DBMS

    NARCIS (Netherlands)

    P.A. Boncz (Peter); L. Liu (Lei); M. Tamer Özsu

    2008-01-01

    htmlabstractA main memory database system is a DBMS that primarily relies on main memory for computer data storage. In contrast, normal database management systems employ hard disk based persisntent storage.

  13. Mini MAX-DOAS Measurements of Air Pollutants over China

    Science.gov (United States)

    Staadt, Steffen; Hao, Nan; Trautmann, Thomas

    2016-08-01

    This study continues the work of Clémer et al., (2010) and is aimed to improve trace gas retrievals with mini MAX-DOAS measurements in Nanjing. Based on that work, aerosol extinction vertical profiles are retrieved using the bePRO inversion algorithm developed by the Royal Belgian Institute for Space Aeronomy (BIRA- IASB). Afterwards, the tropospheric trace gas vertical profiles and vertical column densities (VCDs) are retrieved by applying the optimal estimation method to the O4 MAX-DOAS measurements. The Profiles for N O2 , S O2 , glyoxal, formaldehyde and nitrous acid are obtained with different results and different settings for the DOAS measurement. The AODs show small positive correlation against the AERONET values. For NO2, the retrieval shows reasonable concentrations in winter as opposed to summer and has small positive correlations with GOME-2 data. The SO2 VCDs are not correlated with the GOME-2 data, due to high uncertainties from MAX-DOAS and satellite retrievals, while the vertical mixing ratios (VMR) show good agreement with in-situ data (SORPES) at Nanjing. Nitrous acid shows a maximum in winter and a minimum in summer, while glyoxal has its maximum in August and September.

  14. Scalable and Flexible Multiview MAX-VAR Canonical Correlation Analysis

    Science.gov (United States)

    Fu, Xiao; Huang, Kejun; Hong, Mingyi; Sidiropoulos, Nicholas D.; So, Anthony Man-Cho

    2017-08-01

    Generalized canonical correlation analysis (GCCA) aims at finding latent low-dimensional common structure from multiple views (feature vectors in different domains) of the same entities. Unlike principal component analysis (PCA) that handles a single view, (G)CCA is able to integrate information from different feature spaces. Here we focus on MAX-VAR GCCA, a popular formulation which has recently gained renewed interest in multilingual processing and speech modeling. The classic MAX-VAR GCCA problem can be solved optimally via eigen-decomposition of a matrix that compounds the (whitened) correlation matrices of the views; but this solution has serious scalability issues, and is not directly amenable to incorporating pertinent structural constraints such as non-negativity and sparsity on the canonical components. We posit regularized MAX-VAR GCCA as a non-convex optimization problem and propose an alternating optimization (AO)-based algorithm to handle it. Our algorithm alternates between {\\em inexact} solutions of a regularized least squares subproblem and a manifold-constrained non-convex subproblem, thereby achieving substantial memory and computational savings. An important benefit of our design is that it can easily handle structure-promoting regularization. We show that the algorithm globally converges to a critical point at a sublinear rate, and approaches a global optimal solution at a linear rate when no regularization is considered. Judiciously designed simulations and large-scale word embedding tasks are employed to showcase the effectiveness of the proposed algorithm.

  15. Main: 1FHF [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available oat Peroxidase; Glycine Max Molecule: Seed Coat Peroxidase; Chain: A, B, C; Engineered: Yes Oxidoreductase 1...LFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAI

  16. Wandering ethos and romantic spirit: Reflections following the trail of Max Weber's sociology

    Directory of Open Access Journals (Sweden)

    Jeremić-Molnar Dragana

    2013-01-01

    Full Text Available First part of the article is devoted to the main categories of Max Weber's historicist sociology: ethos and spirit. The authors are examining his concepts of capitalist spirit and protestant spirit and, relaying especially on Weber's unfinished treatise on music, contemplating the missing concept of romantic spirit, which could be tied with wandering ethos. In the second part of article, they are separating the phenomena of wandering (moving without purpose or goal from travelling (moving towards the determined end and analysing the possibilities of re-constructing the wandering ethos in context of emerging early Romanticism. In the end they are dealing with the main change the wandering underwent in 18th Century and early 19th Century: from despised activity practiced by social outcasts only (with few exceptions such as journeymen and merchants to the tool of regeneration.

  17. The physicist. Max Planck and the decay of the world; Der Physiker. Max Planck und das Zerfallen der Welt

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, Ernst Peter

    2010-06-15

    The live of the physicist Max Planck was as exciting, conflicting, and rich on catastrophes as the epoch, in which he lived. Ernst Peter Fischer draws in this fascinatingly told biography the eventful history of the Nobel-price bearer and illustrates simultaneously the unique attainment of Planck, the quantum theory of whom not only revolted the science but also changed fundamentally our picture of the world.

  18. Augmentative Device Helps Max Speak. PACER Center ACTion Information Sheets. PHP-c75

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    This Action Information Sheet follows a family's process of selecting and using augmentative and alternative communication to help their young son, Max, speak. Max is affected by global dyspraxia, which makes learning new motor skills--especially speech--quite difficult. For the first years of his life, Max could not say words. Before he and his…

  19. Molecular docking of Glycine max and Medicago truncatula ureases with urea; bioinformatics approaches.

    Science.gov (United States)

    Filiz, Ertugrul; Vatansever, Recep; Ozyigit, Ibrahim Ilker

    2016-03-01

    Urease (EC 3.5.1.5) is a nickel-dependent metalloenzyme catalyzing the hydrolysis of urea into ammonia and carbon dioxide. It is present in many bacteria, fungi, yeasts and plants. Most species, with few exceptions, use nickel metalloenzyme urease to hydrolyze urea, which is one of the commonly used nitrogen fertilizer in plant growth thus its enzymatic hydrolysis possesses vital importance in agricultural practices. Considering the essentiality and importance of urea and urease activity in most plants, this study aimed to comparatively investigate the ureases of two important legume species such as Glycine max (soybean) and Medicago truncatula (barrel medic) from Fabaceae family. With additional plant species, primary and secondary structures of 37 plant ureases were comparatively analyzed using various bioinformatics tools. A structure based phylogeny was constructed using predicted 3D models of G. max and M. truncatula, whose crystallographic structures are not available, along with three additional solved urease structures from Canavalia ensiformis (PDB: 4GY7), Bacillus pasteurii (PDB: 4UBP) and Klebsiella aerogenes (PDB: 1FWJ). In addition, urease structures of these species were docked with urea to analyze the binding affinities, interacting amino acids and atom distances in urease-urea complexes. Furthermore, mutable amino acids which could potentially affect the protein active site, stability and flexibility as well as overall protein stability were analyzed in urease structures of G. max and M. truncatula. Plant ureases demonstrated similar physico-chemical properties with 833-878 amino acid residues and 89.39-90.91 kDa molecular weight with mainly acidic (5.15-6.10 pI) nature. Four protein domain structures such as urease gamma, urease beta, urease alpha and amidohydro 1 characterized the plant ureases. Secondary structure of plant ureases also demonstrated conserved protein architecture, with predominantly α-helix and random coil structures. In

  20. Exercise tolerance during VO2max testing is a multifactorial psychobiological phenomenon.

    Science.gov (United States)

    Midgley, Adrian W; Earle, Keith; McNaughton, Lars R; Siegler, Jason C; Clough, Peter; Earle, Fiona

    2017-01-01

    Fifty-nine men completed a VO 2max test and a questionnaire to establish reasons for test termination, perceived exercise reserve (difference between actual test duration and the duration the individual perceived could have been achieved if continued until physical limitation), and perception of verbal encouragement. Participants gave between 1 and 11 factors as reasons for test termination, including leg fatigue, various perceptions of physical discomfort, safety concerns, and achievement of spontaneously set goals. The two most common main reasons were leg fatigue and breathing discomfort, which were predicted by pre-to-post test changes in pulmonary function (p = 0.038) and explosive leg strength (p = 0.042; R 2  = 0.40). Median (interquartile range) perceived exercise reserve, was 45 (50) s. Two-thirds of participants viewed verbal encouragement positively, whereas one-third had a neutral or negative perception. This study highlights the complexity of exercise tolerance during VO 2max testing and more research should explore these novel findings.

  1. Coplanar Waveguide Fed Compact Wide Circular-Slotted Antenna for Wi-Fi/WiMAX Applications

    Directory of Open Access Journals (Sweden)

    M. Samsuzzaman

    2014-01-01

    Full Text Available A coplanar waveguide (CPW fed printing and wide circular slotted, dual band antenna for Wi-Fi/WiMAX applications are presented. The antenna mainly encompasses a ground with a wide circular slot in the centre, a rectangular feeding strip, and two pairs of symmetric planar inverted L (SPIL strips connecting with the slotted ground. The tuning effects of the rectangular patch, ground size, and SPIL strips to the resonance and matching condition are examined by HFSS and the prototype is fabricated and measured. The simulation and experimental results show that the antenna has an impedance bandwidth with −10 dB reflection coefficients 600 MHz (3.26–3.86 GHz, lower band and 1040 MHz (5.02–6.26 GHz, upper band, which can cover both the Wi-Fi 5.2/5.5/5.8 GHz and WiMAX 3.3/3.5/3.7/5.8 GHz bands. Moreover, a stable omnidirectional radiation pattern and average peak gain for lower band 3.23 dB and upper band 5.93 dB have been achieved, respectively.

  2. A Printed Monopole Antenna for Triple-Band WLAN/WiMAX Applications

    Directory of Open Access Journals (Sweden)

    Huiqing Zhai

    2015-01-01

    Full Text Available A new compact design of monopole antenna for triple-band WLAN/WiMAX applications with two band-notches based on broadband antenna is presented. By introducing a stub loaded ground and two new paper clip structures etched on radiation patch, a compact overall dimension 31 mm × 33 mm × 1 mm and three separated operating bands effectively covering 2.4/5.2/5.8 GHz WLAN bands and 2.5/3.5/5.5 GHz WiMAX bands can be achieved. Compared with familiar U type slot, the introduced compact paper clip structure can save about 37% of dimension regions, which could effectively improve efficiency of band-notch formation. Simulated and measured results demonstrate that the proposed antenna has good dipole-like radiation characteristics with appreciable gain across the operating bands. Besides, main parameters of the two etched paper clip structures are investigated to control the positions and bandwidths of the two stop-bands, respectively, on basis of which the three working bands can be adjusted independently.

  3. Maine's Employability Skills Program

    Science.gov (United States)

    McMahon, John M.; Wolffe, Karen E.; Wolfe, Judy; Brooker, Carrie

    2013-01-01

    This Practice Report describes the development and implementation of the "Maine Employability Skills Program," a model employment program developed by the Maine Division for the Blind and Visually Impaired (DBVI). The program was designed to support the efforts of the chronically unemployed or underemployed. These consumers were either…

  4. An Analysis of the Max-Min Texture Measure.

    Science.gov (United States)

    1982-01-01

    PANC 33 D2 Confusion Matrices for Scene A, IR 34 D3 Confusion Matrices for Scene B, PANC 35 D4 Confusion Matrices for Scene B, IR 36 D5 Confusion...Matrices for Scene C, PANC 37 D6 Confusion Matrices for Scene C, IR 38 D7 Confusion Matrices for Scene E, PANC 39 D8 Confusion Matrices for Scene E, IR 40...D9 Confusion Matrices for Scene H, PANC 41 DIO Confusion Matrices for Scene H, JR 42 3 .D 10CnuinMtie o cn ,IR4 AN ANALYSIS OF THE MAX-MIN TEXTURE

  5. Max Weber o el enigma emocional del origen del capitalismo

    OpenAIRE

    EDUARDO BERICAT ALASTUEY

    2001-01-01

    Se analiza el trabajo clave de Max Weber, La ética protestante y el espíritu del capitalismo, desde la perspectiva de la Sociología de las Emociones. Aunque la inclusión de las emociones de los fenómenos sociales es clave para entender la idea de Weber sobre el dogma de la predestinación, los sociólogos han trivializado el papel de la emoción. Tras detallar la creencia de Weber en que el espíritu del capitalismo parte del conocimiento de que el destino del hombre está predeterminado (la ética...

  6. 3ds Max design architectural visualization for intermediate users

    CERN Document Server

    Smith, Brian L

    2012-01-01

    Learn time-saving techniques and tested production-ready tips for maximum speed and efficiency in creating professional-level architectural visualizations in 3ds Max. Move from intermediate to an advanced level with specific and comprehensive instruction with this collaboration from nine different authors from around the world. Get their experience and skills in this full-color book, which not only teaches more advanced features, but also demonstrates the practical applications of those features to get readers ready for a real production environment. Fully updated for the most recent version o

  7. Min-Max decoding for non binary LDPC codes

    OpenAIRE

    Savin, Valentin

    2008-01-01

    Iterative decoding of non-binary LDPC codes is currently performed using either the Sum-Product or the Min-Sum algorithms or slightly different versions of them. In this paper, several low-complexity quasi-optimal iterative algorithms are proposed for decoding non-binary codes. The Min-Max algorithm is one of them and it has the benefit of two possible LLR domain implementations: a standard implementation, whose complexity scales as the square of the Galois field's cardinality and a reduced c...

  8. Chain rules for smooth min-and max-entropies

    DEFF Research Database (Denmark)

    Vitanov, Alexande; Dupont-Dupuis, Fréderic; Tomamichel, Marco

    2013-01-01

    The chain rule for the Shannon and von Neumann en- tropy, which relates the total entropy of a system to the entropies of its parts, is of central importance to information theory. Here, we consider the chain rule for the more general smooth min- and max-entropies, used in one-shot in formation...... theory. For these en- tropy measures, the chain rule no longer holds as an equality. How- ever, the standard chain rule for the von Neum ann entropy is re- trieved asymptotically when evaluating the smooth entropies for many identical and independently distributed states....

  9. Nanocrystalline MAX/Mg Composites with Exceptional Properties

    Science.gov (United States)

    2017-01-04

    hardness was 3.4±0.3 GPa, and the ultimate compressive strengths was 1028±5 MPa. The enhancements in elastic and mechanical properties are attributed to...Barsoum. Enthalpy of Formation and Thermodynamic Parameters of the MAX Phase, V2AlC., J. Alloy Compds., ( ): 218. doi: Babak Anasori, El’ad N. Caspi...Paper TOTAL: 08/28/2012 08/28/2012 Received Book 1.00 4.00 Babak Anasori, Michel W. Barsoum. ON THE EFFECT OF Ti2AlC ON THE FORMATION OF THERMALLY

  10. Max Saunders, Ford Madox Ford: a Dual Life

    OpenAIRE

    Brasme, Isabelle

    2014-01-01

    Ford Madox Ford: A Dual Life is a welcome paperback reprint of Max Saunders’s authoritative monograph, which was initially published in 1996. The history of criticism and reception for Ford Madox Ford’s writing has been far from straightforward from the early twentieth to the early twenty-first century. Ford Hermann Hueffer, then Ford Madox Hueffer, then Ford Madox Ford (1873-1939), was at the centre of intellectual circles in the first three decades of the twentieth century. A prevalent figu...

  11. Nanostructured plasma etched, magnetron sputtered nanolaminar Cr2AlC MAX phase thin films

    International Nuclear Information System (INIS)

    Grieseler, Rolf; Hähnlein, Bernd; Stubenrauch, Mike; Kups, Thomas; Wilke, Marcus; Hopfeld, Marcus; Pezoldt, Jörg; Schaaf, Peter

    2014-01-01

    The knowledge of the mechanical properties of new materials determines essentially their usability and functionality when used in micro- and nanostructures. MAX phases are new and highly interesting materials due to their unique combination of materials properties. In this article a new method for producing the Cr 2 AlC MAX phase is presented. Thin film elemental multilayer deposition and subsequent rapid thermal annealing forms the MAX phase within seconds. Additionally, free standing microstructures (beams and cantilevers) based on this MAX phase films are prepared by plasma etching. The mechanical properties of these MAX phase microstructures are investigated

  12. BlackMax: A black-hole event generator with rotation, recoil, split branes, and brane tension

    International Nuclear Information System (INIS)

    Dai Dechang; Starkman, Glenn; Stojkovic, Dejan; Issever, Cigdem; Tseng, Jeff; Rizvi, Eram

    2008-01-01

    We present a comprehensive black-hole event generator, BlackMax, which simulates the experimental signatures of microscopic and Planckian black-hole production and evolution at the LHC in the context of brane world models with low-scale quantum gravity. The generator is based on phenomenologically realistic models free of serious problems that plague low-scale gravity, thus offering more realistic predictions for hadron-hadron colliders. The generator includes all of the black-hole gray-body factors known to date and incorporates the effects of black-hole rotation, splitting between the fermions, nonzero brane tension, and black-hole recoil due to Hawking radiation (although not all simultaneously). The generator can be interfaced with Herwig and Pythia. The main code can be downloaded from http://www-pnp.physics.ox.ac.uk/~issever/BlackMax/blackmax.html.

  13. Turbine main engines

    CERN Document Server

    Main, John B; Herbert, C W; Bennett, A J S

    1965-01-01

    Turbine Main Engines deals with the principle of operation of turbine main engines. Topics covered include practical considerations that affect turbine design and efficiency; steam turbine rotors, blades, nozzles, and diaphragms; lubricating oil systems; and gas turbines for use with nuclear reactors. Gas turbines for naval boost propulsion, merchant ship propulsion, and naval main propulsion are also considered. This book is divided into three parts and begins with an overview of the basic mode of operation of the steam turbine engine and how it converts the pressure energy of the ingoing ste

  14. Maine highway safety plan

    Science.gov (United States)

    2010-01-01

    Each September 1, the MeBHS must provide NHTSA a comprehensive plan to reduce : traffic crashes and resulting deaths, injuries and property damage. The Highway Safety : Plan (HSP) serves as Maines application for available federal funds for these ...

  15. Maine Field Station

    Data.gov (United States)

    Federal Laboratory Consortium — In 2000 NOAA's National Marine Fisheries Service established the Maine Field Station in Orono, ME to have more direct involvement in the conservation of the living...

  16. Maine's forests 2008

    Science.gov (United States)

    George L. McCaskill; William H. McWilliams; Charles J. Barnett; Brett J. Butler; Mark A. Hatfield; Cassandra M. Kurtz; Randall S. Morin; W. Keith Moser; Charles H. Perry; Christopher W. Woodall

    2011-01-01

    The second annual inventory of Maine's forests was completed in 2008 after more than 3,160 forested plots were measured. Forest land occupies almost 17.7 million acres, which represents 82 percent of the total land area of Maine. The dominant forest-type groups are maple/beech/yellow birch, spruce/fir, white/red/jack pine, and aspen/white birch. Statewide volume...

  17. Maine Forests 2013

    Science.gov (United States)

    George L. McCaskill; Thomas Albright; Charles J. Barnett; Brett J. Butler; Susan J. Crocker; Cassandra M. Kurtz; William H. McWilliams; Patrick D. Miles; Randall S. Morin; Mark D. Nelson; Richard H. Widmann; Christopher W. Woodall

    2016-01-01

    The third 5-year annualized inventory of Maine's forests was completed in 2013 after more than 3170 forested plots were measured. Maine contains more than 17.6 million acres of forest land, an area that has been quite stable since 1960, covering more than 82 percent of the total land area. The number of live trees greater than 1 inch in diameter are approaching 24...

  18. Oxidation of Alumina-Forming MAX Phases in Turbine Environments

    Science.gov (United States)

    Smialek, James; Garg, Anita; Harder, Bryan; Nesbitt, James; Gabb, Timothy; Gray, SImon

    2017-01-01

    Protective coatings for high temperature turbine components are based on YSZ thermal barriers and oxidation resistant, alumina-forming NiAl or NiCoCrAlY bond coats. Ti2AlC and Cr2AlC MAX phases are thus of special interest because of good oxidation resistance and CTE that can match Al2O3 and YSZ. Their alumina scales grow according to cubic kinetics due to grain growth in the scale, with initial heating dominated by fast TiO2 growth. Protective cubic kinetics are also found in high pressure burner rig tests of MAXthal 211 Ti2AlC, but with reduced rates due to volatile TiO(OH)2 formation in water vapor. YSZ-coatings on bulk Ti2AlC exhibit remarkable durability up to 1300C in furnace tests and at least a 25x life advantage compared to superalloys. At another extreme, Cr2AlC is resistant to low temperature Na2SO4 hot corrosion and exhibits thermal cycling stability bonded to a superalloy disk material. Accordingly, sputtered Cr2AlC coatings on disk specimens prevented hot corrosion detriments on LCF. Breakaway oxidation (Ti2AlC), scale spallation (Cr2AlC), interdiffusion, and processing as coatings still present serious challenges. However the basic properties of MAX phases provide some unusual opportunities for use in high temperature turbines.

  19. Tapered composite likelihood for spatial max-stable models

    KAUST Repository

    Sang, Huiyan

    2014-05-01

    Spatial extreme value analysis is useful to environmental studies, in which extreme value phenomena are of interest and meaningful spatial patterns can be discerned. Max-stable process models are able to describe such phenomena. This class of models is asymptotically justified to characterize the spatial dependence among extremes. However, likelihood inference is challenging for such models because their corresponding joint likelihood is unavailable and only bivariate or trivariate distributions are known. In this paper, we propose a tapered composite likelihood approach by utilizing lower dimensional marginal likelihoods for inference on parameters of various max-stable process models. We consider a weighting strategy based on a "taper range" to exclude distant pairs or triples. The "optimal taper range" is selected to maximize various measures of the Godambe information associated with the tapered composite likelihood function. This method substantially reduces the computational cost and improves the efficiency over equally weighted composite likelihood estimators. We illustrate its utility with simulation experiments and an analysis of rainfall data in Switzerland.

  20. Cosmological Constraints From SDSS MaxBCG Cluster Abundances

    International Nuclear Information System (INIS)

    Rozo, Eduardo; Wechsler, Risa H.; KICP, Chicago; Koester, Benjamin P.; McKay, Timothy A.; Evrard, August E.; Johnston, David; Sheldon, Erin S.; Annis, James; Frieman, Joshua A.

    2007-01-01

    We perform a maximum likelihood analysis of the cluster abundance measured in the SDSS using the maxBCG cluster finding algorithm. Our analysis is aimed at constraining the power spectrum normalization σ 8 , and assumes flat cosmologies with a scale invariant spectrum, massless neutrinos, and CMB and supernova priors (Omega) m h 2 = 0.128 ± 0.01 and h = 0.72 ± 0.05 respectively. Following the method described in the companion paper Rozo et al. (2007), we derive σ 8 = 0.92 ± 0.10 (1σ) after marginalizing over all major systematic uncertainties. We place strong lower limits on the normalization, σ 8 > 0.76 (95% CL) (> 0.68 at 99% CL). We also find that our analysis favors relatively low values for the slope of the Halo Occupation Distribution (HOD), α = 0.83 ± 0.06. The uncertainties of these determinations will substantially improve upon completion of an ongoing campaign to estimate dynamical, weak lensing, and X-ray cluster masses in the SDSS maxBCG cluster sample

  1. [Max Hirsch founder of rheumatology in Germany: banished and murdered].

    Science.gov (United States)

    Keitel, W

    2014-08-01

    The Jewish physician and scientist Dr. Max Hirsch (1875-1941) made a substantial contribution to consolidation of the foundations of his professional discipline, balneology, and in particular developed the social aspects. He recognized the economic significance of diseases of the musculoskeletal system very early on and gathered important ideas from abroad. Together with the department head in the Prussian Ministry of Education and Cultural Affairs, the Privy Councillor Prof. Dr. Eduard Dietrich and later alone, he was editor of various balneological journals. He worked as general secretary of the Deutsche Gesellschaft für Rheumatologie (German Society of Rheumatology) from the beginning of its existence (1927) and created the publication series Veröffentlichungen der Deutschen Gesellschaft für Rheumabekämpfung (Publications of the German Society against Rheumatism) and Rheuma-Jahrbuch (Annual review of rheumatology) in 1929, 1930 and 1931 and organized seven rheumatology congresses up to 1933. After the accession to power of the National Socialists, Max Hirsch and Eduard Dietrich were deposed from office. Hirsch emigrated to Latvia via Switzerland and the Soviet Union with his wife and one son where they were murdered in the course of the Jewish pogrom. The second son escaped with his family to Sweden.

  2. Pseudogap and cuprate superconductivity: MaxEnt-μSR studies

    International Nuclear Information System (INIS)

    Boekema, C.; Schwartz, R.; Love, A.; Browne, M.C.

    2013-01-01

    Highlights: • A magnetic origin of cuprate superconductivity is plausible. • Cuprate loop currents are observed, close to predictions. • Pseudogap effects are seen above and below T c . -- Abstract: The basic physics of cuprate superconductivity is still much deliberated after 27 years of research. In contrast to phononic or polaronic roots, Varma’s theory promotes a magnetic origin. To probe cuprate magnetism, we examine zero field (ZF) muon-spin-rotation (μSR) data of RBa 2 Cu 3 O 7−δ (RBCO; R = Gd, Eu) especially near T c . Possible weak effects are analyzed using Maximum Entropy (MaxEnt, ME) to transform our μSR time series. Concerning predicted pseudogap loop currents, we have observed μSR signals in zero field for GdBCO above and now also below T c . These are near predicted fields of about 100 Oe. Using MaxEnt, we analyze transverse field (TF) μSR data of optimal doped EuBCO. Our focus is also on a temperature interval above T c to comprehend precursor effects. Our results point toward magnetic roots of cuprate superconductivity

  3. Effective Bandwidth Allocation for WiMAX Mesh Network

    Directory of Open Access Journals (Sweden)

    Hung-Chin Jang

    2010-04-01

    Full Text Available The aim of this paper is to reduce the media access delay in a WiMAX mesh network. We observe that as the number of subscriber stations (SS in a neighborhood increases, the processes of transmission opportunity (TO competition and 3- way handshake are easy to fail. This may degrade transmission efficiency and increase packet transmission delay. Besides, the minislot allocation defined in the WiMAX mesh mode may cause many lower priority services reserve earlier minislots than that of higher priority services like rtPS. This may cause great negative impact on delay-sensitive traffic. In this paper, we design a QoS classifier to enqueue packets according to different QoS service classes, present a dynamic holdoff exponent mechanism to reduce control subframe delay, and propose a Neighborhood-Based Minislot Allocation (NBMA mechanism to reduce data subframe delay. Simulations show that the proposed methodology outperforms that of IEEE 802.16 and Baye's DynExp in delay, jitter and throughput.

  4. Los juegos narrativos de Max Aub en Juego de cartas

    Directory of Open Access Journals (Sweden)

    Valles Calatrava, José R.

    2007-12-01

    Full Text Available After reviewing the dates of writing and edition, the illustrations of the cards and the different thematic relationships among the 106 epistles that integrate Juego de Cartas (1964 by Max Aub, this article successively studies the playful and experimental dimensions of the novel and its opened plot, analyzing in a detailed way the narrative technical procedures used by Aub in its composition: dissociation of the author and apocryphal play, limitless retextualization of story (scattered text and opened montage, greatest interactivity and kaleidoscopic design.Tras examinar las fechas de escritura y publicación, las ilustraciones de los naipes y las vinculaciones temáticas de las 106 epístolas que integran la obra de Max Aub Juego de cartas (1964, este artículo estudia las dimensiones lúdica y experimental de la novela y su estructura abierta, analizando sucesivamente de modo detallado los procedimientos técnicos narrativos empleados por Aub en su composición: disociación autoral y presencia del apócrifo, retextualización ilimitada de la historia narrativa (texto diseminado y montaje abierto, máxima interactividad, diseño caleidoscópico.

  5. Tapered composite likelihood for spatial max-stable models

    KAUST Repository

    Sang, Huiyan; Genton, Marc G.

    2014-01-01

    Spatial extreme value analysis is useful to environmental studies, in which extreme value phenomena are of interest and meaningful spatial patterns can be discerned. Max-stable process models are able to describe such phenomena. This class of models is asymptotically justified to characterize the spatial dependence among extremes. However, likelihood inference is challenging for such models because their corresponding joint likelihood is unavailable and only bivariate or trivariate distributions are known. In this paper, we propose a tapered composite likelihood approach by utilizing lower dimensional marginal likelihoods for inference on parameters of various max-stable process models. We consider a weighting strategy based on a "taper range" to exclude distant pairs or triples. The "optimal taper range" is selected to maximize various measures of the Godambe information associated with the tapered composite likelihood function. This method substantially reduces the computational cost and improves the efficiency over equally weighted composite likelihood estimators. We illustrate its utility with simulation experiments and an analysis of rainfall data in Switzerland.

  6. Cosmological Constraints from the SDSS maxBCG Cluster Catalog

    Energy Technology Data Exchange (ETDEWEB)

    Rozo, Eduardo; /CCAPP; Wechsler, Risa H.; /KIPAC, Menlo Park /SLAC; Rykoff, Eli S.; /UC, Santa Barbara; Annis, James T.; /Fermilab; Becker, Matthew R.; /Chicago U. /KICP, Chicago; Evrard, August E.; /Michigan U. /Michigan U., MCTP; Frieman, Joshua A.; /Fermilab /KICP, Chicago /Chicago U.; Hansen, Sarah M.; /UC, Santa Cruz; Hao, Jia; /Michigan U.; Johnston, David E.; /Northwestern U.; Koester, Benjamin P.; /KICP, Chicago /Chicago U.; McKay, Timothy A.; /Michigan U. /Michigan U., MCTP; Sheldon, Erin S.; /Brookhaven; Weinberg, David H.; /CCAPP /Ohio State U.

    2009-08-03

    We use the abundance and weak lensing mass measurements of the SDSS maxBCG cluster catalog to simultaneously constrain cosmology and the richness-mass relation of the clusters. Assuming a flat {Lambda}CDM cosmology, we find {sigma}{sub 8}({Omega}{sub m}/0.25){sup 0.41} = 0.832 {+-} 0.033 after marginalization over all systematics. In common with previous studies, our error budget is dominated by systematic uncertainties, the primary two being the absolute mass scale of the weak lensing masses of the maxBCG clusters, and uncertainty in the scatter of the richness-mass relation. Our constraints are fully consistent with the WMAP five-year data, and in a joint analysis we find {sigma}{sub 8} = 0.807 {+-} 0.020 and {Omega}{sub m} = 0.265 {+-} 0.016, an improvement of nearly a factor of two relative to WMAP5 alone. Our results are also in excellent agreement with and comparable in precision to the latest cosmological constraints from X-ray cluster abundances. The remarkable consistency among these results demonstrates that cluster abundance constraints are not only tight but also robust, and highlight the power of optically-selected cluster samples to produce precision constraints on cosmological parameters.

  7. Max dD/Dt: A Novel Parameter to Assess Fetal Cardiac Contractility and a Substitute for Max dP/Dt.

    Science.gov (United States)

    Fujita, Yasuyuki; Kiyokoba, Ryo; Yumoto, Yasuo; Kato, Kiyoko

    2018-07-01

    Aortic pulse waveforms are composed of a forward wave from the heart and a reflection wave from the periphery. We focused on this forward wave and suggested a new parameter, the maximum slope of aortic pulse waveforms (max dD/dt), for fetal cardiac contractility. Max dD/dt was calculated from fetal aortic pulse waveforms recorded with an echo-tracking system. A normal range of max dD/dt was constructed in 105 healthy fetuses using linear regression analysis. Twenty-two fetuses with suspected fetal cardiac dysfunction were divided into normal and decreased max dD/dt groups, and their clinical parameters were compared. Max dD/dt of aortic pulse waveforms increased linearly with advancing gestational age (r = 0.93). The decreased max dD/dt was associated with abnormal cardiotocography findings and short- and long-term prognosis. In conclusion, max dD/dt calculated from the aortic pulse waveforms in fetuses can substitute for max dP/dt, an index of cardiac contractility in adults. Copyright © 2018 World Federation for Ultrasound in Medicine and Biology. Published by Elsevier Inc. All rights reserved.

  8. OaMAX2 of Orobanche aegyptiaca and Arabidopsis AtMAX2 share conserved functions in both development and drought responses.

    Science.gov (United States)

    Li, Weiqiang; Nguyen, Kien Huu; Watanabe, Yasuko; Yamaguchi, Shinjiro; Tran, Lam-Son Phan

    2016-09-16

    Previous studies in Arabidopsis reported that the MAX2 (more axillary growth 2) gene is a component of the strigolactone (SL) signaling pathway, which regulates a wide range of biological processes, from plant growth and development to environmental stress responses. Orobanche aegyptiaca is a harmful parasitic plant for many economically important crops. Seed germination of O. aegyptiaca is very sensitive to SLs, suggesting that O. aegyptiaca may contain components of the SL signaling pathway. To investigate this hypothesis, we identified and cloned a MAX2 ortholog from O. aegyptiaca for complementation analyses using the Arabidopsis Atmax2 mutant. The so-called OaMAX2 gene could rescue phenotypes of the Atmax2 mutant in various tested developmental aspects, including seed germination, shoot branching, leaf senescence and growth and development of hypocotyl, root hair, primary root and lateral root. More importantly, OaMAX2 could enhance the drought tolerance of Atmax2 mutant, suggesting its ability to restore the drought-tolerant phenotype of mutant plants defected in AtMAX2 function. Thus, this study provides genetic evidence that the functions of the MAX2 orthologs, and perhaps the MAX2 signaling pathways, are conserved in parasitic and non-parasitic plants. Furthermore, the results of our study enable us to develop a strategy to fight against parasitic plants by suppressing the MAX signaling, which ultimately leads to enhanced productivity of crop plants. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Multiple variables explain the variability in the decrement in VO2max during acute hypobaric hypoxia.

    Science.gov (United States)

    Robergs, R A; Quintana, R; Parker, D L; Frankel, C C

    1998-06-01

    We used multiple regression analyses to determine the relationships between the decrement in sea level (SL, 760 Torr) VO2max during hypobaric hypoxia (HH) and variables that could alter or be related to the decrement in VO2max. HH conditions consisted of 682 Torr, 632 Torr, and 566 Torr, and the measured independent variables were SL-VO2max, SL lactate threshold (SL-LT), the change in hemoglobin saturation at VO2max between 760 and 566 Torr (delta SaO2max), lean body mass (LBM), and gender. Male (N = 14) and female (N = 14) subjects of varied fitness, training status, and residential altitude (1,640-2,460 m) completed cycle ergometry tests of VO2max at each HH condition under randomized and single-blinded conditions. VO2max decreased significantly from 760 Torr after 682 Torr (approximately 915 m) (3.5 +/- 0.9 to 3.4 +/- 0.8 L.min-1, P = 0.0003). Across all HH conditions, the slope of the relative decrement in VO2max (%VO2max) during HH was -9.2%/100 mm Hg (-8.1%/1000 m) with an initial decrease from 100% estimated to occur below 705 Torr (610 m). Step-wise multiple regression revealed that SL-VO2max, SL-LT, delta SaO2max, LBM, and gender each significantly combined to account for 89.03% of the variance in the decrement in VO2max (760-566 Torr) (P decrement in VO2max during HH. The unique variance explanation afforded by SL-LT, LBM, and gender suggests that issues pertaining to oxygen diffusion within skeletal muscle may add to the explanation of between subjects variability in the decrement in VO2max during HH.

  10. Oxidation behaviour of a Ti2AlN MAX-phase coating

    International Nuclear Information System (INIS)

    Wang Qimin; Kim, Kwangho; Garkas, W; Renteria, A Flores; Leyens, C; Sun Chao

    2011-01-01

    In this paper, we reported the oxidation behaviour of Ti 2 AlN coatings on a -TiAl substrate. The coatings composed mainly of Ti 2 AlN MAX phase were obtained by magnetron sputtering and subsequent vacuum annealing. Isothermal oxidation tests at 700-900 deg. C were performed in air. The results indicated that the oxidation resistance of the -TiAl alloy can be improved by depositing a Ti 2 AlN layer on the alloy surface, especially at high temperatures. An Al-rich oxide scale formed on the coating surfaces during oxidation. This scale acts as diffusion barrier blocking the ingress of oxidation, and effectively protects the coated alloys from further oxidation attack.

  11. Oxidation behaviour of a Ti{sub 2}AlN MAX-phase coating

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qimin; Kim, Kwangho [National Core Research Center for Hybrid Materials Solution, Pusan National University, Busan 609-735 (Korea, Republic of); Garkas, W; Renteria, A Flores [Chair of Physical Metallurgy and Materials Technology, Technical University of Brandenburg at Cottbus, 03046 Cottbus (Germany); Leyens, C [Institute of Materials Science, Technical University of Dresden, Helmholtzstrasse 7, 01069 Dresden (Germany); Sun Chao, E-mail: qmwang@pusan.ac.kr, E-mail: kwhokim@pusan.ac.kr [Division of Surface Engineering of Materials, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)

    2011-10-29

    In this paper, we reported the oxidation behaviour of Ti{sub 2}AlN coatings on a -TiAl substrate. The coatings composed mainly of Ti{sub 2}AlN MAX phase were obtained by magnetron sputtering and subsequent vacuum annealing. Isothermal oxidation tests at 700-900 deg. C were performed in air. The results indicated that the oxidation resistance of the -TiAl alloy can be improved by depositing a Ti{sub 2}AlN layer on the alloy surface, especially at high temperatures. An Al-rich oxide scale formed on the coating surfaces during oxidation. This scale acts as diffusion barrier blocking the ingress of oxidation, and effectively protects the coated alloys from further oxidation attack.

  12. Theoretical study of physical properties and oxygen incorporation effect in nanolaminated ternary carbides 211-MAX phases

    KAUST Repository

    Kanoun, Mohammed

    2012-01-01

    In this chapter, we employ ab initio approaches to review some important physical properties of nanolaminated ternary carbides MAX phases. We fi rstly use an all electron full-potential linearized augmented plane-wave method within the generalized gradient approximation and the density functional theory approaches, to explore the existence of a steric effect on the M site in these compounds. The elastic properties are also reported in order to assess the mechanical stability. The substitution of oxygen for carbon in Ti 2 SnC M n +1 AX n, forming Ti 2 SnC 1- x O x, is examined next, where we simulated the effect of oxygen incorporation on mechanical and electronic properties using projector augmented wave method. We show that oxygen has interesting effects on both of elastic and electronic properties, that the bulk modulus decreases when oxygen concentration increases. The bonding in Ti 2 SnC 1- x O x has a tendency to a covalent-ionic nature with the presence of metallic character. © 2012 Woodhead Publishing Limited.

  13. Main sequence mass loss

    International Nuclear Information System (INIS)

    Brunish, W.M.; Guzik, J.A.; Willson, L.A.; Bowen, G.

    1987-01-01

    It has been hypothesized that variable stars may experience mass loss, driven, at least in part, by oscillations. The class of stars we are discussing here are the δ Scuti variables. These are variable stars with masses between about 1.2 and 2.25 M/sub θ/, lying on or very near the main sequence. According to this theory, high rotation rates enhance the rate of mass loss, so main sequence stars born in this mass range would have a range of mass loss rates, depending on their initial rotation velocity and the amplitude of the oscillations. The stars would evolve rapidly down the main sequence until (at about 1.25 M/sub θ/) a surface convection zone began to form. The presence of this convective region would slow the rotation, perhaps allowing magnetic braking to occur, and thus sharply reduce the mass loss rate. 7 refs

  14. On the Potential of MAX phases for Nuclear Applications

    Science.gov (United States)

    Tallman, Darin Joseph

    Materials within nuclear reactors experience some of the harshest environments currently known to man, including long term operation in extreme temperatures, corrosive media, and fast neutron fluences with up to 100 displacements per atom, dpa. In order to improve the efficiency and safety of current and future reactors, new materials are required to meet these harsh demands. The M n+1AXn phases, a growing family of ternary nano-layered ceramics, possess a desirable combination of metallic and ceramic properties. They are composed of an early transition metal (M), a group 13--16 element (A), and carbon and/or nitrogen (X). The MAX phases are being proposed for use in such extreme environments because of their unique combination of high fracture toughness values and thermal conductivities, machinability, oxidation resistance, and ion irradiation damage tolerance. Previous ion irradiation studies have shown that Ti3SiC2 and Ti3AlC2 resist irradiation damage, maintaining crystallinity up to 50 dpa. The aim of this work was to explore the effect of neutron irradiation, up to 9 dpa and at temperatures of 100 to 1000 °C, on select MAX phases for the first time. The MAX phases Ti3SiC2, Ti 3AlC2, Ti2AlC, and Ti2AlN were synthesized, and irradiated in test reactors that simulate in-pile conditions of nuclear reactors. X-ray diffraction, XRD, pattern refinements of samples revealed a distortion of the crystal lattice after low temperature irradiation, which was not observed after high temperature irradiations. Additionally, the XRD results indicated that Ti3AlC2 and Ti2AlN dissociated after relatively low neutron doses. This led us to focus on Ti 3SiC2 and Ti2AlC. For the first time, dislocation loops were observed in Ti3SiC 2 and Ti2AlC as a result of neutron irradiation. At 1 x 1023 loops/m3, the loop density in Ti2 AlC after irradiation to 0.1 dpa at 700°C was 1.5 orders of magnitude greater than that observed in Ti3SiC2, at 3 x 1021 loops/m3. The Ti2AlC composition

  15. Report: Ordine del sentire e apertura al mondo. Filosofia delle emozioni e processo di individuazione della persona XIII Convegno internazionale della Max-Scheler-Gesellschaft Università di Verona 27-30 Maggio 2015

    OpenAIRE

    Maria Teresa Speranza

    2015-01-01

    An interesting debate on the issue of personal identity and its ethical implications has animated the days of the XIII International Congress of Max Scheler‐Gesellschaft. A large program of work has garnered numerous perspectives on the philosophy of person and the phenomenology of otherness, investigating in particular the role of emotions in the formation of person process. The main topic of conference was the Max Scheler’s phenomenology of emotions, which is an i...

  16. FERMILAB: Main Injector

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The Fermilab Main Injector (FMI) project is the centerpiece of the Laboratory's Fermilab III programme for the 1990s. Designed to support a luminosity of at least 5x10 31 cm -2 s -1 in the Tevatron collider, it will also provide new capabilities for rare neutral kaon decay and neutrino oscillation studies. The Fermilab Main Injector 8-150 GeV synchrotron is designed to replace the existing Main Ring which seriously limits beam intensities for the Tevatron and the antiproton production target. The project has passed several significant milestones and is now proceeding rapidly towards construction. The project received a $11.65M appropriation in 1992 and has been given $15M for the current fiscal year. Through the Energy Systems Acquisition Advisory Board (ESAAB) process, the US Department of Energy (DoE) has authorized funds for construction of the underground enclosure and service building where the Main Injector will touch the Tevatron, and to the preparation of bids for remaining project construction

  17. FERMILAB: Main Injector

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1993-06-15

    The Fermilab Main Injector (FMI) project is the centerpiece of the Laboratory's Fermilab III programme for the 1990s. Designed to support a luminosity of at least 5x10{sup 31} cm{sup -2} s{sup -1} in the Tevatron collider, it will also provide new capabilities for rare neutral kaon decay and neutrino oscillation studies. The Fermilab Main Injector 8-150 GeV synchrotron is designed to replace the existing Main Ring which seriously limits beam intensities for the Tevatron and the antiproton production target. The project has passed several significant milestones and is now proceeding rapidly towards construction. The project received a $11.65M appropriation in 1992 and has been given $15M for the current fiscal year. Through the Energy Systems Acquisition Advisory Board (ESAAB) process, the US Department of Energy (DoE) has authorized funds for construction of the underground enclosure and service building where the Main Injector will touch the Tevatron, and to the preparation of bids for remaining project construction.

  18. Main facts 1995

    International Nuclear Information System (INIS)

    1996-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations

  19. Main designations and attributions

    International Nuclear Information System (INIS)

    2010-01-01

    The chapter presents the main designations and attributions of the LNMRI - Brazilian National Laboratory of Metrology of Ionizing Radiation, the Cooperative Center in Radiation Protection and Medical Preparations for Accidents with Radiation; the Treaty for fully banning of nuclear tests and the Regional Center for Training of IAEA

  20. Maine Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Maine. Number of columns is 197 and number of rows is 292. The order of the data is from the lower left to the...

  1. Main facts 1993

    International Nuclear Information System (INIS)

    1994-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  2. Hybrid UWB and WiMAX radio-over-multi-mode fibre for in-building optical networks

    International Nuclear Information System (INIS)

    Perez, J; Llorente, R

    2014-01-01

    In this paper the use of hybrid WiMedia-defined ultra-wideband (UWB) and IEEE 802.16d WiMAX radio-over-fibre is proposed and experimentally demonstrated for multi-mode based in-building optical networks with the advantage of great immunity to optical transmission impairments. In the proposed approach, spectral coexistence of both signals must be achieved with negligible mutual interference. The experimental study performed addressed an indoor configuration with 50 μm multi-mode fibres (MMF) and 850 nm vertical-cavity surface-emitting laser (VCSEL) transmitters. The results indicate that the impact of the wireless convergence in radio-over-multi-mode fibre (RoMMF) is significant for UWB transmissions, mainly due to MMF dispersion and electrooptical (EO) devices with limited bandwidth. On the other hand, WiMAX transmission is feasible for a 300 m MMF and 30 m wireless link in the presence of UWB, with −31 dBm WiMAX EVM. (paper)

  3. Taking Your iPod touch to the Max

    CERN Document Server

    Sadun, Erica

    2010-01-01

    Unleash your iPhone and take it to the limit using secret tips and techniques from gadget hacker Erica Sadun. Fast and fun to read, Taking Your iPod touch 4 to the Max is fully updated to show you how get the most out of Apple's new OS 4. You'll find all the best undocumented tricks as well as the most efficient and enjoyable introduction to the iPhone available. Starting with an introduction to iPod touch 4 basics, you'll quickly move on to discover the iPod touch's hidden potential, like how to connect to a TV, get contract-free VOIP, and hack OS 4 so it will run apps on your iPod touch. Fro

  4. Stress-enhanced lithiation in MAX compounds for battery applications

    KAUST Repository

    Zhu, Jiajie

    2017-07-31

    Li-ion batteries are well-established energy storage systems. Upon lithiation conventional group IVA compound anodes undergo large volume expansion and thus suffer from stress-induced performance degradation. Instead of the emerging MXene anodes fabricated by an expensive and difficult-to-control etching technique, we study the feasibility of utilizing the parent MAX compounds. We reveal that M2AC (M=Ti, V and A=Si, S) compounds repel lithiation at ambient conditions, while structural stress turns out to support lithiation, in contrast to group IVA compounds. For V2SC the Li diffusion barrier is found to be lower than reported for group IVA compound anodes, reflecting potential to achieve fast charge/discharge.

  5. Elevated carbon dioxide increases salicylic acid in Glycine max.

    Science.gov (United States)

    Casteel, Clare L; Segal, Lauren M; Niziolek, Olivia K; Berenbaum, May R; DeLucia, Evan H

    2012-12-01

    Concentrations of carbon dioxide (CO(2)) are increasing in the atmosphere, affecting soybean (Glycine max L.) phytohormone signaling and herbivore resistance. Whether the impact of elevated CO(2) on phytohormones and induced defenses is a generalized response within this species is an open question. We examined jasmonic acid (JA) and salicylic acid (SA) under ambient and elevated CO(2) concentrations with and without Japanese beetle (Popillia japonica Newman) damage and artificial damage across six soybean cultivars (HS93-4118, Pana, IA 3010, Loda, LN97-15076, and Dwight). Elevated CO(2) reduced constitutive levels of JA and related transcripts in some but not all soybean cultivars. In contrast to the variation in JA, constitutive levels of salicylic were increased universally among soybean cultivars grown under elevated CO(2). Variation in hormonal signaling may underpin observed variation in the response of insect herbivores and pathogens to plants grown under elevated CO(2).

  6. BUROCRACIA E CRISE DE LEGITIMIDADE: A PROFECIA DE MAX WEBER

    OpenAIRE

    Branco, Pedro H. Villas Bôas Castelo

    2016-01-01

    Resumo A sociologia da dominação e a do direito de Max Weber representam uma mudança de paradigma no campo da teoria política. Ao deslocarem o eixo de análise dos meios de aquisição e instituição do poder dos dominadores para a crença dos dominados, operam uma notável inversão no modo de compreensão da legitimidade do poder político. A exposição da tensão entre a expansão burocrática e a estrutura da dominação democrática conferiram à reflexão weberiana um tom profético, cuja repercussão se f...

  7. [Max Weber's illness--sociologic aspects of the depressive structure].

    Science.gov (United States)

    Frommer, J; Frommer, S

    1993-05-01

    Between 1897 and 1902 the economist and sociologist Max Weber from Heidelberg suffered from a severe depressive crisis with multiple recurrences of its symptomatology in the following years. The biographic background of the disease process is examined. Questions regarding the specific diagnosis are discussed. Furthermore, his work shows that Weber was indirectly deeply concerned with the cultural, historical and social background conditions of depressive experience and behavior in the context of his study on Protestantic Ethics and the Spirit of Capitalism. Weber's definition of modern society as an iron cage, determined by Occidental Rationalism, shows that this cultural background demands a great amount of role conformity from the individual. Weber's theoretical approach should spark interest in the current psychopathological discussion of the characteristic structural features of a depressed personality.

  8. Stress-enhanced lithiation in MAX compounds for battery applications

    KAUST Repository

    Zhu, Jiajie; Chroneos, Alexander; Wang, Lei; Rao, Feng; Schwingenschlö gl, Udo

    2017-01-01

    Li-ion batteries are well-established energy storage systems. Upon lithiation conventional group IVA compound anodes undergo large volume expansion and thus suffer from stress-induced performance degradation. Instead of the emerging MXene anodes fabricated by an expensive and difficult-to-control etching technique, we study the feasibility of utilizing the parent MAX compounds. We reveal that M2AC (M=Ti, V and A=Si, S) compounds repel lithiation at ambient conditions, while structural stress turns out to support lithiation, in contrast to group IVA compounds. For V2SC the Li diffusion barrier is found to be lower than reported for group IVA compound anodes, reflecting potential to achieve fast charge/discharge.

  9. Historical Paths and Intellectual Projects: The Case of Max Weber

    Directory of Open Access Journals (Sweden)

    Sven Eliaeson

    2017-06-01

    Full Text Available Max Weber is an elusive classic, and competing traditions claim his legacy. As in other cases, the interpretation of this classic should take into account formative experiences, historical context and links to older traditions. Weber theorized rational modernity, albeit with a certain ambiguity (the “iron cage”. He reworked the legacy of German historicism, but took it in the direction of methodological individualism; at the same time, and through the very affiliation to historicism, he contributed to German nation-building. His emphasis on the state as a necessary unit of analysis now seems obsolete, and so does his inclination to take the imperialistic dominance of the European great powers for granted. He was not immune to the ideology that opposed Germany’s cultural calling to Western civilization and Russian barbarism.

  10. The Max Launch Abort System - Concept, Flight Test, and Evolution

    Science.gov (United States)

    Gilbert, Michael G.

    2014-01-01

    The NASA Engineering and Safety Center (NESC) is an independent engineering analysis and test organization providing support across the range of NASA programs. In 2007 NASA was developing the launch escape system for the Orion spacecraft that was evolved from the traditional tower-configuration escape systems used for the historic Mercury and Apollo spacecraft. The NESC was tasked, as a programmatic risk-reduction effort to develop and flight test an alternative to the Orion baseline escape system concept. This project became known as the Max Launch Abort System (MLAS), named in honor of Maxime Faget, the developer of the original Mercury escape system. Over the course of approximately two years the NESC performed conceptual and tradeoff analyses, designed and built full-scale flight test hardware, and conducted a flight test demonstration in July 2009. Since the flight test, the NESC has continued to further develop and refine the MLAS concept.

  11. NASA/Max Planck Institute Barium Ion Cloud Project.

    Science.gov (United States)

    Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.

    1973-01-01

    NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.

  12. Taking Your iPad 2 to the Max

    CERN Document Server

    Sadun, Erica; Sande, Steve

    2011-01-01

    iPad 2: It looks different. It acts different. It connects to the world, yet it is as personal as a well-worn book. And now it has two cameras!. Taking Your iPad 2 to the Max is written so that anyone can quickly get up to speed on Apple's latest hit. As bloggers at The Unofficial Apple Weblog (TUAW.com), the authors have the happy privilege of working with Apple products every day, and they'll guide you through all of the perks of being an iPad 2 owner. This book takes you from selecting and buying an iPad, to connecting it to the Internet, to using the incredible power of the iPad and all it

  13. Taking Your iPhone 4 to the Max

    CERN Document Server

    Sadun, Erica

    2010-01-01

    Unleash your iPhone and take it to the limit using powerful tips and techniques from tech consultant Steve Sande and gadget hacker Erica Sadun. Fast and fun to read, Taking Your iPhone 4 to the Max shows you how to get the most out of Apple's new iPhone 4. You'll find all the best undocumented tricks as well as the most efficient and enjoyable introduction to the iPhone available. Starting with an introduction to iPhone basics, you'll quickly move on to discover the iPhone's hidden potential, like how to connect to a TV, use Voice Control, have video chats with FaceTime, and call friends overs

  14. Taking Your iPhoto '11 to the Max

    CERN Document Server

    Grothaus, Michael

    2011-01-01

    Taking Your iPhoto '11 to the Max walks users through Apple's most popular software application in the iLife suite - iPhoto. This book helps readers use iPhoto to its fullest to organize and create digital memories and keepsakes. * Learn all about Apple's newest version of iPhoto - iPhoto '11 * Explore iPhoto, one menu button at a time * Walk-through tutorials guide you step-by-step What you'll learn * How to import existing photo libraries from popular Windows applications * How to organize and edit your photos * How to tag your photos using iPhoto's Faces and Places features * How to create

  15. Arpad Gerster and Max Thorek contributions to American surgery.

    Science.gov (United States)

    Langer, Robert M

    2009-01-01

    The legacy and the influence on American surgery is discussed of two Hungarian born surgeons: Arpad Gerster (1848-1923) and Max Thorek (1880-1960). Both of them were born in Northern Hungary, then part of the Austro-Hungarian Monarchy, today Slovakia. Gerster got his medical education in Vienna The influence of Theodor Billroth left everlasting impressions in him. In 1874 he arrived in New York and became the first doctor in town who practiced exclusively surgery. He became an attending surgeon in The German Hospital and later at Mount Sinai Hospital. Gerster modernized the hospital's functions and services, introducing the rotation system, and also made the original observation that dissemination of cancer may be caused by surgery. His aseptic methods were revolutionary at the time. Max Thorek arrived in Chicago in 1897. With a fantastic endurance he overwhelmed all barriers and became a doctor. He started his practice in one of Chicago's poor immigrant neighborhoods, but stepwise he could excel and in 1911 he co-founded The American Hospital. His ideas of modernizing surgery became reality. Thorek is one of the first who practiced plastic surgery, and his contribution by writing about surgical errors and safeguards became a great success. He founded the International College of Surgeons, a result of his widespread relations among surgeons all over the world. The parallels in the lives of these great surgeons: solid education, knowledge of languages, talent for music, literature, and arts, creative thinking combined with hard work, good humor, as well as a social conscience led them to make groundbreaking contributions to American and international surgery.

  16. Fermilab Main Injector plan

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-07-15

    The Fermilab Main Injector is the centrepiece of the 'Fermilab III' scheme to significantly upgrade the Laboratory's existing accelerator complex. The new accelerator is designed to provide increased particle beam levels to boost the collision rate in the Tevatron proton-antiproton collider (luminosity in excess of 5 x 10{sup 31} per sq cm per s) and, if approved, would provide increased flexibility in all areas of high energy physics research.

  17. Fermilab Main Injector plan

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    The Fermilab Main Injector is the centrepiece of the 'Fermilab III' scheme to significantly upgrade the Laboratory's existing accelerator complex. The new accelerator is designed to provide increased particle beam levels to boost the collision rate in the Tevatron proton-antiproton collider (luminosity in excess of 5 x 10 31 per sq cm per s) and, if approved, would provide increased flexibility in all areas of high energy physics research

  18. Maine coast winds

    Energy Technology Data Exchange (ETDEWEB)

    Avery, Richard

    2000-01-28

    The Maine Coast Winds Project was proposed for four possible turbine locations. Significant progress has been made at the prime location, with a lease-power purchase contract for ten years for the installation of turbine equipment having been obtained. Most of the site planning and permitting have been completed. It is expect that the turbine will be installed in early May. The other three locations are less suitable for the project, and new locations are being considered.

  19. Project evaluation: main characteristics

    OpenAIRE

    Moutinho, Nuno

    2010-01-01

    — The evaluation process of real investment projects must consider not only the traditional financial approach, but also non-financial aspects. Non financial analysis can provide additional relevant information about projects. We investigate financial and non-financial areas most relevant in project appraisal. We present main critical success factors and areas of analysis that lead to the perception of project success. Finally, companies are segmented to verify its financial and non-financial...

  20. Marketing Maine Tablestock Potatoes

    OpenAIRE

    Berney, Gerald; Grajewski, Gregory; Hinman, Don; Prater, Marvin E.; Taylor, April

    2010-01-01

    The Marketing Services Division of USDA’s Agricultural Marketing Service (AMS) was asked by USDA’s Agricultural Research Service (ARS) National Program Leader and ARS’s New England Soil and Water Research Laboratory personnel to help with existing efforts to assist Maine fresh potato farmers in their search for alternative marketing strategies, and reverse the recent decline in the profitability of their operations. ARS researchers previously had conducted an exhaustive study defining possibl...

  1. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI

  2. WiMAX security and quality of service an end-to-end perspective

    CERN Document Server

    Tang, Seok-Yee; Sharif, Hamid

    2010-01-01

    WiMAX is the first standard technology to deliver true broadband mobility at speeds that enable powerful multimedia applications such as Voice over Internet Protocol (VoIP), online gaming, mobile TV, and personalized infotainment. WiMAX Security and Quality of Service, focuses on the interdisciplinary subject of advanced Security and Quality of Service (QoS) in WiMAX wireless telecommunication systems including its models, standards, implementations, and applications. Split into 4 parts, Part A of the book is an end-to-end overview of the WiMAX architecture, protocol, and system requirements.

  3. Apple F-box Protein MdMAX2 Regulates Plant Photomorphogenesis and Stress Response

    Directory of Open Access Journals (Sweden)

    Jian-Ping An

    2016-11-01

    Full Text Available MAX2 (MORE AXILLARY GROWTH2 is involved in diverse physiological processes, including photomorphogenesis, the abiotic stress response, as well as karrikin and strigolactone signaling-mediated shoot branching. In this study, MdMAX2, an F-box protein that is a homolog of Arabidopsis MAX2, was identified and characterized. Overexpression of MdMAX2 in apple calli enhanced the accumulation of anthocyanin. Ectopic expression of MdMAX2 in Arabidopsis exhibited photomorphogenesis phenotypes, including increased anthocyanin content and decreased hypocotyl length. Further study indicated that MdMAX2 might promote plant photomorphogenesis by affecting the auxin signaling as well as other plant hormones. Transcripts of MdMAX2 were noticeably up-regulated in response to NaCl and Mannitol treatments. Moreover, compared with the wild type, the MdMAX2-overexpressing apple calli and Arabidopsis exhibited increased tolerance to salt and drought stresses. Taken together, these results suggest that MdMAX2 plays a positive regulatory role in plant photomorphogenesis and stress response.

  4. The development of a differential game related to terrorism: Min-Max differential game

    Directory of Open Access Journals (Sweden)

    Abd El-Monem A. Megahed

    2017-07-01

    Full Text Available In this work, we study a differential game related to terrorism: Min-Max differential game taking into account the governmental activities such as the education quality, increasing the chances of labor, social justice, religious awareness and security arrangements. A Min-Max differential game between government and terrorist organizations is considered in this study. To obtain the optimal strategy of solving this problem, we study the analytic form of a Min-Max differential game and the governmental activities. Furthermore, a saddle point of a Min-Max differential game is studied.

  5. Boride-based nano-laminates with MAX-phase-like behaviour

    International Nuclear Information System (INIS)

    Telle, Rainer; Momozawa, Ai; Music, Denis; Schneider, Jochen M.

    2006-01-01

    MAX-phases being usually composed of transition metals, group A elements and carbon/nitrogen are considered interesting materials for many applications because of their tremendous bulk modulus, 'reversible' plasticity, and machinability. This is mainly due to their unique kind of bonding comprising covalent, ionic as well as metallic bonds providing 'easy' planes of rupture and deformability due to the layered crystal structures. In transition metal boride systems, similar types of bonding are available. In particular the W 2 B 5 -structure type and its stacking variations allow the synthesis of strongly layered crystal structures exhibiting unique delamination phenomena. The paper presents ab initio calculations showing the similarities of bonding between the ternary carbides and the corresponding ternary or quaternary borides. Formation of boride-based nano-laminates from auxiliary liquid phases, from the melt as well as during sintering and precipitation from supersaturated solid solutions will be discussed by means of SEM and TEM studies. The role of impurities weakening the interlayer bonding will be addressed in particular. The pronounced cleavage parallel to the basal plane gives rise for crack deflection and pull-out mechanisms if the laminates are dispersed in brittle matrices such as boron carbide, silicon carbide or other transition metal borides. - Graphical abstract: Some transition metal borides crystallise in a layered structure of alternating stacks of metal and boron atoms giving rise for strongly anisotropic properties. Their preferred cleavage parallel and the deformability perpendicular to the basal plan are similar to the peculiar mechanical behaviour recently described for MAX-phases. Ab initio calculations of the crystal structure prove the weak bonds between the layers for a variety of borides which can be used to reinforce ceramic materials on a nano-scale level

  6. Summary of main points

    International Nuclear Information System (INIS)

    2006-01-01

    In conjunction with its 6. annual meeting, the WPDD in close co-operation with the FSC held a Topical session on 'Stakeholder Involvement in Decommissioning' on November 14, 2005. The session was attended by 36 participants totally representing 14 NEA member countries and 2 international organisations. Two keynote addresses were given at the Topical Session. The first one treated of what is needed for robust decisions and how to bring all stakeholders into the debate. In the second keynote address a summary was made on what have been said on stakeholder involvement in decommissioning during earlier meetings of the WPDD. The main part of the session was then devoted to views from different stakeholders regarding their role and their involvement. This part contained viewpoints from local communities (Kaevlinge in Sweden and Port Hope in Canada), authorities (Scottish Executive and CSNC) and operators (EDF from France and EWN from Germany). Case studies from the decommissioning of Dounrey in the UK and from Trojan and Main Yankee in the USA were presented in the end part of the Topical session followed by a summary and lessons learnt report by the Rapporteur. A detailed programme of the Topical session can be seen in Appendix 1

  7. Effects of exercise and group counselling on body composition and VO(2max) in overweight women with polycystic ovary syndrome

    DEFF Research Database (Denmark)

    Roessler, Kirsten Kaya; Birkebaek, Camilla; Ravn, Pernille

    2013-01-01

    with group counselling sessions on anthropometry and cardio-respiratory fitness in women with PCOS. DESIGN: Seventeen sedentary, overweight women with PCOS were randomized in a cross-over design to 16 weeks of intervention: Eight weeks high intensity aerobic exercise was followed by eight weeks group...... counselling (n=8) or vice versa (n=9). Fourteen of the women completed the tests. MAIN OUTCOME MEASURES: Waist circumference, body mass index and maximal aerobic capacity (VO(2max) ) were measured at baseline, cross-over and post-intervention. RESULTS: Waist circumference (119.9 vs. 106.5 cm) and body mass...

  8. NRAO Astronomer Wins Max-Planck Research Award

    Science.gov (United States)

    2005-04-01

    Dr. Christopher Carilli, a National Radio Astronomy Observatory (NRAO) astronomer in Socorro, New Mexico, has been chosen to receive the prestigious Max Planck Research Award from the Alexander von Humboldt Foundation and the Max Planck Society in Germany. Christopher Carilli Dr. Christopher Carilli Click on image for more photos CREDIT: NRAO/AUI/NSF Carilli, a radio astronomer, and German particle physicist Christof Wetterich are the 2005 recipients of the award, conferred on "one researcher working in Germany and one working abroad who have already gained an international reputation and who are expected to produce outstanding achievements in the framework of international collaboration," according to an announcement from the Humboldt Foundation. "This is a great honor for Chris, and we are proud to see him receive such important international recognition for the excellence of his research," said NRAO Director Fred K.Y. Lo. Carilli's research has focused on studying very distant galaxies in the early Universe, and a quest to find the first luminous objects, such as stars or galaxies, to emerge. His most recent interests focus on unveiling the mysteries of what cosmologists call the "Epoch of Reionization," when the first stars and galaxies ionized the neutral hydrogen that pervaded the young Universe. Carilli and his research colleagues have used NRAO's Very Large Array and other radio telescopes to discover that the molecular raw material for star formation already was present in a galaxy seen as it was about 800 million years after the Big Bang, less than 1/16 the current age of the Universe. The Max Planck Research Award provides 750,000 Euros (currently about $900,000), to be used over five years, for research. The funding is provided by the German Ministry of Education and Research. Carilli will use the funding to support young researchers and to build scientific instrumentation, with a focus on fostering radio studies of cosmic reionization and the first

  9. Optical properties of the main electron-irradiation-induced defects in p-type InP: Comparison with calculations for the isolated and acceptor-paired phosphorus vacancy

    International Nuclear Information System (INIS)

    Bretagnon, T.; Bastide, G.; Rouzeyre, M.; Delerue, C.; Lannoo, M.

    1990-01-01

    Optical capacitance spectroscopy and thermal annealing of defects have been used to study both the electron traps EP 1 ,E 11 and the dominant hole traps (H 3 -H 4 -H 4 ' ) produced by low-energy electron irradiation in Zn-doped p-type InP. This shows that the 1.1-eV onset in the photoionization cross sections (PCS's) previously attributed to (H 3 -H 4 ) is actually due to the unrelated electron trap EP 1 . The true PCS's σ p 0 of (H 3 ,H 4 ) are compared with PCS tight-binding Green's function calculations to test the earlier proposal that the (H 2 -H 3 -H 4 -H 4 ' ,E 11 ) series might arise from different states of (V P -Zn) complexes. The model yields an effective agreement as concerns both the energy location of the hole-levels series in the forbidden gap and the vanishingly small contribution to the PCS's of the four equivalent L valence-band minima. The proposal that E 11 might correspond to the ionization of an e state of the V P -Zn complex also agrees with the experimental observation of both optical transitions to the valence band and to the conduction band but cannot account for the midgap position of E 11

  10. Radiative transition probabilities for the main diatomic electronic systems of N2, N2+, NO, O2, CO, CO+, CN, C2 and H2 produced in plasma of atmospheric entry

    Science.gov (United States)

    Qin, Z.; Zhao, J. M.; Liu, L. H.

    2017-11-01

    Accurate radiative transition probabilities of diatomic electronic systems are required to calculate the discrete radiation of plasmas. However, most of the published transition probabilities are obtained using older spectroscopic constants and electronic transition moment functions (ETMFs), some of which deviates greatly from experimental data. Fortunately, a lot of new spectroscopic constants that include more anharmonic correction terms than the earlier ones have been published over the past few years. In this work, the Einstein coefficients, Franck-Condon factors and absorption band oscillator strengths are calculated for important diatomic radiative transition processes of N2-O2, CO2-N2 and H2 plasmas produced in entering into the atmosphere of Earth, Mars and Jupiter. The most up-to-date spectroscopic constants are selected to reconstruct the potential energy curves by the Rydberg-Klein-Rees (RKR) method. Then the vibrational wave functions are calculated through the resolution of the radial Schrödinger equation for such potential energy curves. These results, together with the latest "ab-initio" ETMFs derived from the literature are used to compute the square of electronic-vibrational transition moments, Einstein coefficients and absorption band oscillator strengths. Moreover, the Franck-Condon factors are determined with the obtained vibrational wave functions. In the supplementary material we present tables of the radiative transition probabilities for 40 band systems of N2, N2+, NO, O2, CO, CO+, CN, C2 and H2 molecules. In addition, the calculated radiative lifetimes are systematically validated by available experimental results.

  11. TRIGA reactor main systems

    International Nuclear Information System (INIS)

    Boeck, H.; Villa, M.

    2007-01-01

    This module describes the main systems of low power (<2 MW) and higher power (≥2 MW) TRIGA reactors. The most significant difference between the two is that forced reactor cooling and an emergency core cooling system are generally required for the higher power TRIGA reactors. However, those TRIGA reactors that are designed to be operated above 3 MW also use a TRIGA fuel that is specifically designed for those higher power outputs (3 to 14 MW). Typical values are given for the respective systems although each TRIGA facility will have unique characteristics that may only be determined by the experienced facility operators. Due to the inherent wide scope of these research reactor facilities construction and missions, this training module covers those systems found at most operating TRIGA reactor facilities but may also discuss non-standard equipment that was found to be operationally useful although not necessarily required. (author)

  12. The use and misuse of V(c,max) in Earth System Models.

    Science.gov (United States)

    Rogers, Alistair

    2014-02-01

    Earth System Models (ESMs) aim to project global change. Central to this aim is the need to accurately model global carbon fluxes. Photosynthetic carbon dioxide assimilation by the terrestrial biosphere is the largest of these fluxes, and in many ESMs is represented by the Farquhar, von Caemmerer and Berry (FvCB) model of photosynthesis. The maximum rate of carboxylation by the enzyme Rubisco, commonly termed V c,max, is a key parameter in the FvCB model. This study investigated the derivation of the values of V c,max used to represent different plant functional types (PFTs) in ESMs. Four methods for estimating V c,max were identified; (1) an empirical or (2) mechanistic relationship was used to relate V c,max to leaf N content, (3) V c,max was estimated using an approach based on the optimization of photosynthesis and respiration or (4) calibration of a user-defined V c,max to obtain a target model output. Despite representing the same PFTs, the land model components of ESMs were parameterized with a wide range of values for V c,max (-46 to +77% of the PFT mean). In many cases, parameterization was based on limited data sets and poorly defined coefficients that were used to adjust model parameters and set PFT-specific values for V c,max. Examination of the models that linked leaf N mechanistically to V c,max identified potential changes to fixed parameters that collectively would decrease V c,max by 31% in C3 plants and 11% in C4 plants. Plant trait data bases are now available that offer an excellent opportunity for models to update PFT-specific parameters used to estimate V c,max. However, data for parameterizing some PFTs, particularly those in the Tropics and the Arctic are either highly variable or largely absent.

  13. Komplexní animace v 3D Studiu Max

    OpenAIRE

    Černý, Miloš

    2011-01-01

    Tato práce má za úkol obeznámit čtenáře s uceleným postupem pro vznik komplexní počítačové animace za pomoci 3D modelovacího a animačního softwaru 3ds Max. Provede ho celým postupem od tvorby modelů, přes jejich texturování a skinování až po pozdější animaci se zaměřením na složitější prvky. Kromě praktických příkladů práce popisuje i potřebné teoretické znalosti k jednotlivým problémům, které zároveň v praxi ukáže. Čtenář by měl mít po přečtení této práce představu o tom, jak podobná animace...

  14. Testing Strategies and Methodologies for the Max Launch Abort System

    Science.gov (United States)

    Schaible, Dawn M.; Yuchnovicz, Daniel E.

    2011-01-01

    The National Aeronautics and Space Administration (NASA) Engineering and Safety Center (NESC) was tasked to develop an alternate, tower-less launch abort system (LAS) as risk mitigation for the Orion Project. The successful pad abort flight demonstration test in July 2009 of the "Max" launch abort system (MLAS) provided data critical to the design of future LASs, while demonstrating the Agency s ability to rapidly design, build and fly full-scale hardware at minimal cost in a "virtual" work environment. Limited funding and an aggressive schedule presented a challenge for testing of the complex MLAS system. The successful pad abort flight demonstration test was attributed to the project s systems engineering and integration process, which included: a concise definition of, and an adherence to, flight test objectives; a solid operational concept; well defined performance requirements, and a test program tailored to reducing the highest flight test risks. The testing ranged from wind tunnel validation of computational fluid dynamic simulations to component ground tests of the highest risk subsystems. This paper provides an overview of the testing/risk management approach and methodologies used to understand and reduce the areas of highest risk - resulting in a successful flight demonstration test.

  15. Effect of neutron irradiation on select MAX phases

    International Nuclear Information System (INIS)

    Tallman, Darin J.; Hoffman, Elizabeth N.; Caspi, El’ad N.; Garcia-Diaz, Brenda L.; Kohse, Gordon; Sindelar, Robert L.; Barsoum, Michel W.

    2015-01-01

    Herein we report on the effect of neutron irradiation – of up to 0.1 displacements per atom at 360(20) °C or 695(25) °C – on polycrystalline samples of Ti 3 AlC 2 , Ti 2 AlC, Ti 3 SiC 2 and Ti 2 AlN. Rietveld refinement of X-ray diffraction patterns of the irradiated samples showed irradiation-enhanced dissociation into TiC of the Ti 3 AlC 2 and Ti 3 SiC 2 phases, most prominently in the former. Ti 2 AlN also showed an increase in TiN content, as well as Ti 4 AlN 3 after irradiation. In contrast, Ti 2 AlC was quite stable under these irradiation conditions. Dislocation loops are seen to form in Ti 2 AlC and Ti 3 AlC 2 after irradiation at 360(20) °C. The room temperature electrical resistivity of all samples increased by an order of magnitude after irradiation at 360(20) °C, but only by 25% after 695(25) °C, providing evidence for the MAX phases’ dynamic recovery at temperatures as low at 695(25) °C. Based on these preliminary results, it appears that Ti 2 AlC and Ti 3 SiC 2 are the more promising materials for high-temperature nuclear applications

  16. Max Weber or Jesus Christ: in whose image?

    Science.gov (United States)

    Fitzpatrick, A M; Gaylor, C C

    1985-10-01

    The bureaucratic model of organization and the model that emerges from the Gospel and Vatican Council II provide a stark contrast for Catholic health care administrators to ponder. As articulated by sociologist Max Weber, a bureaucracy is based on a hierarchical structure with sharply defined and protected levels of authority, centralized decision making, rules that govern personnel behavior, and an impersonalized view of employees that stresses their roles as functionaries. The Christian, Gospel-based model, on the other hand, places a premium on collegiality, shared authority, the mediation of conscience, the common good, and the work of the individual. Even though only a few will shape management policy in a large hospital, policymaking should be viewed as a service, a ministry that entails stewardship. Catholic health care leaders should reflect the spirit of collegiality by bringing various strata of staff together in a dynamic, united effort. Thus the institution's statement of mission will not be an abstract recitation of pieties but a living reality, a philosophy that is "owned" by the workers.

  17. Max Weber Revisited, the Verstehen of Migration through Qualitative Research

    Directory of Open Access Journals (Sweden)

    Jorge A. BUSTAMANTE

    2017-01-01

    Full Text Available Se incluye 1 una reinterpretación de un par de conceptos básicos ( Gemeinten Sinn y Verstehen de Max Weber. Se define a la migración internacional (inmigración como una relación social de carácter laboral. Se hace referencia al libro de Ernesto Galarza. La noción teórica de Verstehen entendida por Weber como un “entendimiento pro - fundo” de un fenómeno social, da lugar a la narración que hace el autor, derivada del uso del 2 método de “observación participante” de una experiencia personal. De ésta se deriva el concepto de vulnerabilidad que implica una innovación a los enfo - ques teóricos de la migración. Lo anterior se encuadra en un enfoque metodológico de investigación cualitativa de la cual 3 no se desprenden “hallazgos” en su sentido empírico, sino explicaciones complementarias del “sentido” de los hechos relatados. 4 El encuentro del autor con un compañero migrante en el centro de detención, se presenta como el origen empírico del concepto de vulnerabilidad.

  18. Max Weber o el enigma emocional del origen del capitalismo

    Directory of Open Access Journals (Sweden)

    EDUARDO BERICAT ALASTUEY

    2001-01-01

    Full Text Available Se analiza el trabajo clave de Max Weber, La ética protestante y el espíritu del capitalismo, desde la perspectiva de la Sociología de las Emociones. Aunque la inclusión de las emociones de los fenómenos sociales es clave para entender la idea de Weber sobre el dogma de la predestinación, los sociólogos han trivializado el papel de la emoción. Tras detallar la creencia de Weber en que el espíritu del capitalismo parte del conocimiento de que el destino del hombre está predeterminado (la ética protestante, se destaca que la angustia, más específicamente la humillación, invocada por esta creencia, debe figurar dentro de cualquier teoría acerca de la cultura. El sentimiento de humillación es explorado a través de los componentes cognitivos, evaluativos y emotivos de la cultura, proporcionando una mejor comprensión de la omnisciencia divina, la falta de respeto que la humanidad se merece y la ausencia de felicidad. A causa de la humillación y la falta de dignidad sufrida en muchos niveles, el hombre busca el orgullo personal, el éxito mundano y la modernidad, olvidando la humildad, la salvación eterna y la tradición.

  19. Metabolic and Transcriptional Reprogramming in Developing Soybean (Glycine max Embryos

    Directory of Open Access Journals (Sweden)

    Ruth Grene

    2013-05-01

    Full Text Available Soybean (Glycine max seeds are an important source of seed storage compounds, including protein, oil, and sugar used for food, feed, chemical, and biofuel production. We assessed detailed temporal transcriptional and metabolic changes in developing soybean embryos to gain a systems biology view of developmental and metabolic changes and to identify potential targets for metabolic engineering. Two major developmental and metabolic transitions were captured enabling identification of potential metabolic engineering targets specific to seed filling and to desiccation. The first transition involved a switch between different types of metabolism in dividing and elongating cells. The second transition involved the onset of maturation and desiccation tolerance during seed filling and a switch from photoheterotrophic to heterotrophic metabolism. Clustering analyses of metabolite and transcript data revealed clusters of functionally related metabolites and transcripts active in these different developmental and metabolic programs. The gene clusters provide a resource to generate predictions about the associations and interactions of unknown regulators with their targets based on “guilt-by-association” relationships. The inferred regulators also represent potential targets for future metabolic engineering of relevant pathways and steps in central carbon and nitrogen metabolism in soybean embryos and drought and desiccation tolerance in plants.

  20. Biofertilisasi bakteri rhizobium pada tanaman kedelai (Glycine max (L MERR.

    Directory of Open Access Journals (Sweden)

    Tini Surtiningsih

    2012-02-01

    Full Text Available The aim of this research want to know the influence of the addition Rhizobium bacteria species, dose and combination both ofthem, on growth and production of soybean plant (Glycine max (L Merr.. The experimental design of this research was factorial design4×2, 4 species of Rhizobium are R1 = Rhizobium japonicum, R2 = R. phaseoli, R3 = R. leguminosarum, R4 = mixture of R1, R2 andR3, and 2 dose of inoculan Rhizobium (D1 = 5 m/plant, and D2 = 10 ml/plant with 1010 sel bacteria/ml and 5 replications. Independentvariable is species of Rhizobium, dose of inoculan Rhizobium and combination both of them. Dependent variable is dry matter, weightof nodules and dry weight of seeds. The harvest data was analyzed by Kruskal-Wallis Test using 5% level (a = 0.05 followed by Mann-Whitney Test. The result of this research show that species of Rhizobium, dose of inoculan Rhizobium and combination both of thempresent insignificant result (a > 0.05 on soybean growth and production, but the mixture of Rhizobium species with high level doseof bacteria, present better result than single species with low dose of bacteria.

  1. Nuclear norm regularized convolutional Max Pos@Top machine

    KAUST Repository

    Li, Qinfeng

    2016-11-18

    In this paper, we propose a novel classification model for the multiple instance data, which aims to maximize the number of positive instances ranked before the top-ranked negative instances. This method belongs to a recently emerged performance, named as Pos@Top. Our proposed classification model has a convolutional structure that is composed by four layers, i.e., the convolutional layer, the activation layer, the max-pooling layer and the full connection layer. In this paper, we propose an algorithm to learn the convolutional filters and the full connection weights to maximize the Pos@Top measure over the training set. Also, we try to minimize the rank of the filter matrix to explore the low-dimensional space of the instances in conjunction with the classification results. The rank minimization is conducted by the nuclear norm minimization of the filter matrix. In addition, we develop an iterative algorithm to solve the corresponding problem. We test our method on several benchmark datasets. The experimental results show the superiority of our method compared with other state-of-the-art Pos@Top maximization methods.

  2. Characterisation of Central-African emissions based on MAX-DOAS measurements, satellite observations and model simulations over Bujumbura, Burundi.

    Science.gov (United States)

    Gielen, Clio; Hendrick, Francois; Pinardi, Gaia; De Smedt, Isabelle; Stavrakou, Trissevgeni; Yu, Huan; Fayt, Caroline; Hermans, Christian; Bauwens, Maité; Ndenzako, Eugene; Nzohabonayo, Pierre; Akimana, Rachel; Niyonzima, Sébastien; Müller, Jean-Francois; Van Roozendael, Michel

    2016-04-01

    Central Africa is known for its strong biogenic, pyrogenic, and to a lesser extent anthropogenic emissions. Satellite observations of species like nitrogen dioxide (NO2) and formaldehyde (HCHO), as well as inverse modelling results have shown that there are large uncertainties associated with the emissions in this region. There is thus a need for additional measurements, especially from the ground, in order to better characterise the biomass-burning and biogenic products emitted in this area. We present MAX-DOAS measurements of NO2, HCHO, and aerosols performed in Central Africa, in the city of Bujumbura, Burundi (3°S, 29°E, 850m). A MAX-DOAS instrument has been operating at this location by BIRA-IASB since late 2013. Aerosol-extinction and trace-gases vertical profiles are retrieved by applying the optimal-estimation-based profiling tool bePRO to the measured O4, NO2 and HCHO slant-column densities. The MAX-DOAS vertical columns and profiles are used for investigating the diurnal and seasonal cycles of NO2, HCHO, and aerosols. Regarding the aerosols, the retrieved AODs are compared to co-located AERONET sun photometer measurements for verification purpose, while in the case of NO2 and HCHO, the MAX-DOAS vertical columns and profiles are used for validating GOME-2 and OMI satellite observations. To characterise the biomass-burning and biogenic emissions in the Bujumbura region, the trace gases and aerosol MAX-DOAS retrievals are used in combination to MODIS fire counts/radiative-power and GOME-2/OMI NO2 and HCHO satellite data, as well as simulations from the NOAA backward trajectory model HYSPLIT. First results show that HCHO seasonal variation around local noon is driven by the alternation of rain and dry periods, the latter being associated with intense biomass-burning agricultural activities and forest fires in the south/south-east and transport from this region to Bujumbura. In contrast, NO2 is seen to depend mainly on local emissions close to the city, due

  3. Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).

    Science.gov (United States)

    Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R

    2016-03-01

    Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

  4. V-dotO2max prediction from multi-frequency bioelectrical impedance analysis

    International Nuclear Information System (INIS)

    Stahn, Alexander; Strobel, Günther; Terblanche, Elmarie

    2008-01-01

    Bioelectrical impedance analysis (BIA) has been shown to be highly related to skeletal muscle mass and blood volume, both of which are important determinants of maximal oxygen uptake (V-dotO 2max ). The aim of the present study was therefore to investigate the ability of whole-body and segmental multi-frequency BIA to improve current nonexercise V-dotO 2max prediction models. Data for V-dotO 2max (mL min −1 ), anthropometry, self-reported physical activity (PA-R) and BIA were collected in 115 men and women. Multiple linear regression analysis (MLR) was used to develop the most parsimonious prediction model. Segmental BIA was not superior to whole-body measurements. Correlation coefficients between V-dotO 2max and resistance indices were significantly higher at 500 kHz compared to 50 kHz (p 2max (r = 0.89). After adjusting for age, gender and PA-R, MLR revealed that the inclusion of intracellular resistance index was slightly, but significantly (p 2max ( −1 ). In short, whole-body BIA marginally improves the accuracy of nonexercise V-dotO 2max prediction models and its advantage is most pronounced in individuals with particularly low V-dotO 2max

  5. MAXIMAL OXIGEN UPTAKE (VO2 MAX AS THE INDICATOR OF PHYSICAL WORKING CAPACITY IN SPORTSMEN

    Directory of Open Access Journals (Sweden)

    Zvezdana Rajkovaca

    2005-12-01

    Full Text Available The term “aerobic capacity” represents the sum of aerobic metabolic processes in human organism. It is the basis of the physical working capacity. Value of the maximal oxygen uptake (VO2max is the best indicator for the aerobic capacity evaluation.The purpose of this study was to check the possibility of using VO2max as the indicator of aerobic capacity in sportsmen and to check differences in VO2max values in regard to non-sportsmen.The goals were: 1.Analyses of the VO2max values in sportsmen of various sports 2. Comparison of values of sportsmen with the values of non-sportsmen.This study included 67 sportsmen (rowers, football players and judoists and 28 nonsportsmen. VO2max was measured by using a direct method.The results obtained show statistically higher VO2max values in rowers (4,52 L/min - 55,8 mL/kg/min in regard to football players (4,2 L/min – 53,6 mL/kg/min, judoists (3,58 L/min - 47,2 mL/ kg/min and non-sportsmen (3,28 L/min – 42,3 mL/kg/min. Successful rowing requires high anaerobic capacity and, therefore, high VO2max.These results show higher values of VO2max in sportsmen in regard to non-sportsmen, which is the result of training only.

  6. NiMax: a new approach to develop hadronic event generators in HEP

    International Nuclear Information System (INIS)

    Amelin, N.; Komogorov, M.

    2000-01-01

    The NiMax framework is a new approach to develop, assemble and use hadronic event generators in HEP. There are several important concepts of the NiMax architecture: the components, the data file, the application domain module, the control system and the project. Here we describe these concepts stressing their functionality

  7. Improvements of ModalMax High-Fidelity Piezoelectric Audio Device

    Science.gov (United States)

    Woodard, Stanley E.

    2005-01-01

    ModalMax audio speakers have been enhanced by innovative means of tailoring the vibration response of thin piezoelectric plates to produce a high-fidelity audio response. The ModalMax audio speakers are 1 mm in thickness. The device completely supplants the need to have a separate driver and speaker cone. ModalMax speakers can perform the same applications of cone speakers, but unlike cone speakers, ModalMax speakers can function in harsh environments such as high humidity or extreme wetness. New design features allow the speakers to be completely submersed in salt water, making them well suited for maritime applications. The sound produced from the ModalMax audio speakers has sound spatial resolution that is readily discernable for headset users.

  8. MaxSynBio - Avenues towards creating cells from the bottom up.

    Science.gov (United States)

    Schwille, Petra; Spatz, Joachim; Landfester, Katharina; Bodenschatz, Eberhard; Herminghaus, Stephan; Sourjik, Victor; Erb, Tobias; Bastiaens, Philippe; Lipowsky, Reinhard; Hyman, Anthony; Dabrock, Peter; Baret, Jean-Christophe; Vidakovic-Koch, Tanja; Bieling, Peter; Dimova, Rumiana; Mutschler, Hannes; Robinson, Tom; Tang, Dora; Wegner, Seraphine; Sundmacher, Kai

    2018-05-11

    A large Max Planck-based German research consortium ('MaxSynBio') was formed to investigate living systems from a fundamental perspective. The research program of MaxSynBio relies solely on the bottom-up approach to Synthetic Biology. MaxSynBio focuses on the detailed analysis and understanding of essential processes of life, via their modular reconstitution in minimal synthetic systems. The ultimate goal is to construct a basic living unit entirely from non-living components. The fundamental insights gained from the activities in MaxSynBio can eventually be utilized for establishing a new generation of biotechnological processes, which would be based on synthetic cell constructs that replace natural cells currently used in conventional biotechnology. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Estimated VO2max and its corresponding velocity predict performance of amateur runners

    Directory of Open Access Journals (Sweden)

    Bruno Ribeiro Ramalho Oliveira

    2012-03-01

    Full Text Available In recent years, there has been a substantial increase in the number of runners, with a proportional increase in their involvement in amateur street competition. Identification of the determinants of performance in this population appears necessary for optimization of time devoted to training. The objective of this study was to ascertain the association between estimated maximal oxygen uptake (VO2max, critical velocity (CV and VO2max velocity (VVO2max and athletic performance in the 3.6 km (uphill and 10 and 21.1 km (flatland events. Twelve amateur runners (nine male, mean age 36 ± 5 years underwent five tests: 1 and 5 km race on level ground, 3.6 km race with slope (≈8%, and indirect VO2max measurement. CV was determined from the linear relationship between distance and run time on the first two tests. The subjects then took part in two official 10 km and 21.1 km (half marathon races. VVO2max was calculated from the VO2max through a metabolic equation. VO2max showed the best association with running performance in the 10 and 21.1 km events. For the uphill race, VVO2max showed a better association. Overall, the variable with the highest average association was VO2max (0.91±0.07, followed by VVO2max (0.90±0.04 and VC (0.87±0.06. This study showed strong associations between physiological variables established by low-cost, user-friendly indirect methods and running performance in the 10 and 21.1 km (flatland and 3.6 km (uphill running events.

  10. Anatomical Study of Somatic Embryogenesis in Glycine max (L. Merrill

    Directory of Open Access Journals (Sweden)

    Juliana Aparecida Fernando

    2002-09-01

    Full Text Available A comparative anatomical analysis of somatic embryogenesis in two soybean (Glycine max (L. Merrill genotypes was carried out. The somatic embryos were originated from cotyledonary explants obtained from immature zygotic embryos. The medium used for somatic embryogenesis induction was Murashige and Skoog, 1962, salts and Gamborg et al., 1968, vitamins (MSB supplemented with 0.8 mg.L-1 of 2,4-D for genotype PI 123439 and 40 mg.L-1 of 2,4-D for ‘Williams 82’. Globular structures, constituted by meristematic cells, originated from subepidermal cell divisions of the cotyledonary mesophyll. In PI 123439, the globular structures presented tracheary differentiation among meristematic cells and they could follow distinct morphogenetic process depending on their location along the explant. For ‘Williams 82’ it was observed globular structures along the cotyledonary explant surface. They gave rise to somatic embryos. These embryos showed different morphologies and they were classified based on their shape and number of cotyledons. The ability of these morphological types to convert to plantlets was discussed.Realizou-se uma análise anatômica comparativa da embriogênese somática em dois genótipos de soja (Glycine max (L. Merrill. Os embriões somáticos foram obtidos a partir de explantes cotiledonares excisados de embriões zigóticos imaturos do genótipo PI 123439, adaptado às condições tropicais, e ‘Williams 82’. O meio utilizado para indução da embriogênese somática constituiu-se de sais de Murashige e Skoog,1962, e vitaminas de Gamborg et al., 1968 (MSB suplementado com 0,8 mg.L-1 de 2,4-D (PI 123439 e 40 mg.L-1 (‘Williams 82’. Estruturas globulares originaram-se a partir de divisões celulares nas camadas subepidérmicas do mesofilo cotiledonar e foram constituídas por células meristemáticas. No genótipo PI 123439, as estruturas globulares apresentaram diferenciação traqueal entre as células meristemáticas e

  11. An ab initio study on compressibility of Al-containing MAX-phase carbides

    International Nuclear Information System (INIS)

    Bai, Yuelei; He, Xiaodong; Wang, Rongguo; Zhu, Chuncheng

    2013-01-01

    The compressibility of Al-containing MAX carbides was investigated in details using first-principle calculations based on density functional theory. The bond stiffness and bond angle as a function of pressure were examined. The M-Al bond stiffness is about 1/3–1/2 of M-C bond stiffness. The M-C bond close to Al atoms has the highest bond stiffness in M 3 AlC 2 and M 4 AlC 3 phases, with the similar bond stiffness of the other two bonds in the latter. Generally, the bond stiffness of the strongest M-C bond increases with increasing VEC (Valence Electron Concentration), which also affects the bond stiffness of other bonds. Of most importance, the bulk moduli are 0.256 of the mean bond stiffness for three series. With increasing pressure, M-Al bond angle increases, but M-C bond angles decreases, which indicates that M-Al and M-C bonds shift towards basal plane and along c-axis, respectively. As a result, the compressibility becomes more difficult along c-axis than a-axis. Some abnormal phenomena in the compressibility of Al-containing M n+1 AlX n phases with VEC = 6 are attributed to the thermodynamical instability of these compounds

  12. Time limit and time at VO2max' during a continuous and an intermittent run.

    Science.gov (United States)

    Demarie, S; Koralsztein, J P; Billat, V

    2000-06-01

    The purpose of this study was to verify, by track field tests, whether sub-elite runners (n=15) could (i) reach their VO2max while running at v50%delta, i.e. midway between the speed associated with lactate threshold (vLAT) and that associated with maximal aerobic power (vVO2max), and (ii) if an intermittent exercise provokes a maximal and/or supra maximal oxygen consumption longer than a continuous one. Within three days, subjects underwent a multistage incremental test during which their vVO2max and vLAT were determined; they then performed two additional testing sessions, where continuous and intermittent running exercises at v50%delta were performed up to exhaustion. Subject's gas exchange and heart rate were continuously recorded by means of a telemetric apparatus. Blood samples were taken from fingertip and analysed for blood lactate concentration. In the continuous and the intermittent tests peak VO2 exceeded VO2max values, as determined during the incremental test. However in the intermittent exercise, peak VO2, time to exhaustion and time at VO2max reached significantly higher values, while blood lactate accumulation showed significantly lower values than in the continuous one. The v50%delta is sufficient to stimulate VO2max in both intermittent and continuous running. The intermittent exercise results better than the continuous one in increasing maximal aerobic power, allowing longer time at VO2max and obtaining higher peak VO2 with lower lactate accumulation.

  13. Diffusion of Ag, Au and Cs implants in MAX phase Ti3SiC2

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Weilin; Henager, Charles H.; Varga, Tamas; Jung, Hee Joon; Overman, Nicole R.; Zhang, Chonghong; Gou, Jie

    2015-05-16

    MAX phases (M: early transition metal; A: elements in group 13 or 14; X: C or N), such as titanium silicon carbide (Ti3SiC2), have a unique combination of both metallic and ceramic properties, which make them attractive for potential nuclear applications. Ti3SiC2 has been considered as a possible fuel cladding material. This study reports on the diffusivities of fission product surrogates (Ag and Cs) and a noble metal Au (with diffusion behavior similar to Ag) in this ternary compound at elevated temperatures, as well as in dual-phase nanocomposite of Ti3SiC2/3C-SiC and polycrystalline CVD 3C-SiC for behavior comparisons. Samples were implanted with Ag, Au or Cs ions and characterized with various methods, including x-ray diffraction, electron backscatter diffraction, energy dispersive x-ray spectroscopy, Rutherford backscattering spectrometry, helium ion microscopy, and transmission electron microscopy. The results show that in contrast to immobile Ag in 3C-SiC, there is a significant outward diffusion of Ag in Ti3SiC2 within the dual-phase nanocomposite during Ag ion implantation at 873 K. Similar behavior of Au in polycrystalline Ti3SiC2 was also observed. Cs out-diffusion and release from Ti3SiC2 occurred during post-implantation thermal annealing at 973 K. This study suggests caution and further studies in consideration of Ti3SiC2 as a fuel cladding material for advanced nuclear reactors operating at very high temperatures.

  14. Nutrient Management practices for enhancing Soybean (Glycine max L. production

    Directory of Open Access Journals (Sweden)

    FARID A. HELLAL

    2013-05-01

    La soya (Glycine max L., es el cultivo de legumbres más importante en el mundo. La magnitud de las pérdidas en el rendimientode la soya debido a deficiencias varía dependiendo de los nutrientes. Las deficiencias de N, P, Fe, B y S pueden causar pérdidas en rendimiento de hasta 10 %, 29-45 %, 22-90 %, 100 % y 16-30 %, respectivamente, en la soya dependiendo de la fertilidad del suelo, clima y factores intrínsecos a las plantas. La textura de los suelos utilizados en el cultivo de soya varía entre arenosa y arcillosa. La salinidad del suelo es uno de los mayores factores limitantes en la producción del cultivo en regiones semiáridas, y la salinidad por cloro tiene un mayor efecto en la disminución del rendimiento que la salinidad por sulfatos. Los granos de soya son una gran fuente de energía que contienen 40 % de proteína y 19 % de aceite. El éxito del manejo de nutrientes es maximizar la productividad del cultivo mientras se minimizan los impactos ambientales. Las prácticas de manejo de nutrientes balanceadas y reguladas en el tiempo contribuyen a un crecimiento sostenido del rendimiento y la calidad, influencian la salud de las plantas y reducen los riesgos ambientales. Una nutrición balanceada con fertilizantes minerales puede ayudar en el manejo integrado de plagas para reducir los daños causados por las infestaciones de pestes y enfermedades y reducir los insumos requeridos para su control. Una fertilización balanceada genera mayores ganancias para los agricultores, no necesariamente por reducción de los insumos. El papel de la educación y la extensión en la difusión del conocimiento actual sobre manejo de nutrientes es crucial, desafiante y continuo.

  15. Max Havelaar Dan Citra Antikolonial: Sebuah Tinjauan Poskolonial

    Directory of Open Access Journals (Sweden)

    Christina Dewi

    2008-06-01

    Full Text Available Max Havelaar is a literary work by Multatuli, a.k.a. E.E. Douwes Dekker. This novel is usually known as a novel with an anti-colonial image. While in the other hand, this novel never suggests to stop colonialism done by Dutch in Hindia Belanda. This research aims at revealing the relationship between colonialism's views with its innovation of narrative technique in this novel. The first analysis is trying to do a focalization on MH. The writer wants to do it because MH presents an argument about the essence of colonialism in Hindia Belanda through opinions and views from three focalizations. MH uniquely uses three focalizers and its uniqueness is shown by Stern as a narrator-fokalizer in the Lebak Episode. Although Stern is one of the characters in the novel, it gives the impression that Stern is in a neutral position. He takes place in the middle-position between the two other character-focalizers. However, since he is one of the characters in this novel, his focalization is not perfectly neutral in the manner of inviting the readers to support the attitude of Multatuli, Readers are confronted to make a choice between the war of anticolonial or procolonial interests and to support either one of the two character-fokulizers : Multatuli or Droogstoppcl. The orientalism theory has been applied to conduct focalization in the novel as the research object.. The novel characterizes Multatuli and Stern as opposing figures against the forced labor while Droogstoppcl, on the other hand, as a figure who is supporting forced labor of the coffee trade. MH strove for labors to earn proper wages so that the issue about the procedures of cultuur-stelsel has a special place in MH. Anti-colonial traits are shown by a rejection of low wages, oppression, robbery, injustice, mistreating, and discrimination. This novel is influencing the colonial hegemony of the competition of industrial products among colonized countries in Europe in the 19th century. That is

  16. Max Graf's "Reminiscences of Professor Sigmund Freud" revisited: new evidence from the Freud archives.

    Science.gov (United States)

    Wakefield, Jerome C

    2007-01-01

    Recently derestricted Freud Archive interviews with Max and Herbert Graf and Herbert's wife shed new light on Max Graf's article, "Reminiscences of Professor Sigmund Freud," published in The Psychoanalytic Quarterly in 1942. To explain discrepancies between the interviews and the earlier article, the author postulates that, in the article, Max Graf purposely distorted or omitted certain details in order not to reveal Herbert's identity as "Little Hans" (Freud 1909). The interviews place incidents reported in the article in a new and more complex light, and also underscore the intensely personal nature of the intellectual development of the psychoanalytic movement.

  17. Experimental evaluation of high speed impulse radio UWB interference on WiMAX narrowband systems

    DEFF Research Database (Denmark)

    Yu, Xianbin; Yin, Xiaoli; Tafur Monroy, Idelfonso

    2010-01-01

    Interference of high speed impulse radio ultrawideband (IR-UWB) on 5.735GHz single carrier 64/256-QAM WiMAX narrowband signals is experimentally investigated. The experimental results indicate that the coexistence of 625Mbps and 2Gbps IR-UWB signals causes penalties of 3dB and 0.5dB respectively...... to the WiMAX channel. At higher bit rates, IR-UWB technology is therefore expected to reduce its interference on WiMAX signals. This work serves as further motivation for the exploration of IR-UWB systems with higher speed and higher capacity....

  18. Tunnel Effect in CNNs: Image Reconstruction From Max-Switch Locations

    DEFF Research Database (Denmark)

    de La Roche Saint Andre, Matthieu; Rieger, Laura; Hannemose, Morten

    2016-01-01

    In this paper, we show that reconstruction of an image passed through a neural network is possible, using only the locations of the max pool activations. This was demonstrated with an architecture consisting of an encoder and a decoder. The decoder is a mirrored version of the encoder, where...... convolutions are replaced with deconvolutions and poolings are replaced with unpooling layers. The locations of the max pool switches are transmitted to the corresponding unpooling layer. The reconstruction is computed only from these switches without the use of feature values. Using only the max switch...

  19. LTE, WiMAX and WLAN network design, optimization and performance analysis

    CERN Document Server

    Korowajczuk, Leonhard

    2011-01-01

    A technological overview of LTE and WiMAX LTE, WiMAX and WLAN Network Design, Optimization and Performance Analysis provides a practical guide to LTE and WiMAX technologies introducing various tools and concepts used within. In addition, topics such as traffic modelling of IP-centric networks, RF propagation, fading, mobility, and indoor coverage are explored; new techniques which increase throughput such as MIMO and AAS technology are highlighted; and simulation, network design and performance analysis are also examined. Finally, in the latter part of the book Korowajczuk gives a step-by-step

  20. Sulphur dioxide metabolism in soy-bean, Glycine max var. biloxi

    International Nuclear Information System (INIS)

    Garsed, S.G.; Read, D.J.

    1977-01-01

    First-trifoliate leaves of soybeans Glycine max (L.) Merr. were exposed to 35 SO 2 in the light or dark, and the chemical distribution of the radioactivity in the source leaves and in the remainder of the plant was determined after 1.5 and 24 h. Only 35 SO 4 2- was found in leachates in the light but substantial quantities of 35 SO 3 2- were present in the dark. Radioactivity was present in all fractions of the source leaves examined (insoluble, centrifuge pellet, soluble protein, chloroform-soluble and water-soluble). The main water-soluble compounds labelled were sulphate >glutathione >cysteine. Small quantities of sulphite were also recovered in the dark but not in the light. The ratio of soluble: insoluble radioactivity in the sink tissues was influenced more by leaf age than by light treatment. Sulphate, glutathione and cysteine were labelled in the petioles of the source leaves and 35 SO 4 2- was found in the nutrient solution after 1.5 h in both treatments. It is concluded that light is not necessary for the reduction of internal 35 SO 2 products. The results are discussed in relation to current knowledge of SO 2 metabolism. (author)

  1. Analysis of embryo, cytoplasm and maternal effects on fatty acid components in soybean (Glycine max Merill.)

    Institute of Scientific and Technical Information of China (English)

    NING Hailong; LI Wenxia; LI Wenbin

    2007-01-01

    The quality of oil determined by the constituents and proportion of fatty acid components,and the understanding of heredity of fatty acid components are of importance to breeding good quality soybean varieties.Embryo,cytoplasmic and maternal effects and genotype×environment interaction effects for quality traits of soybean [Glycine max (L.) Merrill.] seeds were analyzed using a general genetic model for quantitative traits of seeds with parents,F1 and F2,of 20 crosses from a diallel mating design of five parents planted in the field in 2003 and 2004 in Harbin,China.The interaction effects of palmitic,stearic,and linoleic acid contents were larger than the genetic main effects,while the genetic main effects were equal to interaction effects for linolenic and oleic acid content.Among all kinds of genetic main effects,the embryo effects were the largest for palmitic,stearic,and linoleic acids,while the cytoplasm effects were the largest for oleic and linolenic acids.Among all kinds of interaction effects,the embryo interaction effects were the largest for fatty acids.The sum of additive and additive× environment effects were larger than that of dominance and dominance×environment effects for the linolenic acid content,but not for other quality traits.The general heritabilities were the main parts of heritabilities for palmitic and oleic acid contents,but the interaction was more important for stearic,linoleic,and linolenic acid contents.For the general heritability,maternal and cytoplasm heritabilities were the main components for palmitic,oleic,and linolenic acid contents.It was shown for the interaction heritabilities that the embryo interaction heritabilities were more important for oleic and linolenic acid contents,while the maternal interaction heritabilities were more important for linoleic acid content.Among selection response components,the maternal and cytoplasm general responses and/or interaction responses were more important for palmitic

  2. Monitoring shipping emissions in the German Bight using MAX-DOAS measurements

    Science.gov (United States)

    Seyler, André; Wittrock, Folkard; Kattner, Lisa; Mathieu-Üffing, Barbara; Peters, Enno; Richter, Andreas; Schmolke, Stefan; Burrows, John P.

    2017-04-01

    Shipping is generally the most energy efficient transportation mode, but, at the same time, it accounts for four fifths of the worldwide total merchandise trade volume. As a result, shipping contributes a significant part to the emissions from the transportation sector. The majority of shipping emissions occurs within 400 km of land, impacting on air pollution in coastal areas and harbor towns. The North Sea has one of the highest ship densities in the world and the vast majority of ships heading for the port of Hamburg sail through the German Bight and into the river Elbe. A three-year time series of ground-based MAX-DOAS measurements of NO2 and SO2 on the island Neuwerk in the German Bight has been analyzed for contributions from shipping emissions. Measurements of individual ship plumes as well as of background pollution are possible from this location, which is 6-7 kilometers away from the main shipping lane towards the harbor of Hamburg. More than 2000 individual ship plumes have been identified in the data and analyzed for the emission ratio of SO2 to NO2, yielding an average ratio of 0.3 for the years 2013/2014. Contributions of ships and land-based sources to air pollution levels in the German Bight have been estimated, showing that despite the vicinity to the shipping lane, the contribution of shipping sources to air pollution is only about 40%. Since January 2015, much lower fuel sulfur content limits of 0.1% (before: 1.0%) apply in the North and Baltic Sea Emission Control Area (ECA). Comparing MAX-DOAS measurements from 2015/2016 (new regulation) to 2013/2014 (old regulation), a large reduction in SO2/NO2 ratios in shipping emissions and a significant reduction (by a factor of eight) in ambient coastal SO2 levels have been observed. In addition to that, selected shipping emission measurements from other measurement sites and campaigns are presented. This study is part of the project MeSMarT (Measurements of Shipping emissions in the Marine Troposphere

  3. "Economia e sociedade": a herança de Max Weber à luz da edição de sua Obra completa (MWG "Economy and society": Max Weber's legacy following the publication of his Complete works (MWG

    Directory of Open Access Journals (Sweden)

    M. Rainer Lepsius

    2012-01-01

    Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.

  4. MaxEnt’s parameter configuration and small samples: are we paying attention to recommendations? A systematic review

    Directory of Open Access Journals (Sweden)

    Narkis S. Morales

    2017-03-01

    Full Text Available Environmental niche modeling (ENM is commonly used to develop probabilistic maps of species distribution. Among available ENM techniques, MaxEnt has become one of the most popular tools for modeling species distribution, with hundreds of peer-reviewed articles published each year. MaxEnt’s popularity is mainly due to the use of a graphical interface and automatic parameter configuration capabilities. However, recent studies have shown that using the default automatic configuration may not be always appropriate because it can produce non-optimal models; particularly when dealing with a small number of species presence points. Thus, the recommendation is to evaluate the best potential combination of parameters (feature classes and regularization multiplier to select the most appropriate model. In this work we reviewed 244 articles published between 2013 and 2015 to assess whether researchers are following recommendations to avoid using the default parameter configuration when dealing with small sample sizes, or if they are using MaxEnt as a “black box tool.” Our results show that in only 16% of analyzed articles authors evaluated best feature classes, in 6.9% evaluated best regularization multipliers, and in a meager 3.7% evaluated simultaneously both parameters before producing the definitive distribution model. We analyzed 20 articles to quantify the potential differences in resulting outputs when using software default parameters instead of the alternative best model. Results from our analysis reveal important differences between the use of default parameters and the best model approach, especially in the total area identified as suitable for the assessed species and the specific areas that are identified as suitable by both modelling approaches. These results are worrying, because publications are potentially reporting over-complex or over-simplistic models that can undermine the applicability of their results. Of particular importance

  5. V/V/sub max/ test for QSOs: comments on the paper by Hawkins and Stewart

    International Nuclear Information System (INIS)

    Wills, D.

    1983-01-01

    Hawkins and Stewart's interpretation of the results of the V/V/sub max/ test for QSO samples is shown to be invalid. Their suggestion that the high values of V/V/sub max/ at small redshifts result from the exclusion of nearby QSOs from the samples is examined quantitatively for the well-studied 3CR sample, and shown to have a negligible effect on the results. Their claim that the values of V/V/sub max/ at larger redshifts indicate a uniform space density of QSOs is not true after an error in their calculations is corrected. Although the V/V/sub max/ test is less sensitive to space density evolution at large redshifts, current results are in good agreement with the hypothesis that a single density evolution law describes the observations out to a redshift of at least 2.5

  6. [Max Weber. Poliitika kui elukutse ja kutsumus. Teadus kui elukutse ja kutsumus] / Hermo Kuusk

    Index Scriptorium Estoniae

    Kuusk, Hermo, 1976-

    2011-01-01

    Tutvustus: Weber, Max. Poliitika kui elukutse ja kutsumus ; Teadus kui elukutse ja kutsumus / tõlkijad: Jaan Isotamm, Henn Käärik, Kaia Sisask. Tallinn : TLU Press, 2010. (Bibliotheca controversiarum)

  7. Max Weber's Types of Rationality: Cornerstones for the Analysis of Rationalization Processes in History.

    Science.gov (United States)

    Kalberg, Stephen

    1980-01-01

    Explores rationality in Max Weber's works and identifies four types of rationality which play major roles in his writing--practical, theoretical, substantive, and formal. Implications for society and education are discussed. (DB)

  8. Modeling and solving semiring constraint satisfaction problems by transformation to weighted semiring Max-SAT

    CSIR Research Space (South Africa)

    Leenen, L

    2007-12-01

    Full Text Available The authors present a variant of the Weighted Maximum Satisfiability Problem (Weighted Max-SAT), which is a modeling of the Semiring Constraint Satisfaction framework. They show how to encode a Semiring Constraint Satisfaction Problem (SCSP...

  9. Jazõk do demokrati ne dovedjot / Max van der Stoel

    Index Scriptorium Estoniae

    Stoel, Max van der, 1924-2011

    1999-01-01

    OSCE vähemusrahvuste ülemkomissari Max van der Stoeli pöördumine Lennart Meri poole seoses riigikeele oskuse nõude sisseviimisega Riigikogu valimise ja kohaliku omavalitsuse volikogu valimise seadusesse

  10. Penultimate modeling of spatial extremes: statistical inference for max-infinitely divisible processes

    KAUST Repository

    Huser, Raphaë l; Opitz, Thomas; Thibaud, Emeric

    2018-01-01

    Extreme-value theory for stochastic processes has motivated the statistical use of max-stable models for spatial extremes. However, fitting such asymptotic models to maxima observed over finite blocks is problematic when the asymptotic stability

  11. RLAM: A Dynamic and Efficient Reinforcement Learning-Based Adaptive Mapping Scheme in Mobile WiMAX Networks

    Directory of Open Access Journals (Sweden)

    M. Louta

    2014-01-01

    Full Text Available WiMAX (Worldwide Interoperability for Microwave Access constitutes a candidate networking technology towards the 4G vision realization. By adopting the Orthogonal Frequency Division Multiple Access (OFDMA technique, the latest IEEE 802.16x amendments manage to provide QoS-aware access services with full mobility support. A number of interesting scheduling and mapping schemes have been proposed in research literature. However, they neglect a considerable asset of the OFDMA-based wireless systems: the dynamic adjustment of the downlink-to-uplink width ratio. In order to fully exploit the supported mobile WiMAX features, we design, develop, and evaluate a rigorous adaptive model, which inherits its main aspects from the reinforcement learning field. The model proposed endeavours to efficiently determine the downlink-to-uplinkwidth ratio, on a frame-by-frame basis, taking into account both the downlink and uplink traffic in the Base Station (BS. Extensive evaluation results indicate that the model proposed succeeds in providing quite accurate estimations, keeping the average error rate below 15% with respect to the optimal sub-frame configurations. Additionally, it presents improved performance compared to other learning methods (e.g., learning automata and notable improvements compared to static schemes that maintain a fixed predefined ratio in terms of service ratio and resource utilization.

  12. Ranking Based Locality Sensitive Hashing Enabled Cancelable Biometrics: Index-of-Max Hashing

    OpenAIRE

    Jin, Zhe; Lai, Yen-Lung; Hwang, Jung-Yeon; Kim, Soohyung; Teoh, Andrew Beng Jin

    2017-01-01

    In this paper, we propose a ranking based locality sensitive hashing inspired two-factor cancelable biometrics, dubbed "Index-of-Max" (IoM) hashing for biometric template protection. With externally generated random parameters, IoM hashing transforms a real-valued biometric feature vector into discrete index (max ranked) hashed code. We demonstrate two realizations from IoM hashing notion, namely Gaussian Random Projection based and Uniformly Random Permutation based hashing schemes. The disc...

  13. Training the Recurrent neural network by the Fuzzy Min-Max algorithm for fault prediction

    International Nuclear Information System (INIS)

    Zemouri, Ryad; Racoceanu, Daniel; Zerhouni, Noureddine; Minca, Eugenia; Filip, Florin

    2009-01-01

    In this paper, we present a training technique of a Recurrent Radial Basis Function neural network for fault prediction. We use the Fuzzy Min-Max technique to initialize the k-center of the RRBF neural network. The k-means algorithm is then applied to calculate the centers that minimize the mean square error of the prediction task. The performances of the k-means algorithm are then boosted by the Fuzzy Min-Max technique.

  14. Epidemiologia e geografia: o complexo patogênico de Max. Sorre

    Directory of Open Access Journals (Sweden)

    Marcelo Urbano Ferreira

    1991-09-01

    Full Text Available Apresentam-se alguns traços essenciais do conceito de complexo patogênico, formulado pelo geógrafo francês Max. Sorre, com o objetivo de estimular estudos de integração entre a epidemiologia e a geografia.Some essential features of the pathogenic complex concept formulated by the French geographer Max. Sorre are presented, aiming at integrating epidemiological and geografic studies.

  15. Epidemiologia e geografia: o complexo patogênico de Max. Sorre

    OpenAIRE

    Ferreira, Marcelo Urbano

    1991-01-01

    Apresentam-se alguns traços essenciais do conceito de complexo patogênico, formulado pelo geógrafo francês Max. Sorre, com o objetivo de estimular estudos de integração entre a epidemiologia e a geografia.Some essential features of the pathogenic complex concept formulated by the French geographer Max. Sorre are presented, aiming at integrating epidemiological and geografic studies.

  16. Genetic Variability in Soybean (Glycine max L.) for Low Soil ...

    African Journals Online (AJOL)

    Abush Tesfaye

    worldwide importance as food and market crop. This is mainly because of its high ... The application of inorganic P fertilizers is one of the possibilities for addressing the problem of low P availability. However ...... Soybean Research Conference held in Foz do Iguassu, Brazil, 1-5 March, 2004. Tong, X.J., X. Yan, Y.G. Lu, ...

  17. Penultimate modeling of spatial extremes: statistical inference for max-infinitely divisible processes

    KAUST Repository

    Huser, Raphaël

    2018-01-09

    Extreme-value theory for stochastic processes has motivated the statistical use of max-stable models for spatial extremes. However, fitting such asymptotic models to maxima observed over finite blocks is problematic when the asymptotic stability of the dependence does not prevail in finite samples. This issue is particularly serious when data are asymptotically independent, such that the dependence strength weakens and eventually vanishes as events become more extreme. We here aim to provide flexible sub-asymptotic models for spatially indexed block maxima, which more realistically account for discrepancies between data and asymptotic theory. We develop models pertaining to the wider class of max-infinitely divisible processes, extending the class of max-stable processes while retaining dependence properties that are natural for maxima: max-id models are positively associated, and they yield a self-consistent family of models for block maxima defined over any time unit. We propose two parametric construction principles for max-id models, emphasizing a point process-based generalized spectral representation, that allows for asymptotic independence while keeping the max-stable extremal-$t$ model as a special case. Parameter estimation is efficiently performed by pairwise likelihood, and we illustrate our new modeling framework with an application to Dutch wind gust maxima calculated over different time units.

  18. Applying FDTD to the Coverage Prediction of WiMAX Femtocells

    Directory of Open Access Journals (Sweden)

    Valcarce Alvaro

    2009-01-01

    Full Text Available Femtocells, or home base stations, are a potential future solution for operators to increase indoor coverage and reduce network cost. In a real WiMAX femtocell deployment in residential areas covered by WiMAX macrocells, interference is very likely to occur both in the streets and certain indoor regions. Propagation models that take into account both the outdoor and indoor channel characteristics are thus necessary for the purpose of WiMAX network planning in the presence of femtocells. In this paper, the finite-difference time-domain (FDTD method is adapted for the computation of radiowave propagation predictions at WiMAX frequencies. This model is particularly suitable for the study of hybrid indoor/outdoor scenarios and thus well adapted for the case of WiMAX femtocells in residential environments. Two optimization methods are proposed for the reduction of the FDTD simulation time: the reduction of the simulation frequency for problem simplification and a parallel graphics processing units (GPUs implementation. The calibration of the model is then thoroughly described. First, the calibration of the absorbing boundary condition, necessary for proper coverage predictions, is presented. Then a calibration of the material parameters that minimizes the error function between simulation and real measurements is proposed. Finally, some mobile WiMAX system-level simulations that make use of the presented propagation model are presented to illustrate the applicability of the model for the study of femto- to macrointerference.

  19. MAX to MYCN intracellular ratio drives the aggressive phenotype and clinical outcome of high risk neuroblastoma.

    Science.gov (United States)

    Ferrucci, Francesca; Ciaccio, Roberto; Monticelli, Sara; Pigini, Paolo; di Giacomo, Simone; Purgato, Stefania; Erriquez, Daniela; Bernardoni, Roberto; Norris, Murray; Haber, Michelle; Milazzo, Giorgio; Perini, Giovanni

    2018-03-01

    Childhood neuroblastoma, a disease of the sympathetic nervous system, is the most common solid tumour of infancy, remarkably refractory to therapeutic treatments. One of the most powerful independent prognostic indicators for this disease is the amplification of the MYCN oncogene, which occurs at high levels in approximately 25% of neuroblastomas. Interestingly, amplification and not just expression of MYCN has a strong prognostic value, although this fact appears quite surprising as MYCN is a transcription factor that requires dimerising with its partner MAX, to exert its function. This observation greatly suggests that the role of MYCN in neuroblastoma should be examined in the context of MAX expression. In this report, we show that, in contrast to what is found in normal cells, MAX expression is significantly different among primary NBs, and that its level appears to correlate with the clinical outcome of the disease. Importantly, controlled modulation of MAX expression in neuroblastoma cells with different extents of MYCN amplification, demonstrates that MAX can instruct gene transcription programs that either reinforce or weaken the oncogenic process enacted by MYCN. In general, our work illustrates that it is the MAX to MYCN ratio that can account for tumour progression and clinical outcome in neuroblastoma and proposes that such a ratio should be considered as an important criterion to the design and development of anti-MYCN therapies. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. Time limit and VO2 slow component at intensities corresponding to VO2max in swimmers.

    Science.gov (United States)

    Fernandes, R J; Cardoso, C S; Soares, S M; Ascensão, A; Colaço, P J; Vilas-Boas, J P

    2003-11-01

    The purpose of this study was to measure, in swimming pool conditions and with high level swimmers, the time to exhaustion at the minimum velocity that elicits maximal oxygen consumption (TLim at vVO(2)max), and the corresponding VO(2) slow component (O(2)SC). The vVO(2)max was determined through an intermittent incremental test (n = 15). Forty-eight hours later, TLim was assessed using an all-out swim at vVO(2)max until exhaustion. VO(2) was measured through direct oximetry and the swimming velocity was controlled using a visual light-pacer. Blood lactate concentrations and heart rate values were also measured. Mean VO(2)max for the incremental test was 5.09 +/- 0.53 l/min and the corresponding vVO(2)max was 1.46 +/- 0.06 m/s. Mean TLim value was 260.20 +/- 60.73 s and it was inversely correlated with the velocity of anaerobic threshold (r = -0.54, p energy cost of the respiratory muscles (r = 0.51), for p swimming pool, in high level swimmers performing at vVO(2)max, and that higher TLim seems to correspond to higher expected O(2)SC amplitude. These findings seem to bring new data with application in middle distance swimming.

  1. Familial aggregation of VO(2max) response to exercise training: results from the HERITAGE Family Study.

    Science.gov (United States)

    Bouchard, C; An, P; Rice, T; Skinner, J S; Wilmore, J H; Gagnon, J; Pérusse, L; Leon, A S; Rao, D C

    1999-09-01

    The aim of this study was to test the hypothesis that individual differences in the response of maximal O(2) uptake (VO(2max)) to a standardized training program are characterized by familial aggregation. A total of 481 sedentary adult Caucasians from 98 two-generation families was exercise trained for 20 wk and was tested for VO(2max) on a cycle ergometer twice before and twice after the training program. The mean increase in VO(2max) reached approximately 400 ml/min, but there was considerable heterogeneity in responsiveness, with some individuals experiencing little or no gain, whereas others gained >1.0 l/min. An ANOVA revealed that there was 2.5 times more variance between families than within families in the VO(2max) response variance. With the use of a model-fitting procedure, the most parsimonious models yielded a maximal heritability estimate of 47% for the VO(2max) response, which was adjusted for age and sex with a maternal transmission of 28% in one of the models. We conclude that the trainability of VO(2max) is highly familial and includes a significant genetic component.

  2. Effect of etching time and resin bond on the flexural strength of IPS e.max Press glass ceramic.

    Science.gov (United States)

    Xiaoping, Luo; Dongfeng, Ren; Silikas, Nick

    2014-12-01

    To evaluate the effect of hydrofluoric acid (HFA) etching time and resin cement bond on the flexural strength of IPS e.max(®) Press glass ceramic. Two hundred and ten bars, 25mm×3mm×2mm, were made from IPS e.max(®) Press ingots through lost-wax, hot-pressed ceramic fabrication technology and randomly divided into five groups with forty-two per group after polishing. The ceramic surfaces of different groups were etched by 9.5% hydrofluoric acid gel for 0, 20, 40, 60 and 120s respectively. Two specimens of each group were selected randomly to examine the surface roughness and 3-dimensional topography with atomic force microscope (AFM), and microstructure was analyzed by the field emission scanning electron microscope (FE-SEM). Then each group were subdivided into two subgroups (n=20). One subgroup of this material was selected to receive a thin (approximately 0.1mm) layer of resin luting agent (Variolink N) whereas the other subgroup remained unaltered. Half of subgroup's specimens were thermocycled 10,000 times before a 3-point bending test in order to determine the flexural strength. Interface between resin cement and ceramic was examined with field emission scanning electronic microscope. Roughness values increased with increasing etching time. The mean flexural strength values of group 0s, 20s, 40s, 60s and 120s were 384±33, 347±43, 330±53, 327±67 and 317±41MPa respectively. Increasing HF etching times reduced the mean flexural strength (pglass ceramic, but resin cement bonding to appropriately etched surface would strengthen the dental ceramic. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  3. Max Auwaerter Price lecture: building and probing atomic structures

    International Nuclear Information System (INIS)

    Ternes, M.

    2008-01-01

    Full text: The control of the geometric, electronic, and magnetic properties of atomic-scale nanostructures is a prerequisite for the understanding and fabrication of new materials and devices. Two routes lead towards this goal: Atomic manipulation of single atoms and molecules by scanning probe microscopy, or patterning using self-assembly. Atomic manipulation has been performed since almost 20 years, but it has been difficult to answer the simple question: how much force does it take to manipulate atoms and molecules on surfaces? To address this question, we used a combined atomic force and scanning tunneling microscope to simultaneously measure the force and the current between an adsorbate and a tip during atomic manipulation. We found that the force it takes to move an atom depends crucially on the binding between adsorbate and surface. Our results indicate that for moving metal atoms on metal surfaces, the lateral force component plays the dominant role. Measuring the forces during manipulation yielded the full potential energy landscape of the tip-sample interaction. Surprisingly, the potential energy barriers are comparable to diffusion barriers, which are obtained in the absence of a probe tip. Furthermore, we used the scanning tunneling microscope to assemble magnetic structures on a thin insulator. We found, that the spin of the atom is influenced by the magnetocrystalline anisotropy of the supporting surface which lifts the spin degeneracy of the ground state and enables the identification of individual atoms. The ground state of atoms with half-integer spin remains always degenerated at zero field due to Kramers theorem. We found that if these states differ by an orbital momentum of m = ±1 the localized spin is screened by the surrounding conducting electrons of the non-magnetic host and form a many-electron spin-singlet at sufficiently low temperature. (author)

  4. Max-Planck-Institute for Nuclear Physics. Annual report 1987

    International Nuclear Information System (INIS)

    Klapdor, H.V.; Jessberger, E.K.

    1987-01-01

    This annual report contains short communications and extended abstracts about the work performed at the named institute together with a list of publications and talks. The work concerns technical developments on accelerators and ion sources, developments of detectors and experimental setups, electronics, data processing, target developments, giant resonances, nuclear spectroscopy, nuclear reaction mechanisms, atomic physics, medium- and high-energy physics, statistical models of nuclei and nuclear reactions, nuclear reactions at high energies, many-particle theory, quantum chromodynamics, meteorites, comets, interstellar dust, planetary atmospheres, cosmic radiation, molecular collisions in the earth atmosphere, nuclear geology and geochemistry, as well as archaeology. See hints under the relevant topics. (HSI)

  5. THE COMPARISON OF ALIENATION IN “KÜRK MANTOLU MADONNA” BY SABAHATTİN ALİ AND “HOMO FABER” BY MAX FRISCH

    OpenAIRE

    İnci Aras

    2014-01-01

    In this study, we examine Sabahattin Ali’s “Kürk Mantolu Madonna”, one of the most important literary classics of Contemporary Turkish Literature, and Max Frisch’s “Homo Faber”, a famous novel in Contemporary German Literature. The main purpose of this study on these works which belong to Turkish and German cultures is to evaluate the characters related to their social and personal alienation. Therefore we carry out our analysis in line with the similarities and differences between main chara...

  6. Electronic commerce

    OpenAIRE

    Zvolánková, Pavla

    2010-01-01

    The thesis deals with a description of electronic commerce from its beginning up to present situation in this area. It explains basic terms connected with electronic commerce and it summarizes the relevant legislation. Moreover it describes e-contracts and rights and duties of both contractual parties. The main view is the view of Internet retailer, which is reflected in the practical part focused on concrete problems of retailers.

  7. Functional conjugated pyridines via main-group element tuning.

    Science.gov (United States)

    Stolar, Monika; Baumgartner, Thomas

    2018-03-29

    Pyridine-based materials have seen widespread attention for the development of n-type organic materials. In recent years, the incorporation of main-group elements has also explored significant advantages for the development and tunability of organic conjugated materials. The unique chemical and electronic structure of main-group elements has led to several enhancements in conventional organic materials. This Feature article highlights recent main-group based pyridine materials by discussing property enhancements and application in organic electronics.

  8. Finnsjoen study site. Scope of activities and main results

    International Nuclear Information System (INIS)

    Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.

    1992-12-01

    The Finnsjoen study site was selected in 1977 to provide input to the KBS-1 and KBS-2 performance assessments. The site was later used as a test site for testing new instruments and new site characterization methods, as well as a research site for studying mainly groundwater flow and groundwater transport. All together, the Finnsjoen studies have involved 11 cored boreholes, down to max 700 m depth, and extensive borehole geophysical, geochemical and geohydraulic measurements, as well as rock stress measurements and tracer tests. This report presents the scope of the Finnsjoen studies together with main results. Conceptual uncertainties in assumptions and models are discussed with emphasis on the models used for the performance assessment SKB91. Of special interest for the Finnsjoen study site is the strong influence caused by a subhorizontal fracture zone on groundwater flow, transport and chemistry

  9. Starting electronics

    CERN Document Server

    Brindley, Keith

    2005-01-01

    Starting Electronics is unrivalled as a highly practical introduction for hobbyists, students and technicians. Keith Brindley introduces readers to the functions of the main component types, their uses, and the basic principles of building and designing electronic circuits. Breadboard layouts make this very much a ready-to-run book for the experimenter; and the use of multimeter, but not oscilloscopes, puts this practical exploration of electronics within reach of every home enthusiast's pocket. The third edition has kept the simplicity and clarity of the original. New material

  10. Electronic identity

    CERN Document Server

    de Andrade, Norberto Nuno Gomes; Argles, David

    2014-01-01

    With the increasing availability of electronic services, security and a reliable means by which identity is verified is essential.Written by Norberto Andrade the first chapter of this book provides an overview of the main legal and regulatory aspects regarding electronic identity in Europe and assesses the importance of electronic identity for administration (public), business (private) and, above all, citizens. It also highlights the role of eID as a key enabler of the economy.In the second chapter Lisha Chen-Wilson, David Argles, Michele Schiano di Zenise and Gary Wills discuss the user-cent

  11. Ratios between the effective doses for tomographic phantoms MAX and FAX

    International Nuclear Information System (INIS)

    Kramer, R.; Khoury, H.J.

    2005-01-01

    In the last two decades, the coefficients for the equivalent dose in organs and tissues, as well as to the effective dose, recommended by the International Commission on Radiological Protection (ICRP) were determined using exposure models based on stylized phantoms type MIRD, representing the human body with its radiosensitive organs and tissues according to the ICRP 23 Reference Man, Monte Carlo codes that simulate in a simplified way radiation physics, fabric compositions from different sources, and sometimes applied in a no realistic way, and by the list of organs and tissues at risk with their corresponding weight factors, published in ICRP 60. In the meantime, the International Commission on radiation units and Measurements (ICRU) published reference data to human tissue compositions in ICRU 44 and ICRP launched new anatomical and physiological data of reference in the report number 89. In addition a draft report with recommendations to be released in 2005 (http://icrp.org/) advances significant changes in the list of radiosensitive organs and tissues as well as their corresponding weight factors. As a practical consequence, all components of the traditional stylized models of exposure should be replaced: Monte Carlo codes, human phantoms, the compositions of the fabric and the selection of the organs and tissues at risk with their respective weight factors to determine the effective dose. This article presents the results of comprehensive research into the dosimetric consequences of replacing the stylized models of exposure. The calculations were done using the EGS4 Monte Carlo and MCNP4C codes for external and internal exposure to photons and electrons with phantoms ADAM and EVA, as well as with tomographic phantoms MAX and FAX, for different compositions and tissue distributions. The ratios between effective doses for models of exposure based on phantoms of voxels and effective doses for the stylized models for external and internal exposure to photons and

  12. The effect of Iron Supplying on VO2 MAX and Haematology Parameter on Menstrual Woman

    Science.gov (United States)

    Nailuvar Sinaga, Rika; Sari Harahap, Novita; Mediyana Sari, Rima

    2018-03-01

    One of the supporting factors to have good aerobic endurance requires high VO2 max levels supported by good quality and quantity level of Haematology parameter especially such as erythrocytes, hematocrit and hemoglobin. One of the components in hemoglobin is iron which functions as theoxygen transport to parts of all body required in the process of metabolism. The objective of this research was to find out the difference between VO2 Max and Haematology parameter between iron supplying and no iron supplyingonmenstrual woman. The type of this research is quasi experimental research with non-randomized control group Pretest-Postest Design. The subjectsarethe studentsat faculty of Sports Sciences, Medan State University with the criteria of female gender, monthly regular menstrual cycle, having the level of health and the level of training, willing to be a sample by filling out informed consent. The total number of research subjectsis twenty students, divided into two groups namely the treatment group and the control group. The hematology parameter was measuredby Haemotology analyzer and VO2 Max was measured by multi-stage run. The result showed that there was a significant effect of iron supplyingon the increase of erythrocyte level on menstrual women, hemotocrit, haemoglobin and an increase in VO2 Max. Iron supplying on menstrual woman has the effect on the increase of erythrocyte, hematocrit, hemoglobin level and VO2 Max

  13. Relationship between running kinematic changes and time limit at vVO2max

    Directory of Open Access Journals (Sweden)

    Leonardo De Lucca

    2012-06-01

    Exhaustive running at maximal oxygen uptake velocity (vVO2max can alter running kinematic parameters and increase energy cost along the time. The aims of the present study were to compare characteristics of ankle and knee kinematics during running at vVO2max and to verify the relationship between changes in kinematic variables and time limit (Tlim. Eleven male volunteers, recreational players of team sports, performed an incremental running test until volitional exhaustion to determine vVO2max and a constant velocity test at vVO2max. Subjects were filmed continuously from the left sagittal plane at 210 Hz for further kinematic analysis. The maximal plantar flexion during swing (p<0.01 was the only variable that increased significantly from beginning to end of the run. Increase in ankle angle at contact was the only variable related to Tlim (r=0.64; p=0.035 and explained 34% of the performance in the test. These findings suggest that the individuals under study maintained a stable running style at vVO2max and that increase in plantar flexion explained the performance in this test when it was applied in non-runners.

  14. Effects of erythrocyte infusion on VO2max at high altitude

    DEFF Research Database (Denmark)

    Young, Jette Feveile; Sawka, M N; Muza, S R

    1996-01-01

    This study investigated whether autologous erythrocyte infusion would ameliorate the decrement in maximal O2 uptake (VO2max) experienced by lowlanders when they ascend to high altitude. VO2max was measured in 16 men (treadmill running) at sea level (SL) and on the 1st (HA1) and 9th (HA9) days...... of high-altitude (4,300 m) residence. After VO2max was measured at SL, subjects were divided into two matched groups (n = 8). Twenty-four hours before ascent to high altitude, the experimental group received a 700-ml infusion of autologous erythrocytes and saline (42% hematocrit), whereas the control...... group received only saline. The VO2max of erythrocyte-infused [54 +/- 1 (SE) ml.kg-1.min-1] and control subjects (52 +/- 2 ml.kg-1.min-1) did not differ at SL before infusion. The decrement in VO2max on HA1 did not differ between groups, averaging 26% overall, despite higher (P

  15. PRELIMINARY STUDY ON APPLICATION OF MAX PLUS ALGEBRA IN DISTRIBUTED STORAGE SYSTEM THROUGH NETWORK CODING

    Directory of Open Access Journals (Sweden)

    Agus Maman Abadi

    2016-04-01

    Full Text Available The increasing need in techniques of storing big data presents a new challenge. One way to address this challenge is the use of distributed storage systems. One strategy that implemented in distributed data storage systems is the use of Erasure Code which applied to network coding. The code used in this technique is based on the algebraic structure which is called as vector space. Some studies have also been carried out to create code that is based on other algebraic structures such as module.  In this study, we are going to try to set up a code based on the algebraic structure which is a generalization of the module that is semimodule by utilizing the max operations and sum operations at max plus algebra. The results of this study indicate that the max operation and the addition operation on max plus algebra cannot be used to establish a semimodule code, but by modifying the operation "+" as "min", we get a code based on semimodule. Keywords:   code, distributed storage systems, network coding, semimodule, max plus algebra

  16. The application of Max-Plus/Min-Plus algebra for an automated analysis; Einsatz der Max-Plus/Min-Plus Algebra zur automatisierten Sicherheitsanalyse

    Energy Technology Data Exchange (ETDEWEB)

    Laengst, W.; Lapp, A.; Stuebbe, K.; Schirmer, J.; Kraft, D. [Robert Bosch GmbH, Stuttgart (Germany). Zentralbereich Forschung und Vorausentwicklung

    2003-07-01

    The methodology introduced in this article is capable of describing a binary behavior of distributed discrete event systems. This is the basis for a safety analysis in early phases of system development and for an automated determination of failure dependencies. For this purpose a system equation similar to the state-space representation in system theory is used. The equation is evaluated applying the Max-Plus/Min-Plus algebra. The procedure is exemplified by a simplified braking system. (orig.) [German] In dem vorliegenden Artikel wird ein Verfahren zur binaeren Beschreibung von verteilten ereignisdiskreten Systemen vorgestellt. Dieses wird als Grundlage fuer eine Sicherheitsanalyse in einer fruehen Phase der Systementwicklung und zur automatisierten Ermittlung von Fehlerabhaengigkeiten eingesetzt. Hierzu wird eine Systemgleichung verwendet, die aehnlich zu der Zustandsraumdarstellung der konventionellen Systemtheorie ist. Dabei erfolgt die Auswertung der Systemgleichung durch Anwendung der Max-Plus/Min-Plus Algebra. Die Vorgehensweise wird anhand des Beispiels eines vereinfachten Bremssystems erlaeutert. (orig.)

  17. Electron microscopy for Engineers

    International Nuclear Information System (INIS)

    Jones, I P

    2009-01-01

    This paper reviews the application of (mainly) Transmission Electron Microscopy (TEM) in an engineering context. The first two sections are TEM and chemical in nature; the final three sections are more general and include aspects of Scanning Electron Microscopy (SEM).

  18. Copyright of Electronic Publishing.

    Science.gov (United States)

    Dong, Elaine; Wang, Bob

    2002-01-01

    Analyzes the importance of copyright, considers the main causes of copyright infringement in electronic publishing, discusses fair use of a copyrighted work, and suggests methods to safeguard copyrighted electronic publishing, including legislation, contracts, and technology. (Author/LRW)

  19. Maximum Acceptance Detector for the Fermilab Collider (MAX)

    International Nuclear Information System (INIS)

    Bjorken, James

    2003-01-01

    The authors propose a detector for the Collider which will cover the largest possible ranges of angles with electromagnetic calorimetry and charged tracking, and with hadronic calorimetry for the forward direction. The goal for the complete detector would be acceptance down to approx 1 mrad, in contrast to CDF and D0, which have coverage only to approx. 40 mrad. Because of the limitations of physical space and running time in all but B0 and D0, such a detector will have to be very compact and compatible with a variety of difficult boundary conditions. For this reason, they propose to run a test program at F0 during the second of the present Collider running period, utilizing existing calorimeters and tracking systems. A less desirable option which can be installed at E0 is also described. With luck there may be the possibility of physics from the test program as well. The final version of the detector would be installed at E0 after the main Injector upgrade. the detector is designed to study processes with relatively large cross sections. The running time requirements are thus minimal and data taking would require running a small fraction of the time with the electrostatic separators turned off

  20. V/V(max) test applied to SMM gamma-ray bursts

    Science.gov (United States)

    Matz, S. M.; Higdon, J. C.; Share, G. H.; Messina, D. C.; Iadicicco, A.

    1992-01-01

    We have applied the V/V(max) test to candidate gamma-ray bursts detected by the Gamma-Ray Spectrometer (GRS) aboard the SMM satellite to examine quantitatively the uniformity of the burst source population. For a sample of 132 candidate bursts identified in the GRS data by an automated search using a single uniform trigger criterion we find average V/V(max) = 0.40 +/- 0.025. This value is significantly different from 0.5, the average for a uniform distribution in space of the parent population of burst sources; however, the shape of the observed distribution of V/V(max) is unusual and our result conflicts with previous measurements. For these reasons we can currently draw no firm conclusion about the distribution of burst sources.

  1. Spectrum unfolding, sensitivity analysis and propagation of uncertainties with the maximum entropy deconvolution code MAXED

    CERN Document Server

    Reginatto, M; Neumann, S

    2002-01-01

    MAXED was developed to apply the maximum entropy principle to the unfolding of neutron spectrometric measurements. The approach followed in MAXED has several features that make it attractive: it permits inclusion of a priori information in a well-defined and mathematically consistent way, the algorithm used to derive the solution spectrum is not ad hoc (it can be justified on the basis of arguments that originate in information theory), and the solution spectrum is a non-negative function that can be written in closed form. This last feature permits the use of standard methods for the sensitivity analysis and propagation of uncertainties of MAXED solution spectra. We illustrate its use with unfoldings of NE 213 scintillation detector measurements of photon calibration spectra, and of multisphere neutron spectrometer measurements of cosmic-ray induced neutrons at high altitude (approx 20 km) in the atmosphere.

  2. Modeling high-Power Accelerators Reliability-SNS LINAC (SNS-ORNL); MAX LINAC (MYRRHA)

    International Nuclear Information System (INIS)

    Pitigoi, A. E.; Fernandez Ramos, P.

    2013-01-01

    Improving reliability has recently become a very important objective in the field of particle accelerators. The particle accelerators in operation are constantly undergoing modifications, and improvements are implemented using new technologies, more reliable components or redundant schemes (to obtain more reliability, strength, more power, etc.) A reliability model of SNS (Spallation Neutron Source) LINAC has been developed within MAX project and analysis of the accelerator systems reliability has been performed within the MAX project, using the Risk Spectrum reliability analysis software. The analysis results have been evaluated by comparison with the SNS operational data. Results and conclusions are presented in this paper, oriented to identify design weaknesses and provide recommendations for improving reliability of MYRRHA linear accelerator. The SNS reliability model developed for the MAX preliminary design phase indicates possible avenues for further investigation that could be needed to improve the reliability of the high-power accelerators, in view of the future reliability targets of ADS accelerators.

  3. Using MaxCompiler for High Level Synthesis of Trigger Algorithms

    CERN Document Server

    Summers, Sioni Paris; Sanders, P.

    2017-01-01

    Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.

  4. Johnson-Cook Strength Model Constants for VascoMax 300 and 1080 Steels

    International Nuclear Information System (INIS)

    Cinnamon, J. D.; Palazotto, A. N.; Kennan, Z.; Brar, N. S.; Bajaj, D.

    2006-01-01

    High strength steels, VascoMax 300 and 1080, are characterized under tension at strain rates of ∼1/s, ∼500/s, ∼1000/s, and ∼1500/s and at high temperatures using the quasi-static and split Hopkinson bar techniques. The data on 1080 steel exhibited a typical strain hardening response, whereas Vasco-Max 300 steel showed diminishing flow stress beyond yielding because of localized necking in gauge section of the tested specimens. The tension data are analyzed to determine the Johnson-Cook (J-C) strength model constants for the two steels. The flow stress values for VascoMax are adjusted to account for necking, and the corrected J-C model is developed

  5. Examining Student Attitudes in Introductory Physics via the Math Attitude and Expectations Survey (MAX)

    Science.gov (United States)

    Hemingway, Deborah; Eichenlaub, Mark; Losert, Wolfgang; Redish, Edward F.

    2017-01-01

    Student often face difficulties with using math in science, and this exploratory project seeks to address the underlying mechanisms that lead to these difficulties. This mixed-methods project includes the creation of two novel assessment surveys, the Mathematical Epistemic Games Survey (MEGS) and the Math Attitude and Expectations Survey (MAX). The MAX, a 30-question Likert-scale survey, focuses on the attitudes towards using mathematics of the students in a reformed introductory physics course for the life sciences (IPLS) which is part of the National Experiment in Undergraduate Education (NEXUS/Physics) developed at the University of Maryland (UMD). Preliminary results from the MAX are discussed with specific attention given to students' attitudes towards math and physics, opinions about interdisciplinarity, and the usefulness of physics in academic settings as well as in professional biological research and modern medicine settings.

  6. MAX: an expert system for running the modular transport code APOLLO II

    International Nuclear Information System (INIS)

    Loussouarn, O.; Ferraris, C.; Boivineau, A.

    1990-01-01

    MAX is an expert system built to help users of the APOLLO II code to prepare the input data deck to run a job. APOLLO II is a modular transport-theory code for calculating the neutron flux in various geometries. The associated GIBIANE command language allows the user to specify the physical structure and the computational method to be used in the calculation. The purpose of MAX is to bring into play expertise in both neutronic and computing aspects of the code, as well as various computational schemes, in order to generate automatically a batch data set corresponding to the APOLLO II calculation desired by the user. MAX is implemented on the SUN 3/60 workstation with the S1 tool and graphic interface external functions

  7. Using MaxCompiler for the high level synthesis of trigger algorithms

    International Nuclear Information System (INIS)

    Summers, S.; Rose, A.; Sanders, P.

    2017-01-01

    Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.

  8. Using MaxCompiler for the high level synthesis of trigger algorithms

    Science.gov (United States)

    Summers, S.; Rose, A.; Sanders, P.

    2017-02-01

    Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.

  9. Fuzzy Mutual Information Based min-Redundancy and Max-Relevance Heterogeneous Feature Selection

    Directory of Open Access Journals (Sweden)

    Daren Yu

    2011-08-01

    Full Text Available Feature selection is an important preprocessing step in pattern classification and machine learning, and mutual information is widely used to measure relevance between features and decision. However, it is difficult to directly calculate relevance between continuous or fuzzy features using mutual information. In this paper we introduce the fuzzy information entropy and fuzzy mutual information for computing relevance between numerical or fuzzy features and decision. The relationship between fuzzy information entropy and differential entropy is also discussed. Moreover, we combine fuzzy mutual information with qmin-Redundancy-Max-Relevanceq, qMax-Dependencyq and min-Redundancy-Max-Dependencyq algorithms. The performance and stability of the proposed algorithms are tested on benchmark data sets. Experimental results show the proposed algorithms are effective and stable.

  10. Dense and high-stability Ti2AlN MAX phase coatings prepared by the combined cathodic arc/sputter technique

    Science.gov (United States)

    Wang, Zhenyu; Liu, Jingzhou; Wang, Li; Li, Xiaowei; Ke, Peiling; Wang, Aiying

    2017-02-01

    Ti2AlN belongs to a family of ternary nano-laminate alloys known as the MAX phases, which exhibit a unique combination of metallic and ceramic properties. In the present work, the dense and high-stability Ti2AlN coating has been successfully prepared through the combined cathodic arc/sputter deposition, followed by heat post-treatment. It was found that the as-deposited Ti-Al-N coating behaved a multilayer structure, where (Ti, N)-rich layer and Al-rich layer grew alternately, with a mixed phase constitution of TiN and TiAlx. After annealing at 800 °C under vacuum condition for 1.5 h, although the multilayer structure still was found, part of multilayer interfaces became indistinct and disappeared. In particular, the thickness of the Al-rich layer decreased in contrast to that of as-deposited coating due to the inner diffusion of the Al element. Moreover, the Ti2AlN MAX phase emerged as the major phase in the annealed coatings and its formation mechanism was also discussed in this study. The vacuum thermal analysis indicated that the formed Ti2AlN MAX phase exhibited a high-stability, which was mainly benefited from the large thickness and the dense structure. This advanced technique based on the combined cathodic arc/sputter method could be extended to deposit other MAX phase coatings with tailored high performance like good thermal stability, high corrosion and oxidation resistance etc. for the next protective coating materials.

  11. Diagnosing in building main pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Telegin, L.G.; Gorelov, A.S.; Kurepin, B.N.; Orekhov, V.I.; Vasil' yev, G.G.; Yakovlev, Ye. I.

    1984-01-01

    General principles are examined for technical diagnosis in building main pipelines. A technique is presented for diagnosis during construction, as well as diagnosis of the technical state of the pipeline-construction machines and mechanisms. The survey materials could be used to set up construction of main pipelines.

  12. Maine Agricultural Foods. Project SEED.

    Science.gov (United States)

    Beaulieu, Peter; Ossenfort, Pat

    This paper describes an activity-based program that teaches students in grades 4-12 about the importance of Maine agriculture in their lives. Specifically, the goal is to increase student awareness of how the foods they eat are planted, harvested, and processed. The emphasis is on crops grown in Maine such as potatoes, broccoli, peas, blueberries,…

  13. HEART RATE VARIABILITY AND BODY COMPOSITION AS VO2MAX DETERMINANTS

    Directory of Open Access Journals (Sweden)

    Henry Humberto León-Ariza

    Full Text Available ABSTRACT Introduction: The maximum oxygen consumption (VO2max is the gold standard in the cardiorespiratory endurance assessment. Objective: This study aimed to develop a mathematical model that contains variables to determine the VO2max of sedentary people. Methods: Twenty participants (10 men and 10 women with a mean age of 19.8±1.77 years were included. For each participant, body composition (percentage of fat and muscle, heart rate variability (HRV at rest (supine and standing, and VO2max were evaluated through an indirect test on a cycloergometer. A multivariate linear regression model was developed from the data obtained, and the model assumptions were verified. Results: Using the data obtained, including percentage of fat (F, percentage of muscle (M, percentage of power at very low frequency (VLF, α-value of the detrended fluctuation analysis (DFAα1, heart rate (HR in the resting standing position, and age of the participants, a model was established for men, which was expressed as VO2max = 4.216 + (Age*0.153 + (F*0.110 - (M*0.053 - (VLF*0.649 - (DFAα1*2.441 - (HR*0.014, with R2 = 0.965 and standard error = 0.146 L/min. For women, the model was expressed as VO2max = 1.947 - (Age*0.047 + (F*0.024 + (M*0.054 + (VLF*1.949 - (DFAα1*0.424 - (HR*0.019, with R2 = 0.987 and standard error = 0.077 L/min. Conclusion: The obtained model demonstrated the influence exerted by body composition, the autonomic nervous system, and age in the prediction of VO2max.

  14. Main Propulsion Test Article (MPTA)

    Science.gov (United States)

    Snoddy, Cynthia

    2010-01-01

    Scope: The Main Propulsion Test Article integrated the main propulsion subsystem with the clustered Space Shuttle Main Engines, the External Tank and associated GSE. The test program consisted of cryogenic tanking tests and short- and long duration static firings including gimbaling and throttling. The test program was conducted on the S1-C test stand (Position B-2) at the National Space Technology Laboratories (NSTL)/Stennis Space Center. 3 tanking tests and 20 hot fire tests conducted between December 21 1 1977 and December 17, 1980 Configuration: The main propulsion test article consisted of the three space shuttle main engines, flightweight external tank, flightweight aft fuselage, interface section and a boilerplate mid/fwd fuselage truss structure.

  15. Motion control system of MAX IV Laboratory soft x-ray beamlines

    International Nuclear Information System (INIS)

    Sjöblom, Peter; Lindberg, Mirjam; Forsberg, Johan; Persson, Andreas G.; Urpelainen, Samuli; Såthe, Conny

    2016-01-01

    At the MAX IV Laboratory, five new soft x-ray beamlines are under development. The first is Species and it will be used to develop and set the standard of the control system, which will be common across the facility. All motion axes at MAX IV will be motorized using stepper motors steered by the IcePAP motion controller and a mixture of absolute and incremental encoders following a predefined coordinate system. The control system software is built in Tango and uses the Python-based Sardana framework. The user controls the entire beamline through a synoptic overview and Sardana is used to run the scans.

  16. Max Weber and the atom of Sociology: a moderate methodological individualism?

    OpenAIRE

    Sell, Carlos Eduardo

    2016-01-01

    Qual a natureza do individualismo metodológico de Max Weber? Para esclarecer essa questão o artigo revisa o debate entre holistas e individualistas, destacando as tentativas de aproximação entre essas posições. Em seguida, com base em Economia e sociedade, busca-se determinar, de maneira imanente, a compreensão weberiana sobre o individualismo como método. Na parte final discutem-se criticamente as tentativas de releitura da Sociologia de Max Weber à luz da controvérsia entre as perspectivas ...

  17. The Dangers of Estimating V˙O2max Using Linear, Nonexercise Prediction Models.

    Science.gov (United States)

    Nevill, Alan M; Cooke, Carlton B

    2017-05-01

    This study aimed to compare the accuracy and goodness of fit of two competing models (linear vs allometric) when estimating V˙O2max (mL·kg·min) using nonexercise prediction models. The two competing models were fitted to the V˙O2max (mL·kg·min) data taken from two previously published studies. Study 1 (the Allied Dunbar National Fitness Survey) recruited 1732 randomly selected healthy participants, 16 yr and older, from 30 English parliamentary constituencies. Estimates of V˙O2max were obtained using a progressive incremental test on a motorized treadmill. In study 2, maximal oxygen uptake was measured directly during a fatigue limited treadmill test in older men (n = 152) and women (n = 146) 55 to 86 yr old. In both studies, the quality of fit associated with estimating V˙O2max (mL·kg·min) was superior using allometric rather than linear (additive) models based on all criteria (R, maximum log-likelihood, and Akaike information criteria). Results suggest that linear models will systematically overestimate V˙O2max for participants in their 20s and underestimate V˙O2max for participants in their 60s and older. The residuals saved from the linear models were neither normally distributed nor independent of the predicted values nor age. This will probably explain the absence of a key quadratic age term in the linear models, crucially identified using allometric models. Not only does the curvilinear age decline within an exponential function follow a more realistic age decline (the right-hand side of a bell-shaped curve), but the allometric models identified either a stature-to-body mass ratio (study 1) or a fat-free mass-to-body mass ratio (study 2), both associated with leanness when estimating V˙O2max. Adopting allometric models will provide more accurate predictions of V˙O2max (mL·kg·min) using plausible, biologically sound, and interpretable models.

  18. Design of polarization encoded all-optical 4-valued MAX logic gate and its applications

    Science.gov (United States)

    Chattopadhyay, Tanay; Nath Roy, Jitendra

    2013-07-01

    Quaternary maximum (QMAX) gate is one type of multi-valued logic gate. An all-optical scheme of polarization encoded quaternary (4-valued) MAX logic gate with the help of Terahertz Optical Asymmetric Demultiplexer (TOAD) based fiber interferometric switch is proposed and described. For the quaternary information processing in optics, the quaternary number (0, 1, 2, 3) can be represented by four discrete polarized states of light. Numerical simulation result confirming the described methods is given in this paper. Some applications of MAX gate in logical operation and memory device are also given.

  19. A max version of Perron--Frobenius theorem for nonnegative tensor

    OpenAIRE

    Afshin, Hamid Reza; Shojaeifard, Ali Reza

    2015-01-01

    In this paper we generalize the max algebra system of nonnegative matrices to the class of nonnegative tensors and derive its fundamental properties. If $\\mathbb{A} \\in \\Re_ + ^{\\left[ {m,n} \\right]}$ is a nonnegative essentially positive tensor such that satisfies the condition class NC, we prove that there exist $\\mu \\left( \\mathbb{A} \\right)$ and a corresponding positive vector $x$ such that $\\mathop {\\max }\\limits_{1 \\le{i_2}\\cdots {i_m} \\le n} \\left\\{ {{a_{i{i_2}\\cdots {i_m}}}{x_{{i_2}}}...

  20. Dual Y-Shaped Monopole Antenna for Dual-Band WLAN/WiMAX Operations

    Directory of Open Access Journals (Sweden)

    Huiqing Zhai

    2014-01-01

    Full Text Available A dual-band design of monopole antenna with two coupled Y-shaped strips for WLAN/WiMAX applications is presented. By the introduction of dual Y-shaped strips, two separated impedance bandwidths of 22.4% (3.28~4.10 GHz and 19.2% (4.90~5.94 GHz can be obtained to meet the specifications of the WLAN/WiMAX communication band applications. The proposed antenna is successfully simulated, designed, and measured, demonstrating the matched impedance and good radiation characteristics with an overall dimension of 17.7×26×1 mm3.

  1. A comparison of buffered lidocaine versus ELA-Max before peripheral intravenous catheter insertions in children.

    Science.gov (United States)

    Luhmann, Janet; Hurt, Sarah; Shootman, Mario; Kennedy, Robert

    2004-03-01

    Peripheral intravenous catheter (PIV) insertion is a common, painful experience for many children in the pediatric emergency department. Although local anesthetics such as injected buffered lidocaine have been shown to be effective at reducing pain and anxiety associated with PIV insertion, they are not routinely used. ELA-Max, a topical local anesthetic, has the advantage of needle-free administration but has not been compared with buffered lidocaine for PIV insertion. To compare the reduction of pain and anxiety during PIV insertion provided by subcutaneous buffered 1% lidocaine or topical ELA-Max in children. A randomized trial in children 4 to 17 years old undergoing PIV insertion with 22-gauge catheters was conducted. Children received either buffered lidocaine or ELA-Max. Buffered lidocaine was administered by using 30-gauge needles to inject 0.1 to 0.2 mL subcutaneously just before PIV insertion. ELA-Max was applied to the skin and occluded with Tegaderm 30 minutes before PIV insertion. Self-reported Visual Analog Scale (VAS) questionnaires (rating on a scale of 1-10; 1 = no pain, anxiety) were completed by patients and their parents before PIV insertion to assess baseline perceptions about pain and anxiety associated with PIV insertion and immediately after PIV insertion to assess pain and anxiety associated with the experience. After PIV insertion, the nurse who inserted the PIV also completed a VAS questionnaire assessing technical difficulty and satisfaction with the local anesthesia. A blinded observer also completed a VAS questionnaire to assess pain and anxiety associated with the PIV insertion. Data were analyzed by using chi2 and t tests. Sixty-nine subjects were enrolled, and questionnaires were competed by all (mean age: 12.1 +/- 4.5 years; 61% female). There were no differences for buffered lidocaine and ELA-Max groups in age, gender, race, prior IV experience, or baseline pain and anxiety. There were no significant differences between buffered

  2. Plan estratégico Limpi Max S.A.C. 2015-2019

    OpenAIRE

    Aniceto Prado, Fabiola Virginia; Barcelona Zakimi, Antoane Andre; Tokashiki Zakimi, Javier Elias; Yutaka Yino Oshiro, Daniel Alberto

    2015-01-01

    El presente plan estratégico ha sido elaborado para la empresa Limpi Max S.A.C. para el periodo comprendido entre los años 2015 a 2019, cuya actividad económica está especializada en el cristalizado de superficies y suelos calcáreos. El mercado del cristalizado se enfoca en centros comerciales, tiendas por departamento y hoteles que cuenten con las superficies mencionadas líneas arriba. El mayor problema que enfrenta Limpi Max es la reducida o nula cultura empresarial en nuestro país de reali...

  3. Traffic grooming in WDM optical network with grooming resources at Max Connectivity nodes

    Science.gov (United States)

    Paul, Partha; Rawat, Balbeer Singh; Ghorai, S. K.

    2012-12-01

    In this paper, we propose Max Connectivity grooming in WDM mesh networks under static lightpath connection requests. The grooming and wavelength conversion resources are placed at the nodes having maximum connections. We propose a heuristic genetic algorithm (GA) model to solve grooming, routing and wavelength assignment. The GA algorithm has been used to optimize the cost of grooming and wavelength conversion resources. The blocking probability has been investigated under different lightpath connections. The performance of Max Connectivity grooming has been compared with other grooming policies. Our results indicate the improvement of resource utilization with minimum blocking probability.

  4. Motion control system of MAX IV Laboratory soft x-ray beamlines

    Energy Technology Data Exchange (ETDEWEB)

    Sjöblom, Peter, E-mail: peter.sjoblom@maxlab.lu.se; Lindberg, Mirjam, E-mail: mirjam.lindberg@maxlab.lu.se; Forsberg, Johan, E-mail: johan.forsberg@maxlab.lu.se; Persson, Andreas G., E-mail: andreas-g.persson@maxlab.lu.se; Urpelainen, Samuli, E-mail: samuli.urpelainen@maxlab.lu.se; Såthe, Conny, E-mail: conny.sathe@maxlab.lu.se [MAX IV Laboratory, Photongatan 2, 225 92 Lund (Sweden)

    2016-07-27

    At the MAX IV Laboratory, five new soft x-ray beamlines are under development. The first is Species and it will be used to develop and set the standard of the control system, which will be common across the facility. All motion axes at MAX IV will be motorized using stepper motors steered by the IcePAP motion controller and a mixture of absolute and incremental encoders following a predefined coordinate system. The control system software is built in Tango and uses the Python-based Sardana framework. The user controls the entire beamline through a synoptic overview and Sardana is used to run the scans.

  5. [Predictive distribution and planting GAP of Cyathula officinalis in China based on 3S technology and MaxEnt modelling].

    Science.gov (United States)

    Wu, Ming-Yan; He, Lan; Chen, Jia-Li; Dong, Guang; Cheng, Wu-Xue

    2017-11-01

    Research on predictive distribution and planting GAP of Cyathula officinalis in China is helpful to provide scientific basis for its protection and planting popularization. According to the data in 63 distribution sites and 49 ecological variables, using MaxEnt ecological niche model and 3S technology, we performed a quantitative analysis of suitable distribution and planting GAP of C. officinalis in China. Our results show that: ① the area of suitable distribution of C. officinalis is about 634 385.80 km² in total, and mainly in Northeastern and Southeastern Sichuan, Northern and Southeastern Yunnan, Western and Southwestern Guizhou, Southwestern and Northeastern Chongqing, Southwestern Shaanxi, Southeastern Gansu, Western Guangxi, Southeastern Tibet. ② The main ecological factors determining the potential distribution are precipitation, altitude, minimum temperature of coldest month, soil type, monthly mean temperature. ③ The planting GAP region are mainly in Guangyuan, Mianyang, Ya'an, Leshan, Liangshan, Panzhihua of Sichuan province, Hanzhong of Shaanxi province, Dali, Nujiang, Chuxiong, Baoshan, Qujing, Wenshan of Yunnan province, southwestern autonomous prefecture in Guizhou province. The results are of great significance for realizing the growth environment, predicting the potential distribution and promoting planting popularization for C. officinalis. Copyright© by the Chinese Pharmaceutical Association.

  6. Relationship between Physical Activity and Age on the Main Categories of Cognitive Processes

    OpenAIRE

    Perrot , Alexandra; Maillot , Pauline; Gagnon , Christine; Bertsch , Jean

    2011-01-01

    Many transversal studies show a positive relationship between physical activity and a large panel of cognitive functions. However, the majority of studies in this domain separately investigated categories of cognitive functions (e.g., attention, executive functions, visuospatial abilities). Studies simultaneously addressing the main categories of cognitive functions are rare. Moreover, assessment methods to measure physical activity are diverse (i.e., direct method with VO2max or indirect met...

  7. A new stage of nuclear electronics-particle electronics

    International Nuclear Information System (INIS)

    Xi Deming

    1987-01-01

    The rapid development of high energy physics experiments has pushed the nuclear electronics to a new stage, i.e. the particle electronics. In this paper the background, main features and recent trends of the particle electronics are expounded

  8. A coincidence study between photo- and Auger electrons

    International Nuclear Information System (INIS)

    Ricz, S.; Koever, A.; Varga, D.; Molnar, J.; Aksela, S.; Jurvansuu, M.

    2000-01-01

    Complete text of publication follows. The investigation of double differential cross sections of photon induced Auger electrons provides very sensitive method for studying the rearrangement process, especially when the angular correlation between photo- and Auger electrons is also studied. Such type of measurements could reveal a new aspect in studying the electron-electron, hole-electron and photoelectron - Auger electron interactions. It enables one to separate the overlapping Auger lines belonging to different initial holes. The traditional coincidence measurement is very time consuming and causes serious calibration problems. In order to overcome these experimental difficulties a new electron-spectrometer (ESA-22) was developed in ATOMKI, Debrecen in cooperation with the Electron spectroscopy group of University of Oulu, Finland. The analyzer consists of a spherical and a cylindrical part. It is very similar to the ESA-21 analyzer. The main differences is that the focal ring can be set different diameters thus either a series of channel detectors can be used to detect the electrons at different angles or a position sensitive channel plate can be applied for simultaneous angular recording of electrons. Furthermore the outer sphere and cylinder are cut into two parts so the spectrometer is capable to analyze two independent angularly resolved electron spectra (in the 0 deg - 180 deg region) at different energy regions, simultaneously. A special electronic control and data handling electronics and software was worked out to control the analyzer. The first results were presented in. In the last year the ESA-22 electron-spectrometer was transported to the I411 beam line of MAX-II synchrotron in Lund, Sweden. The advanced properties of the spectrometer was investigated by measuring coincidences between the photoelectrons originated from the Ar L 3 subshell and the Ar Auger electrons in the 203-207 eV energy region. Fig. 1 shows the single and the coincidence spectra

  9. Attosecond-correlated dynamics of two electrons in argon

    Indian Academy of Sciences (India)

    2014-01-11

    Jan 11, 2014 ... 2Max-Planck-Institut für Kernphysik, 69117 Heidelberg, Germany ... involving a highly correlated electronic transition state. ... laser is low, the recolliding electron can have a maximum energy of about 15 eV which.

  10. Theory of Weak Bipolar Fields and Electron Holes with Applications to Space Plasmas

    International Nuclear Information System (INIS)

    Goldman, Martin V.; Newman, David L.; Mangeney, Andre

    2007-01-01

    A theoretical model of weak electron phase-space holes is used to interpret bipolar field structures observed in space. In the limit eφ max /T e max sech 4 (x/α), where φ max depends on the derivative of the trapped distribution at the separatrix, while α depends only on a screening integral over the untrapped distribution. Idealized trapped and passing electron distributions are inferred from the speed, amplitude, and shape of satellite waveform measurements of weak bipolar field structures

  11. Left main percutaneous coronary intervention.

    Science.gov (United States)

    Teirstein, Paul S; Price, Matthew J

    2012-10-23

    The introduction of drug-eluting stents and advances in catheter techniques have led to increasing acceptance of percutaneous coronary intervention (PCI) as a viable alternative to coronary artery bypass graft (CABG) for unprotected left main disease. Current guidelines state that it is reasonable to consider unprotected left main PCI in patients with low to intermediate anatomic complexity who are at increased surgical risk. Data from randomized trials involving patients who are candidates for either treatment strategy provide novel insight into the relative safety and efficacy of PCI for this lesion subset. Herein, we review the current data comparing PCI with CABG for left main disease, summarize recent guideline recommendations, and provide an update on technical considerations that may optimize clinical outcomes in left main PCI. Copyright © 2012 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  12. Main: FEB3 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available nt to sterilization and rinsing - One of the main components of biofilms is polysaccharides - Some pit-formi...ng bacteria such as Sphingomonas species A1 possess superchannels that directly incorporate and decompose polysaccharides - Detai...e entrance of the superchannel have been elucidated - We have obtained the crystals of ABC importer complexe...of water pipes and dental plaque are examples of biofilms. One of the main components of biofilms is polysac

  13. Decontamination of main coolant pumps

    International Nuclear Information System (INIS)

    Roofthooft, R.

    1988-01-01

    Last year a number of main coolant pumps in Belgian nuclear power plants were decontaminated. A new method has been developed to reduce the time taken for decontamination and the volume of waste to be treated. The method comprises two phases: Oxidation with permanganate in nitric acid and dissolution in oxalic acid. The decontamination of main coolant pumps can now be achieved in less than one day. The decontamination factors attained range between 15 and 150. (orig.) [de

  14. SU-G-TeP2-09: Evaluation of the MaxFOV Extended Field of View (EFOV) Reconstruction Algorithm On a GE RT590 CT Scanner

    International Nuclear Information System (INIS)

    Grzetic, S; Weldon, M; Noa, K; Gupta, N

    2016-01-01

    Purpose: This study compares the newly released MaxFOV Revision 1 EFOV reconstruction algorithm for GE RT590 to the older WideView EFOV algorithm. Two radiotherapy overlays from Q-fix and Diacor, are included in our analysis. Hounsfield Units (HU) generated with the WideView algorithm varied in the extended field (beyond 50cm) and the scanned object’s border varied from slice to slice. A validation of HU consistency between the two reconstruction algorithms is performed. Methods: A CatPhan 504 and CIRS062 Electron Density Phantom were scanned on a GE RT590 CT-Simulator. The phantoms were positioned in multiple locations within the scan field of view so some of the density plugs were outside the 50cm reconstruction circle. Images were reconstructed using both the WideView and MaxFOV algorithms. The HU for each scan were characterized both in average over a volume and in profile. Results: HU values are consistent between the two algorithms. Low-density material will have a slight increase in HU value and high-density material will have a slight decrease in HU value as the distance from the sweet spot increases. Border inconsistencies and shading artifacts are still present with the MaxFOV reconstruction on the Q-fix overlay but not the Diacor overlay (It should be noted that the Q-fix overlay is not currently GE-certified). HU values for water outside the 50cm FOV are within 40HU of reconstructions at the sweet spot of the scanner. CatPhan HU profiles show improvement with the MaxFOV algorithm as it approaches the scanner edge. Conclusion: The new MaxFOV algorithm improves the contour border for objects outside of the standard FOV when using a GE-approved tabletop. Air cavities outside of the standard FOV create inconsistent object borders. HU consistency is within GE specifications and the accuracy of the phantom edge improves. Further adjustments to the algorithm are being investigated by GE.

  15. Rates of the main thermonuclear reactions

    International Nuclear Information System (INIS)

    Abramovich, S.N.; Guzhovskii, B.Ya.; Dunaeva, S.A.; Fomushkin, E.F.

    1992-01-01

    The data on the cross sections of main thermonuclear reactions have been estimated with an account of the latest experimental results in a form of S-factor spline presentation. Based on this estimation, the reates of these reactions in 0.0001-1 MeV temperature range in the supposition of Maxwell distribution of relative velocities have been computed. The Maxwell-Boltzmann averaged -factors were calculated according to the table values of the reaction rates. Then the -factors were approximated with the 3 order spline-function. The necessity of the account of electron shielding and intramolecular movement at low temperatures is discussed (orig.)

  16. Main-chain supramolecular block copolymers.

    Science.gov (United States)

    Yang, Si Kyung; Ambade, Ashootosh V; Weck, Marcus

    2011-01-01

    Block copolymers are key building blocks for a variety of applications ranging from electronic devices to drug delivery. The material properties of block copolymers can be tuned and potentially improved by introducing noncovalent interactions in place of covalent linkages between polymeric blocks resulting in the formation of supramolecular block copolymers. Such materials combine the microphase separation behavior inherent to block copolymers with the responsiveness of supramolecular materials thereby affording dynamic and reversible materials. This tutorial review covers recent advances in main-chain supramolecular block copolymers and describes the design principles, synthetic approaches, advantages, and potential applications.

  17. Finite Abstractions of Max-Plus-Linear Systems : Theory and Algorithms

    NARCIS (Netherlands)

    Adzkiya, D.

    2014-01-01

    Max-Plus-Linear (MPL) systems are a class of discrete-event systems with a continuous state space characterizing the timing of the underlying sequential discrete events. These systems are predisposed to describe the timing synchronization between interleaved processes. MPL systems are employed in

  18. Effects of long-term storage on the quality of soybean, Glycine max ...

    African Journals Online (AJOL)

    Soybean, Glycine max (L.) Merrill, is one of the five most important legumes in the tropics and provides the protein eaten by most people in the region. One of the major constraints to soybean production is that the seed quality deteriorates rapidly during storage. This study was undertaken to assess the effect of some storage ...

  19. Forgotten Bibles: Friedrich Max Müller’s Edition of the Sacred Books of the East

    NARCIS (Netherlands)

    Molendijk, Arie

    2016-01-01

    Max Müller’s edition of the Sacred Books of the East (1879-1910) is doubtless one of the most ambitious and daring editorial projects of late Victorian scholarship. This essay examines the claim that these translations ratify a whole taxonomy of concepts and procedures that will characterize the

  20. Friedrich Max Müller and the Sacred Books of the East

    NARCIS (Netherlands)

    Molendijk, Arie L.

    2016-01-01

    This volume offers a critical analysis of one the most ambitious editorial projects of late Victorian Britain: the edition of the fifty substantial volumes of the Sacred Books of the East (1879-1910). The series was edited and conceptualized by Friedrich Max Müller (1823-1900), a world-famous

  1. Max Bill´s "Die Gute Form" versus Asger Jorn´s "Dynamic Form"

    DEFF Research Database (Denmark)

    Baumeister, Ruth

    2016-01-01

    Departing from their dispute about the reconstruction of the Bauhaus in West Germany after WW2, this article discusses Asger Jorn´s and Max Bill´s different notions of form. Implicitly, this also brings to the forth their different attitude regarding the positions of art and life in the postwar p...

  2. On the behaviour of classes of min-max-plus systems

    NARCIS (Netherlands)

    Soto y Koelemeijer, G.

    2003-01-01

    Discrete Event Systems are systems, the time evolution of which can be described by the occurence of events. Well-known examples of DESs are manufacturing systems and transportation networks. An important class of DESs can be described by the so-called (max,+) algebra, in which, compared to the

  3. Genetic Analysis of Seed Isoflavones, Protein, and Oil Contents in Soybean [Glycine max (L.) Merr.

    Science.gov (United States)

    2014-09-13

    and My Abdelmajid Kassem. Effect of Two Row Spaces on Several Agronomic Traits in Soy - bean [Glycine max (L.) Merr.], Atlas Journal of Plant Biology... SoyS - NP6K Illumina Infinium BeadChip Genotyping Array , Journal of Plant Genome Sciences (09 2013) Masum Akond1, Shiming Liu2, Melanie Boney1

  4. Management of Groin Abcess with Flaminal Forte and KerraMax Care

    Directory of Open Access Journals (Sweden)

    Maggie Pugh

    2016-04-01

    Full Text Available The patient’s dressing plan using Flaminal Forte and KerraMax Care successfully managed the complexities of his wound, absorbing exudate, reducing pain on dressing, malodour and wound bioburden. Moreover, the plan encouraged patient concordance, reduced nursing consultation time and subsequently altered treatment plans for our patients with abscesses

  5. Stages in Educational Reform; The Max Planck Institute Has Produced a Report on Education.

    Science.gov (United States)

    Pfeffer, Gottfried

    1981-01-01

    Outlines the Max Planck Institute's exhaustive report on West German educational trends since World War II. An analysis of the effects of changing social values and demographic factors on educational policy, school organization, enrollment trends, curriculum design, and teaching methods is included. (AM)

  6. On a Robust MaxEnt Process Regression Model with Sample-Selection

    Directory of Open Access Journals (Sweden)

    Hea-Jung Kim

    2018-04-01

    Full Text Available In a regression analysis, a sample-selection bias arises when a dependent variable is partially observed as a result of the sample selection. This study introduces a Maximum Entropy (MaxEnt process regression model that assumes a MaxEnt prior distribution for its nonparametric regression function and finds that the MaxEnt process regression model includes the well-known Gaussian process regression (GPR model as a special case. Then, this special MaxEnt process regression model, i.e., the GPR model, is generalized to obtain a robust sample-selection Gaussian process regression (RSGPR model that deals with non-normal data in the sample selection. Various properties of the RSGPR model are established, including the stochastic representation, distributional hierarchy, and magnitude of the sample-selection bias. These properties are used in the paper to develop a hierarchical Bayesian methodology to estimate the model. This involves a simple and computationally feasible Markov chain Monte Carlo algorithm that avoids analytical or numerical derivatives of the log-likelihood function of the model. The performance of the RSGPR model in terms of the sample-selection bias correction, robustness to non-normality, and prediction, is demonstrated through results in simulations that attest to its good finite-sample performance.

  7. Color Processing using Max-trees : A Comparison on Image Compression

    NARCIS (Netherlands)

    Tushabe, Florence; Wilkinson, M.H.F.

    2012-01-01

    This paper proposes a new method of processing color images using mathematical morphology techniques. It adapts the Max-tree image representation to accommodate color and other vectorial images. The proposed method introduces three new ways of transforming the color image into a gray scale image

  8. Managing the transition to a truly value-creating economy : Max Havelaar Lecture 2013

    NARCIS (Netherlands)

    R.J.M. van Tulder (Rob); J. Post (Julia); A. de Groot-Ruiz (Adrian); P. Blom (Peter)

    2014-01-01

    markdownabstractIt goes without debate that international supply or value chains only add real value to a selected group of companies and people. Cost and benefits are difficult to assess and even more difficult to be distributed in a ‘fair’ manner. The 2013 Max Havelaar lecture brought these three

  9. 77 FR 20445 - eMax Worldwide, Inc.; Order of Suspension of Trading

    Science.gov (United States)

    2012-04-04

    ... Trading April 2, 2012. It appears to the Securities and Exchange Commission that the public interest and... shareholders of record. eMax Worldwide, Inc. is quoted on OTC Markets Group Inc. under the ticker EMXC. The Commission is of the opinion that the public interest and the protection of investors require a suspension of...

  10. On Legal Authority, Crisis of Legitimacy and Schooling in the Writings of Max Weber.

    Science.gov (United States)

    Lenhardt, Gero

    In an attempt to gain a better perspective on the relationship between education and the modern state, this paper reopens the theoretical debate on the key role of formal rationality in Max Weber's interpretation of the capitalist economy and the modern bureaucratic state. Against the background of an extensive review of the development and the…

  11. Max Weber's Contribution to the Sociology of Education: A Critical Appreciation

    Science.gov (United States)

    Rao, S. Srinivasa; Singh, Smriti

    2018-01-01

    Karl Emil Maximilian Weber (1864-1920), more widely known as Max Weber, is credited with numerous contributions to modern sociology and is considered one of the pillars of the discipline along with Karl Marx and Emile Durkheim. Marx (1818-1883) was an established predecessor from Germany whose study of the nineteenth-century European society was…

  12. Community Music during the New Deal: The Contributions of Willem Van de Wall and Max Kaplan

    Science.gov (United States)

    Krikun, Andrew

    2010-01-01

    Willem Van de Wall (1887-1953) and Max Kaplan (1911-98) built careers spanning music performance, music education, adult education, sociology, social work, music therapy and community music. Willem Van de Wall was a seminal influence on the development of the fields of music therapy and adult education--researching the role of music in…

  13. Gamma radiation effect on the anatomical structure of soybean (Glycine max. Merr)

    International Nuclear Information System (INIS)

    Bhikuningputra, W.

    1976-01-01

    Gamma radiation effects on soybean plant (Glycine max. Merr) have been studied by using radiation doses of 0, 20, 25, 30, and 35 Krad. Investigation is carried out after each treatment. It proves that each treatment causes different morphological changes on leaves, stems, roots, and fibres of the treated plants. (SMN)

  14. Max Planck Institute for Human Development and Education: Annual Report 1990.

    Science.gov (United States)

    Max-Planck-Institut fuer Bildungsforschung, Berlin (West Germany).

    The Max Planck Institute for Human Development and Education in Germany consists of four research centers dealing with the following topics: sociology and the study of the life course; development and socialization; psychology and human development; and school systems and instruction. This English-language annual report of the Planck Institute,…

  15. The Emergence of a Root Metaphor in Modern Physics: Max Planck's "Quantum" Metaphor.

    Science.gov (United States)

    Johnson-Sheehan, Richard D.

    1997-01-01

    Uses metaphorical analysis to determine whether or not Max Planck invented the quantum postulate. Demonstrates how metaphorical analysis can be used to analyze the rhetoric of revolutionary texts in science. Concludes that, in his original 1900 quantum paper, Planck considered the quantum postulate to be important, but not revolutionary. (PA)

  16. A Hybrid Shared-Memory Parallel Max-Tree Algorithm for Extreme Dynamic-Range Images.

    Science.gov (United States)

    Moschini, Ugo; Meijster, Arnold; Wilkinson, Michael H F

    2018-03-01

    Max-trees, or component trees, are graph structures that represent the connected components of an image in a hierarchical way. Nowadays, many application fields rely on images with high-dynamic range or floating point values. Efficient sequential algorithms exist to build trees and compute attributes for images of any bit depth. However, we show that the current parallel algorithms perform poorly already with integers at bit depths higher than 16 bits per pixel. We propose a parallel method combining the two worlds of flooding and merging max-tree algorithms. First, a pilot max-tree of a quantized version of the image is built in parallel using a flooding method. Later, this structure is used in a parallel leaf-to-root approach to compute efficiently the final max-tree and to drive the merging of the sub-trees computed by the threads. We present an analysis of the performance both on simulated and actual 2D images and 3D volumes. Execution times are about better than the fastest sequential algorithm and speed-up goes up to on 64 threads.

  17. Receding-horizon control for max-plus linear systems with discrete actions using optimistic planning

    NARCIS (Netherlands)

    Xu, J.; Busoniu, L; van den Boom, A.J.J.; De Schutter, B.H.K.; Cassandras, Christos G.; Giua, Alessandro; Li, Zhiwu

    2016-01-01

    This paper addresses the infinite-horizon optimal control problem for max-plus linear systems where the considered objective function is a sum of discounted stage costs over an infinite horizon. The minimization problem of the cost function is equivalently transformed into a maximization problem of

  18. Dietary fish oil (MaxEPA) enhances pancreatic carcinogenesis in azaserine-treated rats

    NARCIS (Netherlands)

    Appel, M.J.; Woutersen, R.A.

    1996-01-01

    In the present study the putative chemopreventive effect of dietary fish oil (MaxEPA) on azaserine-induced pancreatic carcinogenesis in rats was investigated. Groups of rats were maintained on a semipurified low-fat (LF; 5 wt%) diet or on semipurified high-fat (HF; 25 wt%) diets containing 5 wt%

  19. Non-Exercise Estimation of VO[subscript 2]max Using the International Physical Activity Questionnaire

    Science.gov (United States)

    Schembre, Susan M.; Riebe, Deborah A.

    2011-01-01

    Non-exercise equations developed from self-reported physical activity can estimate maximal oxygen uptake (VO[subscript 2]max) as well as sub-maximal exercise testing. The International Physical Activity Questionnaire is the most widely used and validated self-report measure of physical activity. This study aimed to develop and test a VO[subscript…

  20. Model predictive control for Max-Plus-Linear and piecewise affine systems

    NARCIS (Netherlands)

    Necoara, I.

    2006-01-01

    This Ph.D. thesis considers the development of new analysis and control techniques for special classes of hybrid systems and discrete event systems. Two particular classes of hybrid systems (piecewise affine systems and max-min-plus-scaling systems), and two particular classes of discrete event

  1. A Hybrid Shared-Memory Parallel Max-Tree Algorithm for Extreme Dynamic-Range Images

    NARCIS (Netherlands)

    Moschini, Ugo; Meijster, Arnold; Wilkinson, Michael

    Max-trees, or component trees, are graph structures that represent the connected components of an image in a hierarchical way. Nowadays, many application fields rely on images with high-dynamic range or floating point values. Efficient sequential algorithms exist to build trees and compute

  2. A Modified MinMax k-Means Algorithm Based on PSO.

    Science.gov (United States)

    Wang, Xiaoyan; Bai, Yanping

    The MinMax k -means algorithm is widely used to tackle the effect of bad initialization by minimizing the maximum intraclustering errors. Two parameters, including the exponent parameter and memory parameter, are involved in the executive process. Since different parameters have different clustering errors, it is crucial to choose appropriate parameters. In the original algorithm, a practical framework is given. Such framework extends the MinMax k -means to automatically adapt the exponent parameter to the data set. It has been believed that if the maximum exponent parameter has been set, then the programme can reach the lowest intraclustering errors. However, our experiments show that this is not always correct. In this paper, we modified the MinMax k -means algorithm by PSO to determine the proper values of parameters which can subject the algorithm to attain the lowest clustering errors. The proposed clustering method is tested on some favorite data sets in several different initial situations and is compared to the k -means algorithm and the original MinMax k -means algorithm. The experimental results indicate that our proposed algorithm can reach the lowest clustering errors automatically.

  3. Max Headroom, Ad Man of the Eighties: When Commercial Becomes Cult.

    Science.gov (United States)

    Wassmuth, Birgit L.; Carr, Douglas J.

    With Coca-Cola's selection of a digital, computer-constructed "spokesthing" named Max Headroom, came a dramatic shift toward a reliance on high technology to deliver the advertising message. Headroom was developed in Britain, and made his debut on the Home Box Office television network in 1985. Coca-Cola then bought the rights to…

  4. Numerical Analysis of Strongly Nonlinear Oscillation Systems using He's Max-Min Method

    DEFF Research Database (Denmark)

    Babazadeh, H; Domairry, G; Barari, Amin

    2011-01-01

    Nonlinear functions are crucial points and terms in engineering problems. Actual and physical problems can be solved by solving and processing such functions. Thus, most scientists and engineers focus on solving these equations. This paper presents a novel method called the max-min method...

  5. "New People" and "Old Structures": Max Adler and Siegfried Bernfeld on Society, Education and Change

    Science.gov (United States)

    Sunker, Heinz

    2005-01-01

    This article deals with central issues in the field of theory of education and history of education. The examples of Max Adler and Siegfried Bernfeld show that contemporary debates on education and society, social reproduction of social inequality, and education and social change have been subjects of strong controversies in the first third of the…

  6. Distinct transcriptional profiles of ozone stress in soybean (Glycine max) flowers and pods

    Science.gov (United States)

    Tropospheric ozone (O3) is a secondary air pollutant and anthropogenic greenhouse gas. Concentrations of tropospheric O3 ([O3] have more than doubled since the Industrial Revolution, and are high enough to damage plant productivity. Soybean (Glycine max L. Merr.) is the world's most important legume...

  7. Using Max-Plus Algebra for the Evaluation of Stochastic Process Algebra Prefixes

    NARCIS (Netherlands)

    Cloth, L.; de Alfaro, L.; Gilmore, S.; Bohnenkamp, H.C.; Haverkort, Boudewijn R.H.M.

    2001-01-01

    In this paper, the concept of complete finite prefixes for process algebra expressions is extended to stochastic models. Events are supposed to happen after a delay that is determined by random variables assigned to the preceding conditions. Max-plus algebra expressions are shown to provide an

  8. Enteromorpha intestinalis Derived Seaweed Liquid Fertilizers as Prospective Biostimulant for Glycine max

    Directory of Open Access Journals (Sweden)

    Chetna Mathur

    2015-12-01

    Full Text Available ABSTRACT In the present study, the potential of seaweed liquid fertilizer (SLF of marine algae Enteromorpha intestinalis was evaluated for its effect on seed germination, yield, biochemical parameters and pigment characteristics of Glycine maxE. intestinalis was collected form Mandapam coast of Gulf of Mannar, Tamil Nadu, and the dried seaweeds were used for the preparation of SLF. G. max seeds were germinated with four different concentrations (20, 40, 60, and 100% of SLF; its growth and yield parameters were evaluated and compared with chemical fertilizer and control. The morphological and bio-chemical parameters such as seed germination (100%, root (6.6cm and shoot length (5.4 cm, carbohydrates (0.098 mg/g, protein (0.56 mg/g, pigment (0.444 mg/g chl a; 1.073 mg/g chl b; 3.70 mg/g carotenoids of the plant was found maximum at a concentration of 60% SLF. The phenol content (3.25 mg/g was maximum in 40% SLF. The GC-MS analysis of SLF revealed the presence of notable benzoic compounds involved in plant growth promotion. Results showed thatE. intestinalis derived SLF was potential biostimulant forG. max. Thus, marine algae based fertilizer could be an effective and alternate to the chemical fertilizers emphasizing the need for systematic evaluation programme for SLF on various crops.

  9. Pengaruh Pemberian Pyraclotrobin Terhadap Efisiensi Penyerapan Nitrogen Dan Kualitas Hasil Tanaman Kedelai (Glycine Max L. Merr.)

    OpenAIRE

    Mansur, Mansur; Ashari, Sumeru; Kuswanto, Kuswanto

    2015-01-01

    Kedelai (Glycine max (L.) Merr.) adalah tanaman kacang-kacangan (Leguminosae) yang menjadi komoditas tanaman pangan penting karena tingginya kandungan protein. Penelitian ini dilakukan untuk mengetahui pengaruh pemberian pyraclostrobin terhadap efisiensi penyerapan nitrogen, pertumbuhan tanaman dan hasil tanaman kedelai. Bahan penelitian yang digunakan adalah benih kedelai varietas wilis, pyraclostrobin dan pupuk urea 46% N. Rancangan yang digunakan adalah rancangan tersarang yang terdiri da...

  10. Functional and in silico assessment of MAX variants of unknown significance

    DEFF Research Database (Denmark)

    Comino-Méndez, Iñaki; Leandro-García, Luis J; Montoya, Guillermo

    2015-01-01

    UNLABELLED: The presence of germline mutations affecting the MYC-associated protein X (MAX) gene has recently been identified as one of the now 11 major genetic predisposition factors for the development of hereditary pheochromocytoma and/or paraganglioma. Little is known regarding how missense v...

  11. Rescuing the MaxEnt treatment for q-generalized entropies

    Science.gov (United States)

    Plastino, A.; Rocca, M. C.

    2018-02-01

    It has been recently argued that the MaxEnt variational problem would not adequately work for Renyi's and Tsallis' entropies. We constructively show here that this is not so if one formulates the associated variational problem in a more orthodox functional fashion.

  12. Cross-layer ultrasound video streaming over mobile WiMAX and HSUPA networks.

    Science.gov (United States)

    Alinejad, Ali; Philip, Nada Y; Istepanian, Robert S H

    2012-01-01

    It is well known that the evolution of 4G-based mobile multimedia network systems will contribute significantly to future mobile healthcare (m-health) applications that require high bandwidth and fast data rates. Central to the success of such emerging applications is the compatibility of broadband networks, such as mobile Worldwide Interoperability For Microwave Access (WiMAX) and High-Speed Uplink Packet Access (HSUPA), and especially their rate adaption issues combined with the acceptable real-time medical quality of service requirements. In this paper, we address the relevant challenges of cross-layer design requirements for real-time rate adaptation of ultrasound video streaming in mobile WiMAX and HSUPA networks. A comparative performance analysis of such approach is validated in two experimental m-health test bed systems for both mobile WiMAX and HSUPA networks. The experimental results have shown an improved performance of mobile WiMAX compared to the HSUPA using the same cross-layer optimization approach.

  13. Electronic payment systems

    OpenAIRE

    Mláka, Michal

    2010-01-01

    This bachelor thesis analysis issue of electronic payment systems. It discusses their use for payments on the internet and sending funds via e-mail. The first part is devoted to the theoretical definition and legislation of the issuance of electronic money and activities of electronic money institutions. The main part of the work clearly focuses on the use of e-wallets, which is an integral part of electronic payment systems. E-wallet of electronic payment system Moneybookers is considered as...

  14. Electron accelerator

    International Nuclear Information System (INIS)

    Abramyan.

    1981-01-01

    The USSR produces an electron accelerator family of a simple design powered straight from the mains. The specifications are given of accelerators ELITA-400, ELITA-3, ELT-2, TEUS-3 and RIUS-5 with maximum electron energies of 0.3 to 5 MeV, a mean power of 10 to 70 kW operating in both the pulsed and the continuous (TEUS-3) modes. Pulsed accelerators ELITA-400 and ELITA-3 and RIUS-5 in which TESLA resonance transformers are used are characterized by their compact size. (Ha)

  15. Electronic cigarette

    OpenAIRE

    Wang, Tao

    2016-01-01

    As we know E-cigarette is becoming increasingly popular all over the world. It is a new product that the most of smoking people would like to buy and use. However, we are not realizing advantages and disadvantages of e-cigarette clearly. My objective was to research the development of electronic cigarette whether it is under control or a good way of marketing. The thesis has two main parts. They include answers to questions what is electronic cigarette and how to manage the whole industry...

  16. QoS Management and Control for an All-IP WiMAX Network Architecture: Design, Implementation and Evaluation

    Directory of Open Access Journals (Sweden)

    Thomas Michael Bohnert

    2008-01-01

    Full Text Available The IEEE 802.16 standard provides a specification for a fixed and mobile broadband wireless access system, offering high data rate transmission of multimedia services with different Quality-of-Service (QoS requirements through the air interface. The WiMAX Forum, going beyond the air interface, defined an end-to-end WiMAX network architecture, based on an all-IP platform in order to complete the standards required for a commercial rollout of WiMAX as broadband wireless access solution. As the WiMAX network architecture is only a functional specification, this paper focuses on an innovative solution for an end-to-end WiMAX network architecture offering in compliance with the WiMAX Forum specification. To our best knowledge, this is the first WiMAX architecture built by a research consortium globally and was performed within the framework of the European IST project WEIRD (WiMAX Extension to Isolated Research Data networks. One of the principal features of our architecture is support for end-to-end QoS achieved by the integration of resource control in the WiMAX wireless link and the resource management in the wired domains in the network core. In this paper we present the architectural design of these QoS features in the overall WiMAX all-IP framework and their functional as well as performance evaluation. The presented results can safely be considered as unique and timely for any WiMAX system integrator.

  17. Registration of cytoplasmic male-sterile oilseed sunflower genetic stocks CMS GIG2 and CMS GIG2-RV, and fertility restoration lines RF GIG2-MAX 1631 and RF GIG2-MAX 1631-RV

    Science.gov (United States)

    Two cytoplasmic male-sterile (CMS) oilseed sunflower (Helianthus annuus L.) genetic stocks, CMS GIG2 (Reg. No. xxx, PI xxxx), and CMS GIG2-RV (Reg. No. xxx, PI xxxx), and corresponding fertility restoration lines RF GIG2-MAX 1631 (Reg. No. xxx, PI xxxx) and RF GIG2-MAX 1631-RV (Reg. No. xxx, PI xxx...

  18. Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress

    Science.gov (United States)

    2014-01-01

    Background Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. Results M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. Conclusions MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress. PMID:24383424

  19. Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress.

    Science.gov (United States)

    Chen, Zi-Hong; Xu, Ling; Yang, Feng-lian; Ji, Guang-Hai; Yang, Jing; Wang, Jian-Yun

    2014-01-03

    Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress.

  20. Comparison of Three Popular Exercise Modalities on V˙O2max in Overweight and Obese.

    Science.gov (United States)

    Bækkerud, Fredrik Hjulstad; Solberg, Frederic; Leinan, Ingeborg Megård; Wisløff, Ulrik; Karlsen, Trine; Rognmo, Øivind

    2016-03-01

    In this prospective randomized trial, we examined the effect of three popular exercise training modalities on maximal oxygen uptake (V˙O2max) in overweight and obese individuals. In addition, we examined possible concomitant adaptations in endurance exercise performance (time to exhaustion (TTE)), citrate synthase (CS) activity, venous and arterial function, blood volume, and calculated stroke volume (SV). Thirty subjects were recruited (age, 41 ± 9 yr; weight, 91 ± 14 kg; height, 173 ± 8 cm; body mass index, 30 ± 4 kg·m(-2)) and randomized to either 6 wk of 4 × 4-min high-intensity interval training (4HIIT) at 85%-95% of HRmax, 10 × 1-min HIIT (1HIIT) at V˙O2max load, or 45-min moderate-intensity continuous training (MICT) at 70% of HRmax. V˙O2max, TTE, CS activity, venous and arterial function, as well as blood volume were measured before and after the training period. O2 pulse was calculated and used to estimate SV. Analysis was conducted per protocol. Only 4HIIT increased V˙O2max (P HIIT (P = 0.04) and MICT (P = 0.03) (4HIIT, 10%; 1HIIT, 3.3%; and MICT, 3.1%). All groups increased TTE (4HIIT, 198%; 1HIIT, 116%; MICT, 52%), with a higher increase after 4HIIT compared with that after MICT (P = 0.02). Calculated SV increased only after 4HIIT (14.4%). Plasma volume and hemoglobin mass increased after 1HIIT only (5.6% and 6.5%); however, no group differences were found. All groups increased CS activity (4HIIT, 35%; 1HIIT, 35%; MICT, 56%), with no group differences. Arterial inflow (15.7%) and venous outflow (22.7%) decreased after MICT, but there were no group differences. 4HIIT was superior to 1HIIT and MICT in improving V˙O2max likely because of an increased SV.

  1. The effect of cloud screening on MAX-DOAS aerosol retrievals.

    Science.gov (United States)

    Gielen, Clio; Van Roozendael, Michel; Hendrik, Francois; Fayt, Caroline; Hermans, Christian; Pinardi, Gaia; De Backer, Hugo; De Bock, Veerle; Laffineur, Quentin; Vlemmix, Tim

    2014-05-01

    In recent years, ground-based multi-axis differential absorption spectroscopy (MAX-DOAS) has shown to be ideally suited for the retrieval of tropospheric trace gases and deriving information on the aerosol properties. These measurements are invaluable to our understanding of the physics and chemistry of the atmospheric system, and the impact on the Earth's climate. Unfortunately, MAX-DOAS measurements are often performed under strong non-clear-sky conditions, causing strong data quality degradation and uncertainties on the retrievals. Here we present the result of our cloud-screening method, using the colour index (CI), on aerosol retrievals from MAX-DOAS measurements (AOD and vertical profiles). We focus on two large data sets, from the Brussels and Beijing area. Using the CI we define 3 different sky conditions: bad (=full thick cloud cover/extreme aerosols), mediocre (=thin clouds/aerosols) and good (=clear sky). We also flag the presence of broken/scattered clouds. We further compare our cloud-screening method with results from cloud-cover fractions derived from thermic infrared measurements. In general, our method shows good results to qualify the sky and cloud conditions of MAX-DOAS measurements, without the need for other external cloud-detection systems. Removing data under bad-sky and broken-cloud conditions results in a strongly improved agreement, in both correlation and slope, between the MAX-DOAS aerosol retrievals and data from other instruments (e.g. AERONET, Brewer). With the improved AOD retrievals, the seasonal and diurnal variations of the aerosol content and vertical distribution at both sites can be investigated in further detail. By combining with additional information derived by other instruments (Brewer, lidar, ...) operated at the stations, we will further study the observed aerosol characteristics, and their influence on and by meteorological conditions such as clouds and/or the boundary layer height.

  2. New Main Ring control system

    International Nuclear Information System (INIS)

    Seino, K.; Anderson, L.; Ducar, R.; Franck, A.; Gomilar, J.; Hendricks, B.; Smedinghoff, J.

    1990-03-01

    The Fermilab Main Ring control system has been operational for over sixteen years. Aging and obsolescence of the equipment make the maintenance difficult. Since the advent of the Tevatron, considerable upgrades have been made to the controls of all the Fermilab accelerators except the Main Ring. Modernization of the equipment and standardization of the hardware and software have thus become inevitable. The Tevatron CAMAC serial system has been chosen as a basic foundation in order to make the Main Ring control system compatible with the rest of the accelerator complex. New hardware pieces including intelligent CAMAC modules have been designed to satisfy unique requirements. Fiber optic cable and repeaters have been installed in order to accommodate new channel requirements onto the already saturated communication medium system. 8 refs., 2 figs

  3. Deficit Round Robin with Fragmentation Scheduling to Achieve Generalized Weighted Fairness for Resource Allocation in IEEE 802.16e Mobile WiMAX Networks

    Directory of Open Access Journals (Sweden)

    Chakchai So-In

    2010-10-01

    Full Text Available Deficit Round Robin (DRR is a fair packet-based scheduling discipline commonly used in wired networks where link capacities do not change with time. However, in wireless networks, especially wireless broadband networks, i.e., IEEE 802.16e Mobile WiMAX, there are two main considerations violate the packet-based service concept for DRR. First, the resources are allocated per Mobile WiMAX frame. To achieve full frame utilization, Mobile WiMAX allows packets to be fragmented. Second, due to a high variation in wireless channel conditions, the link/channel capacity can change over time and location. Therefore, we introduce a Deficit Round Robin with Fragmentation (DRRF to allocate resources per Mobile WiMAX frame in a fair manner by allowing for varying link capacity and for transmitting fragmented packets. Similar to DRR and Generalized Processor Sharing (GPS, DRRF achieves perfect fairness. DRRF results in a higher throughput than DRR (80% improvement while causing less overhead than GPS (8 times less than GPS. In addition, in Mobile WiMAX, the quality of service (QoS offered by service providers is associated with the price paid. This is similar to a cellular phone system; the users may be required to pay air-time charges. Hence, we have also formalized a Generalized Weighted Fairness (GWF criterion which equalizes a weighted sum of service time units or slots, called temporal fairness, and transmitted bytes, called throughput fairness, for customers who are located in a poor channel condition or at a further distance versus for those who are near the base stations, or have a good channel condition. We use DRRF to demonstrate the application of GWF. These fairness criteria are used to satisfy basic requirements for resource allocation, especially for non real-time traffic. Therefore, we also extend DRRF to support other QoS requirements, such as minimum reserved traffic rate, maximum sustained traffic rate, and traffic priority. For real

  4. Electronics and electronic systems

    CERN Document Server

    Olsen, George H

    1987-01-01

    Electronics and Electronic Systems explores the significant developments in the field of electronics and electronic devices. This book is organized into three parts encompassing 11 chapters that discuss the fundamental circuit theory and the principles of analog and digital electronics. This book deals first with the passive components of electronic systems, such as resistors, capacitors, and inductors. These topics are followed by a discussion on the analysis of electronic circuits, which involves three ways, namely, the actual circuit, graphical techniques, and rule of thumb. The remaining p

  5. Main: FBB2 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available ion of the c-ring - A subunit packing model of E. coli c-ring has been proposed - The main chain secondary s...tructure of thermophile c-ring has been obtained ATP synthase is a general term for an enzyme that can synth

  6. Main: FEA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available al or an anti-cancer drug, is the main cause of hospital-acquired infection - Dru...e will elucidate the entire structure of the transport machinery in action to understand its functions in detail. FEA5.csml ...

  7. Residential Energy Efficiency Potential: Maine

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-11-02

    Energy used by Maine single-family homes that can be saved through cost-effective improvements. Prepared by Eric Wilson and Noel Merket, NREL, and Erin Boyd, U.S. Department of Energy Office of Energy Policy and Systems Analysis.

  8. CENTRE OF THE MAIN INTERESTS

    Directory of Open Access Journals (Sweden)

    DIANA DELEANU

    2013-05-01

    Full Text Available The centre of the main interests of the debtor is a legal tool meant to settle conflicts that can arise between jurisdictions in cross-border insolvencies, based on the principles of mutual recognition and co-operation.

  9. Max J. Friedländer (1867-1958) : Kunst en kennerschap, een leven gewijd aan de vroeg Nederlandse schilderkunst

    NARCIS (Netherlands)

    Laemers, S.A.M.

    2017-01-01

    Max J. Friedländer (1867-1958). Art and Connoisseurship, a Life dedicated to Early Netherlandish Painting, aims to elucidate the life and work of Max Friedländer on the basis of a number of themes, especially his connoisseurship and its meaning for the exploration of early Netherlandish painting.

  10. Modeling and Control of Switching Max-Plus-Linear Systems : Rescheduling of railway traffic and changing gaits in legged locomotion

    NARCIS (Netherlands)

    Kersbergen, B.

    2015-01-01

    The operation of many systems can be described by the timing of events. When the system behavior can be described by equations that are "linear'' in the max-plus algebra, which has maximization and addition as its basic operations, the system is called a max-plus-linear system. In many of these

  11. 75 FR 12730 - Foreign-Trade Zone 158-Vicksburg/Jackson, MS; Amendment to Application for Subzone; Max Home, LLC...

    Science.gov (United States)

    2010-03-17

    ...-purpose subzone status for the upholstered furniture manufacturing facilities of Max Home, LLC (Max Home... additional manufacturing plant and warehouse (100 employees/ 26 acres/160,000 sq. ft.) are located at 1313... finished upholstered furniture (chairs, seats, sofas, sleep sofas, and sectionals). The additional...

  12. Analisis Kinerja Subscriber Station WiMAX di Urban Area Bandung

    Directory of Open Access Journals (Sweden)

    DWI ARYANTA

    2017-06-01

    Full Text Available ABSTRAK   Teknologi komunikasi wireless semakin pesat mengalami perkembangan. WiMAX  merupakan suatu teknologi broadband yang didukung oleh standar IEEE 802.16d (802.16-2004 yang mampu memberikan layanan data berkecepatan tinggi hingga 75 Mbps dalam radius maksimal 40-50 km pada bandwidth 20 MHz. Alokasi frekuensi yang dipakai Indonesia untuk jaringan WiMAX  ini ialah 3,3 – 3,4 GHz. Penelitian ini dilakukan dengan melakukan proses pengukuran kinerja perangkat radio WiMAX  yaitu HiMax 331-SS. Proses pengukuran dilakukan antara CPE dan base station dengan antenna sektoral 1200 pada ketinggian 45 m. Lokasi pengukuran dilakukan di beberapa area kota Bandung yang telah ditentukan sebelumnya. Hasil pengukuran memperlihatkan nilai CINR tertinggi adalah 31 dB dengan modulasi 64 QAM – ¾ dan terendah nilai 10 dB dengan modulasi BPSK 1/2. Nilai RSSI tertinggi -54 dBm berada dan nilai RSSI terendah -89 dBm. Nilai throughput tertinggi untuk layanan streaming video sebesar  1000,8 kbps (downlink dengan modulasi 64 QAM – ¾. Nilai delay terendah sebesar 56,247 ms pada kondisi LOS dan tertinggi sebesar 139,5 ms pada kondisi NLOS. Nilai terbesar packet loss sebesar 20% yaitu pada lokasi pengukuran terjauh 14,3 km. Kata Kunci : delay, packet loss, RSSI, CINR, throughput, CPE, WiMAX .   ABSTRACT   Wireless communication technologies have evolved more rapidly. WiMAX  is a broadband technology that is supported by the IEEE standard 802.16-2004/d which is able to provide high speed data services of up to 75 Mbps within a radius of 40-50 km at a maximum bandwidth of 20 MHz. Indonesia frequency allocation used for the WiMAX  network is 3.3 to 3.4 GHz. This study was conducted with the performance measurement process that is Himax 331 WiMAX  radio - SS. Process measurement is made between the CPE and base station sector antennas at a height of 45 m in 1200. Locations measurements performed in several areas of Bandung predetermined. The measurement

  13. Glycine max

    African Journals Online (AJOL)

    otoigiakih

    2013-05-29

    May 29, 2013 ... obvious, such as cross incompatibility and sterility of either hybrids or their ... ficulty in producing fertile hybrids and progeny by cros- sing genotypes .... Analysis of recombination rate in female and male gametogenesis in ...

  14. Max Weber

    DEFF Research Database (Denmark)

    Harste, Gorm

    2006-01-01

    Temaet er dels Webers teori om magt, herredømme og autoritet, herunder om en udøvende nagts disciplinære bureaukrati og dets retligt-legale legitimeringsform. Dels hvorledes Weber kunne tænke teorier om magt, og hvordan magt påvirkede tænkning. Hvorledes er det muligt at tænke magtens former, når...

  15. Molecular Electronics

    DEFF Research Database (Denmark)

    Jennum, Karsten Stein

    This thesis includes the synthesis and characterisation of organic compounds designed for molecular electronics. The synthesised organic molecules are mainly based on two motifs, the obigo(phenyleneethynylenes) (OPE)s and tetrathiafulvalene (TTF) as shown below. These two scaffolds (OPE and TTF......) are chemically merged together to form cruciform-like structures that are an essential part of the thesis. The cruciform molecules were subjected to molecular conductance measurements to explore their capability towards single-crystal field-effect transistors (Part 1), molecular wires, and single electron......, however, was obtained by a study of a single molecular transistor. The investigated OPE5-TTF compound was captured in a three-terminal experiment, whereby manipulation of the molecule’s electronic spin was possible in different charge states. Thus, we demonstrated how the cruciform molecules could...

  16. Performance Evaluation of WiMAX Broadband from High Altitude Platform Cellular System and Terrestrial Coexistence Capability

    Directory of Open Access Journals (Sweden)

    Yang Z

    2008-01-01

    Full Text Available The performance obtained from providing worldwide interoperability for microwave access (WiMAX from high altitude platforms (HAPs with multiple antenna payloads is investigated, and the coexistence capability with multiple-operator terrestrial WiMAX deployments is examined. A scenario composed of a single HAP and coexisting multiple terrestrial WiMAX base stations deployed inside the HAP coverage area (with radius of 30 km to provide services to fixed users with the antenna mounted on the roof with a directive antenna to receive signals from HAPs is proposed. A HAP cellular configuration with different possible reuse patterns is established. The coexistence performance is assessed in terms of HAP downlink and uplink performance, interfered by terrestrial WiMAX deployment. Simulation results show that it is effective to deliver WiMAX via HAPs and share the spectrum with terrestrial systems.

  17. Performance Evaluation of WiMAX Broadband from High Altitude Platform Cellular System and Terrestrial Coexistence Capability

    Directory of Open Access Journals (Sweden)

    T. Hult

    2008-12-01

    Full Text Available The performance obtained from providing worldwide interoperability for microwave access (WiMAX from high altitude platforms (HAPs with multiple antenna payloads is investigated, and the coexistence capability with multiple-operator terrestrial WiMAX deployments is examined. A scenario composed of a single HAP and coexisting multiple terrestrial WiMAX base stations deployed inside the HAP coverage area (with radius of 30 km to provide services to fixed users with the antenna mounted on the roof with a directive antenna to receive signals from HAPs is proposed. A HAP cellular configuration with different possible reuse patterns is established. The coexistence performance is assessed in terms of HAP downlink and uplink performance, interfered by terrestrial WiMAX deployment. Simulation results show that it is effective to deliver WiMAX via HAPs and share the spectrum with terrestrial systems.

  18. MaxBin 2.0: an automated binning algorithm to recover genomes from multiple metagenomic datasets

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Yu-Wei [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Simmons, Blake A. [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Singer, Steven W. [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-10-29

    The recovery of genomes from metagenomic datasets is a critical step to defining the functional roles of the underlying uncultivated populations. We previously developed MaxBin, an automated binning approach for high-throughput recovery of microbial genomes from metagenomes. Here, we present an expanded binning algorithm, MaxBin 2.0, which recovers genomes from co-assembly of a collection of metagenomic datasets. Tests on simulated datasets revealed that MaxBin 2.0 is highly accurate in recovering individual genomes, and the application of MaxBin 2.0 to several metagenomes from environmental samples demonstrated that it could achieve two complementary goals: recovering more bacterial genomes compared to binning a single sample as well as comparing the microbial community composition between different sampling environments. Availability and implementation: MaxBin 2.0 is freely available at http://sourceforge.net/projects/maxbin/ under BSD license. Supplementary information: Supplementary data are available at Bioinformatics online.

  19. Prevalence of subclinical ketosis in mainly pasture-grazed dairy cows in New Zealand in early lactation.

    Science.gov (United States)

    Compton, C W R; McDougall, S; Young, L; Bryan, M A

    2014-01-01

    The main aim of this study was to describe the prevalence of primary subclinical ketosis (SCK) in mainly pasture-grazed dairy cows in three dairy-farming regions of New Zealand 7-12, and 35-40 days post-calving. A second aim was to investigate herd- and cow-level factors associated with the prevalence of SCK. A cross-sectional longitudinal prevalence survey was undertaken in 1,620 dairy cows from 57 herds. A random sample of cows without disease in the prior 30 days were enrolled at one farm visit within 5 days of calving, and blood samples were collected 7 and 28 days later (7-12 and 35-40 days post-calving) for measurement of beta-hydroxy butyrate (BHBA) concentrations using an electronic cow-side meter. SCK was defined as blood BHBA concentration ≥1.4 mmol/L. Mean cow-level prevalence of SCK varied with interval post-calving (16.8 and 3.2% at 7-12 days and 35-40 days post-calving, respectively) and age (13.0 and 13.1% of 2-year olds and ≥8-year olds, respectively, compared to 7.2% of 3-4-year-old cows). Mean herd-level prevalence of SCK was 14.3 (min 0, max 60.0)% and 2.6 (min 0, max 24.4)% at 7-12 days and 35-40 days post-calving, respectively, and was greater in Southland (13.3%) than Waikato and Canterbury herds (6.9 and 4.7%, respectively). This is the first population-based report of the prevalence of SCK in New Zealand dairy herds and demonstrates that age and interval post-calving are important risk factors determining prevalence; and that there is wide variation in prevalence between herds. Subclinical ketosis may be unrecognised but common in many New Zealand dairy cows in the first 2 weeks of lactation.

  20. Development of a cloud-screening method for MAX-DOAS measurements

    Science.gov (United States)

    Gielen, Clio; Van Roozendael, Michel; Hendrik, Francois; Fayt, Caroline; Hermans, Christian; Pinardi, Gaia; Vlemmix, Tim

    2013-04-01

    In recent years, ground-based multi-axis differential absorption spectroscopy (MAX-DOAS) has shown to be ideally suited for the retrieval of tropospheric trace gases and deriving information on the aerosol properties. These measurements are invaluable to our understanding of the physics and chemistry of the atmospheric system, and the impact on the Earth's climate. Unfortunately, MAX-DOAS measurements are often performed under (partially) cloudy conditions, causing data quality degradation and higher uncertainties on the retrievals. A high aerosol load and/or a strong cloud cover can introduce additional photon absorption or multiple scattering. The first effect strongly impacts the retrieved differential slant columns (DSCDs) of the trace gases, leading to an underestimation of the atmospheric column density. Multiple scattering, on the other hand, becomes important for low clouds with a high optical depth, and cause a strong increase in the retrieved trace gas DSCDs. The presence of thin clouds can furthermore introduce a degeneracy in the retrieved aerosol optical depth, since they will have similar effect on the MAX-DOAS measurements. In this case, only information on the trace gas DSCDs can be successfully retrieved. If the cloud cover consists of broken or scattered clouds, the MAX-DOAS method becomes very unstable, since the different elevation angels will probe regions of the sky with strongly deviating properties. Here we present a method to qualify the sky and cloud conditions, using the colour index and O4 DSCDs, as derived from the MAX-DOAS measurements. The colour index is defined as the ratio of the intensities at the short- and long-wavelength part of the visible spectral range, typically at 400 nm and 670 nm. For increasing optical thickness due to clouds or aerosols, the colour index values decrease and values for different elevation angles converge. In the case of broken clouds, the colour index shows a strong and rapid temporal variation, which

  1. High-Intensity Interval Training Increases Cardiac Output and V˙O2max.

    Science.gov (United States)

    Astorino, Todd A; Edmunds, Ross M; Clark, Amy; King, Leesa; Gallant, Rachael A; Namm, Samantha; Fischer, Anthony; Wood, Kimi M

    2017-02-01

    Increases in maximal oxygen uptake (V˙O2max) frequently occur with high-intensity interval training (HIIT), yet the specific adaptation explaining this result remains elusive. This study examined changes in V˙O2max and cardiac output (CO) in response to periodized HIIT. Thirty-nine active men and women (mean age and V˙O2max = 22.9 ± 5.4 yr and 39.6 ± 5.6 mL·kg·min) performed HIIT and 32 men and women (age and V˙O2max = 25.7 ± 4.5 yr and 40.7 ± 5.2 mL·kg·min) were nonexercising controls (CON). The first 10 sessions of HIIT required eight to ten 60 s bouts of cycling at 90%-110% percent peak power output interspersed with 75 s recovery, followed by randomization to one of three regimes (sprint interval training (SIT), high-volume interval training (HIITHI), or periodized interval training (PER) for the subsequent 10 sessions. Before, midway, and at the end of training, progressive cycling to exhaustion was completed during which V˙O2max and maximal CO were estimated. Compared with CON, significant (P HIIT + SIT (39.8 ± 7.3 mL·kg·min to 43.6 ± 6.1 mL·kg·min), HIIT + HIITHI (41.1 ± 4.9 mL·kg·min to 44.6 ± 7.0 mL·kg·min), and HIIT + PER (39.5 ± 5.6 mL·kg·min to 44.1 ± 5.4 mL·kg·min) occurred which were mediated by significant increases in maximal CO (20.0 ± 3.1 L·min to 21.7 ± 3.2 L·min, P = 0.04). Maximal stroke volume was increased with HIIT (P = 0.04), although there was no change in maximal HR (P = 0.88) or arteriovenous O2 difference (P = 0.36). These CO data are accurate and represent the mean changes from pre- to post-HIIT across all three training groups. Increases in V˙O2max exhibited in response to different HIIT regimes are due to improvements in oxygen delivery.

  2. Sequence-specific DNA binding by MYC/MAX to low-affinity non-E-box motifs.

    Directory of Open Access Journals (Sweden)

    Michael Allevato

    Full Text Available The MYC oncoprotein regulates transcription of a large fraction of the genome as an obligatory heterodimer with the transcription factor MAX. The MYC:MAX heterodimer and MAX:MAX homodimer (hereafter MYC/MAX bind Enhancer box (E-box DNA elements (CANNTG and have the greatest affinity for the canonical MYC E-box (CME CACGTG. However, MYC:MAX also recognizes E-box variants and was reported to bind DNA in a "non-specific" fashion in vitro and in vivo. Here, in order to identify potential additional non-canonical binding sites for MYC/MAX, we employed high throughput in vitro protein-binding microarrays, along with electrophoretic mobility-shift assays and bioinformatic analyses of MYC-bound genomic loci in vivo. We identified all hexameric motifs preferentially bound by MYC/MAX in vitro, which include the low-affinity non-E-box sequence AACGTT, and found that the vast majority (87% of MYC-bound genomic sites in a human B cell line contain at least one of the top 21 motifs bound by MYC:MAX in vitro. We further show that high MYC/MAX concentrations are needed for specific binding to the low-affinity sequence AACGTT in vitro and that elevated MYC levels in vivo more markedly increase the occupancy of AACGTT sites relative to CME sites, especially at distal intergenic and intragenic loci. Hence, MYC binds diverse DNA motifs with a broad range of affinities in a sequence-specific and dose-dependent manner, suggesting that MYC overexpression has more selective effects on the tumor transcriptome than previously thought.

  3. ONKALO - Main drawings in 2007

    International Nuclear Information System (INIS)

    2008-05-01

    The first overall site characterisation programme for a Finnish repository of spent nuclear fuel was introduced in 1982. This programme already suggested that the site confirmation for a detailed repository design and safety assessment should include characterisation performed in an underground rock characterisation facility (URCF). This idea was confirmed during the detailed site characterisation. International views have also emphasised the importance of underground characterisation before the final decision to construct the repository is taken. The underground rock characterisation facility (ONKALO) is excavated at Olkiluoto in the municipality of Eurajoki. ONKALO should be constructed to allow characterisation work for site confirmation without jeopardising long-term safety of the repository site. It should also be possible to link ONKALO later to the repository as to a part of it. The construction of ONKALO was started in 2004 and will be completed in 2014. The characterisation work has started in ONKALO and will focus on the disposal depth. In the main drawings stage, ONKALO was described at the level of detail needed for a construction permit in 2003. This meant description of the location, final structures and final systems. This summary report describes the development of design to updated main drawings in 2007 at the same level of detail (no temporary arrangements are described). The main changes are the added exhaust air shaft and advancing the controlled area's inlet air shaft to the ONKALO phase. Also the layout and the depth of the characterisation levels have been updated according to the current bedrock information. Some buildings on the surface will house sets of equipment directly connected with underground facility and this equipment is described in this report. No buildings or other equipment are described in this report, because they are not directly connected with the underground facility. The main element of ONKALO is a system of

  4. A main sequence for quasars

    Science.gov (United States)

    Marziani, Paola; Dultzin, Deborah; Sulentic, Jack W.; Del Olmo, Ascensión; Negrete, C. A.; Martínez-Aldama, Mary L.; D'Onofrio, Mauro; Bon, Edi; Bon, Natasa; Stirpe, Giovanna M.

    2018-03-01

    The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

  5. A Main Sequence for Quasars

    Directory of Open Access Journals (Sweden)

    Paola Marziani

    2018-03-01

    Full Text Available The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

  6. At ISR Main Control Room

    CERN Multimedia

    1983-01-01

    After 13 years the exploitation of the Intersecting Storage Rings as a beam-beam collider went to an end. In this last year the demands were very exacting, both in terms of operating time and diversified running conditions (Annual Report 1983 p. 123). Before dismantelement the photographer made a last tour, see photos 8310889X --> 8310667X. This photo shows the Main Control Room.

  7. Accurate, rapid identification of dislocation lines in coherent diffractive imaging via a min-max optimization formulation

    Energy Technology Data Exchange (ETDEWEB)

    Ulvestad, A. [Materials Science Division, Argonne National Laboratory, Lemont, IL 60439, USA; Menickelly, M. [Mathematics and Computer Science Division, Argonne National Laboratory, Lemont, IL 60439, USA; Wild, S. M. [Mathematics and Computer Science Division, Argonne National Laboratory, Lemont, IL 60439, USA

    2018-01-01

    Defects such as dislocations impact materials properties and their response during external stimuli. Imaging these defects in their native operating conditions to establish the structure-function relationship and, ultimately, to improve performance via defect engineering has remained a considerable challenge for both electron-based and x-ray-based imaging techniques. While Bragg coherent x-ray diffractive imaging (BCDI) is successful in many cases, nuances in identifying the dislocations has left manual identification as the preferred method. Derivative-based methods are also used, but they can be inaccurate and are computationally inefficient. Here we demonstrate a derivative-free method that is both more accurate and more computationally efficient than either derivative-or human-based methods for identifying 3D dislocation lines in nanocrystal images produced by BCDI. We formulate the problem as a min-max optimization problem and show exceptional accuracy for experimental images. We demonstrate a 227x speedup for a typical experimental dataset with higher accuracy over current methods. We discuss the possibility of using this algorithm as part of a sparsity-based phase retrieval process. We also provide MATLAB code for use by other researchers.

  8. The bumpy road Max Planck from radiation theory to the quantum (1896-1906)

    CERN Document Server

    Badino, Massimiliano

    2015-01-01

    This book examines the different areas of knowledge, traditions, and conceptual resources that contributed to the building of Max Planck’s theory of radiation. It presents an insightful comparative analysis that not only sheds light upon a fundamental chapter in the history of modern physics, but also enlarges our understanding of how theoreticians work. Coverage offers a deep investigation into the technical aspects behind the theory and extends in time the notion of quantum revolution. It also presents a full-fledged discussion of the combinatorial part of Planck’s theory and places emphasis on the epistemological role of mathematical practices. By painstakingly reconstructing both the electromagnetic and the combinatorial part of Planck’s black-body theory, the author shows how some apparently merely technical resources, such as the Fourier series, effectively contributed to shape the final form of Planck’s theory. For decades, historians have debated the conditions of possibility of Max Planck’s...

  9. An Overlapping Communities Detection Algorithm via Maxing Modularity in Opportunistic Networks

    Directory of Open Access Journals (Sweden)

    Gao Zhi-Peng

    2016-01-01

    Full Text Available Community detection in opportunistic networks has been a significant and hot issue, which is used to understand characteristics of networks through analyzing structure of it. Community is used to represent a group of nodes in a network where nodes inside the community have more internal connections than external connections. However, most of the existing community detection algorithms focus on binary networks or disjoint community detection. In this paper, we propose a novel algorithm via maxing modularity of communities (MMCto find overlapping community structure in opportunistic networks. It utilizes contact history of nodes to calculate the relation intensity between nodes. It finds nodes with high relation intensity as the initial community and extend the community with nodes of higher belong degree. The algorithm achieves a rapid and efficient overlapping community detection method by maxing the modularity of community continuously. The experiments prove that MMC is effective for uncovering overlapping communities and it achieves better performance than COPRA and Conductance.

  10. Using the Min/Max Method for Replenishment of Picking Locations

    Directory of Open Access Journals (Sweden)

    Apsalons Raitis

    2017-03-01

    Full Text Available The irregularity of removing quantities from a definite picking location in a warehouse very often results in the stock out in the particular picking address. In practice, the Red Card principle is used to determine a critical level for each picking location when it is necessary to start the replenishment of stock in the picking address. The question is how to calculate an adequate critical level. The guidelines in this paper explain in detail the solution of the problem using the Min/Max stock control method and mathematical algorithms adjusted by authors. In order to check the validity of these mathematical algorithms of the Min/Max method, the simulation modelling has been also done and presented.

  11. The eDoc-Server Project Building an Institutional Repository for the Max Planck Society

    CERN Document Server

    Beier, Gerhard

    2004-01-01

    With the eDoc-Server the Heinz Nixdorf Center for Information Management in the Max Planck Society (ZIM) provides the research institutes of the Max Planck Society (MPS) with a platform to disseminate, store, and manage their scientific output. Moreover, eDoc serves as a tool to facilitate and promote open access to scientific information and primary sources. Since its introduction in October 2002 eDoc has gained high visibility within the MPS. It has been backed by strong institutional commitment to open access as documented in the 'Berlin Declaration on Open Access to the Data of the Sciences and Humanities', which was initiated by the MPS and found large support among major research organizations in Europe. This paper will outline the concept as well as the current status of the eDoc-Server, providing an example for the development and introduction of an institutional repository in a multi-disciplinary research organization.

  12. Reducing Conservatism in Aircraft Engine Response Using Conditionally Active Min-Max Limit Regulators

    Science.gov (United States)

    May, Ryan D.; Garg, Sanjay

    2012-01-01

    Current aircraft engine control logic uses a Min-Max control selection structure to prevent the engine from exceeding any safety or operational limits during transients due to throttle commands. This structure is inherently conservative and produces transient responses that are slower than necessary. In order to utilize the existing safety margins more effectively, a modification to this architecture is proposed, referred to as a Conditionally Active (CA) limit regulator. This concept uses the existing Min-Max architecture with the modification that limit regulators are active only when the operating point is close to a particular limit. This paper explores the use of CA limit regulators using a publicly available commercial aircraft engine simulation. The improvement in thrust response while maintaining all necessary safety limits is demonstrated in a number of cases.

  13. Bayesian Modeling of Air Pollution Extremes Using Nested Multivariate Max-Stable Processes

    KAUST Repository

    Vettori, Sabrina; Huser, Raphaë l; Genton, Marc G.

    2018-01-01

    Capturing the potentially strong dependence among the peak concentrations of multiple air pollutants across a spatial region is crucial for assessing the related public health risks. In order to investigate the multivariate spatial dependence properties of air pollution extremes, we introduce a new class of multivariate max-stable processes. Our proposed model admits a hierarchical tree-based formulation, in which the data are conditionally independent given some latent nested $\\alpha$-stable random factors. The hierarchical structure facilitates Bayesian inference and offers a convenient and interpretable characterization. We fit this nested multivariate max-stable model to the maxima of air pollution concentrations and temperatures recorded at a number of sites in the Los Angeles area, showing that the proposed model succeeds in capturing their complex tail dependence structure.

  14. [Establishment of database with standard 3D tooth crowns based on 3DS MAX].

    Science.gov (United States)

    Cheng, Xiaosheng; An, Tao; Liao, Wenhe; Dai, Ning; Yu, Qing; Lu, Peijun

    2009-08-01

    The database with standard 3D tooth crowns has laid the groundwork for dental CAD/CAM system. In this paper, we design the standard tooth crowns in 3DS MAX 9.0 and create a database with these models successfully. Firstly, some key lines are collected from standard tooth pictures. Then we use 3DS MAX 9.0 to design the digital tooth model based on these lines. During the design process, it is important to refer to the standard plaster tooth model. After some tests, the standard tooth models designed with this method are accurate and adaptable; furthermore, it is very easy to perform some operations on the models such as deforming and translating. This method provides a new idea to build the database with standard 3D tooth crowns and a basis for dental CAD/CAM system.

  15. Bayesian Modeling of Air Pollution Extremes Using Nested Multivariate Max-Stable Processes

    KAUST Repository

    Vettori, Sabrina

    2018-03-18

    Capturing the potentially strong dependence among the peak concentrations of multiple air pollutants across a spatial region is crucial for assessing the related public health risks. In order to investigate the multivariate spatial dependence properties of air pollution extremes, we introduce a new class of multivariate max-stable processes. Our proposed model admits a hierarchical tree-based formulation, in which the data are conditionally independent given some latent nested $\\\\alpha$-stable random factors. The hierarchical structure facilitates Bayesian inference and offers a convenient and interpretable characterization. We fit this nested multivariate max-stable model to the maxima of air pollution concentrations and temperatures recorded at a number of sites in the Los Angeles area, showing that the proposed model succeeds in capturing their complex tail dependence structure.

  16. On Max-Plus Algebra and Its Application on Image Steganography

    Directory of Open Access Journals (Sweden)

    Kiswara Agung Santoso

    2018-01-01

    Full Text Available We propose a new steganography method to hide an image into another image using matrix multiplication operations on max-plus algebra. This is especially interesting because the matrix used in encoding or information disguises generally has an inverse, whereas matrix multiplication operations in max-plus algebra do not have an inverse. The advantages of this method are the size of the image that can be hidden into the cover image, larger than the previous method. The proposed method has been tested on many secret images, and the results are satisfactory which have a high level of strength and a high level of security and can be used in various operating systems.

  17. MaxEnt-Based Ecological Theory: A Template for Integrated Catchment Theory

    Science.gov (United States)

    Harte, J.

    2017-12-01

    The maximum information entropy procedure (MaxEnt) is both a powerful tool for inferring least-biased probability distributions from limited data and a framework for the construction of complex systems theory. The maximum entropy theory of ecology (METE) describes remarkably well widely observed patterns in the distribution, abundance and energetics of individuals and taxa in relatively static ecosystems. An extension to ecosystems undergoing change in response to disturbance or natural succession (DynaMETE) is in progress. I describe the structure of both the static and the dynamic theory and show a range of comparisons with census data. I then propose a generalization of the MaxEnt approach that could provide a framework for a predictive theory of both static and dynamic, fully-coupled, eco-socio-hydrological catchment systems.

  18. Running Performance, VO2max, and Running Economy: The Widespread Issue of Endogenous Selection Bias.

    Science.gov (United States)

    Borgen, Nicolai T

    2018-05-01

    Studies in sport and exercise medicine routinely use samples of highly trained individuals in order to understand what characterizes elite endurance performance, such as running economy and maximal oxygen uptake VO 2max . However, it is not well understood in the literature that using such samples most certainly leads to biased findings and accordingly potentially erroneous conclusions because of endogenous selection bias. In this paper, I review the current literature on running economy and VO 2max , and discuss the literature in light of endogenous selection bias. I demonstrate that the results in a large part of the literature may be misleading, and provide some practical suggestions as to how future studies may alleviate endogenous selection bias.

  19. Ethical care of the other: Edith Stein and Max Scheler's contributions

    Directory of Open Access Journals (Sweden)

    Valdecyr Herdy Alves

    2018-05-01

    Full Text Available Abstract Objective: To analyze the empathy of Edith Stein and the sympathy of Max Scheler for an ethical care of the other. Method: A reflexive, philosophical study anchored in the philosopher Edith Stein's thoughts about empathy for the care of the human person, and likewise of the philosopher Max Scheler on sympathy. It intends to converge the thoughts of the thinkers with the intention of presenting the importance of the care with the person. Results: Stein's empathy leads the human being to perceive the experiences of others and the need for the ethical care of the other; Scheler, in relation to sympathy, brings love as the basis for the ethical care, essential in this relationship with the other. Conclusion: Life and care are become necessary for human relationships, and thus, according to Stein and Scheler's philosophies, each person is invited to perceive the other as a human being.

  20. Fabrication of fiber composites with a MAX phase matrix by reactive melt infiltration

    International Nuclear Information System (INIS)

    Lenz, F; Krenkel, W

    2011-01-01

    Due to the inherent brittleness of ceramics it is very desirable to increase the damage tolerance of ceramics. The ternary MAX phases are a promising group of materials with high fracture toughness. The topic of this study is the development of ceramic matrix composites (CMCs) with a matrix containing MAX phases, to achieve a damage tolerant structural composite material. For this purpose carbon fiber reinforced preforms with a carbon-titanium carbide matrix (C/C-TiC) were developed and infiltrated with silicon by a pressureless reactive melt infiltration. Finally liquid silicon caused the formation of SiC, TiSi 2 and Ti 3 SiC 2 in the matrix of the composite.

  1. System-Level Model for OFDM WiMAX Transceiver in Radiation Environment

    International Nuclear Information System (INIS)

    Abdel Alim, O.; Elboghdadly, N.; Ashour, M.M.; Elaskary, A.M.

    2008-01-01

    WiMAX (Worldwide Inter operability for Microwave Access), an evolving standard for point-to-multipoint wireless networking, works for the l ast mile c onnections for replacing optical fiber technology network but with no need for adding more infra structure within crowded areas. Optical fiber technology is seriously considered for communication and monitoring applications in space and around nuclear reactors. Space and nuclear environments are characterized, in particular, by the presence of ionizing radiation fields. Therefore the influence of radiation on such networks needs to be investigated. This paper has the objective of building a System level model for a WiMAX OFDM (Orthogonal Frequency Division Multiplexing) based transceiver. Modeling irradiation noise as an external effect added to the Additive White Gaussian noise (AWGN). Then analyze, discuss the results based on qualitatively performance evaluation using BER calculations for radiation environment

  2. The antioxidative response system in Glycine max (L.) Merr. exposed to Deltamethrin, a synthetic pyrethroid insecticide

    International Nuclear Information System (INIS)

    Bashir, Fozia; Mahmooduzzafar; Siddiqi, T.O.; Iqbal, Muhammad

    2007-01-01

    Forty-five-day-old plants of Glycine max (soybean) were exposed to several Deltamethrin (synthetic pyrethroid insecticide) concentrations (0.00 %, 0.05 %, 0.10 %, 0.15 % and 0.20 %) through foliar spray in the field conditions. In the treated plants, as observed at the pre-flowering (10 DAT), flowering (45 DAT) and post-flowering (70 DAT) stages, lipid peroxidation, proline content and total glutathione content increased, whereas the total ascorbate content decreased, as compared with the control. Among the enzymatic antioxidants, activity of superoxide dismutase, ascorbate peroxidase and glutathione reductase increased significantly whereas that of catalase declined markedly in relation to increasing concentration of Deltamethrin applied. The changes observed were dose-dependent, showing a strong correlation with the degree of treatment. - The Deltamethrin-induced oxidative stress alters the ascorbate-glutathione cycle in Glycine max

  3. Diffusion, Thermal Properties and Chemical Compatibilities of Select MAX Phases with Materials For Advanced Nuclear Systems

    Energy Technology Data Exchange (ETDEWEB)

    Barsoum, Michel [Drexel Univ., Philadelphia, PA (United States); Bentzel, Grady [Drexel Univ., Philadelphia, PA (United States); Tallman, Darin J. [Drexel Univ., Philadelphia, PA (United States); Sindelar, Robert [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Garcia-Diaz, Brenda [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hoffman, Elizabeth [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-04-04

    The demands of Gen IV nuclear power plants for long service life under neutron irradiation at high temperature are severe. Advanced materials that would withstand high temperatures (up to 1000+ ºC) to high doses in a neutron field would be ideal for reactor internal structures and would add to the long service life and reliability of the reactors. The objective of this work is to investigate the chemical compatibility of select MAX with potential materials that are important for nuclear energy, as well as to measure the thermal transport properties as a function of neutron irradiation. The chemical counterparts chosen for this work are: pyrolytic carbon, SiC, U, Pd, FLiBe, Pb-Bi and Na, the latter 3 in the molten state. The thermal conductivities and heat capacities of non-irradiated MAX phases will be measured.

  4. Capacity Evaluation for IEEE 802.16e Mobile WiMAX

    Directory of Open Access Journals (Sweden)

    Chakchai So-In

    2010-01-01

    Full Text Available We present a simple analytical method for capacity evaluation of IEEE 802.16e Mobile WiMAX networks. Various overheads that impact the capacity are explained and methods to reduce these overheads are also presented. The advantage of a simple model is that the effect of each decision and sensitivity to various parameters can be seen easily. We illustrate the model by estimating the capacity for three sample applications—Mobile TV, VoIP, and data. The analysis process helps explain various features of IEEE 802.16e Mobile WiMAX. It is shown that proper use of overhead reducing mechanisms and proper scheduling can make an order of magnitude difference in performance. This capacity evaluation method can also be used for validation of simulation models.

  5. Pentaatomic planar tetracoordinate silicon with 14 valence electrons: a large-scale global search of SiX(n)Y(m)(q) (n + m = 4; q = 0, ±1, -2; X, Y = main group elements from H to Br).

    Science.gov (United States)

    Xu, Jing; Ding, Yi-hong

    2015-03-05

    Designing and characterizing the compounds with exotic structures and bonding that seemingly contrast the traditional chemical rules are a never-ending goal. Although the silicon chemistry is dominated by the tetrahedral picture, many examples with the planar tetracoordinate-Si skeletons have been discovered, among which simple species usually contain the 17/18 valence electrons. In this work, we report hitherto the most extensive structural search for the pentaatomic ptSi with 14 valence electrons, that is, SiXnYm(q) (n + m = 4; q = 0, ±1, -2; X, Y = main group elements from H to Br). For 129 studied systems, 50 systems have the ptSi structure as the local minimum. Promisingly, nine systems, that is, Li3SiAs(2-), HSiY3 (Y = Al/Ga), Ca3SiAl(-), Mg4Si(2-), C2LiSi, Si3Y2 (Y = Li/Na/K), each have the global minimum ptSi. The former six systems represent the first prediction. Interestingly, in HSiY3 (Y = Al/Ga), the H-atom is only bonded to the ptSi-center via a localized 2c-2e σ bond. This sharply contradicts the known pentaatomic planar-centered systems, in which the ligands are actively involved in the ligand-ligand bonding besides being bonded to the planar center. Therefore, we proposed here that to generalize the 14e-ptSi, two strategies can be applied as (1) introducing the alkaline/alkaline-earth elements and (2) breaking the peripheral bonding. In light of the very limited global ptSi examples, the presently designed six systems with 14e are expected to enrich the exotic ptSi chemistry and welcome future laboratory confirmation. © 2014 Wiley Periodicals, Inc.

  6. An Application of Max Lusher's Theory of Colour Psychology in Forogh Farrokhzad's Poetry

    OpenAIRE

    M Alavi Moghaddam; S Poorshahram

    2010-01-01

    Colour is recognized as one of the criteria for personality analysis in modern psychology. Colours are a kind of energy and visible sounds which play an important role in one's life. Their influences on human's soul and mind are undeniable. In other words, colour can be considered as a reflection of one's mental and physical situation since colours have special influence on soul and body equally. Max Lusher's study of colours is among the most recent theories which deal with psychological ana...

  7. Design and Development of Basic Physical Layer WiMAX Network Simulation Models

    Science.gov (United States)

    2009-01-01

    Wide Web . The third software version was developed during the period of 22 August to 4 November, 2008. The software version developed during the...researched on the Web . The mathematics of some fundamental concepts such as Fourier transforms, convolutional coding techniques were also reviewed...Mathworks Matlab users’ website. A simulation model was found, entitled Estudio y Simulacion de la capa Jisica de la norma 802.16 ( Sistema WiMAX) developed

  8. Representing Sikhism: essays in memory of the Irish scholar Max Arthur Macauliffe

    OpenAIRE

    Shackle, Christopher; Bocking, Brian

    2017-01-01

    This is an introduction, by the guest editors, to the special issue of JISASR (Vol 4, 2017) entitled 'Representing Sikhism: Essays in Memory of the Irish Scholar Max Arthur Macauliffe'. The genesis of this special issue lies in pioneering work on Macauliffe's Irish identity and personal and scholarly life undertaken by Professor Tadhg Foley (Galway). The active interest and support of members of the Sikh community in Ireland led to a conference, hosted by the Study of Religions Department at ...

  9. Mini Max (T-864): a progress report on a disoriented chiral condensate search at the Tevatron

    International Nuclear Information System (INIS)

    Taylor, Cyrus

    1996-01-01

    Relativistic quantum field theory treats the vacuum as a medium with bulk properties characterized by long-range order parameters. This has led to suggestions that regions disoriented vacuum might be formed in high energy collision processes. The putative phenomenology of such 'Disoriented Chiral condensates'will be reviewed and used to motivate the design of Fermilab experiment T-864 (Mini Max). The status f the experiment at the time of writing is reviewed, as are prospects for future developments. (author)

  10. A comparison of VO2max and metabolic variables between treadmill running and treadmill skating.

    Science.gov (United States)

    Koepp, Kriston K; Janot, Jeffrey M

    2008-03-01

    The purpose of this study was to determine differences in VO2max and metabolic variables between treadmill running and treadmill skating. This study also examined VO2max responses during a continuous skating treadmill protocol and a discontinuous skating treadmill protocol. Sixteen male high school hockey players, who had a mean age of 16 +/- 1 years and were of an above-average fitness level, participated in this study. All subjects completed 4 exercise trials: a 1-hour skating treadmill familiarization trial, a treadmill running trial, and 2 randomized skating treadmill trials. Minute ventilation (VE), oxygen consumption VO2), carbon dioxide production VCO2), respiratory exchange ratio (RER), and heart rate were averaged every 15 seconds up to VO2max for each exercise test. The results showed that there was a significant difference (P skating treadmill protocol. There was also a significant difference for maximal RER between the discontinuous and continuous skating treadmill protocol and between the discontinuous skating treadmill protocol and running treadmill protocol. In conclusion, the running treadmill elicited a greater VO2max (mL.kg.min) than the skating treadmill did, but when it comes to specificity of ice skating, the skating treadmill may be ideal. Also, there was no significant difference between the discontinuous and continuous skating treadmill protocols. Therefore, a continuous protocol is possible on the skating treadmill without compromising correct skating position and physiologic responses. However, the continuous skating treadmill protocol should undergo validation before other scientists, coaches, and strength and conditioning professionals can apply it correctly.

  11. Max Uhle - Julio Tello: A political-academic controversy in the conformation of Peruvian archaeology

    OpenAIRE

    Alejandra Ramos

    2013-01-01

    Max Uhle (1856-1944) and Julio Tello (1880-1947) made prominent contributions to the development of Peruvian archaeology in the first half of the 20th century, coinciding at some points and differing in others. Their contrasting academic proposals were linked to political positions, which in turn impacted the way of imagining the development of Peruvian archaeology. The article analyzes how the interdependence in the characterizations of Uhle and Tello led to the formation of a mirrored logic...

  12. Validation of a ramp running protocol for determination of the true VO2max in mice

    Directory of Open Access Journals (Sweden)

    Mohamed Ayachi

    2016-08-01

    Full Text Available In the field of comparative physiology, it remains to be established whether the concept of VO2max is valid in the mouse and, if so, how this value can be accurately determined. In humans, VO2max is generally considered to correspond to the plateau observed when VO2 no longer rises with an increase in workload. In contrast, the concept of VO2peak tends to be used in murine studies. The objectives of the present study were to determine whether (i a continuous ramp protocol yielded a higher VO2peak than a stepwise, incremental protocol, and (ii the VO2peak measured in the ramp protocol corresponded to VO2max. The three protocols (based on intensity-controlled treadmill running until exhaustion with eight female FVB/N mice were performed in random order: (a an incremental protocol that begins at 10 m.min-1 speed and increases by 3 m.min-1 every 3 min. (b a ramp protocol with slow acceleration (3 m.min-2, and (c a ramp protocol with fast acceleration (12 m.min-2. Each protocol was performed with two slopes (0° and 25°. Hence, each mouse performed six exercise tests. We found that the value of VO2peak was protocol-dependent (p 8 mmol.l-1 and a respiratory exchange ratio >1. The total duration of the 3 m.min-2 0° ramp protocol was shorter than that of the incremental protocol. Taken as a whole, our results suggest that VO2max in the mouse is best determined by applying a ramp exercise protocol with slow acceleration and no treadmill slope.

  13. Simulated Lidar Images of Human Pose using a 3DS Max Virtual Laboratory

    Science.gov (United States)

    2015-12-01

    AFRL-RH-WP-TR-2015-0089 SIMULATED LIDAR IMAGES OF HUMAN POSE USING A 3DS MAX VIRTUAL LABORATORY Jeanne Smith Isiah Davenport Infoscitex Corp...MM-YYYY) 11-12-2015 2. REPORT TYPE Interim 3. DATES COVERED (From - To) March 2013 – April 2015 4. TITLE AND SUBTITLE Simulated LIDAR ...Cleared: 88ABW-2016-0242, 25 January 2016 Report contains color 14. ABSTRACT Large sets of 3D Simulated LIDAR (Light Detection and

  14. Adaptive Priority-Based Downlink Scheduling for WiMAX Networks

    OpenAIRE

    Wu, Shih-Jung; Huang, Shih-Yi; Huang, Kuo-Feng

    2012-01-01

    Supporting quality of service (QoS) guarantees for diverse multimedia services are the primary concerns for WiMAX (IEEE 802.16) networks. A scheduling scheme that satisfies QoS requirements has become more important for wireless communications. We propose a downlink scheduling scheme called adaptive priority-based downlink scheduling (APDS) for providing QoS guarantees in IEEE 802.16 networks. APDS comprises two major components: priority assignment and resource allocation. Different service-...

  15. Constrained Balancing of Two Industrial Rotor Systems: Least Squares and Min-Max Approaches

    Directory of Open Access Journals (Sweden)

    Bin Huang

    2009-01-01

    Full Text Available Rotor vibrations caused by rotor mass unbalance distributions are a major source of maintenance problems in high-speed rotating machinery. Minimizing this vibration by balancing under practical constraints is quite important to industry. This paper considers balancing of two large industrial rotor systems by constrained least squares and min-max balancing methods. In current industrial practice, the weighted least squares method has been utilized to minimize rotor vibrations for many years. One of its disadvantages is that it cannot guarantee that the maximum value of vibration is below a specified value. To achieve better balancing performance, the min-max balancing method utilizing the Second Order Cone Programming (SOCP with the maximum correction weight constraint, the maximum residual response constraint as well as the weight splitting constraint has been utilized for effective balancing. The min-max balancing method can guarantee a maximum residual vibration value below an optimum value and is shown by simulation to significantly outperform the weighted least squares method.

  16. Investigation of a new handover approach in LTE and WiMAX.

    Science.gov (United States)

    Hindia, Mohammad Nour; Reza, Ahmed Wasif; Noordin, Kamarul Ariffin

    2014-01-01

    Nowadays, one of the most important challenges in heterogeneous networks is the connection consistency between the mobile station and the base stations. Furthermore, along the roaming process between the mobile station and the base station, the system performance degrades significantly due to the interferences from neighboring base stations, handovers to inaccurate base station and inappropriate technology selection. In this paper, several algorithms are proposed to improve mobile station performance and seamless mobility across the long-term evolution (LTE) and Worldwide Interoperability for Microwave Access (WiMAX) technologies, along with a minimum number of redundant handovers. Firstly, the enhanced global positioning system (GPS) and the novel received signal strength (RSS) prediction approaches are suggested to predict the target base station accurately. Then, the multiple criteria with two thresholds algorithm is proposed to prioritize the selection between LTE and WiMAX as the target technology. In addition, this study also covers the intercell and cochannel interference reduction by adjusting the frequency reuse ratio 3 (FRR3) to work with LTE and WiMAX. The obtained results demonstrate high next base station prediction efficiency and high accuracy for both horizontal and vertical handovers. Moreover, the received signal strength is kept at levels higher than the threshold, while maintaining low connection cost and delay within acceptable levels. In order to highlight the combination of the proposed algorithms' performance, it is compared with the existing RSS and multiple criteria handover decision algorithms.

  17. WiMAX OFDM system simulation and sub-system FPGA implementation

    International Nuclear Information System (INIS)

    Elaskary, A.M.F.

    2009-01-01

    Orthogonal frequency division multiplexing (OFDM) has been used in many wireless communication systems also it is gaining a lot of attention for the next generations of mobile communication systems. OFDM is considered a good candidate for wireless systems because it has high bandwidth efficiency and can transmit at very high data rate in multi path, interference , and fading environment. in general OFDM has widely been studied and implemented to combat transmission channel impairments, but some challenges still facing OFDM in transmission system implementation especially for recent and future applications. One of these important applications is the worldwide interoperability for microwave access (WiMAX) system. According to the IEEE 802.16 standards, WiMAX is considered as a good solution for last mile connection at crowded areas and a high-speed internet connection to mobile vehicles with speed of up to 300 km/h. This thesis studies OFDM system in details and proposes simulink models for simulating OFDM impairments and its effects on system performance. This study has been used for building up system level and end to end WiMAX OFDM transmitter/receiver which follows published specifications in IEEE 802.16 standards using mat lab/simulink.

  18. Rectangular Ring Antenna Excited by Circular Disc Monopole for WiMAX System

    Directory of Open Access Journals (Sweden)

    Souphanna Vongsack

    2014-01-01

    Full Text Available This research presents a rectangular ring antenna excited by a circular disc monopole (CDM mounted in front of a square reflector. The proposed antenna is designed to cover a frequency range of 2.300–5.825 GHz and thereby is suitable for WiMAX applications. Multiple parametric studies were carried out using the CST Microwave Studio simulation program. A prototype antenna was fabricated and experimented. The measurements were taken and compared with the simulation results, which indicates good agreement between both results. The prototype antenna produces an impedance bandwidth (|S11| < −10 dB that covers the WiMAX frequency range and a constant unidirectional radiation pattern (θ=0° and ∅=90°. The minimum and maximum gains are 3.7 and 8.7 dBi, respectively. The proposed antenna is of compact size and has good unidirectional radiation performance. Thus, it is very suitable for a multitude of WiMAX applications.

  19. Proteomics Quality Control: Quality Control Software for MaxQuant Results.

    Science.gov (United States)

    Bielow, Chris; Mastrobuoni, Guido; Kempa, Stefan

    2016-03-04

    Mass spectrometry-based proteomics coupled to liquid chromatography has matured into an automatized, high-throughput technology, producing data on the scale of multiple gigabytes per instrument per day. Consequently, an automated quality control (QC) and quality analysis (QA) capable of detecting measurement bias, verifying consistency, and avoiding propagation of error is paramount for instrument operators and scientists in charge of downstream analysis. We have developed an R-based QC pipeline called Proteomics Quality Control (PTXQC) for bottom-up LC-MS data generated by the MaxQuant software pipeline. PTXQC creates a QC report containing a comprehensive and powerful set of QC metrics, augmented with automated scoring functions. The automated scores are collated to create an overview heatmap at the beginning of the report, giving valuable guidance also to nonspecialists. Our software supports a wide range of experimental designs, including stable isotope labeling by amino acids in cell culture (SILAC), tandem mass tags (TMT), and label-free data. Furthermore, we introduce new metrics to score MaxQuant's Match-between-runs (MBR) functionality by which peptide identifications can be transferred across Raw files based on accurate retention time and m/z. Last but not least, PTXQC is easy to install and use and represents the first QC software capable of processing MaxQuant result tables. PTXQC is freely available at https://github.com/cbielow/PTXQC .

  20. A linear programming approach to max-sum problem: a review.

    Science.gov (United States)

    Werner, Tomás

    2007-07-01

    The max-sum labeling problem, defined as maximizing a sum of binary (i.e., pairwise) functions of discrete variables, is a general NP-hard optimization problem with many applications, such as computing the MAP configuration of a Markov random field. We review a not widely known approach to the problem, developed by Ukrainian researchers Schlesinger et al. in 1976, and show how it contributes to recent results, most importantly, those on the convex combination of trees and tree-reweighted max-product. In particular, we review Schlesinger et al.'s upper bound on the max-sum criterion, its minimization by equivalent transformations, its relation to the constraint satisfaction problem, the fact that this minimization is dual to a linear programming relaxation of the original problem, and the three kinds of consistency necessary for optimality of the upper bound. We revisit problems with Boolean variables and supermodular problems. We describe two algorithms for decreasing the upper bound. We present an example application for structural image analysis.