Activity of flavonoids through λ sub max and electron cross-section
International Nuclear Information System (INIS)
Murthy, V.R.; Sreenivasulu, M.
1997-01-01
Flavonoids are widespread groups of natural constituents and present in the drugs in the form of mono or diglycosides. Being physiologically active, flavonoids are important in the field of pharmacological and clinical applications. Not many physical properties of flavonoids have been studied so far excepting UV and NMR studies. This paper deals with the evaluation of electron ionization cross section through λ sub max, a parameter available from UV studies. Electron ionization cross section was primarily conceived to be of use in radiation chemical data, mass spectroscopic and thermodynamic studies. But later attempts to correlate electron ionization cross-section with structural and related parameters prompted the authors to derive an explicit expression relating λ sub max and electron ionization cross-section (Q). The application of this method to correlate Q through λ sub max and interpret the results in terms of chemical activity are discussed
Electron-Cloud Build-up in the FNAL Main Injector
International Nuclear Information System (INIS)
Furman, M.A.
2007-01-01
We present a summary on ongoing simulation results for the electron-cloud buildup in the context of the proposed FNAL Main Injector (MI) intensity upgrade [1] in a fieldfree region at the location of the RFA electron detector [2]. By combining our simulated results for the electron flux at the vacuum chamber wall with the corresponding measurements obtained with the RFA we infer that the peak secondary electron yield (SEY) (delta) max is ∼> 1.4, and the average electron density is n e ∼> 10 10 m -3 at transition energy for the specific fill pattern and beam intensities defined below. The sensitivity of our results to several variables remains to be explored in order to reach more definitive results. Effects from the electron cloud on the beam are being investigated separately [3
Undulator physics and coherent harmonic generation at the MAX-lab electron storage ring
International Nuclear Information System (INIS)
Werin, Sverker.
1991-01-01
This work presents the undulator and harmonic generation project at the electron storage ring MAX-lab at University of Lund. The theory of undulator radiation, laser coherent harmonic generation, optical klystron amplifiers and FELs is treated in one uniform way, with complete solutions of the necessary equations. The permanent magnet undulator is described in some detail, along with the installation of the undulator in the storage ring. Details regarding the emitted radiation, the electron beam path in the undulator and other results are analysed. Finally harmonic generation using a Nd:YAG laser and the creation of coherent photons at the third harmonic (355 nm) is described. (author)
WiMax taking wireless to the max
Pareek, Deepak
2006-01-01
With market value expected to reach 5 billion by 2007 and the endorsement of some of the biggest names in telecommunications, World Interoperability for Microwave Access (WiMAX) is poised to change the broadband wireless landscape. But how much of WiMAX's touted potential is merely hype? Now that several pre-WiMAX networks have been deployed, what are the operators saying about QoS and ROI? How and when will device manufacturers integrate WiMAX into their products? What is the business case for using WiMAX rather than any number of other established wireless alternatives?WiMAX: Taking Wireless
New features of the MAX IV thermionic pre-injector
Energy Technology Data Exchange (ETDEWEB)
Andersson, J., E-mail: joel.andersson@maxiv.lu.se; Olsson, D., E-mail: david.olsson@maxiv.lu.se; Curbis, F.; Malmgren, L.; Werin, S.
2017-05-21
The MAX IV facility in Lund, Sweden consists of two storage rings for production of synchrotron radiation. The smaller 1.5 GeV ring is presently under construction, while the larger 3 GeV ring is being commissioned. Both rings will be operating with top-up injections from a full-energy injector. During injection, the electron beam is first delivered to the main injector from a thermionic pre-injector which consists of a thermionic RF gun, a chopper system, and an energy filter. In order to reduce losses of high-energy electrons along the injector and in the rings, the electron beam provided by the thermionic pre-injector should have the correct time structure and energy distribution. In this paper, the design of the MAX IV thermionic pre-injector with all its sub components is presented. The electron beam delivered by the pre-injector and its dependence on parameters such as optics, cathode temperature, and RF power are studied. Measurements are here compared with simulation results obtained by particle tracking and electromagnetic codes. The chopper system is described in detail, and different driving schemes that optimize the injection efficiency for the two storage rings are investigated. During operation, it was discovered that the structure of the beam delivered by the gun is affected by mode beating between the accelerating and a low-order mode. This mode beating is also studied in detail. Finally, initial measurements of the electron beam delivered to the 3 GeV ring during commissioning are presented.
Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.
Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H
2011-10-01
In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.
A short period undulator for MAX
International Nuclear Information System (INIS)
Ahola, H.; Meinander, T.
1992-01-01
A hybrid undulator for generation of high brilliance synchrotron radiation in the photon energy range of 60--600 eV at the 550 MeV electron storage ring MAX in Lund, Sweden has been designed and built at the Technical Research Centre of Finland in close collaboration with MAX-lab of Lund University. At the rather modest electron energy of MAX this photon energy range can be reached only by an undulator featuring a fairly short period and the smallest possible magnetic gap. Even then, higher harmonics (up to the 13th) of the radiation spectrum must be utilized. An optimization of the magnetic design resulted in a hybrid configuration of NdFeB magnets and soft iron poles with a period of 24 mm and a minimum magnetic gap of 7--10 mm. A variable-gap vacuum chamber allows reduction of the vacuum gap from a maximum of 20 mm, needed for injection, down to 6 mm during stored beam operation. A special design of this chamber permits a magnetic gap between pole tips that is only 1 mm larger than the vacuum gap. Adequate field uniformity was ensured by calibration of magnets to equal strength at their true operating point and verification of the homogeneity of their magnetization. Magnetic measurements included Hall probe scans of the undulator field and flip coil evaluations of the field integral
Min-Max Spaces and Complexity Reduction in Min-Max Expansions
Energy Technology Data Exchange (ETDEWEB)
Gaubert, Stephane, E-mail: Stephane.Gaubert@inria.fr [Ecole Polytechnique, INRIA and CMAP (France); McEneaney, William M., E-mail: wmceneaney@ucsd.edu [University of California San Diego, Dept. of Mech. and Aero. Eng. (United States)
2012-06-15
Idempotent methods have been found to be extremely helpful in the numerical solution of certain classes of nonlinear control problems. In those methods, one uses the fact that the value function lies in the space of semiconvex functions (in the case of maximizing controllers), and approximates this value using a truncated max-plus basis expansion. In some classes, the value function is actually convex, and then one specifically approximates with suprema (i.e., max-plus sums) of affine functions. Note that the space of convex functions is a max-plus linear space, or moduloid. In extending those concepts to game problems, one finds a different function space, and different algebra, to be appropriate. Here we consider functions which may be represented using infima (i.e., min-max sums) of max-plus affine functions. It is natural to refer to the class of functions so represented as the min-max linear space (or moduloid) of max-plus hypo-convex functions. We examine this space, the associated notion of duality and min-max basis expansions. In using these methods for solution of control problems, and now games, a critical step is complexity-reduction. In particular, one needs to find reduced-complexity expansions which approximate the function as well as possible. We obtain a solution to this complexity-reduction problem in the case of min-max expansions.
Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson
Jakobson, Max, 1923-2013
2002-01-01
President Rüütel andis Soome tuntud diplomaadile ja Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni (IKURK) esimehele Max Jakobsonile Maarjamaa Risti I klassi teenetemärgi. Tseremooniajärgne intervjuu Max Jakobsoniga
DEFF Research Database (Denmark)
Sanchez, Ron
2013-01-01
This chapter offers some reflections on Max Boisot and his extraordinary intellect drawn from our 15 years of exchanging and crafting ideas together. I first comment on the process of working with Max, and then suggest some of the remarkable qualities of thought that I believe distinguished Max's...... these qualities of thought are also reflected in Max's individual work and especially in his crowning achievement, the Information-Space Model....
Donovan, E.; Spanswick, E. L.; Chicoine, R.; Pugsley, J.; Langlois, P.
2011-12-01
AuroraMAX is a public outreach and education initiative that brings auroral images to the public in real time. AuroraMAX utilizes an observing station located just outside Yellowknife, Canada. The station houses a digital All-Sky Imager (ASI) that collects full-colour images of the night sky every six seconds. These images are then transmitted via satellite internet to our web server, where they are made instantly available to the public. Over the last two years this program has rapidly become one of the most successful outreach programs in the history of Space Science in Canada, with hundreds of thousands of distinct visitors to the CSA AuroraMAX website, thousands of followers on social media, and hundreds of newspaper, magazine, radio, and television spots. Over the next few years, the project will expand to include a high-resolution SLR delivering real-time auroral images (also from Yellowknife), as well as a program where astronauts on the ISS will take pictures of the aurora with a handheld SLR. The objectives of AuroraMAX are public outreach and education. The ASI design, operation, and software were based on infrastructure that was developed for the highly successful ASI component of the NASA THEMIS mission as well as the Canadian Space Agency (CSA) Canadian GeoSpace Monitoring (CGSM) program. So from an education and public outreach perspective, AuroraMAX is a single camera operating in the Canadian north. On the other hand, AuroraMAX is one of nearly 40 All-Sky Imagers that are operating across North America. The AuroraMAX camera produces data that is seamlessly integrated with the CGSM ASI data, and made widely available to the Space Science community through open-access web and FTP sites. One of our objectives in the next few years is to incorporate some of the data from the THEMIS and CGSM imagers into the AuroraMAX system, to maximize viewing opportunities and generate more real-time data for public outreach. This is an exemplar of a program that
Novel Approaches to Enhance Mobile WiMAX Security
Directory of Open Access Journals (Sweden)
Taeshik Shon
2010-01-01
Full Text Available The IEEE 802.16 Working Group on Broadband Wireless Access Standards released IEEE 802.16-2004 which is a standardized technology for supporting broadband and wireless communication with fixed and nomadic access. After the IEEE 802.16-2004 standard, a new advanced and revised standard was released as the IEEE 802.16e-2005 amendment which is foundation of Mobile WiMAX network supporting handover and roaming capabilities. In the area of security aspects, compared to IEEE 802.16-2004, IEEE 802.16e, called Mobile WiMAX, adopts improved security architecture—PKMv2 which includes EAP authentication, AES-based authenticated encryption, and CMAC or HMAC message protection. However, there is no guarantee that PKMv2-based Mobile WiMAX network will not have security flaws. In this paper, we investigate the current Mobile WiMAX security architecture focusing mainly on pointing out new security vulnerabilities such as a disclosure of security context in network entry, a lack of secure communication in network domain, and a necessity of efficient handover supporting mutual authentication. Based on the investigation results, we propose a novel Mobile WiMAX security architecture, called RObust and Secure MobilE WiMAX (ROSMEX, to prevent the new security vulnerabilities.
Beyond NextGen: AutoMax Overview and Update
Kopardekar, Parimal; Alexandrov, Natalia
2013-01-01
Main Message: National and Global Needs - Develop scalable airspace operations management system to accommodate increased mobility needs, emerging airspace uses, mix, future demand. Be affordable and economically viable. Sense of Urgency. Saturation (delays), emerging airspace uses, proactive development. Autonomy is Needed for Airspace Operations to Meet Future Needs. Costs, time critical decisions, mobility, scalability, limits of cognitive workload. AutoMax to Accommodate National and Global Needs. Auto: Automation, autonomy, autonomicity for airspace operations. Max: Maximizing performance of the National Airspace System. Interesting Challenges and Path Forward.
International Nuclear Information System (INIS)
Preston, M.F.; Myers, L.S.; Annand, J.R.M.; Fissum, K.G.; Hansen, K.; Isaksson, L.; Jebali, R.; Lundin, M.
2014-01-01
Rate-dependent effects in the electronics used to instrument the tagger focal plane at the MAX IV Laboratory were recently investigated using the novel approach of Monte Carlo simulation to allow for normalization of high-rate experimental data acquired with single-hit time-to-digital converters (TDCs). The instrumentation of the tagger focal plane has now been expanded to include multi-hit TDCs. The agreement between results obtained from data taken using single-hit and multi-hit TDCs demonstrate a thorough understanding of the behavior of the detector system
Energy Technology Data Exchange (ETDEWEB)
Preston, M.F. [Lund University, SE-221 00 Lund (Sweden); Myers, L.S. [Duke University, Durham, NC 27708 (United States); Annand, J.R.M. [University of Glasgow, Glasgow G12 8QQ, Scotland (United Kingdom); Fissum, K.G., E-mail: kevin.fissum@nuclear.lu.se [Lund University, SE-221 00 Lund (Sweden); Hansen, K.; Isaksson, L. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Jebali, R. [Arktis Radiation Detectors Limited, 8045 Zürich (Switzerland); Lundin, M. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden)
2014-04-21
Rate-dependent effects in the electronics used to instrument the tagger focal plane at the MAX IV Laboratory were recently investigated using the novel approach of Monte Carlo simulation to allow for normalization of high-rate experimental data acquired with single-hit time-to-digital converters (TDCs). The instrumentation of the tagger focal plane has now been expanded to include multi-hit TDCs. The agreement between results obtained from data taken using single-hit and multi-hit TDCs demonstrate a thorough understanding of the behavior of the detector system.
Electron Cloud Measurements in Fermilab Main Injector and Recycler
Energy Technology Data Exchange (ETDEWEB)
Eldred, Jeffrey Scott [Indiana U.; Backfish, M. [Fermilab; Tan, C. Y. [Fermilab; Zwaska, R. [Fermilab
2015-06-01
This conference paper presents a series of electron cloud measurements in the Fermilab Main Injector and Recycler. A new instability was observed in the Recycler in July 2014 that generates a fast transverse excitation in the first high intensity batch to be injected. Microwave measurements of electron cloud in the Recycler show a corresponding depen- dence on the batch injection pattern. These electron cloud measurements are compared to those made with a retard- ing field analyzer (RFA) installed in a field-free region of the Recycler in November. RFAs are also used in the Main Injector to evaluate the performance of beampipe coatings for the mitigation of electron cloud. Contamination from an unexpected vacuum leak revealed a potential vulnerability in the amorphous carbon beampipe coating. The diamond-like carbon coating, in contrast, reduced the electron cloud signal to 1% of that measured in uncoated stainless steel beampipe.
Human mitochondrial haplogroup H: the highest VO2max consumer--is it a paradox?
Martínez-Redondo, Diana; Marcuello, Ana; Casajús, José A; Ara, Ignacio; Dahmani, Yahya; Montoya, Julio; Ruiz-Pesini, Eduardo; López-Pérez, Manuel J; Díez-Sánchez, Carmen
2010-03-01
Mitochondrial background has been demonstrated to influence maximal oxygen uptake (VO(2max), in mLkg(-1)min(-1)), but this genetic influence can be compensated for by regular exercise. A positive correlation among electron transport chain (ETC) coupling, ATP and reactive oxygen species (ROS) production has been established, and mitochondrial variants have been reported to show differences in their ETC performance. In this study, we examined in detail the VO(2max) differences found among mitochondrial haplogroups. We recruited 81 healthy male Spanish Caucasian individuals and determined their mitochondrial haplogroup. Their VO(2max) was determined using incremental cycling exercise (ICE). VO(2max) was lower in J than in non-J haplogroup individuals (P=0.04). The H haplogroup was responsible for this difference (VO(2max); J vs. H; P=0.008) and this group also had significantly higher mitochondrial oxidative damage (mtOD) than the J haplogroup (P=0.04). In agreement with these results, VO(2max) and mtOD were positively correlated (P=0.01). Given that ROS production is the major contributor to mtOD and consumes four times more oxygen per electron than the ETC, our results strongly suggest that ROS production is responsible for the higher VO(2max) found in the H variant. These findings not only contribute to a better understanding of the mechanisms underneath VO(2max), but also help to explain some reported associations between mitochondrial haplogroups and mtOD with longevity, sperm motility, premature aging and susceptibility to different pathologies.
PENGEMBANGAN PERSAMAAN VO2 MAX DAN EVALUASI HR MAX (STUDI AWAL PADA PEKERJA PRIA
Directory of Open Access Journals (Sweden)
Purnawan Adi Wicaksono
2012-10-01
Full Text Available Kapasitas fisik maksimum seseorang direpresentasikan dengan nilai konsumsi oksigen maksimum (VO2 Max dan denyut nadi maksimum (HR Max yang memberikan suatu informasi batasan kemampuan fisik maksimum seseorang dalam melakukan pekerjaan. Penelitian kali ini mempunyai tujuan untuk mencari nilai VO2 Max pekerja pria Indonesia untuk nantinya akan dikembangkan suatu persamaan prediksi VO2 Max yang didekati dengan hubungan linier antara denyut nadi (Heart Rate seperti yang dilakukan Astrand (2003, tinggi badan (Chatterjee et al, 2006, berat badan (Akalan et al, 2008, usia (Magrani et al, 2009 dan mengevaluasi persamaan HR Max manakah yang dapat diaplikasikan untuk mendekati nilai denyut nadi maksimum pekerja Indonesia. Responden dalam penelitian kali ini adalah 12 pekerja industri pria yang diambil dari beberapa industri di Depok dan sekitarnya. Kriteria responden yang berpartisipasi dalam penelitian kali ini adalah: berusia 20-40 tahun, bukan perokok baik aktif maupun pasif, sehat , tidak mengkonsumsi makanan, kafein, alkohol minimal 2 jam sebelum eksperimen (Balderrama et. al, 2007.Eksperimen yang dilakukan menggunakan metode maximal test dengan protokol treadmill. Adapun peralatan yang digunakan adalah seperangkat alat pengukur kondisi fisiologi Fitmate MED (COSMED srl-Italy terdiri dari Heart Rate Transmitter, Heart Rate Receiver, V mask (Hans Rudolph Inc,dan treadmill SportArt@60. Eksperimen dilakukan menjadi dua bagian, yaitu istirahat dan tahap bekerja.Aktivitas istirahat terdiri dari tidur selama 20 menit, duduk selama 20 menit dan berdiri selama 10 menit. Eksperimen tahap kedua yaitu tahap kerja yang terdiri dari latihan selama 5 menit. Responden dipersilakan beristirahat selama 15 menit, setelah itu responden melaksanakan maximal test detik hingga responden merasa tidak sanggup lagi melanjutkan eksperimen. Hasil penelitian model prediksi VO2 max untuk pekerja industri pria mempunyai nilai 2,78 ± 0,5 liter/menit dan dengan regresi linier
Electron Cloud Parameterization Studies in the LHC
Dominguez, O; Baglin, V; Bregliozzi, G; Jimenez, J M; Metral, E; Rumolo, G; Schulte, D; Zimmermann, F
2011-01-01
During LHC beam commissioning with 150, 75 and 50-ns bunch spacing, important electron-cloud effects, like pressure rise, cryogenic heat load, beam instabilities or emittance growth, were observed. The main strategy to combat the LHC electron cloud, defined about ten years ago, relies on the surface conditioning arising from the chamber-surface bombardment with cloud electrons. In a standard model, the conditioning state of the beam-pipe surface is characterized by three parameters: 1. most importantly, the secondary emission yield δmax; 2. the incident electron energy at which the yield is maximum, ε_max; and 3. the probability of elastic reflection of low-energy primary electrons hitting the chamber wall, R. Since at the LHC no in-situ secondary-yield measurements are available, we compare the relative local pressure-rise measurements taken for different beam configurations against simulations in which surface parameters are scanned. This benchmarking of measurements and simulations is used to infer the s...
Main Issues on Electronic Commerce and Policy Recommendations
Chongwha Lee; Seongbong Lee
1998-01-01
"Electronic Commerce" means that people sell and buy commodity, labor service and information through internet and now is mainly be used in commercial intercourse. The core of the international research related to Electronic Commerce is a tax-exemption, land tax, liberalization of encrypted technology and privacy protection policy, etc. Meanwhile, intellectual property, consumer protection and limitation of packing specification are also researched together with the business activeness. The r...
Analysis list: Max [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Max Blood,Muscle,Pluripotent stem cell + mm9 http://dbarchive.biosciencedbc.jp/kyus...hu-u/mm9/target/Max.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Max.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/target/Max.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Blood....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Muscle.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Max.Pluripotent_stem_cell.tsv http://dbarchive.biosciencedbc.jp/k
Toughening Mechanisms in Nanolayered MAX Phase Ceramics—A Review
Directory of Open Access Journals (Sweden)
Xinhua Chen
2017-03-01
Full Text Available Advanced engineering and functional ceramics are sensitive to damage cracks, which delay the wide applications of these materials in various fields. Ceramic composites with enhanced fracture toughness may trigger a paradigm for design and application of the brittle components. This paper reviews the toughening mechanisms for the nanolayered MAX phase ceramics. The main toughening mechanisms for these ternary compounds were controlled by particle toughening, phase-transformation toughening and fiber-reinforced toughening, as well as texture toughening. Based on the various toughening mechanisms in MAX phase, models of SiC particles and fibers toughening Ti3SiC2 are established to predict and explain the toughening mechanisms. The modeling work provides insights and guidance to fabricate MAX phase-related composites with optimized microstructures in order to achieve the desired mechanical properties required for harsh application environments.
Max Algebraic Complementary Basic Matrices
Czech Academy of Sciences Publication Activity Database
Fiedler, Miroslav; Hall, F.J.
2014-01-01
Roč. 457, 15 September (2014), s. 287-292 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : CB-matrix * Max algebra * Max permanent * Max eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014
2012-03-12
... DEPARTMENT OF COMMERCE International Trade Administration Max Planck Florida Institute, et al.; Notice of Consolidated Decision on Applications for Duty-Free Entry of Electron Microscope This is a... Constitution Avenue NW., Washington, DC. Docket Number: 11-061. Applicant: Max Planck Florida Institute...
Directory of Open Access Journals (Sweden)
K. T. Karthikeyan
2017-11-01
Full Text Available Vertically aligned carbon nanotubes have been synthesized by spray pyrolysis from Glycine max oil on silicon substrate using ferrocene as catalyst at 650 °C. Glycine max oil, a plant-based hydrocarbon precursor was used as a source of carbon and argon as a carrier gas. The as-grown vertically aligned carbon nanotubes were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, X-ray diffraction, thermogravimetric analysis, and Raman spectroscopy. Scanning electron microscopic images reveal that the dense bundles of aligned carbon nanotubes. High resolution transmission electron microscopy and Raman spectroscopy observations indicate that as-grown aligned carbon nanotubes are well graphitized.
Murdock, Kelly L
2011-01-01
Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav
Energy Technology Data Exchange (ETDEWEB)
Shein, I.R. [Institute of Solid State Chemistry, Ural Branch of the Russian Academy of Sciences, Ekaterinburg 620990 (Russian Federation); Ivanovskii, A.L., E-mail: ivanovskii@ihim.uran.ru [Institute of Solid State Chemistry, Ural Branch of the Russian Academy of Sciences, Ekaterinburg 620990 (Russian Federation)
2013-02-01
Very recently (2012, Phys. Rev Lett., 109, 035502) a new hexagonal (s.g. P63/mmc, Music-Sharp-Sign 194) ternary phase Nb{sub 2}GeC, which belongs to so-called 211-like MAX phases, was discovered. In order to get a systematic insight into the structural, elastic, and electronic properties of Nb{sub 2}GeC, we used two complementary DFT-based first-principles approaches (as implemented in the VASP and Wien2k packages) to calculate the optimized structural parameters, band structure, densities of state, Fermi surface, and a set of elastic parameters: elastic constants (C{sub ij}), bulk modulus (B), compressibility ({beta}), shear modulus (G), Young's modulus (Y), and elastic anisotropy indexes, which were discussed in comparison with available data. Besides, the inter-atomic bonding picture for Nb{sub 2}GeC was discussed using electron density maps and Bader's charge analysis.
Main Issues on Electronic Commerce and Policy Recommendations
Directory of Open Access Journals (Sweden)
Chongwha Lee
1998-03-01
Full Text Available "Electronic Commerce" means that people sell and buy commodity, labor service and information through internet and now is mainly be used in commercial intercourse. The core of the international research related to Electronic Commerce is a tax-exemption, land tax, liberalization of encrypted technology and privacy protection policy, etc. Meanwhile, intellectual property, consumer protection and limitation of packing specification are also researched together with the business activeness. The reason why questions related to Electronic Commerce are in the back of the spotlight is that US and major countries in EU lead the international research to maximize their own benefits. These researches are related to rectify legal system framework for protecting development of Electronic Commerce and to work out international standards. Also, enlarging Electronic Commerce on online resources is also regarded as the core issue by OECD, APEC and other international organization and it is inevitable to have multilateral negotiation regarding this issue. Based on the opinion above mentioned, we collect all the problems brought by Electronic Commerce Activeness in each area in this paper and try to find out corresponding solutions to face these problems.
Origin of the main deep electron trap in electron irradiated InP
International Nuclear Information System (INIS)
Sibille, A.
1986-01-01
The electrical activity and annealing behavior of the main electron trap in electron irradiated InP p + n junctions has been investigated. A very marked depth dependence of the annealing rate has been found. Moreover, this center apparently acts as if it were a deep donor, leading to an increase of carrier concentration on the n side. All these results are coherently interpreted with a model in terms of radiation defect D(P) (phosphorus interstitial or vacancy), residual shallow acceptor complexing, the final annealing resulting from a dissociation of the complex followed by a diffusion and either recapture or annihilation of D(P)
A min-max variational principle
International Nuclear Information System (INIS)
Georgiev, P.G.
1995-11-01
In this paper a variational principle for min-max problems is proved that is of the same spirit as Deville-Godefroy-Zizler's variational principle for minimization problems. A localization theorem in which the mini-max points for the perturbed function with respect top a given ε-min-max point are localized is presented. 3 refs
Microstructure and Oxidation of a MAX Phase/Superalloy Hybrid Interface
Smialek, James L.; Garg, Anita
2014-01-01
Corrosion resistant, strain tolerant MAX phase coatings are of interest for turbine applications. Thin Cr2AlC MAX phase wafers were vacuum diffusion bonded to an advanced turbine disk alloy, LSHR, at 1100 C. The interface, examined by optical and scanning electron microscopy, revealed a primary diffusion zone consisting of 10 micrometers of beta-Ni(Co)Al, decorated with various NiCoCrAl, MC and M3B2 precipitates. On the Cr2AlC side, an additional 40 micrometers Al-depletion zone of Cr7C3 formed in an interconnected network with the beta-Ni(Co)Al. Oxidation of an exposed edge at 800 C for 100 h produced a fine-grained lenticular alumina scale over Cr2AlC and beta-Ni(Co)Al, with coarser chromia granules over the Cr7C3 regions. Subsequent growth of the diffusion layers was only 5 micrometers in total. A residual stress of 500 MPa was estimated for the MAX phase layer, but no interfacial damage was observed. Subsequent tests for 1000 h reveal similar results.
MAX-DOAS measurements of NO2 column densities in Vienna
Schreier, Stefan; Weihs, Philipp; Peters, Enno; Richter, Andreas; Ostendorf, Mareike; Schönhardt, Anja; Burrows, John P.; Schmalwieser, Alois
2017-04-01
In the VINDOBONA (VIenna horizontal aNd vertical Distribution OBservations Of Nitrogen dioxide and Aerosols) project, two Multi AXis Differential Optical Absorption Spectroscopy (MAX-DOAS) systems will be set up at two different locations and altitudes in Vienna, Austria. After comparison measurements in Bremen, Germany, and Cabauw, The Netherlands, the first of the two MAX-DOAS instruments was set up at the University of Veterinary Medicine in the northeastern part of Vienna in December 2016. The instrument performs spectral measurements of visible scattered sunlight at defined horizontal and vertical viewing directions. From these measurements, column densities of NO2 and aerosols are derived by applying the DOAS analysis. First preliminary results are presented. The second MAX-DOAS instrument will be set up in April/May 2017 at the University of Natural Resources and Life Sciences in the northwestern part of Vienna. Once these two instruments are measuring simultaneously, small campaigns including car DOAS zenith-sky and tower DOAS off-axis measurements are planned. The main emphasis of this project will be on the installation and operation of two MAX-DOAS instruments, the improvement of tropospheric NO2 and aerosol retrieval, and the characterization of the horizontal, vertical, and temporal variations of tropospheric NO2 and aerosols in Vienna, Austria.
Mastering Autodesk 3ds Max 2013
Harper, Jeffrey
2012-01-01
Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides
Sensor development at the semiconductor laboratory of the Max-Planck-Society
Bähr, A.; Lechner, P.; Ninkovic, J.
2017-12-01
For more than twenty years the semiconductor laboratory of the Max-Planck Society (MPG-HLL) is developing high-performing, specialised, scientific silicon sensors including the integration of amplifying electronics on the sensor chip. This paper summarises the actual status of these devices like pnCCDs and DePFET Active Pixel Sensors and their applications.
Serang, Oliver
2015-08-01
Observations depending on sums of random variables are common throughout many fields; however, no efficient solution is currently known for performing max-product inference on these sums of general discrete distributions (max-product inference can be used to obtain maximum a posteriori estimates). The limiting step to max-product inference is the max-convolution problem (sometimes presented in log-transformed form and denoted as "infimal convolution," "min-convolution," or "convolution on the tropical semiring"), for which no O(k log(k)) method is currently known. Presented here is an O(k log(k)) numerical method for estimating the max-convolution of two nonnegative vectors (e.g., two probability mass functions), where k is the length of the larger vector. This numerical max-convolution method is then demonstrated by performing fast max-product inference on a convolution tree, a data structure for performing fast inference given information on the sum of n discrete random variables in O(nk log(nk)log(n)) steps (where each random variable has an arbitrary prior distribution on k contiguous possible states). The numerical max-convolution method can be applied to specialized classes of hidden Markov models to reduce the runtime of computing the Viterbi path from nk(2) to nk log(k), and has potential application to the all-pairs shortest paths problem.
Eight-component retrievals from ground-based MAX-DOAS observations
Directory of Open Access Journals (Sweden)
H. Irie
2011-06-01
Full Text Available We attempt for the first time to retrieve lower-tropospheric vertical profile information for 8 quantities from ground-based Multi-Axis Differential Optical Absorption Spectroscopy (MAX-DOAS observations. The components retrieved are the aerosol extinction coefficients at two wavelengths, 357 and 476 nm, and NO2, HCHO, CHOCHO, H2O, SO2, and O3 volume mixing ratios. A Japanese MAX-DOAS profile retrieval algorithm, version 1 (JM1, is applied to observations performed at Cabauw, the Netherlands (51.97° N, 4.93° E, in June–July 2009 during the Cabauw Intercomparison campaign of Nitrogen Dioxide measuring Instruments (CINDI. Of the retrieved profiles, we focus here on the lowest-layer data (mean values at altitudes 0–1 km, where the sensitivity is usually highest owing to the longest light path. In support of the capability of the multi-component retrievals, we find reasonable overall agreement with independent data sets, including a regional chemical transport model (CHIMERE and in situ observations performed near the surface (2–3 m and at the 200-m height level of the tall tower in Cabauw. Plumes of enhanced HCHO and SO2 were likely affected by biogenic and ship emissions, respectively, and an improvement in their emission strengths is suggested for better agreement between CHIMERE simulations and MAX-DOAS observations. Analysis of air mass factors indicates that the horizontal spatial representativeness of MAX-DOAS observations is about 3–15 km (depending mainly on aerosol extinction, comparable to or better than the spatial resolution of current UV-visible satellite observations and model calculations. These demonstrate that MAX-DOAS provides multi-component data useful for the evaluation of satellite observations and model calculations and can play an important role in bridging different data sets having different spatial resolutions.
Tukey max-stable processes for spatial extremes
Xu, Ganggang; Genton, Marc G.
2016-01-01
We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max
Validation of masks for determination of V̇O2 max in horses exercising at high intensity.
Sides, R H; Kirkpatrick, R; Renner, E; Gough, K; Katz, L M; Evans, D L; Bayly, W M
2018-01-01
The need for a horse to be ridden while wearing a measurement device that allows unrestricted ventilation and gas exchange has hampered accurate measurement of its maximal oxygen consumption (V̇O 2 max) under field conditions. Design and validate a facemask with the potential to measure V̇O 2 max accurately in the field. Experiment with 6 × 6 Latin square design. Two variations of a mask and associated electronic control module (ECM) were designed to enable breath-by-breath measurement of airflows through two 7.8 cm diameter pneumotachometers located 7.5 cm in front of each narus. The ECM was comprised of an analogue-to-digital converter and a lithium-ion battery that provided power and signal filtering to the pneumotachometers and an oxygen sensing cell, and powered a pump connected to gas sampling ports between the nares and pneumotachometers. Airflow and oxygen content of inspired and expired gases were recorded through the ECM and electronically transferred to a notebook. V̇O 2 was determined from these recordings using a customised software program. Mask B encased the lower jaw. Mask R left the jaw free so the horse could wear a bit if ridden. V̇O 2 max and arterial blood gases were measured in 6 horses during multiple treadmill tests. Each mask was worn twice and results compared to those from an established open flow-through system (O) by ANOVA-RM (Pmasks. V̇O 2 max measures were reproducible for each mask. Intraclass correlation coefficient between raters = 0.99. Some rebreathing of expired air from mask dead space. Masks capable of measuring V̇O 2 max during treadmill exercise were developed, tested and found to be accurate. Mask R has potential application to measurement of V̇O 2 max under field conditions. © 2017 EVJ Ltd.
Cui, Shawn X.; Freedman, Michael H.; Sattath, Or; Stong, Richard; Minton, Greg
2016-06-01
The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.
Energy Technology Data Exchange (ETDEWEB)
Cui, Shawn X., E-mail: xingshan@math.ucsb.edu [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Quantum Architectures and Computation Group, Microsoft Research, Redmond, Washington 98052 (United States); Freedman, Michael H., E-mail: michaelf@microsoft.com [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Microsoft Research, Station Q, University of California, Santa Barbara, California 93106 (United States); Sattath, Or, E-mail: sattath@gmail.com [Computer Science Division, University of California, Berkeley, California 94720 (United States); Stong, Richard, E-mail: stong@ccrwest.org; Minton, Greg, E-mail: gtminto@ccrwest.org [Center for Communications Research, La Jolla, California 92121 (United States)
2016-06-15
The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.
Ford C-Max plug-in hybrid; Ford C-Max mit Plug-in-Hybridtechnik
Energy Technology Data Exchange (ETDEWEB)
Schamel, Andreas; D' Annunzio, Julie; Iorio, Rob [Ford Motor Company, Dearborn, MI (United States); Schmitz, Peter [Ford-Forschungszentrum Aachen GmbH, Aachen (Germany)
2013-03-01
Ford provides consumers a broad choice of electrified vehicles globally, including full hybrids, plug-in hybrids and all-electric vehicles. The all-new 2013 model year C-Max Energi Plug-in Hybrid utilises the third generation of Ford hybrid technology. This article discusses the hybrid powersplit architecture and components, as well as the charging capability and human-machine interfaces, used in the C-Max Energi Plug-In Hybrid. (orig.)
New Electron Cloud Detectors for the PS Main Magnets
Yin Vallgren, Ch; Gilardoni, S; Taborelli, M; Neupert, H; Ferreira Somoza, J
2014-01-01
Electron cloud (EC) has already been observed during normal operation of the PS, therefore it is necessary to study its in fluence on any beam instability for the future LHC Injector Upgrade (LIU). Two new electron cloud detectors have been discussed, developed and installed during the Long Shutdown (LS1) in one of the PS main magnets. The first measurement method is based on current measurement by using a shielded button-type pick-up. Due to the geometry and space limitation in the PS magnet, the button-type pick-up made of a 96%Al2O3 block coated with a thin layer of solvent-based Ag painting, placed 30 degrees to the bottom part of the vacuum chamber was installed in the horizontal direction where the only opening of the magnet coil is. The other newly developed measurement method is based on detection of photons emitted by the electrons from the electron cloud impinging on the vacuum chamber walls. The emitted photons are reected to a quartz window. A MCP-PMT (Micro-Channel Plate Photomultiplier Tube) wit...
Max dD/Dt: A Novel Parameter to Assess Fetal Cardiac Contractility and a Substitute for Max dP/Dt.
Fujita, Yasuyuki; Kiyokoba, Ryo; Yumoto, Yasuo; Kato, Kiyoko
2018-07-01
Aortic pulse waveforms are composed of a forward wave from the heart and a reflection wave from the periphery. We focused on this forward wave and suggested a new parameter, the maximum slope of aortic pulse waveforms (max dD/dt), for fetal cardiac contractility. Max dD/dt was calculated from fetal aortic pulse waveforms recorded with an echo-tracking system. A normal range of max dD/dt was constructed in 105 healthy fetuses using linear regression analysis. Twenty-two fetuses with suspected fetal cardiac dysfunction were divided into normal and decreased max dD/dt groups, and their clinical parameters were compared. Max dD/dt of aortic pulse waveforms increased linearly with advancing gestational age (r = 0.93). The decreased max dD/dt was associated with abnormal cardiotocography findings and short- and long-term prognosis. In conclusion, max dD/dt calculated from the aortic pulse waveforms in fetuses can substitute for max dP/dt, an index of cardiac contractility in adults. Copyright © 2018 World Federation for Ultrasound in Medicine and Biology. Published by Elsevier Inc. All rights reserved.
Examination of returned solar-max surfaces for impacting orbital debris and meteoroids
Kessler, D. J.; Zook, H. A.; Potter, A. E.; Mckay, D. S.; Clanton, U. S.; Warren, J. L.; Watts, L. A.; Schultz, R. A.; Schramm, L. S.; Wentworth, S. J.
1985-01-01
Previous theoretical studies predicted that in certain regions of earth orbit, the man-made earth orbiting debris environment will soon exceed the interplanetary meteoroid environment for sizes smaller than 1 cm. The surfaces returned from the repaired Solar Max Mission (SMM) by STS 41-C on April 12, 1984, offered an excellent opportunity to examine both the debris and meteoroid environments. To date, approximately 0.7 sq. met. of the thermal insulation and 0.05 sq. met of the aluminum louvers have been mapped by optical microscope for crater diameters larger than 40 microns. Craters larger in diameter than about 100 microns found on the initial 75 micron thick Kapton first sheet on the MEB (Main Electronics Box) blanket are actually holes and constitute perforations through that blanket. The following populations have been found to date in impact sites on these blankets: (1) meteoritic material; (2) thermal paint particles; (3) aluminum droplets; and (4) waste particles.
WiMax network planning and optimization
Zhang, Yan
2009-01-01
This book offers a comprehensive explanation on how to dimension, plan, and optimize WiMAX networks. The first part of the text introduces WiMAX networks architecture, physical layer, standard, protocols, security mechanisms, and highly related radio access technologies. It covers system framework, topology, capacity, mobility management, handoff management, congestion control, medium access control (MAC), scheduling, Quality of Service (QoS), and WiMAX mesh networks and security. Enabling easy understanding of key concepts and technologies, the second part presents practical examples and illu
Tukey max-stable processes for spatial extremes
Xu, Ganggang
2016-09-21
We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max-stable process are demonstrated theoretically and numerically. Simulation studies and an application to Swiss rainfall data indicate the effectiveness of the proposed process. © 2016 Elsevier B.V.
Computation of electron cloud diagnostics and mitigation in the main injector
International Nuclear Information System (INIS)
Veitzer, S A; Cary, J R; Stoltz, P H; LeBrun, P; Spentzouris, P; Amundson, J F
2009-01-01
High-performance computations on Blue Gene/P at Argonne's Leadership Computing Facility have been used to determine phase shifts induced in injected RF diagnostics as a function of electron cloud density in the Main Injector. Inversion of the relationship between electron cloud parameters and induced phase shifts allows us to predict electron cloud density and evolution over many bunch periods. Long time-scale simulations using Blue Gene have allowed us to measure cloud evolution patterns under the influence of beam propagation with realistic physical parameterizations, such as elliptical beam pipe geometry, self-consistent electromagnetic fields, space charge, secondary electron emission, and the application of arbitrary external magnetic fields. Simultaneously, we are able to simulate the use of injected microwave diagnostic signals to measure electron cloud density, and the effectiveness of various mitigation techniques such as surface coating and the application of confining magnetic fields. These simulations provide a baseline for both RF electron cloud diagnostic design and accelerator fabrication in order to measure electron clouds and mitigate the adverse effects of such clouds on beam propagation.
Approximation by max-product type operators
Bede, Barnabás; Gal, Sorin G
2016-01-01
This monograph presents a broad treatment of developments in an area of constructive approximation involving the so-called "max-product" type operators. The exposition highlights the max-product operators as those which allow one to obtain, in many cases, more valuable estimates than those obtained by classical approaches. The text considers a wide variety of operators which are studied for a number of interesting problems such as quantitative estimates, convergence, saturation results, localization, to name several. Additionally, the book discusses the perfect analogies between the probabilistic approaches of the classical Bernstein type operators and of the classical convolution operators (non-periodic and periodic cases), and the possibilistic approaches of the max-product variants of these operators. These approaches allow for two natural interpretations of the max-product Bernstein type operators and convolution type operators: firstly, as possibilistic expectations of some fuzzy variables, and secondly,...
Li, Weiqiang; Nguyen, Kien Huu; Watanabe, Yasuko; Yamaguchi, Shinjiro; Tran, Lam-Son Phan
2016-09-16
Previous studies in Arabidopsis reported that the MAX2 (more axillary growth 2) gene is a component of the strigolactone (SL) signaling pathway, which regulates a wide range of biological processes, from plant growth and development to environmental stress responses. Orobanche aegyptiaca is a harmful parasitic plant for many economically important crops. Seed germination of O. aegyptiaca is very sensitive to SLs, suggesting that O. aegyptiaca may contain components of the SL signaling pathway. To investigate this hypothesis, we identified and cloned a MAX2 ortholog from O. aegyptiaca for complementation analyses using the Arabidopsis Atmax2 mutant. The so-called OaMAX2 gene could rescue phenotypes of the Atmax2 mutant in various tested developmental aspects, including seed germination, shoot branching, leaf senescence and growth and development of hypocotyl, root hair, primary root and lateral root. More importantly, OaMAX2 could enhance the drought tolerance of Atmax2 mutant, suggesting its ability to restore the drought-tolerant phenotype of mutant plants defected in AtMAX2 function. Thus, this study provides genetic evidence that the functions of the MAX2 orthologs, and perhaps the MAX2 signaling pathways, are conserved in parasitic and non-parasitic plants. Furthermore, the results of our study enable us to develop a strategy to fight against parasitic plants by suppressing the MAX signaling, which ultimately leads to enhanced productivity of crop plants. Copyright © 2016 Elsevier Inc. All rights reserved.
U.S. Department of Health & Human Services — The MAX Provider Characteristics (PC) File Implementation Report describes the design, implementation, and results of the MAXPC prototype, which was based on three...
Kanoun, Mohammed; Goumri-Said, Souraya
2012-01-01
In this chapter, we employ ab initio approaches to review some important physical properties of nanolaminated ternary carbides MAX phases. We fi rstly use an all electron full-potential linearized augmented plane-wave method within the generalized
Accurate simulation of the electron cloud in the Fermilab Main Injector with VORPAL
Energy Technology Data Exchange (ETDEWEB)
Lebrun, Paul L.G.; Spentzouris, Panagiotis; /Fermilab; Cary, John R.; Stoltz, Peter; Veitzer, Seth A.; /Tech-X, Boulder
2010-05-01
Precision simulations of the electron cloud at the Fermilab Main Injector have been studied using the plasma simulation code VORPAL. Fully 3D and self consistent solutions that includes E.M. field maps generated by the cloud and the proton bunches have been obtained, as well detailed distributions of the electron's 6D phase space. We plan to include such maps in the ongoing simulation of the space charge effects in the Main Injector. Simulations of the response of beam position monitors, retarding field analyzers and microwave transmission experiments are ongoing.
Introducing Autodesk 3ds Max 2011
Derakhshani, Dariush
2010-01-01
An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c
Light-Enhanced Antibacterial Activity of Graphene Oxide, Mainly via Accelerated Electron Transfer.
Chong, Yu; Ge, Cuicui; Fang, Ge; Wu, Renfei; Zhang, He; Chai, Zhifang; Chen, Chunying; Yin, Jun-Jie
2017-09-05
Before graphene derivatives can be exploited as next-generation antimicrobials, we must understand their behavior under environmental conditions. Here, we demonstrate how exposure to simulated sunlight significantly enhances the antibacterial activity of graphene oxide (GO) and reveal the underlying mechanism. Our measurements of reactive oxygen species (ROS) showed that only singlet oxygen ( 1 O 2 ) is generated by GO exposed to simulated sunlight, which contributes only slightly to the oxidation of antioxidant biomolecules. Unexpectedly, we find the main cause of oxidation is light-induced electron-hole pairs generated on the surface of GO. These light-induced electrons promote the reduction of GO, introducing additional carbon-centered free radicals that may also enhance the antibacterial activities of GO. We conclude that GO-mediated oxidative stress mainly is ROS-independent; simulated sunlight accelerates the transfer of electrons from antioxidant biomolecules to GO, thereby destroying bacterial antioxidant systems and causing the reduction of GO. Our insights will help support the development of graphene for antibacterial applications.
German science. Max Planck charts new path.
Koenig, R
2000-06-09
Germany's premier basic research organization, the Max Planck Society, released a long-awaited blueprint for change during its annual meeting this week, recommending that the society's nearly 3000 scientists embrace more interdisciplinary and international projects in a range of new research priorities. The report, called Max Planck 2000-Plus, is the product of an 18-month-long internal review. Its recommendations were formulated by some two dozen Max Planck researchers and administrators, who sought input from every institute.
Associations between VO2max and vitality in older workers: a cross-sectional study
Directory of Open Access Journals (Sweden)
van der Beek Allard J
2010-11-01
Full Text Available Abstract Background To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. Methods In 427 older workers (aged 45 + years participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. Results The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673. There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006, after adjusting for age, gender and chronic disease status. Conclusions VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale, but not with occupational health related vitality (measured with the UWES Vitality Scale. The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. Trial registration NTR1240
Associations between VO2max and vitality in older workers: a cross-sectional study.
Strijk, Jorien E; Proper, Karin I; Klaver, Linda; van der Beek, Allard J; van Mechelen, Willem
2010-11-09
To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. In 427 older workers (aged 45 + years) participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673). There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006), after adjusting for age, gender and chronic disease status. VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale), but not with occupational health related vitality (measured with the UWES Vitality Scale). The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. NTR1240.
ELA-max: A new topical lidocaine formulation.
Goldman, Ran D
2004-05-01
To evaluate the role of a new formulation of lidocaine (ELA-max) in local anesthesia in children and compare it with the eutectic mixture of local anesthetics (EMLA). Relevant literature was identified by a MEDLINE search (1966-November 2003) using the search terms ELA-max and EMLA. Bibliographies of selected articles were also examined to include all relevant investigations. The product manufacturer was contacted for inclusion of the most recent data available. Topical anesthesia in children is clinically challenging. ELA-max has been shown to be as effective as EMLA for venipuncture in children, but with faster onset. Adverse effects, such as transient blanching with redness and erythema, have been reported. Further investigation is needed to determine the effectiveness of ELA-max on other painful procedures in children, as well as its safety.
Exact simulation of max-stable processes.
Dombry, Clément; Engelke, Sebastian; Oesting, Marco
2016-06-01
Max-stable processes play an important role as models for spatial extreme events. Their complex structure as the pointwise maximum over an infinite number of random functions makes their simulation difficult. Algorithms based on finite approximations are often inexact and computationally inefficient. We present a new algorithm for exact simulation of a max-stable process at a finite number of locations. It relies on the idea of simulating only the extremal functions, that is, those functions in the construction of a max-stable process that effectively contribute to the pointwise maximum. We further generalize the algorithm by Dieker & Mikosch (2015) for Brown-Resnick processes and use it for exact simulation via the spectral measure. We study the complexity of both algorithms, prove that our new approach via extremal functions is always more efficient, and provide closed-form expressions for their implementation that cover most popular models for max-stable processes and multivariate extreme value distributions. For simulation on dense grids, an adaptive design of the extremal function algorithm is proposed.
Medicaid Analytic eXtract (MAX) General Information
U.S. Department of Health & Human Services — The Medicaid Analytic eXtract (MAX) data is a set of person-level data files on Medicaid eligibility, service utilization, and payments. The MAX data are created to...
1-Chloronaphthalene decomposition in air using electron beam irradiation
International Nuclear Information System (INIS)
Chmielewski, A.G.; Sun, Y.; Bulka, S.; Zimek, Z.
2006-01-01
A method for the preparation of model gas containing 1-chloronaphthalene can be referred to 1,1-DCE (dichloroethene). A pulsed electron beam (EB) accelerator ILU-6 (2.0 MeV max., 20 kW max.) was used as an irradiation source. The absorbed dose rate inside the irradiation vessel was 10.835 kGy/min. Total absorbed dose was adjusted by changing irradiation time of the Pyrex glass vessels. 1-Chloronaphthalene concentration was analyzed using gas-chromatography. It has been found, that 1-chloronaphthalene can be decomposed in air or N 2 using EB irradiation. Decomposition efficiency of 1-chloronaphthalene in air is higher than that in N 2 . Positive charge transfer reactions and OH radicals' reaction may play a main role in 1-chloronaphthalene decomposition process
Max Jakobson õiendab arveid ajalooga / Imbi Paju
Paju, Imbi, 1959-
2003-01-01
Soome politoloogi ja diplomaadi Max Jakobsoni raamatust "Tilinpäätos" ("Arve sulgemine"), milles ta käsitleb Eesti ja Soome suhteid 20. sajandil. Vt samas: Lennart Meri meelitas Jakobsoni sõjakuritegusid uurima; lühiintervjuu Max Jakobsoniga
Veteranpoliitik Max Jakobson õpetab ajalugu / Sirje Kiin
Kiin, Sirje, 1949-
1998-01-01
Soome sõltumatu välispoliitika konsultant ja ajakirjanik Max Jakobson. Ülevaade Max Jakobsoni intervjuust soomerootsi majandusajakirjale "Forum för ekonomi och teknik" 1998. aasta aprillinumbris Venemaa Baltimaade-vastasest propagandast ning EL-i ja NATO laienemisest
International Nuclear Information System (INIS)
Hoffmann, Dieter
2010-01-01
Max Planck (1858-1947) is according to the words of Max von Laue the ''father of quantum physics''. This characteristic has until today continuance, although Planck stood for long time sceptically in front of his quantum hypothesis and so became a revolutionary in spite of his wishes. Eclipted by this pioneer role of the scholar for the foundation of the quantum theory are the numerous further works of the scholer, by which he has in many other fields provided eminent things. Starting with his fundamental contribution to thermodynamics, which make him to an excellent researcher of the field, until the works in the early history of relativity theory and the promotion of the young Einstein, which let him become also to a pioneer of the second central pillar of modern physics. The present collection attempts to show the whole spectrum of the physical works of Max Planck and his role in the formation of modern physics. [de
Shared responsibility for managing electronic waste: A case study of Maine, USA
International Nuclear Information System (INIS)
Wagner, Travis P.
2009-01-01
Based on high disposal and low recycling rates of electronic waste (e-waste) and continued exportation to developing countries, reliance on municipal responsibility for e-waste management has been unsuccessful in the United States. This case study examines Maine's program, which was the first US state to mandate producer responsibility for recycling household e-waste. Maine's program established a shared cost responsibility among producers, municipalities, and consumers. The study found that Maine's program resulted in a significant reduction in disposal and a corresponding increase in environmentally sound recycling. In the first 3 years of the program, 6.406 million kg of household e-waste was collected and recycled for a population of 1.32 million. The new program, implemented in 2006, increased the number of e-waste items collected and recycled by 108% in the first year, 170% in the second year, and 221% in the third year. The program decreased direct economic costs to municipalities and households because of the shared cost approach and for the first time established costs for producers. There was no empirical evidence indicating that producers have or will improve the recyclability of electronic products to reduce recycling costs. While other weaknesses were that found potentially limit the adoption of Maine's program, its positive aspects warrant consideration by other governments.
Progress on electron cloud effects calculations for the FNAL main injector
International Nuclear Information System (INIS)
Furman, Miguel A; Sonnad, Kiran G.; Furman, Miguel A.; Vay, Jean-Luc
2008-01-01
We have studied the response of the beam to an electron cloud for the Fermilab Main Injector using the Quasistatic Model [1] implemented into the particle-in-cell code Warp [2]. Specifically, we have addressed the effects due to varying the beam intensity, electron cloud density and chromaticity. In addition, we have estimated the contribution to emittance evolution due to beam space-charge effects. We have carried out a comparison between how the beam responds at injection energy and at top energy. We also present some results on the validation of the computational model, and report on progress towards improving the computational model
Deterministic algorithms for multi-criteria Max-TSP
Manthey, Bodo
2012-01-01
We present deterministic approximation algorithms for the multi-criteria maximum traveling salesman problem (Max-TSP). Our algorithms are faster and simpler than the existing randomized algorithms. We devise algorithms for the symmetric and asymmetric multi-criteria Max-TSP that achieve ratios of
International Nuclear Information System (INIS)
Reginatto, M.; Goldhagen, P.
1998-06-01
The problem of analyzing data from a multisphere neutron spectrometer to infer the energy spectrum of the incident neutrons is discussed. The main features of the code MAXED, a computer program developed to apply the maximum entropy principle to the deconvolution (unfolding) of multisphere neutron spectrometer data, are described, and the use of the code is illustrated with an example. A user's guide for the code MAXED is included in an appendix. The code is available from the authors upon request
Improvements of ModalMax High-Fidelity Piezoelectric Audio Device
Woodard, Stanley E.
2005-01-01
ModalMax audio speakers have been enhanced by innovative means of tailoring the vibration response of thin piezoelectric plates to produce a high-fidelity audio response. The ModalMax audio speakers are 1 mm in thickness. The device completely supplants the need to have a separate driver and speaker cone. ModalMax speakers can perform the same applications of cone speakers, but unlike cone speakers, ModalMax speakers can function in harsh environments such as high humidity or extreme wetness. New design features allow the speakers to be completely submersed in salt water, making them well suited for maritime applications. The sound produced from the ModalMax audio speakers has sound spatial resolution that is readily discernable for headset users.
WiMAX network performance monitoring & optimization
DEFF Research Database (Denmark)
Zhang, Qi; Dam, H
2008-01-01
frequency reuse, capacity planning, proper network dimensioning, multi-class data services and so on. Furthermore, as a small operator we also want to reduce the demand for sophisticated technicians and man labour hours. To meet these critical demands, we design a generic integrated network performance......In this paper we present our WiMAX (worldwide interoperability for microwave access) network performance monitoring and optimization solution. As a new and small WiMAX network operator, there are many demanding issues that we have to deal with, such as limited available frequency resource, tight...... this integrated network performance monitoring and optimization system in our WiMAX networks. This integrated monitoring and optimization system has such good flexibility and scalability that individual function component can be used by other operators with special needs and more advanced function components can...
Heidergott, Bernd; van der Woude, Jacob
2014-01-01
Trains pull into a railroad station and must wait for each other before leaving again in order to let passengers change trains. How do mathematicians then calculate a railroad timetable that accurately reflects their comings and goings? One approach is to use max-plus algebra, a framework used to model Discrete Event Systems, which are well suited to describe the ordering and timing of events. This is the first textbook on max-plus algebra, providing a concise and self-contained introduction to the topic. Applications of max-plus algebra abound in the world around us. Traffic systems, compu
International Nuclear Information System (INIS)
Noda, S.; Yoshida, K.; Ogasawara, M.; Yoshida, H.
1980-01-01
In order to obtain a deeper insight into the initial localization and the subsequent stabilization of electrons and to unravel the detailed mechanism of the electron scavenging reaction in a glassy ethanol matrix, spectrophotometric studies have been made on this matrix with toluene, an inefficient electron scavenger, γ irradiated at 4.2 0 K. Inhomogeneous depletion of the trapped electron spectrum by toluene indicates that IR-absorbing (lambda/sub max/ = 1500 nm) and visible-absorbing (lambda/sub max/ = 640 nm) electrons are initially generated, but that the former are unstable at higher temperature. Toluene scavenges the IR-absorbing electrons more efficiently by a factor of 10 than the visible-absorbing electrons. This selectivity is much higher than that of an efficient scavenger, such as benzyl chloride, as previously reported. The electron scavenging reaction results in the formation of the transient radical anion of toluene, which is readily protonated to yield the methylcyclohexadienyl radical at 77 0 K. 3 figures
FLECH PowerMax Service Requirement Specification
DEFF Research Database (Denmark)
It is expected that in the future, ancillary services will be required at distribution level. This work describes how one of these ancillary services, the PowerMax service, must be spec ified within a market framework. The basis of this work is the Flexibility Clearing House (FLE CH) platform...... and the Distribution System Operator (DSO) services defined in [1]. The PowerMax service has been further discussed in [2], and this technical report seeks to clarify the implementation details first discussed in that paper. The aim of the PowerMax service it to relieve congestion issue s in the distribution system...... by establishing a maximum power that a cluster of consumer devices may draw from the syste m. The consumers will receive a payment for providing this service, and the DSO will be able to postpone grid reinfo rcement...
Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson ; interv. Kai Tänavsuu
Jakobson, Max, 1923-2013
2002-01-01
Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni esimees Max Jakobson oma suhtumisest talle Maarjamaa Risti I klassi teenetemärgi andmisse, tema juhitava komisjoni tööst, eestlaste püüdlusest ühineda NATOga, kommunismi ja natsismi hukkamõistust
U.S. Department of Health & Human Services — CMS is interested in linking MAX files with survey data, including four surveys conducted by the National Center for Health Statistics (NCHS) - the National Health...
Studies of E-Cloud Build up for the FNAL Main Injector and for the LHC
International Nuclear Information System (INIS)
Furman, M.A.
2006-01-01
We present a summary of recent simulation studies of the electron-cloud (EC) build-up for the FNAL MI and for the LHC. In the first case we pay particular attention to the dependence on bunch intensity N b at injection energy assuming the nominal bunch spacing t b = 19 ns, and we focus on the dipole magnets and field-free regions. The saturated value of the average EC density shows a clear threshold in N b beyond which the beam will be approximately neutralized on average. For the case of the LHC we limit our discussion to arc dipoles at collision energy, and bunch spacings t b = 25 ns or t b = 75 ns. The main variables exercised in this study are N b and the peak value of the secondary emission yield (SEY) (delta) max . For t b = 25 ns we conclude that the EC power deposition is comfortably below the available cooling capacity of the cryogenic system if (delta) max is below ∼ 1.2 at nominal N b . For t b = 75 ns, the EC power deposition is insignificant. As a byproduct of this exercise, we reach a detailed understanding of the significant role played by the backscattered secondary electrons. This article summarizes the results, an slightly extends the discussions, presented in Refs. 1 and 2
Brutsaert, Tom D; Parra, Esteban J; Shriver, Mark D; Gamboa, Alfredo; Palacios, Jose-Antonio; Rivera, Maria; Rodriguez, Ivette; León-Velarde, Fabiola
2003-08-01
Quechua in the Andes may be genetically adapted to altitude and able to resist decrements in maximal O2 consumption in hypoxia (DeltaVo2 max). This hypothesis was tested via repeated measures of Vo2 max (sea level vs. 4338 m) in 30 men of mixed Spanish and Quechua origins. Individual genetic admixture level (%Spanish ancestry) was estimated by using ancestry-informative DNA markers. Genetic admixture explained a significant proportion of the variability in DeltaVo2 max after control for covariate effects, including sea level Vo2 max and the decrement in arterial O2 saturation measured at Vo2 max (DeltaSpO2 max) (R2 for admixture and covariate effects approximately 0.80). The genetic effect reflected a main effect of admixture on DeltaVo2 max (P = 0.041) and an interaction between admixture and DeltaSpO2 max (P = 0.018). Admixture predicted DeltaVo2 max only in subjects with a large DeltaSpO2 max (P = 0.031). In such subjects, DeltaVo2 max was 12-18% larger in a subgroup of subjects with high vs. low Spanish ancestry, with least squares mean values (+/-SE) of 739 +/- 71 vs. 606 +/- 68 ml/min, respectively. A trend for interaction (P = 0.095) was also noted between admixture and the decrease in ventilatory threshold at 4338 m. As previously, admixture predicted DeltaVo2 max only in subjects with a large decrease in ventilatory threshold. These findings suggest that the genetic effect on DeltaVo2 max depends on a subject's aerobic fitness. Genetic effects may be more important (or easier to detect) in athletic subjects who are more likely to show gas-exchange impairment during exercise. The results of this study are consistent with the evolutionary hypothesis and point to a better gas-exchange system in Quechua.
Hybrid UWB and WiMAX radio-over-multi-mode fibre for in-building optical networks
International Nuclear Information System (INIS)
Perez, J; Llorente, R
2014-01-01
In this paper the use of hybrid WiMedia-defined ultra-wideband (UWB) and IEEE 802.16d WiMAX radio-over-fibre is proposed and experimentally demonstrated for multi-mode based in-building optical networks with the advantage of great immunity to optical transmission impairments. In the proposed approach, spectral coexistence of both signals must be achieved with negligible mutual interference. The experimental study performed addressed an indoor configuration with 50 μm multi-mode fibres (MMF) and 850 nm vertical-cavity surface-emitting laser (VCSEL) transmitters. The results indicate that the impact of the wireless convergence in radio-over-multi-mode fibre (RoMMF) is significant for UWB transmissions, mainly due to MMF dispersion and electrooptical (EO) devices with limited bandwidth. On the other hand, WiMAX transmission is feasible for a 300 m MMF and 30 m wireless link in the presence of UWB, with −31 dBm WiMAX EVM. (paper)
U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...
An analysis of main factors in electron beam flue gas purification
International Nuclear Information System (INIS)
Zhang Ming; Xu Guang
2003-01-01
Electron beam flue gas purification method is developing very quickly in recent years. Based on the experiment setting for electron beam flue gas purification in Institute of Nuclear Energy and Technology, Tsinghua University, how the technique factors affect the ratio of desulphurization and denitrogenation are described. Radiation dose (D), temperature (T), humidity (H), pour ammonia quantity (α) and initial concentration of SO 2 (C SO 2 ) and NO x (C NO x ) are main factors influencing flue gas purification. Using the methods of correlation analysis and regression analysis, the primary effect factors are found out and the regression equations are set to optimize the system process, predigest the system structure and to forecast the experimental results. (authors)
Knowledge, organization, and management building on the work of Max Boisot
Ihrig, Martin
2013-01-01
Max Boisot was one of the most original thinkers in management and organization studies. An independent scholar with an independent, enquiring, and innovative mind, his work ranged over a number of different areas from early attempts to understand contemporary developments in China to the role of information in organizations, and later the management of Big Science. Yet, as this book shows, there was a central strand that ran through these apparently diverse areas, which was the attempt to understand the relationship between knowledge and information, and its organization -- in firms, organizations, and societies -- by means of the model Boisot developed, the 'I-Space'. Knowledge, Organization, and Management brings together key examples of Max Boisot's work into a single volume, setting these alongside original, extended commentaries and reflections by his academic collaborators. Structured under five core sections, it covers the main areas in which he forged new understandings: analyses of the Chinese syste...
Max Jakobsoni saatuseaastad, soomlased ja meie / Imbi Paju
Paju, Imbi, 1959-
2008-01-01
Soome politoloogist ja diplomaadist Max Jakobsonist ja tema uuest raamatust "Saatuseaastad. Soome tõusis, andis Venemaale järele ja pääses". Artiklis on juttu ka Max Jakobsoni suhetest Eesti presidentide Lennart Meri ja Toomas Hendrik Ilvesega
Max-Plus Stochastic Control and Risk-Sensitivity
International Nuclear Information System (INIS)
Fleming, Wendell H.; Kaise, Hidehiro; Sheu, Shuenn-Jyi
2010-01-01
In the Maslov idempotent probability calculus, expectations of random variables are defined so as to be linear with respect to max-plus addition and scalar multiplication. This paper considers control problems in which the objective is to minimize the max-plus expectation of some max-plus additive running cost. Such problems arise naturally as limits of some types of risk sensitive stochastic control problems. The value function is a viscosity solution to a quasivariational inequality (QVI) of dynamic programming. Equivalence of this QVI to a nonlinear parabolic PDE with discontinuous Hamiltonian is used to prove a comparison theorem for viscosity sub- and super-solutions. An example from mathematical finance is given, and an application in nonlinear H-infinity control is sketched.
Digital logic circuit design with ALTERA MAX+PLUS II
International Nuclear Information System (INIS)
Lee, Seung Ho; Park, Yong Su; Park, Gun Jong; Lee, Ju Heon
2006-09-01
This book is composed of five parts. The first part has introduction of ALTERA MAX+PLUS II and graphic editor, text editor, compiler, waveform editor simulator and timing analyzer of it. The second part is about direction of digital logic circuit design with training kit. The third part has grammar and practice of VHDL in ALTERA MAX+PLUS II including example and history of VHDL. The fourth part shows the design example of digital logic circuit by VHDL of ALTERA MAX+PLUS II which lists designs of adder and subtractor, code converter, counter, state machine and LCD module. The last part explains design example of digital logic circuit by graphic editor in ALTERA MAX+PLUS II.
Max Weber Visits America: A Review of the Video
Directory of Open Access Journals (Sweden)
Michael Wise
2006-11-01
Full Text Available The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976 to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided using the .mp4 format. The video should appeal to students and professors interested in Max Weber. It can be included in courses ranging from introductory sociology to theory.
The interactional foundations of MaxEnt: Open questions
Energy Technology Data Exchange (ETDEWEB)
Harré, Michael S., E-mail: michael.harre@sydney.edu.au [Complex Systems Research Group, School of Civil Engineering, The University of Sydney, Sydney NSW 2006 (Australia)
2014-12-05
One of the simplest and potentially most useful techniques to be developed in the 20{sup th} century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals.
The interactional foundations of MaxEnt: Open questions
International Nuclear Information System (INIS)
Harré, Michael S.
2014-01-01
One of the simplest and potentially most useful techniques to be developed in the 20 th century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals
Heijmans, H.G.; van Woerkom, P.Th.L.M.; Ankersmit, W.; Hagman, R.; Heijmans, H.G.; Olsder, G.J.; van de Schootbrugge, G.
2017-01-01
De Max-Planck-Medaille is een onderscheiding die sinds 1929 jaarlijks wordt uitgereikt door de toentertijd grootste vereniging van natuurkundigen ter wereld: de Deutsche Physikalische Gesellschaft. Het is als het ware de Nobelprijs voor de theoretische natuurkunde, volgens de natuurkundigen zelf. In
Theory of Weak Bipolar Fields and Electron Holes with Applications to Space Plasmas
International Nuclear Information System (INIS)
Goldman, Martin V.; Newman, David L.; Mangeney, Andre
2007-01-01
A theoretical model of weak electron phase-space holes is used to interpret bipolar field structures observed in space. In the limit eφ max /T e max sech 4 (x/α), where φ max depends on the derivative of the trapped distribution at the separatrix, while α depends only on a screening integral over the untrapped distribution. Idealized trapped and passing electron distributions are inferred from the speed, amplitude, and shape of satellite waveform measurements of weak bipolar field structures
Intertextuality and Television Discourse: The Max Headroom Story.
Braddlee
Max Headroom, the computer-generated media personality, presents a good opportunity for an investigation of the degree of intertextuality in television. Max combines narrative genres (science fiction and film noir), television program types (prime-time episodic narrative, made-for-TV movie, talkshows), advertising and programming, and electronic…
Autodesk 3ds Max 2012 Essentials
Derakhshani, Randi L
2011-01-01
Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,
Bureaucracy and Education: an analysis since Max Weber
Directory of Open Access Journals (Sweden)
João Alfredo Costa de Campos Melo Júnior
2010-06-01
Full Text Available This paper aims at providing a discussion on bureaucracy and education based on the comprehensive sociology developed by Weber. The choice of Max Weber seems to be the most appropriate due the diversity and depth of his intellectual production, what includes the issue of bureaucracy. The use of Weber should serve as a precise instrument of conceptual analysis on the theme addressed here. Certainly, this thinker has been one of the main scholars on bureaucracy, with focus on Germany at the time of the First World War (1914-1918. It is within such a productive theoretical framework that we intend to provide a few reflections about education and bureaucracy from a Weberian epistemological base.
Research on 3D virtual campus scene modeling based on 3ds Max and VRML
Kang, Chuanli; Zhou, Yanliu; Liang, Xianyue
2015-12-01
With the rapid development of modem technology, the digital information management and the virtual reality simulation technology has become a research hotspot. Virtual campus 3D model can not only express the real world objects of natural, real and vivid, and can expand the campus of the reality of time and space dimension, the combination of school environment and information. This paper mainly uses 3ds Max technology to create three-dimensional model of building and on campus buildings, special land etc. And then, the dynamic interactive function is realized by programming the object model in 3ds Max by VRML .This research focus on virtual campus scene modeling technology and VRML Scene Design, and the scene design process in a variety of real-time processing technology optimization strategy. This paper guarantees texture map image quality and improve the running speed of image texture mapping. According to the features and architecture of Guilin University of Technology, 3ds Max, AutoCAD and VRML were used to model the different objects of the virtual campus. Finally, the result of virtual campus scene is summarized.
Max Weber Visits America: A Review of the Video
Michael Wise
2006-01-01
The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976) to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided...
Exercise tolerance during VO2max testing is a multifactorial psychobiological phenomenon.
Midgley, Adrian W; Earle, Keith; McNaughton, Lars R; Siegler, Jason C; Clough, Peter; Earle, Fiona
2017-01-01
Fifty-nine men completed a VO 2max test and a questionnaire to establish reasons for test termination, perceived exercise reserve (difference between actual test duration and the duration the individual perceived could have been achieved if continued until physical limitation), and perception of verbal encouragement. Participants gave between 1 and 11 factors as reasons for test termination, including leg fatigue, various perceptions of physical discomfort, safety concerns, and achievement of spontaneously set goals. The two most common main reasons were leg fatigue and breathing discomfort, which were predicted by pre-to-post test changes in pulmonary function (p = 0.038) and explosive leg strength (p = 0.042; R 2 = 0.40). Median (interquartile range) perceived exercise reserve, was 45 (50) s. Two-thirds of participants viewed verbal encouragement positively, whereas one-third had a neutral or negative perception. This study highlights the complexity of exercise tolerance during VO 2max testing and more research should explore these novel findings.
Autodesk 3ds Max 2013 essentials
Derakhshani, Dariush
2012-01-01
A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.
Murdock, Kelly L
2013-01-01
A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty
A Printed Monopole Antenna for Triple-Band WLAN/WiMAX Applications
Directory of Open Access Journals (Sweden)
Huiqing Zhai
2015-01-01
Full Text Available A new compact design of monopole antenna for triple-band WLAN/WiMAX applications with two band-notches based on broadband antenna is presented. By introducing a stub loaded ground and two new paper clip structures etched on radiation patch, a compact overall dimension 31 mm × 33 mm × 1 mm and three separated operating bands effectively covering 2.4/5.2/5.8 GHz WLAN bands and 2.5/3.5/5.5 GHz WiMAX bands can be achieved. Compared with familiar U type slot, the introduced compact paper clip structure can save about 37% of dimension regions, which could effectively improve efficiency of band-notch formation. Simulated and measured results demonstrate that the proposed antenna has good dipole-like radiation characteristics with appreciable gain across the operating bands. Besides, main parameters of the two etched paper clip structures are investigated to control the positions and bandwidths of the two stop-bands, respectively, on basis of which the three working bands can be adjusted independently.
Apple F-box Protein MdMAX2 Regulates Plant Photomorphogenesis and Stress Response
Directory of Open Access Journals (Sweden)
Jian-Ping An
2016-11-01
Full Text Available MAX2 (MORE AXILLARY GROWTH2 is involved in diverse physiological processes, including photomorphogenesis, the abiotic stress response, as well as karrikin and strigolactone signaling-mediated shoot branching. In this study, MdMAX2, an F-box protein that is a homolog of Arabidopsis MAX2, was identified and characterized. Overexpression of MdMAX2 in apple calli enhanced the accumulation of anthocyanin. Ectopic expression of MdMAX2 in Arabidopsis exhibited photomorphogenesis phenotypes, including increased anthocyanin content and decreased hypocotyl length. Further study indicated that MdMAX2 might promote plant photomorphogenesis by affecting the auxin signaling as well as other plant hormones. Transcripts of MdMAX2 were noticeably up-regulated in response to NaCl and Mannitol treatments. Moreover, compared with the wild type, the MdMAX2-overexpressing apple calli and Arabidopsis exhibited increased tolerance to salt and drought stresses. Taken together, these results suggest that MdMAX2 plays a positive regulatory role in plant photomorphogenesis and stress response.
Max Scheler's Phenomenology of Interrelation
African Journals Online (AJOL)
denise
German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy .... process of deliberation or ask myself how the other person might be feeling .... Scheler believes that Nietzsche mistakenly identifies.
President Ilves kohtus Max Jakobsoniga
2008-01-01
President Toomas Hendrik Ilves ja Soome tuntud diplomaat Max Jakobson arutasid 16. septembril 2008 Tallinnas toimunud kohtumisel julgeolekuolukorda Euroopas pärast Venemaa-Gruusia sõda, Euroopa Liidu suhteid Venemaaga ja NATO tulevikku
Max Weber's Critique of the Bureaucratisation of Education
Madan, Amman
2014-01-01
In this commentary, the author discusses the critique by Max Weber and his views on bureaucratisation of education. The modern school, said Max Weber (1864-1920) over a hundred years ago, has as its educational ideal the bureaucrat and no longer the cultivated elite of older times. The shift to modernity and to its characteristic institution, the…
The design of a 3 GHz thermionic RF-gun and energy filter for MAX-lab
Anderberg, B; Demirkan, M; Eriksson, M; Malmgren, L; Werin, S
2002-01-01
A new pre-injector has been designed for the MAX-laboratory. It consists of an RF-gun and a magnetic energy filter. The newly designed RF-gun geometry will be operated at 3 GHz in the thermionic mode using a BaO cathode. The pre-injector will provide a 2.3 MeV electron beam in 3 ps micro pulses to a new injector system currently under construction.
MaxSynBio - Avenues towards creating cells from the bottom up.
Schwille, Petra; Spatz, Joachim; Landfester, Katharina; Bodenschatz, Eberhard; Herminghaus, Stephan; Sourjik, Victor; Erb, Tobias; Bastiaens, Philippe; Lipowsky, Reinhard; Hyman, Anthony; Dabrock, Peter; Baret, Jean-Christophe; Vidakovic-Koch, Tanja; Bieling, Peter; Dimova, Rumiana; Mutschler, Hannes; Robinson, Tom; Tang, Dora; Wegner, Seraphine; Sundmacher, Kai
2018-05-11
A large Max Planck-based German research consortium ('MaxSynBio') was formed to investigate living systems from a fundamental perspective. The research program of MaxSynBio relies solely on the bottom-up approach to Synthetic Biology. MaxSynBio focuses on the detailed analysis and understanding of essential processes of life, via their modular reconstitution in minimal synthetic systems. The ultimate goal is to construct a basic living unit entirely from non-living components. The fundamental insights gained from the activities in MaxSynBio can eventually be utilized for establishing a new generation of biotechnological processes, which would be based on synthetic cell constructs that replace natural cells currently used in conventional biotechnology. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B
2013-12-15
Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.
The use and misuse of V(c,max) in Earth System Models.
Rogers, Alistair
2014-02-01
Earth System Models (ESMs) aim to project global change. Central to this aim is the need to accurately model global carbon fluxes. Photosynthetic carbon dioxide assimilation by the terrestrial biosphere is the largest of these fluxes, and in many ESMs is represented by the Farquhar, von Caemmerer and Berry (FvCB) model of photosynthesis. The maximum rate of carboxylation by the enzyme Rubisco, commonly termed V c,max, is a key parameter in the FvCB model. This study investigated the derivation of the values of V c,max used to represent different plant functional types (PFTs) in ESMs. Four methods for estimating V c,max were identified; (1) an empirical or (2) mechanistic relationship was used to relate V c,max to leaf N content, (3) V c,max was estimated using an approach based on the optimization of photosynthesis and respiration or (4) calibration of a user-defined V c,max to obtain a target model output. Despite representing the same PFTs, the land model components of ESMs were parameterized with a wide range of values for V c,max (-46 to +77% of the PFT mean). In many cases, parameterization was based on limited data sets and poorly defined coefficients that were used to adjust model parameters and set PFT-specific values for V c,max. Examination of the models that linked leaf N mechanistically to V c,max identified potential changes to fixed parameters that collectively would decrease V c,max by 31% in C3 plants and 11% in C4 plants. Plant trait data bases are now available that offer an excellent opportunity for models to update PFT-specific parameters used to estimate V c,max. However, data for parameterizing some PFTs, particularly those in the Tropics and the Arctic are either highly variable or largely absent.
Min-max optimal public service system design
Directory of Open Access Journals (Sweden)
Marek Kvet
2015-03-01
Full Text Available This paper deals with designing a fair public service system. To achieve fairness, various schemes are be applied. The strongest criterion in the process is minimization of disutility of the worst situated users and then optimization of disutility of the better situated users under the condition that disutility of the worst situated users does not worsen, otherwise called lexicographical minimization. Focusing on the first step, this paper endeavours to find an effective solution to the weighted p-median problem based on radial formulation. Attempts at solving real instances when using a location-allocation model often fail due to enormous computational time or huge memory demands. Radial formulation can be implemented using commercial optimisation software. The main goal of this study is to show that the suitability solving of the min-max optimal public service system design can save computational time.
Digital logic circuit design with ALTERA MAX+PLUS II
International Nuclear Information System (INIS)
Lee, Seung Ho; Park, Yong Su; Lee, Ju Heon
2006-03-01
Contents of this book are the kinds of integrated circuit, design process of integrated circuit, introduction of ALTERA MAX+PLUS II, designing logic circuit with VHDL of ALTERA MAX+PLUS II, grammar and practice of VHDL of ALTERA MAX+PLUS II, design for adder, subtractor, parallel binary subtractor, BCD design, CLA design, code converter design, ALU design, register design, counter design, accumulator design, state machine design, frequency divider design, circuit design with TENMILLION counter, LCD module, circuit design for control the outside RAM in training kit and introduction for HEB-DTK-20K-240/HBE-DTK-IOK.
Directory of Open Access Journals (Sweden)
Yulia V. Dementieva
2016-01-01
Full Text Available The aim of the study is the description of the main problems of formation of the student’s electronic portfolio in the conditions of realization of Federal State Educational Standards of the Higher Education (FSES of HE.Methods.Theoretical analysis of scientific literature concerning the subject under discussion; monitoring of existing practices in modern Russian Universities procedures for the formation and maintenance of students electronic portfolio.Results. The author describes the main problems of the electronic students’ portfolio formation; some ways of solving described problems are offered.Scientific novelty concludes in the formation of key ideas of the electronic students’ portfolio based on the understanding of requirements of Federal State Educational Standards of Higher Education for the results of mastering educational programs. They are the formation of general cultural, general professional and professional competences.Practical significance. The researching results will become the theoretical basis for the systematic organization of the process of creating and maintaining an electronic students’ portfolio during the whole period of their studying at the university; the researching results can become a basis for methodological developments.
2013-01-01
Max Reinharz was born in Vienna, Austria, in 1923. In 1939 he was obliged to emigrate to the UK. At the beginning of the Second World War he was interned as an enemy alien and then deported to Australia at a time when the British feared an invasion by Germany. He returned to the UK in 1943 and joined the British Army. After he was demobbed in 1947, he studied physics in Vienna, where he took his doctorate in 1953. Max Reinharz (centre) with Gordon Munday (left) and Henri Laporte (right) in 1979. After working in Brussels, at the physics Institute of Genoa and the University of Pisa, he joined CERN in 1960 as a fellow and in 1964 became a senior physicist in the NP Division. His name is associated with many publications, such as those of the CERN neutrino experiment and the CERN-Geneva-Lund collaboration to verify T symmetry conservation in lambda decays. He then joined a small team in the Proton Synchrotron Division (MPS) responsible for assisting external physics groups to prepare and i...
BlackMax: A black-hole event generator with rotation, recoil, split branes, and brane tension
International Nuclear Information System (INIS)
Dai Dechang; Starkman, Glenn; Stojkovic, Dejan; Issever, Cigdem; Tseng, Jeff; Rizvi, Eram
2008-01-01
We present a comprehensive black-hole event generator, BlackMax, which simulates the experimental signatures of microscopic and Planckian black-hole production and evolution at the LHC in the context of brane world models with low-scale quantum gravity. The generator is based on phenomenologically realistic models free of serious problems that plague low-scale gravity, thus offering more realistic predictions for hadron-hadron colliders. The generator includes all of the black-hole gray-body factors known to date and incorporates the effects of black-hole rotation, splitting between the fermions, nonzero brane tension, and black-hole recoil due to Hawking radiation (although not all simultaneously). The generator can be interfaced with Herwig and Pythia. The main code can be downloaded from http://www-pnp.physics.ox.ac.uk/~issever/BlackMax/blackmax.html.
V-dotO2max prediction from multi-frequency bioelectrical impedance analysis
International Nuclear Information System (INIS)
Stahn, Alexander; Strobel, Günther; Terblanche, Elmarie
2008-01-01
Bioelectrical impedance analysis (BIA) has been shown to be highly related to skeletal muscle mass and blood volume, both of which are important determinants of maximal oxygen uptake (V-dotO 2max ). The aim of the present study was therefore to investigate the ability of whole-body and segmental multi-frequency BIA to improve current nonexercise V-dotO 2max prediction models. Data for V-dotO 2max (mL min −1 ), anthropometry, self-reported physical activity (PA-R) and BIA were collected in 115 men and women. Multiple linear regression analysis (MLR) was used to develop the most parsimonious prediction model. Segmental BIA was not superior to whole-body measurements. Correlation coefficients between V-dotO 2max and resistance indices were significantly higher at 500 kHz compared to 50 kHz (p 2max (r = 0.89). After adjusting for age, gender and PA-R, MLR revealed that the inclusion of intracellular resistance index was slightly, but significantly (p 2max ( −1 ). In short, whole-body BIA marginally improves the accuracy of nonexercise V-dotO 2max prediction models and its advantage is most pronounced in individuals with particularly low V-dotO 2max
Compositions of (max, +) automata
Czech Academy of Sciences Publication Activity Database
Lahaye, S.; Komenda, Jan; Boimond, J.-L.
2015-01-01
Roč. 25, 1-2 (2015), s. 323-344 ISSN 0924-6703 R&D Projects: GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : (max,+) automata * synchronous product * asynchronous product Subject RIV: BA - General Mathematics Impact factor: 1.268, year: 2015 http://link.springer.com/article/10.1007/s10626-014-0186-6
International Nuclear Information System (INIS)
Pivi, M.; Raubenheimer, T.O.; Furman, M.A.
2003-01-01
In the beam pipe of the Main Damping Ring (MDR) of the Next Linear Collider (NLC), ionization of residual gases and secondary emission give rise to an electron-cloud which stabilizes to equilibrium after few bunch trains. In this paper, we present recent computer simulation results for the main features of the electron cloud at the NLC and preliminary simulation results for the TESLA main damping rings, obtained with the code POSINST that has been developed at LBNL, and lately in collaboration with SLAC, over the past 7 years. Possible remedies to mitigate the effect are also discussed. We have recently included the possibility to simulate different magnetic field configurations in our code including solenoid, quadrupole, sextupole and wiggler
Reachability analysis for timed automata using max-plus algebra
DEFF Research Database (Denmark)
Lu, Qi; Madsen, Michael; Milata, Martin
2012-01-01
We show that max-plus polyhedra are usable as a data structure in reachability analysis of timed automata. Drawing inspiration from the extensive work that has been done on difference bound matrices, as well as previous work on max-plus polyhedra in other areas, we develop the algorithms needed...
Diversity of endophytic fungi in Glycine max.
Fernandes, Elio Gomes; Pereira, Olinto Liparini; da Silva, Cynthia Cânedo; Bento, Claudia Braga Pereira; de Queiroz, Marisa Vieira
2015-12-01
Endophytic fungi are microorganisms that live within plant tissues without causing disease during part of their life cycle. With the isolation and identification of these fungi, new species are being discovered, and ecological relationships with their hosts have also been studied. In Glycine max, limited studies have investigated the isolation and distribution of endophytic fungi throughout leaves and roots. The distribution of these fungi in various plant organs differs in diversity and abundance, even when analyzed using molecular techniques that can evaluate fungal communities in different parts of the plants, such as denaturing gradient gel electrophoresis (DGGE). Our results show there is greater species richness of culturable endophytic filamentous fungi in the leaves G. max as compared to roots. Additionally, the leaves had high values for diversity indices, i.e. Simpsons, Shannon and Equitability. Conversely, dominance index was higher in roots as compared to leaves. The fungi Ampelomyces sp., Cladosporium cladosporioides, Colletotrichum gloeosporioides, Diaporthe helianthi, Guignardia mangiferae and Phoma sp. were more frequently isolated from the leaves, whereas the fungi Fusarium oxysporum, Fusarium solani and Fusarium sp. were prevalent in the roots. However, by evaluating the two communities by DGGE, we concluded that the species richness was higher in the roots than in the leaves. UPGMA analysis showed consistent clustering of isolates; however, the fungus Leptospora rubella, which belongs to the order Dothideales, was grouped among species of the order Pleosporales. The presence of endophytic Fusarium species in G. max roots is unsurprising, since Fusarium spp. isolates have been previously described as endophyte in other reports. However, it remains to be determined whether the G. max Fusarium endophytes are latent pathogens or non-pathogenic forms that benefit the plant. This study provides a broader knowledge of the distribution of the fungal
Simulations of Electron Cloud Effects on the Beam Dynamics for the FNAL Main Injector Upgrade
International Nuclear Information System (INIS)
Sonnad Kiran G.; Furman, Miguel; Vay, Jean-Luc; Venturini, Marco; Celata, Christine M.; Grote, David
2006-01-01
The Fermilab main injector (MI) is being considered for an upgrade as part of the high intensity neutrino source (HINS) effort. This upgrade will involve a significant increasing of the bunch intensity relative to its present value. Such an increase will place the MI in a regime in which electron-cloud effects are expected to become important. We have used the electrostatic particle-in-cell code WARP, recently augmented with new modeling capabilities and simulation techniques, to study the dynamics of beam-electron cloud interaction. This work in progress involves a systematic assessment of beam instabilities due to the presence of electron clouds
Scaff, Lawrence A.
1981-01-01
This paper investigates the unique intellectual partnership of Max Weber and Robert Michels, with particular emphasis on Weber's influence on Michel's inquiry into the sociology of parties and organization. Concludes with an evaluation of the import of Weber's critique of Michels' work. (DB)
Lyashchenko, K. N.; Andreev, O. Yu; Voitkiv, A. B.
2018-03-01
We consider electron loss from a hydrogen-like highly charged ion (HCI) in relativistic collisions with hydrogen and helium in the range of impact velocities v min ≤ v ≤ v max (v min and v max correspond to the threshold energy ε th for electron loss in collisions with a free electron and to ≈5 ε th, respectively) where any reliable data for loss cross sections are absent. In this range, where the loss process is characterized by large momentum transfers, we express it in terms of electron loss in collisions with equivelocity protons and electrons and explore by performing a detailed comparative study of these subprocesses. Our results, in particular, show that: (i) compared to equivelocity electrons protons are more effective in inducing electron loss, (ii) the relative effectiveness of electron projectiles grows with increase in the atomic number of a HCI, (iii) collisions with protons and electrons lead to a qualitatively different population of the final-state-electron momentum space and even when the total loss cross sections in these collisions become already equal the spectra of the outgoing electrons still remain quite different in almost the entire volume of the final-state-electron momentum space, (iv) in collisions with hydrogen and helium the contributions to the loss process from the interactions with the nucleus and the electron(s) of the atom could be rather well separated in a substantial part of the final-state-electron momentum space.
Max Aub, crítico e historiador literario
Directory of Open Access Journals (Sweden)
Francisco Caudet
2002-11-01
Full Text Available On the basis of similarities and dissimilarities in the consideration of authors dealt with in Discurso de la novela española contemporánea, Francisco Caudet points out Max Aub's poetics of realism stated in both his critical studies and fiction. This essay shows that Aub's contribution to the study of Mexican and Spanish literature is outstanding, not only because of his socio-historical approach, but also because of a specific perspective. This does not mean writing a "history" of literature but rather connecting creative processes. Committed during his youth to the avant-garde, Max Aub shifts after the Civil War to a type of new realistic writing. The author highlights Max Aub's activity as a critic discussing and commenting his sources. Aub's critical essays cannot be detached from his personal ideas about literary theory and practice.
Origin and behavior of main electron traps in Si-implanted GaAs
International Nuclear Information System (INIS)
Fang, Z.Q.; Yamamoto, H.; Look, D.C.
1990-01-01
The electron traps in Si-implanted active layers (n ∼ 10 17 cm -3 ) have been studied by capacitance and conductance DLTS techniques in conjunction with different anneal conditions, which include rapid thermal anneals at different temperatures and furnace anneals with Si 3 N 4 cap or capless in an AsH 3 atmosphere. As compared to the electron traps in as-grown bulk n-GaAs (n ∼ 4 x 10 16 cm -3 ), nearly the same electron traps, i.e. EL2, EL3, EL4, EL5, EL6, and EL9 can be observed in the Si-implanted layers. Through a comparison with the annealing behavior of the main electron traps in bulk n-GaAs, the processing associated origins of some of the traps (EL2, EL3, EL4, EL5 and EL9) observed in Si-implanted GaAs layers have been determined. For some Si-implanted capped with Si 3 N 4 and furnace annealed, traps EL3 and EL4 dominate the trap EL2. In such layers it is found that emission due to EL3 is reduced while emission from EL12 is augmented by increasing the filling pulse width from 10 μs to 5 x 10 3 μs. In this paper phenomenon is explained in terms of a defect reaction enhanced by electron capture, showing a metastability or bistability
Applying FDTD to the Coverage Prediction of WiMAX Femtocells
Directory of Open Access Journals (Sweden)
Valcarce Alvaro
2009-01-01
Full Text Available Femtocells, or home base stations, are a potential future solution for operators to increase indoor coverage and reduce network cost. In a real WiMAX femtocell deployment in residential areas covered by WiMAX macrocells, interference is very likely to occur both in the streets and certain indoor regions. Propagation models that take into account both the outdoor and indoor channel characteristics are thus necessary for the purpose of WiMAX network planning in the presence of femtocells. In this paper, the finite-difference time-domain (FDTD method is adapted for the computation of radiowave propagation predictions at WiMAX frequencies. This model is particularly suitable for the study of hybrid indoor/outdoor scenarios and thus well adapted for the case of WiMAX femtocells in residential environments. Two optimization methods are proposed for the reduction of the FDTD simulation time: the reduction of the simulation frequency for problem simplification and a parallel graphics processing units (GPUs implementation. The calibration of the model is then thoroughly described. First, the calibration of the absorbing boundary condition, necessary for proper coverage predictions, is presented. Then a calibration of the material parameters that minimizes the error function between simulation and real measurements is proposed. Finally, some mobile WiMAX system-level simulations that make use of the presented propagation model are presented to illustrate the applicability of the model for the study of femto- to macrointerference.
Attosecond-correlated dynamics of two electrons in argon
Indian Academy of Sciences (India)
2014-01-11
Jan 11, 2014 ... 2Max-Planck-Institut für Kernphysik, 69117 Heidelberg, Germany ... involving a highly correlated electronic transition state. ... laser is low, the recolliding electron can have a maximum energy of about 15 eV which.
DEFF Research Database (Denmark)
Eistrup, Jens
2010-01-01
undervisningsartiklen introducerer en række af Max Webers centrale begreber om herredømme, bureaukrati, social handlen, rationalitet og profession. dernæst illustreres hvorledes Webers begreber kan tjene til at belyse spændingsfeltet mellem politik og profession i en socialfaglig kontekst....
Tunnel Effect in CNNs: Image Reconstruction From Max-Switch Locations
DEFF Research Database (Denmark)
de La Roche Saint Andre, Matthieu; Rieger, Laura; Hannemose, Morten
2016-01-01
In this paper, we show that reconstruction of an image passed through a neural network is possible, using only the locations of the max pool activations. This was demonstrated with an architecture consisting of an encoder and a decoder. The decoder is a mirrored version of the encoder, where...... convolutions are replaced with deconvolutions and poolings are replaced with unpooling layers. The locations of the max pool switches are transmitted to the corresponding unpooling layer. The reconstruction is computed only from these switches without the use of feature values. Using only the max switch...
iamxt: Max-tree toolbox for image processing and analysis
Directory of Open Access Journals (Sweden)
Roberto Souza
2017-01-01
Full Text Available The iamxt is an array-based max-tree toolbox implemented in Python using the NumPy library for array processing. It has state of the art methods for building and processing the max-tree, and a large set of visualization tools that allow to view the tree and the contents of its nodes. The array-based programming style and max-tree representation used in the toolbox make it simple to use. The intended audience of this toolbox includes mathematical morphology students and researchers that want to develop research in the field and image processing researchers that need a toolbox simple to use and easy to integrate in their applications.
Effects of erythrocyte infusion on VO2max at high altitude
DEFF Research Database (Denmark)
Young, Jette Feveile; Sawka, M N; Muza, S R
1996-01-01
This study investigated whether autologous erythrocyte infusion would ameliorate the decrement in maximal O2 uptake (VO2max) experienced by lowlanders when they ascend to high altitude. VO2max was measured in 16 men (treadmill running) at sea level (SL) and on the 1st (HA1) and 9th (HA9) days...... of high-altitude (4,300 m) residence. After VO2max was measured at SL, subjects were divided into two matched groups (n = 8). Twenty-four hours before ascent to high altitude, the experimental group received a 700-ml infusion of autologous erythrocytes and saline (42% hematocrit), whereas the control...... group received only saline. The VO2max of erythrocyte-infused [54 +/- 1 (SE) ml.kg-1.min-1] and control subjects (52 +/- 2 ml.kg-1.min-1) did not differ at SL before infusion. The decrement in VO2max on HA1 did not differ between groups, averaging 26% overall, despite higher (P
WiMAX security and quality of service an end-to-end perspective
Tang, Seok-Yee; Sharif, Hamid
2010-01-01
WiMAX is the first standard technology to deliver true broadband mobility at speeds that enable powerful multimedia applications such as Voice over Internet Protocol (VoIP), online gaming, mobile TV, and personalized infotainment. WiMAX Security and Quality of Service, focuses on the interdisciplinary subject of advanced Security and Quality of Service (QoS) in WiMAX wireless telecommunication systems including its models, standards, implementations, and applications. Split into 4 parts, Part A of the book is an end-to-end overview of the WiMAX architecture, protocol, and system requirements.
Is Recreational Soccer Effective for Improving VO2max A Systematic Review and Meta-Analysis.
Milanović, Zoran; Pantelić, Saša; Čović, Nedim; Sporiš, Goran; Krustrup, Peter
2015-09-01
Soccer is the most popular sport worldwide, with a long history and currently more than 500 million active participants, of whom 300 million are registered football club members. On the basis of scientific findings showing positive fitness and health effects of recreational soccer, FIFA (Fédération Internationale de Football Association) introduced the slogan "Playing football for 45 min twice a week-best prevention of non-communicable diseases" in 2010. The objective of this paper was to perform a systematic review and meta-analysis of the literature to determine the effects of recreational soccer on maximal oxygen uptake (VO2max). Six electronic databases (MEDLINE, PubMed, SPORTDiscus, Web of Science, CINAHL and Google Scholar) were searched for original research articles. A manual search was performed to cover the areas of recreational soccer, recreational physical activity, recreational small-sided games and VO2max using the following key terms, either singly or in combination: recreational small-sided games, recreational football, recreational soccer, street football, street soccer, effect, maximal oxygen uptake, peak oxygen uptake, cardiorespiratory fitness, VO2max. The inclusion criteria were divided into four sections: type of study, type of participants, type of interventions and type of outcome measures. Probabilistic magnitude-based inferences for meta-analysed effects were based on standardised thresholds for small, moderate and large changes (0.2, 0.6 and 1.2, respectively) derived from between-subject standard deviations for baseline fitness. Seventeen studies met the inclusion criteria and were included in the systematic review and meta-analysis. Mean differences showed that VO2max increased by 3.51 mL/kg/min (95 % CI 3.07-4.15) over a recreational soccer training programme in comparison with other training models. The meta-analysed effects of recreational soccer on VO2max compared with the controls of no exercise, continuous running and strength
International Nuclear Information System (INIS)
Rangelov, J.M.
1986-01-01
An electron model is proposed explaining the physical reasons for its nonrelativistic quantum-mechanical behaviour, the origin of its own mechanical and magnetic momentum and field energy. As an example the main electron state in hydrogen atom is obtained
Estimated VO2max and its corresponding velocity predict performance of amateur runners
Directory of Open Access Journals (Sweden)
Bruno Ribeiro Ramalho Oliveira
2012-03-01
Full Text Available In recent years, there has been a substantial increase in the number of runners, with a proportional increase in their involvement in amateur street competition. Identification of the determinants of performance in this population appears necessary for optimization of time devoted to training. The objective of this study was to ascertain the association between estimated maximal oxygen uptake (VO2max, critical velocity (CV and VO2max velocity (VVO2max and athletic performance in the 3.6 km (uphill and 10 and 21.1 km (flatland events. Twelve amateur runners (nine male, mean age 36 ± 5 years underwent five tests: 1 and 5 km race on level ground, 3.6 km race with slope (≈8%, and indirect VO2max measurement. CV was determined from the linear relationship between distance and run time on the first two tests. The subjects then took part in two official 10 km and 21.1 km (half marathon races. VVO2max was calculated from the VO2max through a metabolic equation. VO2max showed the best association with running performance in the 10 and 21.1 km events. For the uphill race, VVO2max showed a better association. Overall, the variable with the highest average association was VO2max (0.91±0.07, followed by VVO2max (0.90±0.04 and VC (0.87±0.06. This study showed strong associations between physiological variables established by low-cost, user-friendly indirect methods and running performance in the 10 and 21.1 km (flatland and 3.6 km (uphill running events.
International Nuclear Information System (INIS)
Pacansky, J.; Waltman, R.J.
1991-01-01
Several poly(perfluoro ethers) are exposed to electron beams to study the mechanism for main chain scission. Electron beam exposures were performed with the viscous poly(perfluoro ethers) under argon gas, and also at 9 K under vacuum, to determine mechanistic details for the chemical degradation. Here the authors report that, after main chain scission of the bulk poly(perfluoro ethers), sample weight loss is observed concomitant with evolution of gaseous products. Since this suggests that some unzipping of the polymer chain occurs, the products were identified and, most importantly, the efficiency for their formation was determined in terms of G values, and compared to known G values for main chain scission. The results show that COF 2 is the major gaseous product produced from unbranched ethers while CF 4 and COF 2 are the major products from branched polymers. The gaseous products were also exposed to the high-energy electron beam and the G values for decomposition are given
Directory of Open Access Journals (Sweden)
Maurício Tragtenberg
1966-06-01
Full Text Available Max Weber inicia sua carreira universitária em 1893, como professor extraordinário de Direito Mercantil e Romano, na Universidade de Berlim. Em 1894 assume a Cadeira de Economia Política na Universidade de Hamburgo e em 1897 leciona na Universidade de Heidelberg.
Design of a pulsed angular selective electron gun for the KATRIN main spectrometer
Energy Technology Data Exchange (ETDEWEB)
Winzen, Daniel; Hannen, Volker; Ortjohann, Hans-Werner; Zacher, Michael; Weinheimer, Christian [Institut fuer Kernphysik, Westfaelische Wilhelms-Universitaet, Muenster (Germany); Collaboration: KATRIN-Collaboration
2012-07-01
The KATRIN (KArlsruhe TRItium Neutrino mass) experiment will study the tritium {beta}-spectrum near the endpoint of 18.6 keV, aiming to measure the mass of the electron antineutrino. Using an electrostatic retarding spectrometer (MAC-E-Filter), the projected sensitivity for m{sub ve} is 200 meV/c{sup 2} at 90% C.L. In order to map out the electric and magnetic fields in the main spectrometer, an angular selective electron gun is currently being developed. The e-gun uses an UV-Laser to produce electrons via the photo-electric effect from a copper substrate which are then accelerated electrostatically. It features a small energy spread of approx. 0.1 eV, a sharp emission angle and will be able to cover the whole magnetic flux tube of KATRIN. Using a pulsed laser it is also possible to investigate the time of flight (TOF) of electrons through the spectrometer, offering enhanced sensitivity to spectrometer properties far away from the analysing plane. By comparing information from transmission function measurements and TOF data with Monte Carlo simulations of the setup, one will be able to achieve a detailed understanding of the spectrometer properties.
Optimal resampling for the noisy OneMax problem
Liu, Jialin; Fairbank, Michael; Pérez-Liébana, Diego; Lucas, Simon M.
2016-01-01
The OneMax problem is a standard benchmark optimisation problem for a binary search space. Recent work on applying a Bandit-Based Random Mutation Hill-Climbing algorithm to the noisy OneMax Problem showed that it is important to choose a good value for the resampling number to make a careful trade off between taking more samples in order to reduce noise, and taking fewer samples to reduce the total computational cost. This paper extends that observation, by deriving an analytical expression f...
Max Reinhardt Haus Berliini / Triin Ojari
Ojari, Triin, 1974-
1998-01-01
Arhitekt Peter Eisenmani projekteeritud multifunktsionaalne maja on planeeritud II maailmasõjas hävinud Max Reinhardti teatrihoone kohale. Ühte hoonetahukasse kui uude maamärki on 'volditud' kokku aktiivse linnaelu kõik aspektid.
International Nuclear Information System (INIS)
Piantavini, Mário S.; Gonçalves, Alan G.; Trindade, Ângela C.L.B.; Noseda, Miguel D.; Mercê, Ana L.R.; Pontarolo, Roberto; Machado, Antonio E.H.
2017-01-01
Kojic acid (KA) is an organic acid widely used in pharmaceutical industry, mainly as a skin lightening agent. Based on the ability of KA to form complexes with ions, we found the most possible kind of complex formed with cation aluminum. KA-Al 3+ complex structures were studied using potentiometric and spectrophotometric (UV) titrations, FTIR and 13 C NMR. The electronic spectroscopy showed that the KA-Al 3+ complexes absorb at higher wavelengths (λ max = 305 nm) than do the non-complexed KA (λ max = 269 nm), confirming complexation. The IR spectra of KA complexed and not complexed allowed to correlate the changes in the absorption of enol and carbonyl groups in absence and presence of Al 3+ in aqueous solutions. The complexation suggested by the potentiometric titration and FTIR spectroscopy are in accordance with the data obtained from NMR results. Calculations based on quantum mechanics were utilized to understand the differences found in the non complexed and complexed KAH electronic spectra. (author)
E2GPR - Edit your geometry, Execute GprMax2D and Plot the Results!
Pirrone, Daniele; Pajewski, Lara
2015-04-01
In order to predict correctly the Ground Penetrating Radar (GPR) response from a particular scenario, Maxwell's equations have to be solved, subject to the physical and geometrical properties of the considered problem and to its initial conditions. Several techniques have been developed in computational electromagnetics, for the solution of Maxwell's equations. These methods can be classified into two main categories: differential and integral equation solvers, which can be implemented in the time or spectral domain. All of the different methods present compromises between computational efficiency, stability, and the ability to model complex geometries. The Finite-Difference Time-Domain (FDTD) technique has several advantages over alternative approaches: it has inherent simplicity, efficiency and conditional stability; it is suitable to treat impulsive behavior of the electromagnetic field and can provide either ultra-wideband temporal waveforms or the sinusoidal steady-state response at any frequency within the excitation spectrum; it is accurate and highly versatile; and it has become a mature and well-researched technique. Moreover, the FDTD technique is suitable to be executed on parallel-processing CPU-based computers and to exploit the modern computer visualisation capabilities. GprMax [1] is a very well-known and largely validated FDTD software tool, implemented by A. Giannopoulos and available for free public download on www.gprmax.com, together with examples and a detailled user guide. The tool includes two electromagnetic wave simulators, GprMax2D and GprMax3D, for the full-wave simulation of two-dimensional and three-dimensional GPR models. In GprMax, everything can be done with the aid of simple commands that are used to define the model parameters and results to be calculated. These commands need to be entered in a simple ASCII text file. GprMax output files can be stored in ASCII or binary format. The software is provided with MATLAB functions, which
The correction of electron lens aberrations
Energy Technology Data Exchange (ETDEWEB)
Hawkes, P.W., E-mail: peter.hawkes@cemes.fr
2015-09-15
The progress of electron lens aberration correction from about 1990 onwards is chronicled. Reasonably complete lists of publications on this and related topics are appended. A present for Max Haider and Ondrej Krivanek in the year of their 65th birthdays. By a happy coincidence, this review was completed in the year that both Max Haider and Ondrej Krivanek reached the age of 65. It is a pleasure to dedicate it to the two leading actors in the saga of aberration corrector design and construction. They would both wish to associate their colleagues with such a tribute but it is the names of Haider and Krivanek (not forgetting Joachim Zach) that will remain in the annals of electron optics, next to that of Harald Rose. I am proud to know that both regard me as a friend as well as a colleague. - Highlights: • Geometrical aberration correction. • Chromatic aberration correction. • 50 pm resolution. • High-resolution electron energy-loss spectroscopy. • Extensive bibliographies.
The correction of electron lens aberrations
International Nuclear Information System (INIS)
Hawkes, P.W.
2015-01-01
The progress of electron lens aberration correction from about 1990 onwards is chronicled. Reasonably complete lists of publications on this and related topics are appended. A present for Max Haider and Ondrej Krivanek in the year of their 65th birthdays. By a happy coincidence, this review was completed in the year that both Max Haider and Ondrej Krivanek reached the age of 65. It is a pleasure to dedicate it to the two leading actors in the saga of aberration corrector design and construction. They would both wish to associate their colleagues with such a tribute but it is the names of Haider and Krivanek (not forgetting Joachim Zach) that will remain in the annals of electron optics, next to that of Harald Rose. I am proud to know that both regard me as a friend as well as a colleague. - Highlights: • Geometrical aberration correction. • Chromatic aberration correction. • 50 pm resolution. • High-resolution electron energy-loss spectroscopy. • Extensive bibliographies
Elastic and Mechanical Properties of the MAX Phases
Barsoum, Michel W.; Radovic, Miladin
2011-08-01
The more than 60 ternary carbides and nitrides, with the general formula Mn+1AXn—where n = 1, 2, or 3; M is an early transition metal; A is an A-group element (a subset of groups 13-16); and X is C and/or N—represent a new class of layered solids, where Mn+1Xn layers are interleaved with pure A-group element layers. The growing interest in the Mn+1AXn phases lies in their unusual, and sometimes unique, set of properties that can be traced back to their layered nature and the fact that basal dislocations multiply and are mobile at room temperature. Because of their chemical and structural similarities, the MAX phases and their corresponding MX phases share many physical and chemical properties. In this paper we review our current understanding of the elastic and mechanical properties of bulk MAX phases where they differ significantly from their MX counterparts. Elastically the MAX phases are in general quite stiff and elastically isotropic. The MAX phases are relatively soft (2-8 GPa), are most readily machinable, and are damage tolerant. Some of them are also lightweight and resistant to thermal shock, oxidation, fatigue, and creep. In addition, they behave as nonlinear elastic solids, dissipating 25% of the mechanical energy during compressive cycling loading of up to 1 GPa at room temperature. At higher temperatures, they undergo a brittle-to-plastic transition, and their mechanical behavior is a strong function of deformation rate.
Microspectroscopy At Beamline 73 MAX-lab
International Nuclear Information System (INIS)
Engdahl, Anders
2010-01-01
Presentation of some projects at the infrared microspectroscopy experimental station at beamline 73 MAX-lab. Among the subjects are found identification of organic residues in fossil material and examination of the chemistry in an old oak wood wreck.
Analisis Kinerja Subscriber Station WiMAX di Urban Area Bandung
Directory of Open Access Journals (Sweden)
DWI ARYANTA
2017-06-01
Full Text Available ABSTRAK Teknologi komunikasi wireless semakin pesat mengalami perkembangan. WiMAX merupakan suatu teknologi broadband yang didukung oleh standar IEEE 802.16d (802.16-2004 yang mampu memberikan layanan data berkecepatan tinggi hingga 75 Mbps dalam radius maksimal 40-50 km pada bandwidth 20 MHz. Alokasi frekuensi yang dipakai Indonesia untuk jaringan WiMAX ini ialah 3,3 – 3,4 GHz. Penelitian ini dilakukan dengan melakukan proses pengukuran kinerja perangkat radio WiMAX yaitu HiMax 331-SS. Proses pengukuran dilakukan antara CPE dan base station dengan antenna sektoral 1200 pada ketinggian 45 m. Lokasi pengukuran dilakukan di beberapa area kota Bandung yang telah ditentukan sebelumnya. Hasil pengukuran memperlihatkan nilai CINR tertinggi adalah 31 dB dengan modulasi 64 QAM – ¾ dan terendah nilai 10 dB dengan modulasi BPSK 1/2. Nilai RSSI tertinggi -54 dBm berada dan nilai RSSI terendah -89 dBm. Nilai throughput tertinggi untuk layanan streaming video sebesar 1000,8 kbps (downlink dengan modulasi 64 QAM – ¾. Nilai delay terendah sebesar 56,247 ms pada kondisi LOS dan tertinggi sebesar 139,5 ms pada kondisi NLOS. Nilai terbesar packet loss sebesar 20% yaitu pada lokasi pengukuran terjauh 14,3 km. Kata Kunci : delay, packet loss, RSSI, CINR, throughput, CPE, WiMAX . ABSTRACT Wireless communication technologies have evolved more rapidly. WiMAX is a broadband technology that is supported by the IEEE standard 802.16-2004/d which is able to provide high speed data services of up to 75 Mbps within a radius of 40-50 km at a maximum bandwidth of 20 MHz. Indonesia frequency allocation used for the WiMAX network is 3.3 to 3.4 GHz. This study was conducted with the performance measurement process that is Himax 331 WiMAX radio - SS. Process measurement is made between the CPE and base station sector antennas at a height of 45 m in 1200. Locations measurements performed in several areas of Bandung predetermined. The measurement
Sequence-specific DNA binding by MYC/MAX to low-affinity non-E-box motifs.
Directory of Open Access Journals (Sweden)
Michael Allevato
Full Text Available The MYC oncoprotein regulates transcription of a large fraction of the genome as an obligatory heterodimer with the transcription factor MAX. The MYC:MAX heterodimer and MAX:MAX homodimer (hereafter MYC/MAX bind Enhancer box (E-box DNA elements (CANNTG and have the greatest affinity for the canonical MYC E-box (CME CACGTG. However, MYC:MAX also recognizes E-box variants and was reported to bind DNA in a "non-specific" fashion in vitro and in vivo. Here, in order to identify potential additional non-canonical binding sites for MYC/MAX, we employed high throughput in vitro protein-binding microarrays, along with electrophoretic mobility-shift assays and bioinformatic analyses of MYC-bound genomic loci in vivo. We identified all hexameric motifs preferentially bound by MYC/MAX in vitro, which include the low-affinity non-E-box sequence AACGTT, and found that the vast majority (87% of MYC-bound genomic sites in a human B cell line contain at least one of the top 21 motifs bound by MYC:MAX in vitro. We further show that high MYC/MAX concentrations are needed for specific binding to the low-affinity sequence AACGTT in vitro and that elevated MYC levels in vivo more markedly increase the occupancy of AACGTT sites relative to CME sites, especially at distal intergenic and intragenic loci. Hence, MYC binds diverse DNA motifs with a broad range of affinities in a sequence-specific and dose-dependent manner, suggesting that MYC overexpression has more selective effects on the tumor transcriptome than previously thought.
WiMAX technology and network evolution
Etemad, Kamran
2010-01-01
WiMAX, the Worldwide Interoperability for Microwave Access, represents a paradigm shift in telecommunications technology. It offers the promise of cheaper, smaller, and simpler technology compared to existing broadband options such as DSL, cable, fiber, and 3G wireless.
Nanostructured plasma etched, magnetron sputtered nanolaminar Cr2AlC MAX phase thin films
International Nuclear Information System (INIS)
Grieseler, Rolf; Hähnlein, Bernd; Stubenrauch, Mike; Kups, Thomas; Wilke, Marcus; Hopfeld, Marcus; Pezoldt, Jörg; Schaaf, Peter
2014-01-01
The knowledge of the mechanical properties of new materials determines essentially their usability and functionality when used in micro- and nanostructures. MAX phases are new and highly interesting materials due to their unique combination of materials properties. In this article a new method for producing the Cr 2 AlC MAX phase is presented. Thin film elemental multilayer deposition and subsequent rapid thermal annealing forms the MAX phase within seconds. Additionally, free standing microstructures (beams and cantilevers) based on this MAX phase films are prepared by plasma etching. The mechanical properties of these MAX phase microstructures are investigated
Jakobson, Max, 1923-2013
2003-01-01
Balti riikide NATOga liitumise mõjust julgeolekule Läänemere regioonis, Euroopa Liidu kaitsepoliitikast ning Venemaa ja islamiterrorismi ohust julgeolekule. Vt. samas: Toomas Hiio ülevaade Max Jakobsoni elust ja tegevusest
LTE, WiMAX and WLAN network design, optimization and performance analysis
Korowajczuk, Leonhard
2011-01-01
A technological overview of LTE and WiMAX LTE, WiMAX and WLAN Network Design, Optimization and Performance Analysis provides a practical guide to LTE and WiMAX technologies introducing various tools and concepts used within. In addition, topics such as traffic modelling of IP-centric networks, RF propagation, fading, mobility, and indoor coverage are explored; new techniques which increase throughput such as MIMO and AAS technology are highlighted; and simulation, network design and performance analysis are also examined. Finally, in the latter part of the book Korowajczuk gives a step-by-step
The development of a differential game related to terrorism: Min-Max differential game
Directory of Open Access Journals (Sweden)
Abd El-Monem A. Megahed
2017-07-01
Full Text Available In this work, we study a differential game related to terrorism: Min-Max differential game taking into account the governmental activities such as the education quality, increasing the chances of labor, social justice, religious awareness and security arrangements. A Min-Max differential game between government and terrorist organizations is considered in this study. To obtain the optimal strategy of solving this problem, we study the analytic form of a Min-Max differential game and the governmental activities. Furthermore, a saddle point of a Min-Max differential game is studied.
DEFF Research Database (Denmark)
Menzel, Karl Peter; Stadler, Peter F.; Gorodkin, Jan
2011-01-01
MOTIVATION: The task of reconstructing a genomic sequence from a particular species is gaining more and more importance in the light of the rapid development of high-throughput sequencing technologies and their limitations. Applications include not only compensation for missing data in unsequenced...... genomic regions and the design of oligonucleotide primers for target genes in species with lacking sequence information but also the preparation of customized queries for homology searches. RESULTS: We introduce the maxAlike algorithm, which reconstructs a genomic sequence for a specific taxon based...... on sequence homologs in other species. The input is a multiple sequence alignment and a phylogenetic tree that also contains the target species. For this target species, the algorithm computes nucleotide probabilities at each sequence position. Consensus sequences are then reconstructed based on a certain...
Huser, Raphaël
2018-01-09
Extreme-value theory for stochastic processes has motivated the statistical use of max-stable models for spatial extremes. However, fitting such asymptotic models to maxima observed over finite blocks is problematic when the asymptotic stability of the dependence does not prevail in finite samples. This issue is particularly serious when data are asymptotically independent, such that the dependence strength weakens and eventually vanishes as events become more extreme. We here aim to provide flexible sub-asymptotic models for spatially indexed block maxima, which more realistically account for discrepancies between data and asymptotic theory. We develop models pertaining to the wider class of max-infinitely divisible processes, extending the class of max-stable processes while retaining dependence properties that are natural for maxima: max-id models are positively associated, and they yield a self-consistent family of models for block maxima defined over any time unit. We propose two parametric construction principles for max-id models, emphasizing a point process-based generalized spectral representation, that allows for asymptotic independence while keeping the max-stable extremal-$t$ model as a special case. Parameter estimation is efficiently performed by pairwise likelihood, and we illustrate our new modeling framework with an application to Dutch wind gust maxima calculated over different time units.
Albert Einstein and his mentor Max Talmey. The seventh Charles B. Snyder Lecture.
Ravin, J G
1997-01-01
While he was a student at the Munich medical school, Max Talmey strongly influenced the education of Albert Einstein. Their association occurred during five years of Einstein's second decade. They lost contact for many years after each left Munich. Talmey emigrated to the United States and practiced medicine, mainly ophthalmology, in New York City. He made significant contributions to medicine, to the popularization of Einstein's work, and to the development of international languages. The relationship of Talmey and Einstein was rekindled when Einstein visited and later moved to the United States.
Augmentative Device Helps Max Speak. PACER Center ACTion Information Sheets. PHP-c75
PACER Center, 2014
2014-01-01
This Action Information Sheet follows a family's process of selecting and using augmentative and alternative communication to help their young son, Max, speak. Max is affected by global dyspraxia, which makes learning new motor skills--especially speech--quite difficult. For the first years of his life, Max could not say words. Before he and his…
Robergs, R A; Quintana, R; Parker, D L; Frankel, C C
1998-06-01
We used multiple regression analyses to determine the relationships between the decrement in sea level (SL, 760 Torr) VO2max during hypobaric hypoxia (HH) and variables that could alter or be related to the decrement in VO2max. HH conditions consisted of 682 Torr, 632 Torr, and 566 Torr, and the measured independent variables were SL-VO2max, SL lactate threshold (SL-LT), the change in hemoglobin saturation at VO2max between 760 and 566 Torr (delta SaO2max), lean body mass (LBM), and gender. Male (N = 14) and female (N = 14) subjects of varied fitness, training status, and residential altitude (1,640-2,460 m) completed cycle ergometry tests of VO2max at each HH condition under randomized and single-blinded conditions. VO2max decreased significantly from 760 Torr after 682 Torr (approximately 915 m) (3.5 +/- 0.9 to 3.4 +/- 0.8 L.min-1, P = 0.0003). Across all HH conditions, the slope of the relative decrement in VO2max (%VO2max) during HH was -9.2%/100 mm Hg (-8.1%/1000 m) with an initial decrease from 100% estimated to occur below 705 Torr (610 m). Step-wise multiple regression revealed that SL-VO2max, SL-LT, delta SaO2max, LBM, and gender each significantly combined to account for 89.03% of the variance in the decrement in VO2max (760-566 Torr) (P decrement in VO2max during HH. The unique variance explanation afforded by SL-LT, LBM, and gender suggests that issues pertaining to oxygen diffusion within skeletal muscle may add to the explanation of between subjects variability in the decrement in VO2max during HH.
Epidemiologia e geografia: o complexo patogênico de Max. Sorre
Ferreira, Marcelo Urbano
1991-01-01
Apresentam-se alguns traços essenciais do conceito de complexo patogênico, formulado pelo geógrafo francês Max. Sorre, com o objetivo de estimular estudos de integração entre a epidemiologia e a geografia.Some essential features of the pathogenic complex concept formulated by the French geographer Max. Sorre are presented, aiming at integrating epidemiological and geografic studies.
V/V(max) test applied to SMM gamma-ray bursts
Matz, S. M.; Higdon, J. C.; Share, G. H.; Messina, D. C.; Iadicicco, A.
1992-01-01
We have applied the V/V(max) test to candidate gamma-ray bursts detected by the Gamma-Ray Spectrometer (GRS) aboard the SMM satellite to examine quantitatively the uniformity of the burst source population. For a sample of 132 candidate bursts identified in the GRS data by an automated search using a single uniform trigger criterion we find average V/V(max) = 0.40 +/- 0.025. This value is significantly different from 0.5, the average for a uniform distribution in space of the parent population of burst sources; however, the shape of the observed distribution of V/V(max) is unusual and our result conflicts with previous measurements. For these reasons we can currently draw no firm conclusion about the distribution of burst sources.
A Modified MinMax k-Means Algorithm Based on PSO.
Wang, Xiaoyan; Bai, Yanping
The MinMax k -means algorithm is widely used to tackle the effect of bad initialization by minimizing the maximum intraclustering errors. Two parameters, including the exponent parameter and memory parameter, are involved in the executive process. Since different parameters have different clustering errors, it is crucial to choose appropriate parameters. In the original algorithm, a practical framework is given. Such framework extends the MinMax k -means to automatically adapt the exponent parameter to the data set. It has been believed that if the maximum exponent parameter has been set, then the programme can reach the lowest intraclustering errors. However, our experiments show that this is not always correct. In this paper, we modified the MinMax k -means algorithm by PSO to determine the proper values of parameters which can subject the algorithm to attain the lowest clustering errors. The proposed clustering method is tested on some favorite data sets in several different initial situations and is compared to the k -means algorithm and the original MinMax k -means algorithm. The experimental results indicate that our proposed algorithm can reach the lowest clustering errors automatically.
Multivariate Max-Stable Spatial Processes
Genton, Marc G.
2014-01-06
Analysis of spatial extremes is currently based on univariate processes. Max-stable processes allow the spatial dependence of extremes to be modelled and explicitly quantified, they are therefore widely adopted in applications. For a better understanding of extreme events of real processes, such as environmental phenomena, it may be useful to study several spatial variables simultaneously. To this end, we extend some theoretical results and applications of max-stable processes to the multivariate setting to analyze extreme events of several variables observed across space. In particular, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. Then, we define a Poisson process construction in the multivariate setting and introduce multivariate versions of the Smith Gaussian extremevalue, the Schlather extremal-Gaussian and extremal-t, and the BrownResnick models. Inferential aspects of those models based on composite likelihoods are developed. We present results of various Monte Carlo simulations and of an application to a dataset of summer daily temperature maxima and minima in Oklahoma, U.S.A., highlighting the utility of working with multivariate models in contrast to the univariate case. Based on joint work with Simone Padoan and Huiyan Sang.
Boudenot, Jean-Claude
2016-01-01
« Les atomes, dit Jean Perrin en 1913, ne sont pas ces éléments éternels et insécables dont l'irréductible simplicité donnait au possible une borne, et, dans leur inimaginable petitesse, nous commençons à pressentir un fourmillement prodigieux de mondes nouveaux ». C'est bien dans un monde totalement nouveau, le monde quantique, que nous a fait pénétrer la découverte des quanta par Max Planck. Son article de 1900 est le déclencheur de l'une des plus grandes révolutions scientifiques de tous les temps. Les trente années qui suivent sont les plus riches de la physique ; Planck, Einstein, Bohr, Sommerfeld, de Broglie, Schrödinger, Heisenberg, Dirac, Born, Pauli… reconstruisent la physique sur de nouvelles bases sur fond de conflit des générations. Le monde est par ailleurs secoué par la guerre, Max Planck est tourmenté et vit des épreuves personnelles dramatiques. C'est l'homme, aussi bien que l'oeuvre, que les auteurs ont tenté de dépeindre dans cet ouvrage. Ils ont également souhait�...
Multivariate Max-Stable Spatial Processes
Genton, Marc G.
2014-01-01
Analysis of spatial extremes is currently based on univariate processes. Max-stable processes allow the spatial dependence of extremes to be modelled and explicitly quantified, they are therefore widely adopted in applications. For a better understanding of extreme events of real processes, such as environmental phenomena, it may be useful to study several spatial variables simultaneously. To this end, we extend some theoretical results and applications of max-stable processes to the multivariate setting to analyze extreme events of several variables observed across space. In particular, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. Then, we define a Poisson process construction in the multivariate setting and introduce multivariate versions of the Smith Gaussian extremevalue, the Schlather extremal-Gaussian and extremal-t, and the BrownResnick models. Inferential aspects of those models based on composite likelihoods are developed. We present results of various Monte Carlo simulations and of an application to a dataset of summer daily temperature maxima and minima in Oklahoma, U.S.A., highlighting the utility of working with multivariate models in contrast to the univariate case. Based on joint work with Simone Padoan and Huiyan Sang.
HEART RATE VARIABILITY AND BODY COMPOSITION AS VO2MAX DETERMINANTS
Directory of Open Access Journals (Sweden)
Henry Humberto León-Ariza
Full Text Available ABSTRACT Introduction: The maximum oxygen consumption (VO2max is the gold standard in the cardiorespiratory endurance assessment. Objective: This study aimed to develop a mathematical model that contains variables to determine the VO2max of sedentary people. Methods: Twenty participants (10 men and 10 women with a mean age of 19.8±1.77 years were included. For each participant, body composition (percentage of fat and muscle, heart rate variability (HRV at rest (supine and standing, and VO2max were evaluated through an indirect test on a cycloergometer. A multivariate linear regression model was developed from the data obtained, and the model assumptions were verified. Results: Using the data obtained, including percentage of fat (F, percentage of muscle (M, percentage of power at very low frequency (VLF, α-value of the detrended fluctuation analysis (DFAα1, heart rate (HR in the resting standing position, and age of the participants, a model was established for men, which was expressed as VO2max = 4.216 + (Age*0.153 + (F*0.110 - (M*0.053 - (VLF*0.649 - (DFAα1*2.441 - (HR*0.014, with R2 = 0.965 and standard error = 0.146 L/min. For women, the model was expressed as VO2max = 1.947 - (Age*0.047 + (F*0.024 + (M*0.054 + (VLF*1.949 - (DFAα1*0.424 - (HR*0.019, with R2 = 0.987 and standard error = 0.077 L/min. Conclusion: The obtained model demonstrated the influence exerted by body composition, the autonomic nervous system, and age in the prediction of VO2max.
Epidemiologia e geografia: o complexo patogênico de Max. Sorre
Directory of Open Access Journals (Sweden)
Marcelo Urbano Ferreira
1991-09-01
Full Text Available Apresentam-se alguns traços essenciais do conceito de complexo patogênico, formulado pelo geógrafo francês Max. Sorre, com o objetivo de estimular estudos de integração entre a epidemiologia e a geografia.Some essential features of the pathogenic complex concept formulated by the French geographer Max. Sorre are presented, aiming at integrating epidemiological and geografic studies.
Oxidation behaviour of a Ti2AlN MAX-phase coating
International Nuclear Information System (INIS)
Wang Qimin; Kim, Kwangho; Garkas, W; Renteria, A Flores; Leyens, C; Sun Chao
2011-01-01
In this paper, we reported the oxidation behaviour of Ti 2 AlN coatings on a -TiAl substrate. The coatings composed mainly of Ti 2 AlN MAX phase were obtained by magnetron sputtering and subsequent vacuum annealing. Isothermal oxidation tests at 700-900 deg. C were performed in air. The results indicated that the oxidation resistance of the -TiAl alloy can be improved by depositing a Ti 2 AlN layer on the alloy surface, especially at high temperatures. An Al-rich oxide scale formed on the coating surfaces during oxidation. This scale acts as diffusion barrier blocking the ingress of oxidation, and effectively protects the coated alloys from further oxidation attack.
Using MaxCompiler for High Level Synthesis of Trigger Algorithms
Summers, Sioni Paris; Sanders, P.
2017-01-01
Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.
Clinical implementation of MOSFET detectors for dosimetry in electron beams
International Nuclear Information System (INIS)
Bloemen-van Gurp, Esther J.; Minken, Andre W.H.; Mijnheer, Ben J.; Dehing-Oberye, Cary J.G.; Lambin, Philippe
2006-01-01
Background and purpose: To determine the factors converting the reading of a MOSFET detector placed on the patient's skin without additional build-up to the dose at the depth of dose maximum (D max ) and investigate their feasibility for in vivo dose measurements in electron beams. Materials and methods: Factors were determined to relate the reading of a MOSFET detector to D max for 4-15 MeV electron beams in reference conditions. The influence of variation in field size, SSD, angle and field shape on the MOSFET reading, obtained without additional build-up, was evaluated using 4, 8 and 15 MeV beams and compared to ionisation chamber data at the depth of dose maximum (z max ). Patient entrance in vivo measurements included 40 patients, mostly treated for breast tumours. The MOSFET reading, converted to D max , was compared to the dose prescribed at this depth. Results: The factors to convert MOSFET reading to D max vary between 1.33 and 1.20 for the 4 and 15 MeV beams, respectively. The SSD correction factor is approximately 8% for a change in SSD from 95 to 100 cm, and 2% for each 5-cm increment above 100 cm SSD. A correction for fields having sides smaller than 6 cm and for irregular field shape is also recommended. For fields up to 20 x 20 cm 2 and for oblique incidence up to 45 deg., a correction is not necessary. Patient measurements demonstrated deviations from the prescribed dose with a mean difference of -0.7% and a standard deviation of 2.9%. Conclusion: Performing dose measurements with MOSFET detectors placed on the patient's skin without additional build-up is a well suited technique for routine dose verification in electron beams, when applying the appropriate conversion and correction factors
International Nuclear Information System (INIS)
Gavrilov, V.V.; Torokhova, N.V.; Fasakhov, I.K.
1986-01-01
Recombination radiation effect on the relation of signals behind the filters depending on the plasma temperature(sorption method for T determination) is demonstrated. This factor produces the main effect on the method accuracy (100-400%), the other factors analysed in combination make an error in temperature at the level of 50%. Method of plasma electron distribution function reconstruction by continuous x-radiation spectrum, based on the correctness (under certain limitations for the required function) of the equation, linking the electron distribution function with bremmsstrahlung spectral density is presented
On the spectrum in max algebra
Czech Academy of Sciences Publication Activity Database
Müller, Vladimír; Peperko, A.
2015-01-01
Roč. 485, November (2015), s. 250-266 ISSN 0024-3795 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : non-negativ matrices * max algebra * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015 http://www.sciencedirect.com/science/article/pii/S0024379515004139
Wang, Zhenyu; Liu, Jingzhou; Wang, Li; Li, Xiaowei; Ke, Peiling; Wang, Aiying
2017-02-01
Ti2AlN belongs to a family of ternary nano-laminate alloys known as the MAX phases, which exhibit a unique combination of metallic and ceramic properties. In the present work, the dense and high-stability Ti2AlN coating has been successfully prepared through the combined cathodic arc/sputter deposition, followed by heat post-treatment. It was found that the as-deposited Ti-Al-N coating behaved a multilayer structure, where (Ti, N)-rich layer and Al-rich layer grew alternately, with a mixed phase constitution of TiN and TiAlx. After annealing at 800 °C under vacuum condition for 1.5 h, although the multilayer structure still was found, part of multilayer interfaces became indistinct and disappeared. In particular, the thickness of the Al-rich layer decreased in contrast to that of as-deposited coating due to the inner diffusion of the Al element. Moreover, the Ti2AlN MAX phase emerged as the major phase in the annealed coatings and its formation mechanism was also discussed in this study. The vacuum thermal analysis indicated that the formed Ti2AlN MAX phase exhibited a high-stability, which was mainly benefited from the large thickness and the dense structure. This advanced technique based on the combined cathodic arc/sputter method could be extended to deposit other MAX phase coatings with tailored high performance like good thermal stability, high corrosion and oxidation resistance etc. for the next protective coating materials.
Wandering ethos and romantic spirit: Reflections following the trail of Max Weber's sociology
Directory of Open Access Journals (Sweden)
Jeremić-Molnar Dragana
2013-01-01
Full Text Available First part of the article is devoted to the main categories of Max Weber's historicist sociology: ethos and spirit. The authors are examining his concepts of capitalist spirit and protestant spirit and, relaying especially on Weber's unfinished treatise on music, contemplating the missing concept of romantic spirit, which could be tied with wandering ethos. In the second part of article, they are separating the phenomena of wandering (moving without purpose or goal from travelling (moving towards the determined end and analysing the possibilities of re-constructing the wandering ethos in context of emerging early Romanticism. In the end they are dealing with the main change the wandering underwent in 18th Century and early 19th Century: from despised activity practiced by social outcasts only (with few exceptions such as journeymen and merchants to the tool of regeneration.
MAXIMAL OXIGEN UPTAKE (VO2 MAX AS THE INDICATOR OF PHYSICAL WORKING CAPACITY IN SPORTSMEN
Directory of Open Access Journals (Sweden)
Zvezdana Rajkovaca
2005-12-01
Full Text Available The term “aerobic capacity” represents the sum of aerobic metabolic processes in human organism. It is the basis of the physical working capacity. Value of the maximal oxygen uptake (VO2max is the best indicator for the aerobic capacity evaluation.The purpose of this study was to check the possibility of using VO2max as the indicator of aerobic capacity in sportsmen and to check differences in VO2max values in regard to non-sportsmen.The goals were: 1.Analyses of the VO2max values in sportsmen of various sports 2. Comparison of values of sportsmen with the values of non-sportsmen.This study included 67 sportsmen (rowers, football players and judoists and 28 nonsportsmen. VO2max was measured by using a direct method.The results obtained show statistically higher VO2max values in rowers (4,52 L/min - 55,8 mL/kg/min in regard to football players (4,2 L/min – 53,6 mL/kg/min, judoists (3,58 L/min - 47,2 mL/ kg/min and non-sportsmen (3,28 L/min – 42,3 mL/kg/min. Successful rowing requires high anaerobic capacity and, therefore, high VO2max.These results show higher values of VO2max in sportsmen in regard to non-sportsmen, which is the result of training only.
Nonlinear bound on unstable field energy in relativistic electron beams and plasmas
International Nuclear Information System (INIS)
Davidson, R.C.; Yoon, P.H.
1989-01-01
This paper makes use of Fowler's method [J. Math Phys. 4, 559 (1963)] to determine the nonlinear thermodynamic bound on field energy in unstable plasmas or electron beams in which the electrons are relativistic. Treating the electrons as the only active plasma component, the nonlinear Vlasov--Maxwell equations and the associated global conservation constraints are used to calculate the lowest upper bound on the field energy [ΔE-script/sub F/]/sub max/ that can evolve for the general initial electron distribution function f/sub b//sub / 0 equivalentf/sub b/(x,p,0). The results are applied to three choices of the initial distribution function f/sub b//sub / 0 . Two of the distribution functions have an inverted population in momentum p/sub perpendicular/ perpendicular to the magnetic field B 0 e/sub z/, and the third distribution function reduces to a bi-Maxwellian in the nonrelativistic limit. The lowest upper bound on the efficiency of radiation generation, eta/sub max/ = [ΔE-script/sub F/]/sub max//[V -1 ∫ d 3 x∫ d 3 p(γ-1)mc 2 f/sub b//sub / 0 ], is calculated numerically over a wide range of system parameters for varying degrees of initial anisotropy
Analisis Throughput Varian TCP Pada Model Jaringan WiMAX
Directory of Open Access Journals (Sweden)
Medi Taruk
2016-07-01
Full Text Available Transmission Control Protocol (TCP is a protocol that works at the transport layer of the OSI model. TCP was originally designed more destined for a wired network. However, to meet the need for the development of a very fast network technology based on the needs of the use by the user, it needs further development to the use of TCP on wireless devices. One implementation of a wireless network based on Worldwide Interoperability for Microwave Access (WiMAX network is a model that offers a variety advantage, particularly in terms of access speed. In this case, use NS-2 to see throughput at TCP variants tested, namely TCP-Tahoe, TCP-Reno, TCP-Vegas, and TCP-SACK over WiMAX network model, with few observations scenarios. The first is a look at each of these variants throughput of TCP when only one particular variant of the work in the network. Second observe all variants of TCP throughput at the same time and have the equivalent QoS, but with the possibility of a small congestion based on the capacity of the link is made sufficient. Third observed throughput with multi congestion. In WiMAX network has scheduling services are UGS, rtPS and ertPS using UDP protocol and nrtPS and BE using the TCP Protocol. By using the software network simulator (NS-2 to obtain performance comparison TCP protocol-based services on the WiMAX network with QoS parameters are throughput, packet loss, fairness and time delay.
The effect of cloud screening on MAX-DOAS aerosol retrievals.
Gielen, Clio; Van Roozendael, Michel; Hendrik, Francois; Fayt, Caroline; Hermans, Christian; Pinardi, Gaia; De Backer, Hugo; De Bock, Veerle; Laffineur, Quentin; Vlemmix, Tim
2014-05-01
In recent years, ground-based multi-axis differential absorption spectroscopy (MAX-DOAS) has shown to be ideally suited for the retrieval of tropospheric trace gases and deriving information on the aerosol properties. These measurements are invaluable to our understanding of the physics and chemistry of the atmospheric system, and the impact on the Earth's climate. Unfortunately, MAX-DOAS measurements are often performed under strong non-clear-sky conditions, causing strong data quality degradation and uncertainties on the retrievals. Here we present the result of our cloud-screening method, using the colour index (CI), on aerosol retrievals from MAX-DOAS measurements (AOD and vertical profiles). We focus on two large data sets, from the Brussels and Beijing area. Using the CI we define 3 different sky conditions: bad (=full thick cloud cover/extreme aerosols), mediocre (=thin clouds/aerosols) and good (=clear sky). We also flag the presence of broken/scattered clouds. We further compare our cloud-screening method with results from cloud-cover fractions derived from thermic infrared measurements. In general, our method shows good results to qualify the sky and cloud conditions of MAX-DOAS measurements, without the need for other external cloud-detection systems. Removing data under bad-sky and broken-cloud conditions results in a strongly improved agreement, in both correlation and slope, between the MAX-DOAS aerosol retrievals and data from other instruments (e.g. AERONET, Brewer). With the improved AOD retrievals, the seasonal and diurnal variations of the aerosol content and vertical distribution at both sites can be investigated in further detail. By combining with additional information derived by other instruments (Brewer, lidar, ...) operated at the stations, we will further study the observed aerosol characteristics, and their influence on and by meteorological conditions such as clouds and/or the boundary layer height.
Directory of Open Access Journals (Sweden)
Thomas Michael Bohnert
2008-01-01
Full Text Available The IEEE 802.16 standard provides a specification for a fixed and mobile broadband wireless access system, offering high data rate transmission of multimedia services with different Quality-of-Service (QoS requirements through the air interface. The WiMAX Forum, going beyond the air interface, defined an end-to-end WiMAX network architecture, based on an all-IP platform in order to complete the standards required for a commercial rollout of WiMAX as broadband wireless access solution. As the WiMAX network architecture is only a functional specification, this paper focuses on an innovative solution for an end-to-end WiMAX network architecture offering in compliance with the WiMAX Forum specification. To our best knowledge, this is the first WiMAX architecture built by a research consortium globally and was performed within the framework of the European IST project WEIRD (WiMAX Extension to Isolated Research Data networks. One of the principal features of our architecture is support for end-to-end QoS achieved by the integration of resource control in the WiMAX wireless link and the resource management in the wired domains in the network core. In this paper we present the architectural design of these QoS features in the overall WiMAX all-IP framework and their functional as well as performance evaluation. The presented results can safely be considered as unique and timely for any WiMAX system integrator.
The Dangers of Estimating V˙O2max Using Linear, Nonexercise Prediction Models.
Nevill, Alan M; Cooke, Carlton B
2017-05-01
This study aimed to compare the accuracy and goodness of fit of two competing models (linear vs allometric) when estimating V˙O2max (mL·kg·min) using nonexercise prediction models. The two competing models were fitted to the V˙O2max (mL·kg·min) data taken from two previously published studies. Study 1 (the Allied Dunbar National Fitness Survey) recruited 1732 randomly selected healthy participants, 16 yr and older, from 30 English parliamentary constituencies. Estimates of V˙O2max were obtained using a progressive incremental test on a motorized treadmill. In study 2, maximal oxygen uptake was measured directly during a fatigue limited treadmill test in older men (n = 152) and women (n = 146) 55 to 86 yr old. In both studies, the quality of fit associated with estimating V˙O2max (mL·kg·min) was superior using allometric rather than linear (additive) models based on all criteria (R, maximum log-likelihood, and Akaike information criteria). Results suggest that linear models will systematically overestimate V˙O2max for participants in their 20s and underestimate V˙O2max for participants in their 60s and older. The residuals saved from the linear models were neither normally distributed nor independent of the predicted values nor age. This will probably explain the absence of a key quadratic age term in the linear models, crucially identified using allometric models. Not only does the curvilinear age decline within an exponential function follow a more realistic age decline (the right-hand side of a bell-shaped curve), but the allometric models identified either a stature-to-body mass ratio (study 1) or a fat-free mass-to-body mass ratio (study 2), both associated with leanness when estimating V˙O2max. Adopting allometric models will provide more accurate predictions of V˙O2max (mL·kg·min) using plausible, biologically sound, and interpretable models.
Cross-layer ultrasound video streaming over mobile WiMAX and HSUPA networks.
Alinejad, Ali; Philip, Nada Y; Istepanian, Robert S H
2012-01-01
It is well known that the evolution of 4G-based mobile multimedia network systems will contribute significantly to future mobile healthcare (m-health) applications that require high bandwidth and fast data rates. Central to the success of such emerging applications is the compatibility of broadband networks, such as mobile Worldwide Interoperability For Microwave Access (WiMAX) and High-Speed Uplink Packet Access (HSUPA), and especially their rate adaption issues combined with the acceptable real-time medical quality of service requirements. In this paper, we address the relevant challenges of cross-layer design requirements for real-time rate adaptation of ultrasound video streaming in mobile WiMAX and HSUPA networks. A comparative performance analysis of such approach is validated in two experimental m-health test bed systems for both mobile WiMAX and HSUPA networks. The experimental results have shown an improved performance of mobile WiMAX compared to the HSUPA using the same cross-layer optimization approach.
Hou, Bin; Ma, Xiaohua; Yang, Ling; Zhu, Jiejie; Zhu, Qing; Chen, Lixiang; Mi, Minhan; Zhang, Hengshuang; Zhang, Meng; Zhang, Peng; Zhou, Xiaowei; Hao, Yue
2017-07-01
In this paper, a normally-off AlGaN/GaN high-electron-mobility transistors (HEMT) fabricated using inductively coupled plasma (ICP) CF4 plasma recessing and an implantation technique is reported. A gate-to-channel distance of ˜10 nm and an equivalent negative fluorine sheet charge density of -1.21 × 1013 cm-2 extracted using a simple threshold voltage (V th) analytical model result in a high V th of 1.5 V, a peak transconductance of 356 mS/mm, and a subthreshold slope of 133 mV/decade. A small degradation of channel mobility leads to a high RF performance with f T/f max of 41/125 GHz, resulting in a record high f T × L g product of 10.66 GHz·µm among Schottky barrier AlGaN/GaN normally-off HEMTs with V th exceeding 1 V, to the best of our knowledge.
Coplanar Waveguide Fed Compact Wide Circular-Slotted Antenna for Wi-Fi/WiMAX Applications
Directory of Open Access Journals (Sweden)
M. Samsuzzaman
2014-01-01
Full Text Available A coplanar waveguide (CPW fed printing and wide circular slotted, dual band antenna for Wi-Fi/WiMAX applications are presented. The antenna mainly encompasses a ground with a wide circular slot in the centre, a rectangular feeding strip, and two pairs of symmetric planar inverted L (SPIL strips connecting with the slotted ground. The tuning effects of the rectangular patch, ground size, and SPIL strips to the resonance and matching condition are examined by HFSS and the prototype is fabricated and measured. The simulation and experimental results show that the antenna has an impedance bandwidth with −10 dB reflection coefficients 600 MHz (3.26–3.86 GHz, lower band and 1040 MHz (5.02–6.26 GHz, upper band, which can cover both the Wi-Fi 5.2/5.5/5.8 GHz and WiMAX 3.3/3.5/3.7/5.8 GHz bands. Moreover, a stable omnidirectional radiation pattern and average peak gain for lower band 3.23 dB and upper band 5.93 dB have been achieved, respectively.
Energy Technology Data Exchange (ETDEWEB)
Piantavini, Mário S.; Gonçalves, Alan G.; Trindade, Ângela C.L.B.; Noseda, Miguel D.; Mercê, Ana L.R.; Pontarolo, Roberto, E-mail: pontarolo@ufpr.br [Universidade Federal do Paraná (UFPR), Curitiba (Brazil); Machado, Antonio E.H. [Universidade Federal de Uberlândia (UFU), MG (Brazil)
2017-08-15
Kojic acid (KA) is an organic acid widely used in pharmaceutical industry, mainly as a skin lightening agent. Based on the ability of KA to form complexes with ions, we found the most possible kind of complex formed with cation aluminum. KA-Al{sup 3+} complex structures were studied using potentiometric and spectrophotometric (UV) titrations, FTIR and {sup 13}C NMR. The electronic spectroscopy showed that the KA-Al{sup 3+} complexes absorb at higher wavelengths (λ{sub max}= 305 nm) than do the non-complexed KA (λ{sub max}= 269 nm), confirming complexation. The IR spectra of KA complexed and not complexed allowed to correlate the changes in the absorption of enol and carbonyl groups in absence and presence of Al{sup 3+} in aqueous solutions. The complexation suggested by the potentiometric titration and FTIR spectroscopy are in accordance with the data obtained from NMR results. Calculations based on quantum mechanics were utilized to understand the differences found in the non complexed and complexed KAH electronic spectra. (author)
Directory of Open Access Journals (Sweden)
Paulo Henrique Silva Marques de Azevedo
2010-08-01
Full Text Available Foi investigada a influência do gênero no tempo limite (Tlim e na cinética do VO2 durante corrida na velocidade associada ao VO2max (vVO2max em nove homens e nove mulheres, todos adultos, jovens e sedentários, com idades entre 20 e 30 anos. Homens e mulheres realizaram dois testes em esteira rolante, sendo um teste incremental para determinar VO2max (42,66 ± 4,50 vs. 32,92 ± 6,03mL.kg-1.min-1 e vVO2max (13.2 ± 1.5 vs. 10,3 ± 2,0km.h-1, respectivamente. Um segundo teste com carga constante na vVO2max até a exaustão. O Tlim e a cinética do VO2 foram determinados. Não houve diferença significante entre homens e mulheres para constante de tempo (τ (35,76 ± 21,03 vs. 36,5 ± 6,21s, respectivamente; P = 0,29; Tlim (308 ± 84,3 vs. 282,11 ± 57,19s, respectivamente; P = 0,68, tempo para atingir o VO2max (TAVO2max (164,48 ± 96,73 vs. 167,88 ± 28,59s, respectivamente; P = 0,29, tempo para atingir o VO2max em percentual do Tlim (%Tlim (50,24 ± 16,93 vs. 62,63 ± 16,60%, respectivamente; P = 0,19, tempo mantido no VO2max (TMVO2max (144,08 ± 42,55 vs. 114,23 ± 76,96s, respectivamente; P = 0,13. Estes resultados sugerem que a cinética do VO2 e o Tlim são similares entre homens e mulheres sedentários na vVO2max.The aim of this study was to investigate the influence of gender on Tthre and VO2 response during running exercise performed at vVO2max. Therefore, eighteen untrained individuals (9 male and 9 female with normal weight and aged between 20 - 30 years (VO2max = 42.66 ± 4.50 vs 32.92 ± 6.03 mL.kg-1.min-1 and vVO2max = 13.2 ± 1.5 vs 10.3 ± 2.0 km.h-1, for male and female, respectively were assessed. Subjects performed two exercise tests on treadmill. First one was an incremental test to determine VO2max, velocity at VO2max (vVO2max and second test was performed at steady velocity - vVO2max - until exhaustion. The threshold time (Tthre and VO2 kinetics response was determined. No significant differences were observed between men
Oxidation behaviour of a Ti{sub 2}AlN MAX-phase coating
Energy Technology Data Exchange (ETDEWEB)
Wang Qimin; Kim, Kwangho [National Core Research Center for Hybrid Materials Solution, Pusan National University, Busan 609-735 (Korea, Republic of); Garkas, W; Renteria, A Flores [Chair of Physical Metallurgy and Materials Technology, Technical University of Brandenburg at Cottbus, 03046 Cottbus (Germany); Leyens, C [Institute of Materials Science, Technical University of Dresden, Helmholtzstrasse 7, 01069 Dresden (Germany); Sun Chao, E-mail: qmwang@pusan.ac.kr, E-mail: kwhokim@pusan.ac.kr [Division of Surface Engineering of Materials, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)
2011-10-29
In this paper, we reported the oxidation behaviour of Ti{sub 2}AlN coatings on a -TiAl substrate. The coatings composed mainly of Ti{sub 2}AlN MAX phase were obtained by magnetron sputtering and subsequent vacuum annealing. Isothermal oxidation tests at 700-900 deg. C were performed in air. The results indicated that the oxidation resistance of the -TiAl alloy can be improved by depositing a Ti{sub 2}AlN layer on the alloy surface, especially at high temperatures. An Al-rich oxide scale formed on the coating surfaces during oxidation. This scale acts as diffusion barrier blocking the ingress of oxidation, and effectively protects the coated alloys from further oxidation attack.
[Psychiatry as cultural science: considerations following Max Weber].
Bormuth, M
2010-11-01
Psychiatry can be seen as a natural and cultural science. According to this the postulate of freedom is its strong value judgment. Since the times of enlightenment it has been described metaphorically by the myth of the expulsion from Paradise. Following Max Weber and Wilhelm Dilthey, Karl Jaspers has introduced this perspective into psychiatry. His strict dichotomy between explaining and understanding has later been critically revised by Werner Janzarik and Hans Heimann. Their concepts of structure dynamic, of pathography and of anthropology are closer to Max Weber who connected natural and cultural sciences in a much stronger way. Especially the pathographic example of Nietzsche allows to demonstrate the differences between Jaspers and the later psychopathologists of the Heidelberg and Tübingen schools.
Directory of Open Access Journals (Sweden)
Yongfeng Qiu
2017-11-01
Full Text Available Strong electromagnetic fields are radiated during the operation of the intense electron-beam accelerator (IEBA, which may lead to the nearby electronic devices out of order. In this paper, the research on the electromagnetic radiation characteristic of the gas main switch of a capacitive IEBA is carried out by the methods of theory analysis and experiment investigation. It is obtained that the gas main switch is the dominating radiation resource. In the absence of electromagnetic shielding for the gas main switch, when the pulse forming line of the IEBA is charged to 700 kV, the radiation field with amplitude of 3280 V/m, dominant frequency of 84 MHz and high frequency 100 MHz is obtained at a distance of 10 meters away from the gas main switch. The experimental results of the radiation field agree with the theoretical calculations. We analyze the achievements of several research groups and find that there is a relationship between the rise time (T of the transient current of the gas main switch and the dominant frequency (F of the radiation field, namely, F*T=1. Contrast experiment is carried out with a metal shield cover for the gas main switch. Experimental results show that for the shielded setup the radiation field reduces to 115 V/m, the dominant frequency increases to 86.5 MHz at a distance of 10 away meters from the gas main switch. These conclusions are beneficial for further research on the electromagnetic radiation and protection of the IEBA.
NiMax: a new approach to develop hadronic event generators in HEP
International Nuclear Information System (INIS)
Amelin, N.; Komogorov, M.
2000-01-01
The NiMax framework is a new approach to develop, assemble and use hadronic event generators in HEP. There are several important concepts of the NiMax architecture: the components, the data file, the application domain module, the control system and the project. Here we describe these concepts stressing their functionality
A linear programming approach to max-sum problem: a review.
Werner, Tomás
2007-07-01
The max-sum labeling problem, defined as maximizing a sum of binary (i.e., pairwise) functions of discrete variables, is a general NP-hard optimization problem with many applications, such as computing the MAP configuration of a Markov random field. We review a not widely known approach to the problem, developed by Ukrainian researchers Schlesinger et al. in 1976, and show how it contributes to recent results, most importantly, those on the convex combination of trees and tree-reweighted max-product. In particular, we review Schlesinger et al.'s upper bound on the max-sum criterion, its minimization by equivalent transformations, its relation to the constraint satisfaction problem, the fact that this minimization is dual to a linear programming relaxation of the original problem, and the three kinds of consistency necessary for optimality of the upper bound. We revisit problems with Boolean variables and supermodular problems. We describe two algorithms for decreasing the upper bound. We present an example application for structural image analysis.
Using MaxCompiler for the high level synthesis of trigger algorithms
International Nuclear Information System (INIS)
Summers, S.; Rose, A.; Sanders, P.
2017-01-01
Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.
Using MaxCompiler for the high level synthesis of trigger algorithms
Summers, S.; Rose, A.; Sanders, P.
2017-02-01
Firmware for FPGA trigger applications at the CMS experiment is conventionally written using hardware description languages such as Verilog and VHDL. MaxCompiler is an alternative, Java based, tool for developing FPGA applications which uses a higher level of abstraction from the hardware than a hardware description language. An implementation of the jet and energy sum algorithms for the CMS Level-1 calorimeter trigger has been written using MaxCompiler to benchmark against the VHDL implementation in terms of accuracy, latency, resource usage, and code size. A Kalman Filter track fitting algorithm has been developed using MaxCompiler for a proposed CMS Level-1 track trigger for the High-Luminosity LHC upgrade. The design achieves a low resource usage, and has a latency of 187.5 ns per iteration.
Relationship between running kinematic changes and time limit at vVO2max
Directory of Open Access Journals (Sweden)
Leonardo De Lucca
2012-06-01
Exhaustive running at maximal oxygen uptake velocity (vVO2max can alter running kinematic parameters and increase energy cost along the time. The aims of the present study were to compare characteristics of ankle and knee kinematics during running at vVO2max and to verify the relationship between changes in kinematic variables and time limit (Tlim. Eleven male volunteers, recreational players of team sports, performed an incremental running test until volitional exhaustion to determine vVO2max and a constant velocity test at vVO2max. Subjects were filmed continuously from the left sagittal plane at 210 Hz for further kinematic analysis. The maximal plantar flexion during swing (p<0.01 was the only variable that increased significantly from beginning to end of the run. Increase in ankle angle at contact was the only variable related to Tlim (r=0.64; p=0.035 and explained 34% of the performance in the test. These findings suggest that the individuals under study maintained a stable running style at vVO2max and that increase in plantar flexion explained the performance in this test when it was applied in non-runners.
Compton, C W R; McDougall, S; Young, L; Bryan, M A
2014-01-01
The main aim of this study was to describe the prevalence of primary subclinical ketosis (SCK) in mainly pasture-grazed dairy cows in three dairy-farming regions of New Zealand 7-12, and 35-40 days post-calving. A second aim was to investigate herd- and cow-level factors associated with the prevalence of SCK. A cross-sectional longitudinal prevalence survey was undertaken in 1,620 dairy cows from 57 herds. A random sample of cows without disease in the prior 30 days were enrolled at one farm visit within 5 days of calving, and blood samples were collected 7 and 28 days later (7-12 and 35-40 days post-calving) for measurement of beta-hydroxy butyrate (BHBA) concentrations using an electronic cow-side meter. SCK was defined as blood BHBA concentration ≥1.4 mmol/L. Mean cow-level prevalence of SCK varied with interval post-calving (16.8 and 3.2% at 7-12 days and 35-40 days post-calving, respectively) and age (13.0 and 13.1% of 2-year olds and ≥8-year olds, respectively, compared to 7.2% of 3-4-year-old cows). Mean herd-level prevalence of SCK was 14.3 (min 0, max 60.0)% and 2.6 (min 0, max 24.4)% at 7-12 days and 35-40 days post-calving, respectively, and was greater in Southland (13.3%) than Waikato and Canterbury herds (6.9 and 4.7%, respectively). This is the first population-based report of the prevalence of SCK in New Zealand dairy herds and demonstrates that age and interval post-calving are important risk factors determining prevalence; and that there is wide variation in prevalence between herds. Subclinical ketosis may be unrecognised but common in many New Zealand dairy cows in the first 2 weeks of lactation.
İnci Aras
2014-01-01
In this study, we examine Sabahattin Ali’s “Kürk Mantolu Madonna”, one of the most important literary classics of Contemporary Turkish Literature, and Max Frisch’s “Homo Faber”, a famous novel in Contemporary German Literature. The main purpose of this study on these works which belong to Turkish and German cultures is to evaluate the characters related to their social and personal alienation. Therefore we carry out our analysis in line with the similarities and differences between main chara...
Boride-based nano-laminates with MAX-phase-like behaviour
International Nuclear Information System (INIS)
Telle, Rainer; Momozawa, Ai; Music, Denis; Schneider, Jochen M.
2006-01-01
MAX-phases being usually composed of transition metals, group A elements and carbon/nitrogen are considered interesting materials for many applications because of their tremendous bulk modulus, 'reversible' plasticity, and machinability. This is mainly due to their unique kind of bonding comprising covalent, ionic as well as metallic bonds providing 'easy' planes of rupture and deformability due to the layered crystal structures. In transition metal boride systems, similar types of bonding are available. In particular the W 2 B 5 -structure type and its stacking variations allow the synthesis of strongly layered crystal structures exhibiting unique delamination phenomena. The paper presents ab initio calculations showing the similarities of bonding between the ternary carbides and the corresponding ternary or quaternary borides. Formation of boride-based nano-laminates from auxiliary liquid phases, from the melt as well as during sintering and precipitation from supersaturated solid solutions will be discussed by means of SEM and TEM studies. The role of impurities weakening the interlayer bonding will be addressed in particular. The pronounced cleavage parallel to the basal plane gives rise for crack deflection and pull-out mechanisms if the laminates are dispersed in brittle matrices such as boron carbide, silicon carbide or other transition metal borides. - Graphical abstract: Some transition metal borides crystallise in a layered structure of alternating stacks of metal and boron atoms giving rise for strongly anisotropic properties. Their preferred cleavage parallel and the deformability perpendicular to the basal plan are similar to the peculiar mechanical behaviour recently described for MAX-phases. Ab initio calculations of the crystal structure prove the weak bonds between the layers for a variety of borides which can be used to reinforce ceramic materials on a nano-scale level
Mini MAX-DOAS Measurements of Air Pollutants over China
Staadt, Steffen; Hao, Nan; Trautmann, Thomas
2016-08-01
This study continues the work of Clémer et al., (2010) and is aimed to improve trace gas retrievals with mini MAX-DOAS measurements in Nanjing. Based on that work, aerosol extinction vertical profiles are retrieved using the bePRO inversion algorithm developed by the Royal Belgian Institute for Space Aeronomy (BIRA- IASB). Afterwards, the tropospheric trace gas vertical profiles and vertical column densities (VCDs) are retrieved by applying the optimal estimation method to the O4 MAX-DOAS measurements. The Profiles for N O2 , S O2 , glyoxal, formaldehyde and nitrous acid are obtained with different results and different settings for the DOAS measurement. The AODs show small positive correlation against the AERONET values. For NO2, the retrieval shows reasonable concentrations in winter as opposed to summer and has small positive correlations with GOME-2 data. The SO2 VCDs are not correlated with the GOME-2 data, due to high uncertainties from MAX-DOAS and satellite retrievals, while the vertical mixing ratios (VMR) show good agreement with in-situ data (SORPES) at Nanjing. Nitrous acid shows a maximum in winter and a minimum in summer, while glyoxal has its maximum in August and September.
A max version of Perron--Frobenius theorem for nonnegative tensor
Afshin, Hamid Reza; Shojaeifard, Ali Reza
2015-01-01
In this paper we generalize the max algebra system of nonnegative matrices to the class of nonnegative tensors and derive its fundamental properties. If $\\mathbb{A} \\in \\Re_ + ^{\\left[ {m,n} \\right]}$ is a nonnegative essentially positive tensor such that satisfies the condition class NC, we prove that there exist $\\mu \\left( \\mathbb{A} \\right)$ and a corresponding positive vector $x$ such that $\\mathop {\\max }\\limits_{1 \\le{i_2}\\cdots {i_m} \\le n} \\left\\{ {{a_{i{i_2}\\cdots {i_m}}}{x_{{i_2}}}...
Turg Tallinnas = A market for Tallinn / Max Rink
Rink, Max
2007-01-01
Hollandi arhitektuurikoolide lõputööde preemia Archiprix võitis 2007. a. Max Rink Delfti Tehnikaülikoolist Tallinna Balti jaama turu asemele kavandatud mitmefunktsioonilise turuhoone projektiga "Maja-turg". Juhendaja Klaske Havik
Identification and Hierarchy of Main Electronic Health Record Components in Occupational Medicine
Directory of Open Access Journals (Sweden)
Dorin TRIFF
2010-12-01
Full Text Available Starting from the legal requirements relating to structuring of medical records in occupational medicine and international requirements regarding the certification of electronic health records we have focused on structuring and then evaluating an EHR model in occupational medicine that integrates the main functions and certification criteria required by the European and US certification bodies. The application we designed, called Medmun, structured for use in occupational medicine practices based on the model of medical file provided by the Romanian legislation, integrates both necessary components of occupational medicine practice for administration of characteristic information related to socio-economic unit, work place, health surveillance as well as components of specific EHR functionality. The application has been submitted for free evaluation by specialist physicians of five counties over a period of nine months and subsequently assessed using a questionnaire on the usefulness of specific functional components in the EHR occupational medicine practice. The model was positively evaluated after experimental employment by occupational health practitioners. They consider that absence of legislative support for EHR implementation in medical practice is the main obstacle to the use of such applications in occupational medicine practice.
Projekti Min-E-Max kohtumine Saksamaal / Katrin Arge
Arge, Katrin
2005-01-01
Oktoobri keskel toimus Lõuna-Saksamaa väikelinnas Oberderdingenis Hispaania, Portugali, Ungari, Leedu, Eesti ja Saksamaa õpetajate kohtumine seoses Euroopa Liidu poolt rahastatava Comenius1 projektiga Min-E-Max (minimum energy input maximum output)
Johnson-Cook Strength Model Constants for VascoMax 300 and 1080 Steels
International Nuclear Information System (INIS)
Cinnamon, J. D.; Palazotto, A. N.; Kennan, Z.; Brar, N. S.; Bajaj, D.
2006-01-01
High strength steels, VascoMax 300 and 1080, are characterized under tension at strain rates of ∼1/s, ∼500/s, ∼1000/s, and ∼1500/s and at high temperatures using the quasi-static and split Hopkinson bar techniques. The data on 1080 steel exhibited a typical strain hardening response, whereas Vasco-Max 300 steel showed diminishing flow stress beyond yielding because of localized necking in gauge section of the tested specimens. The tension data are analyzed to determine the Johnson-Cook (J-C) strength model constants for the two steels. The flow stress values for VascoMax are adjusted to account for necking, and the corrected J-C model is developed
On a Robust MaxEnt Process Regression Model with Sample-Selection
Directory of Open Access Journals (Sweden)
Hea-Jung Kim
2018-04-01
Full Text Available In a regression analysis, a sample-selection bias arises when a dependent variable is partially observed as a result of the sample selection. This study introduces a Maximum Entropy (MaxEnt process regression model that assumes a MaxEnt prior distribution for its nonparametric regression function and finds that the MaxEnt process regression model includes the well-known Gaussian process regression (GPR model as a special case. Then, this special MaxEnt process regression model, i.e., the GPR model, is generalized to obtain a robust sample-selection Gaussian process regression (RSGPR model that deals with non-normal data in the sample selection. Various properties of the RSGPR model are established, including the stochastic representation, distributional hierarchy, and magnitude of the sample-selection bias. These properties are used in the paper to develop a hierarchical Bayesian methodology to estimate the model. This involves a simple and computationally feasible Markov chain Monte Carlo algorithm that avoids analytical or numerical derivatives of the log-likelihood function of the model. The performance of the RSGPR model in terms of the sample-selection bias correction, robustness to non-normality, and prediction, is demonstrated through results in simulations that attest to its good finite-sample performance.
International Nuclear Information System (INIS)
Sonnad, Kiran G.; Furman, Miguel A.; Vay, Jean-Luc; Venturini, Marco; Celata, Christine; Grote, David
2006-01-01
The electrostatic particle-in-cell codeWARP is currently being expanded in order to study electron cloud effects on the dynamics of the beam in storage rings. Results for the Fermilab main injector (MI) show the existence of a threshold in the electron density beyond which there is rapid emittance growth. The Fermilab MI is being considered for an upgrade as part of the high intensity neutrino source (HINS) effort, which will result in a significant increasing of the bunch intensity relative to its present value, placing it in a regime where electron-cloud effects are expected to become important. Various results from the simulations using WARP are discussed here
Directory of Open Access Journals (Sweden)
Marius Stefan
2007-08-01
Full Text Available Now it is an accepted fact that plant growth-promoting rhizobacteria (PGPR can increase the productivity of several crops. The main objective of the present study was to find if there are any differences in protein content in the seeds of soybean (Glycine max L. MERR.. Using spectrophotometric methods for analyzing the protein contents and electrophoretic methods for qualitative analysis it was observed that no major modifications occur in protein spectrum. Looking at the quantitative side there was a small improvement in protein quantity.
MaxBin 2.0: an automated binning algorithm to recover genomes from multiple metagenomic datasets
Energy Technology Data Exchange (ETDEWEB)
Wu, Yu-Wei [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Simmons, Blake A. [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Singer, Steven W. [Joint BioEnergy Inst. (JBEI), Emeryville, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-10-29
The recovery of genomes from metagenomic datasets is a critical step to defining the functional roles of the underlying uncultivated populations. We previously developed MaxBin, an automated binning approach for high-throughput recovery of microbial genomes from metagenomes. Here, we present an expanded binning algorithm, MaxBin 2.0, which recovers genomes from co-assembly of a collection of metagenomic datasets. Tests on simulated datasets revealed that MaxBin 2.0 is highly accurate in recovering individual genomes, and the application of MaxBin 2.0 to several metagenomes from environmental samples demonstrated that it could achieve two complementary goals: recovering more bacterial genomes compared to binning a single sample as well as comparing the microbial community composition between different sampling environments. Availability and implementation: MaxBin 2.0 is freely available at http://sourceforge.net/projects/maxbin/ under BSD license. Supplementary information: Supplementary data are available at Bioinformatics online.
Max Roach's Adventures in Higher Music Education.
Hentoff, Nat
1980-01-01
Max Roach and the author discuss Roach's efforts to gain recognition of the complexity and importance of American musical forms, particularly jazz, by American university music departments. In addition, Roach describes his approach to marketing his music, an approach which avoids the economic exploitation often suffered by American jazz musicians.…
Kanoun, Mohammed
2012-01-01
In this chapter, we employ ab initio approaches to review some important physical properties of nanolaminated ternary carbides MAX phases. We fi rstly use an all electron full-potential linearized augmented plane-wave method within the generalized gradient approximation and the density functional theory approaches, to explore the existence of a steric effect on the M site in these compounds. The elastic properties are also reported in order to assess the mechanical stability. The substitution of oxygen for carbon in Ti 2 SnC M n +1 AX n, forming Ti 2 SnC 1- x O x, is examined next, where we simulated the effect of oxygen incorporation on mechanical and electronic properties using projector augmented wave method. We show that oxygen has interesting effects on both of elastic and electronic properties, that the bulk modulus decreases when oxygen concentration increases. The bonding in Ti 2 SnC 1- x O x has a tendency to a covalent-ionic nature with the presence of metallic character. © 2012 Woodhead Publishing Limited.
MAX: an expert system for running the modular transport code APOLLO II
International Nuclear Information System (INIS)
Loussouarn, O.; Ferraris, C.; Boivineau, A.
1990-01-01
MAX is an expert system built to help users of the APOLLO II code to prepare the input data deck to run a job. APOLLO II is a modular transport-theory code for calculating the neutron flux in various geometries. The associated GIBIANE command language allows the user to specify the physical structure and the computational method to be used in the calculation. The purpose of MAX is to bring into play expertise in both neutronic and computing aspects of the code, as well as various computational schemes, in order to generate automatically a batch data set corresponding to the APOLLO II calculation desired by the user. MAX is implemented on the SUN 3/60 workstation with the S1 tool and graphic interface external functions
Fuzzy Mutual Information Based min-Redundancy and Max-Relevance Heterogeneous Feature Selection
Directory of Open Access Journals (Sweden)
Daren Yu
2011-08-01
Full Text Available Feature selection is an important preprocessing step in pattern classification and machine learning, and mutual information is widely used to measure relevance between features and decision. However, it is difficult to directly calculate relevance between continuous or fuzzy features using mutual information. In this paper we introduce the fuzzy information entropy and fuzzy mutual information for computing relevance between numerical or fuzzy features and decision. The relationship between fuzzy information entropy and differential entropy is also discussed. Moreover, we combine fuzzy mutual information with qmin-Redundancy-Max-Relevanceq, qMax-Dependencyq and min-Redundancy-Max-Dependencyq algorithms. The performance and stability of the proposed algorithms are tested on benchmark data sets. Experimental results show the proposed algorithms are effective and stable.
Time limit and time at VO2max' during a continuous and an intermittent run.
Demarie, S; Koralsztein, J P; Billat, V
2000-06-01
The purpose of this study was to verify, by track field tests, whether sub-elite runners (n=15) could (i) reach their VO2max while running at v50%delta, i.e. midway between the speed associated with lactate threshold (vLAT) and that associated with maximal aerobic power (vVO2max), and (ii) if an intermittent exercise provokes a maximal and/or supra maximal oxygen consumption longer than a continuous one. Within three days, subjects underwent a multistage incremental test during which their vVO2max and vLAT were determined; they then performed two additional testing sessions, where continuous and intermittent running exercises at v50%delta were performed up to exhaustion. Subject's gas exchange and heart rate were continuously recorded by means of a telemetric apparatus. Blood samples were taken from fingertip and analysed for blood lactate concentration. In the continuous and the intermittent tests peak VO2 exceeded VO2max values, as determined during the incremental test. However in the intermittent exercise, peak VO2, time to exhaustion and time at VO2max reached significantly higher values, while blood lactate accumulation showed significantly lower values than in the continuous one. The v50%delta is sufficient to stimulate VO2max in both intermittent and continuous running. The intermittent exercise results better than the continuous one in increasing maximal aerobic power, allowing longer time at VO2max and obtaining higher peak VO2 with lower lactate accumulation.
Maria Teresa Speranza
2015-01-01
An interesting debate on the issue of personal identity and its ethical implications has animated the days of the XIII International Congress of Max Scheler‐Gesellschaft. A large program of work has garnered numerous perspectives on the philosophy of person and the phenomenology of otherness, investigating in particular the role of emotions in the formation of person process. The main topic of conference was the Max Scheler’s phenomenology of emotions, which is an i...
Energy Technology Data Exchange (ETDEWEB)
Backfish, Michael
2013-04-01
This paper documents the use of four retarding field analyzers (RFAs) to measure electron cloud signals created in Fermilab’s Main Injector during 120 GeV operations. The first data set was taken from September 11, 2009 to July 4, 2010. This data set is used to compare two different types of beam pipe that were installed in the accelerator. Two RFAs were installed in a normal steel beam pipe like the rest of the Main Injector while another two were installed in a one meter section of beam pipe that was coated on the inside with titanium nitride (TiN). A second data run started on August 23, 2010 and ended on January 10, 2011 when Main Injector beam intensities were reduced thus eliminating the electron cloud. This second run uses the same RFA setup but the TiN coated beam pipe was replaced by a one meter section coated with amorphous carbon (aC). This section of beam pipe was provided by CERN in an effort to better understand how an aC coating will perform over time in an accelerator. The research consists of three basic parts: (a) continuously monitoring the conditioning of the three different types of beam pipe over both time and absorbed electrons (b) measurement of the characteristics of the surrounding magnetic fields in the Main Injector in order to better relate actual data observed in the Main Injector with that of simulations (c) measurement of the energy spectrum of the electron cloud signals using retarding field analyzers in all three types of beam pipe.
Nuclear norm regularized convolutional Max Pos@Top machine
Li, Qinfeng; Zhou, Xiaofeng; Gu, Aihua; Li, Zonghua; Liang, Ru-Ze
2016-01-01
, named as Pos@Top. Our proposed classification model has a convolutional structure that is composed by four layers, i.e., the convolutional layer, the activation layer, the max-pooling layer and the full connection layer. In this paper, we propose
Development of a cloud-screening method for MAX-DOAS measurements
Gielen, Clio; Van Roozendael, Michel; Hendrik, Francois; Fayt, Caroline; Hermans, Christian; Pinardi, Gaia; Vlemmix, Tim
2013-04-01
In recent years, ground-based multi-axis differential absorption spectroscopy (MAX-DOAS) has shown to be ideally suited for the retrieval of tropospheric trace gases and deriving information on the aerosol properties. These measurements are invaluable to our understanding of the physics and chemistry of the atmospheric system, and the impact on the Earth's climate. Unfortunately, MAX-DOAS measurements are often performed under (partially) cloudy conditions, causing data quality degradation and higher uncertainties on the retrievals. A high aerosol load and/or a strong cloud cover can introduce additional photon absorption or multiple scattering. The first effect strongly impacts the retrieved differential slant columns (DSCDs) of the trace gases, leading to an underestimation of the atmospheric column density. Multiple scattering, on the other hand, becomes important for low clouds with a high optical depth, and cause a strong increase in the retrieved trace gas DSCDs. The presence of thin clouds can furthermore introduce a degeneracy in the retrieved aerosol optical depth, since they will have similar effect on the MAX-DOAS measurements. In this case, only information on the trace gas DSCDs can be successfully retrieved. If the cloud cover consists of broken or scattered clouds, the MAX-DOAS method becomes very unstable, since the different elevation angels will probe regions of the sky with strongly deviating properties. Here we present a method to qualify the sky and cloud conditions, using the colour index and O4 DSCDs, as derived from the MAX-DOAS measurements. The colour index is defined as the ratio of the intensities at the short- and long-wavelength part of the visible spectral range, typically at 400 nm and 670 nm. For increasing optical thickness due to clouds or aerosols, the colour index values decrease and values for different elevation angles converge. In the case of broken clouds, the colour index shows a strong and rapid temporal variation, which
Min-max event-triggered computation tree logic
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
Temporal logic model-checking (Clarkeet al1986) is one of the most popular and well studied ... Min-max CTL, for reasoning about such extremal timing properties and showed .... A control flow decision is taken based on the value of one or more variables (like a ... We first present a few examples to informally explain the.
Teaching Financial Literacy with Max and Ruby
Brown, Natalya; Ferguson, Kristen
2017-01-01
Teaching financial literacy is important at all stages of life, but is often neglected with elementary students. In this article, the authors describe a strategy for teaching financial literacy using the books about Max and Ruby by Rosemary Wells. These books can help introduce the five key concepts of financial literacy: scarcity, exchange,…
Filiz, Ertugrul; Vatansever, Recep; Ozyigit, Ibrahim Ilker
2016-03-01
Urease (EC 3.5.1.5) is a nickel-dependent metalloenzyme catalyzing the hydrolysis of urea into ammonia and carbon dioxide. It is present in many bacteria, fungi, yeasts and plants. Most species, with few exceptions, use nickel metalloenzyme urease to hydrolyze urea, which is one of the commonly used nitrogen fertilizer in plant growth thus its enzymatic hydrolysis possesses vital importance in agricultural practices. Considering the essentiality and importance of urea and urease activity in most plants, this study aimed to comparatively investigate the ureases of two important legume species such as Glycine max (soybean) and Medicago truncatula (barrel medic) from Fabaceae family. With additional plant species, primary and secondary structures of 37 plant ureases were comparatively analyzed using various bioinformatics tools. A structure based phylogeny was constructed using predicted 3D models of G. max and M. truncatula, whose crystallographic structures are not available, along with three additional solved urease structures from Canavalia ensiformis (PDB: 4GY7), Bacillus pasteurii (PDB: 4UBP) and Klebsiella aerogenes (PDB: 1FWJ). In addition, urease structures of these species were docked with urea to analyze the binding affinities, interacting amino acids and atom distances in urease-urea complexes. Furthermore, mutable amino acids which could potentially affect the protein active site, stability and flexibility as well as overall protein stability were analyzed in urease structures of G. max and M. truncatula. Plant ureases demonstrated similar physico-chemical properties with 833-878 amino acid residues and 89.39-90.91 kDa molecular weight with mainly acidic (5.15-6.10 pI) nature. Four protein domain structures such as urease gamma, urease beta, urease alpha and amidohydro 1 characterized the plant ureases. Secondary structure of plant ureases also demonstrated conserved protein architecture, with predominantly α-helix and random coil structures. In
Experimental evaluation of high speed impulse radio UWB interference on WiMAX narrowband systems
DEFF Research Database (Denmark)
Yu, Xianbin; Yin, Xiaoli; Tafur Monroy, Idelfonso
2010-01-01
Interference of high speed impulse radio ultrawideband (IR-UWB) on 5.735GHz single carrier 64/256-QAM WiMAX narrowband signals is experimentally investigated. The experimental results indicate that the coexistence of 625Mbps and 2Gbps IR-UWB signals causes penalties of 3dB and 0.5dB respectively...... to the WiMAX channel. At higher bit rates, IR-UWB technology is therefore expected to reduce its interference on WiMAX signals. This work serves as further motivation for the exploration of IR-UWB systems with higher speed and higher capacity....
Directory of Open Access Journals (Sweden)
Yang Z
2008-01-01
Full Text Available The performance obtained from providing worldwide interoperability for microwave access (WiMAX from high altitude platforms (HAPs with multiple antenna payloads is investigated, and the coexistence capability with multiple-operator terrestrial WiMAX deployments is examined. A scenario composed of a single HAP and coexisting multiple terrestrial WiMAX base stations deployed inside the HAP coverage area (with radius of 30 km to provide services to fixed users with the antenna mounted on the roof with a directive antenna to receive signals from HAPs is proposed. A HAP cellular configuration with different possible reuse patterns is established. The coexistence performance is assessed in terms of HAP downlink and uplink performance, interfered by terrestrial WiMAX deployment. Simulation results show that it is effective to deliver WiMAX via HAPs and share the spectrum with terrestrial systems.
Evaluating the Performance of IPTV over Fixed WiMAX
Hamodi, Jamil; Salah, Khaled; Thool, Ravindra
2013-12-01
IEEE specifies different modulation techniques for WiMAX; namely, BPSK, QPSK, 16 QAM and 64 QAM. This paper studies the performance of Internet Protocol Television (IPTV) over Fixed WiMAX system considering different combinations of digital modulation. The performance is studied taking into account a number of key system parameters which include the variation in the video coding, path-loss, scheduling service classes different rated codes in FEC channel coding. The performance study was conducted using OPNET simulation. The performance is studied in terms of packet lost, packet jitter delay, end-to-end delay, and network throughput. Simulation results show that higher order modulation and coding schemes (namely, 16 QAM and 64 QAM) yield better performance than that of QPSK.
International Nuclear Information System (INIS)
Shurygin, R. V.; Morozov, D. Kh.
2014-01-01
Turbulent dynamics of the near-wall tokamak plasma is simulated by numerically solving the nonlinear reduced Braginskii magnetohydrodynamic equations with allowance for a lithium ion admixture. The effects of turbulence and radiation of the admixture are analyzed in the framework of a self-consistent approach. The radial distributions of the radiative loss power and the density of Li 0 atoms and Li +1 ions are obtained as functions of the electron and ion temperatures of the main plasma in the near-wall layer. The results of numerical simulations show that supply of lithium ions into the low-temperature near-wall plasma substantially depends on whether the additional power is deposited into the electron or ion component of the main plasma. If the electron temperature in the layer increases (ECR heating), then the ion density drops. At the same time, an increase in the temperature of the main ions (ICR heating) leads to an increase in the density of Li +1 ions. The results of numerical simulations are explained by the different influence of the electron and ion temperatures on the atomic processes governing the accumulation and loss of particles in the balance equations for neutral Li 0 atoms and Li +1 ions in the admixture. The radial profile of the electron temperature and the corresponding distribution of the radiative loss power for different densities of neutral Li 0 atoms on the wall are obtained. The calculations show that the presence of Li +1 ions affects turbulent transport of the main ions. In this case, the electron heat flux increases by 20–30% with increasing Li +1 density, whereas the flux of the main ions drops by nearly the same amount. The radial profile of the turbulent flux of lithium ions is obtained. It is demonstrated that the appearance of the pinch effect is related to the positive density gradient of lithium ions across the calculation layer. For the parameters of the T-10 tokamak, the effect of radiative cooling of the near-wall plasma
Lifescience Database Archive (English)
Full Text Available 1V3H 大豆 Soybean Glycine max (L.) Merrill Beta-Amylase Name=Bmy1; Glycine Max Molecule: Beta-Amylase; Chai... 495 AA, Molecular weight: 56011 Da ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRSLFQLVQECGLTLQAI...MSFHQCGGNVGDIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG...FLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSG...GWREDIRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIFKKFVLKMHADQDYCANPQKYNHAITPLKPSAPKIPIEVLLEATKPTLPFPWLPETDMKVDG soybean_1V3H.jpg ...
A Hybrid Shared-Memory Parallel Max-Tree Algorithm for Extreme Dynamic-Range Images.
Moschini, Ugo; Meijster, Arnold; Wilkinson, Michael H F
2018-03-01
Max-trees, or component trees, are graph structures that represent the connected components of an image in a hierarchical way. Nowadays, many application fields rely on images with high-dynamic range or floating point values. Efficient sequential algorithms exist to build trees and compute attributes for images of any bit depth. However, we show that the current parallel algorithms perform poorly already with integers at bit depths higher than 16 bits per pixel. We propose a parallel method combining the two worlds of flooding and merging max-tree algorithms. First, a pilot max-tree of a quantized version of the image is built in parallel using a flooding method. Later, this structure is used in a parallel leaf-to-root approach to compute efficiently the final max-tree and to drive the merging of the sub-trees computed by the threads. We present an analysis of the performance both on simulated and actual 2D images and 3D volumes. Execution times are about better than the fastest sequential algorithm and speed-up goes up to on 64 threads.
International Nuclear Information System (INIS)
Ze-Gao, Wang; Yuan-Fu, Chen; Cao, Chen; Ben-Lang, Tian; Fu-Tong, Chu; Xing-Zhao, Liu; Yan-Rong, Li
2010-01-01
The electrical properties of AlGaN/GaN high electron mobility transistor (HEMT) with and without high-κ organic dielectrics are investigated. The maximum drain current I D max and the maximum transconductance g m max of the organic dielectric/AlGaN/GaN structure can be enhanced by 74.5%, and 73.7% compared with those of the bare AlGaN/GaN HEMT, respectively. Both the threshold voltage V T and g m max of the dielectric/AlGaN/GaN HEMT are strongly dielectric-constant-dependent. Our results suggest that it is promising to significantly improve the performance of the AlGaN/GaN HEMT by introducing the high-κ organic dielectric. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Gielen, Clio; Hendrick, Francois; Pinardi, Gaia; De Smedt, Isabelle; Stavrakou, Trissevgeni; Yu, Huan; Fayt, Caroline; Hermans, Christian; Bauwens, Maité; Ndenzako, Eugene; Nzohabonayo, Pierre; Akimana, Rachel; Niyonzima, Sébastien; Müller, Jean-Francois; Van Roozendael, Michel
2016-04-01
Central Africa is known for its strong biogenic, pyrogenic, and to a lesser extent anthropogenic emissions. Satellite observations of species like nitrogen dioxide (NO2) and formaldehyde (HCHO), as well as inverse modelling results have shown that there are large uncertainties associated with the emissions in this region. There is thus a need for additional measurements, especially from the ground, in order to better characterise the biomass-burning and biogenic products emitted in this area. We present MAX-DOAS measurements of NO2, HCHO, and aerosols performed in Central Africa, in the city of Bujumbura, Burundi (3°S, 29°E, 850m). A MAX-DOAS instrument has been operating at this location by BIRA-IASB since late 2013. Aerosol-extinction and trace-gases vertical profiles are retrieved by applying the optimal-estimation-based profiling tool bePRO to the measured O4, NO2 and HCHO slant-column densities. The MAX-DOAS vertical columns and profiles are used for investigating the diurnal and seasonal cycles of NO2, HCHO, and aerosols. Regarding the aerosols, the retrieved AODs are compared to co-located AERONET sun photometer measurements for verification purpose, while in the case of NO2 and HCHO, the MAX-DOAS vertical columns and profiles are used for validating GOME-2 and OMI satellite observations. To characterise the biomass-burning and biogenic emissions in the Bujumbura region, the trace gases and aerosol MAX-DOAS retrievals are used in combination to MODIS fire counts/radiative-power and GOME-2/OMI NO2 and HCHO satellite data, as well as simulations from the NOAA backward trajectory model HYSPLIT. First results show that HCHO seasonal variation around local noon is driven by the alternation of rain and dry periods, the latter being associated with intense biomass-burning agricultural activities and forest fires in the south/south-east and transport from this region to Bujumbura. In contrast, NO2 is seen to depend mainly on local emissions close to the city, due
Efficient production of transgenic soybean (Glycine max [L] Merrill ...
African Journals Online (AJOL)
Efficient production of transgenic soybean (Glycine max [L] Merrill) plants mediated via whisker-supersonic (WSS) method. MM Khalafalla, HA El-Shemy, SM Rahman, M Teraishi, H Hasegawa, T Terakawa, M Ishimoto ...
WiMAX OFDM system simulation and sub-system FPGA implementation
International Nuclear Information System (INIS)
Elaskary, A.M.F.
2009-01-01
Orthogonal frequency division multiplexing (OFDM) has been used in many wireless communication systems also it is gaining a lot of attention for the next generations of mobile communication systems. OFDM is considered a good candidate for wireless systems because it has high bandwidth efficiency and can transmit at very high data rate in multi path, interference , and fading environment. in general OFDM has widely been studied and implemented to combat transmission channel impairments, but some challenges still facing OFDM in transmission system implementation especially for recent and future applications. One of these important applications is the worldwide interoperability for microwave access (WiMAX) system. According to the IEEE 802.16 standards, WiMAX is considered as a good solution for last mile connection at crowded areas and a high-speed internet connection to mobile vehicles with speed of up to 300 km/h. This thesis studies OFDM system in details and proposes simulink models for simulating OFDM impairments and its effects on system performance. This study has been used for building up system level and end to end WiMAX OFDM transmitter/receiver which follows published specifications in IEEE 802.16 standards using mat lab/simulink.
Directory of Open Access Journals (Sweden)
Agus Maman Abadi
2016-04-01
Full Text Available The increasing need in techniques of storing big data presents a new challenge. One way to address this challenge is the use of distributed storage systems. One strategy that implemented in distributed data storage systems is the use of Erasure Code which applied to network coding. The code used in this technique is based on the algebraic structure which is called as vector space. Some studies have also been carried out to create code that is based on other algebraic structures such as module. In this study, we are going to try to set up a code based on the algebraic structure which is a generalization of the module that is semimodule by utilizing the max operations and sum operations at max plus algebra. The results of this study indicate that the max operation and the addition operation on max plus algebra cannot be used to establish a semimodule code, but by modifying the operation "+" as "min", we get a code based on semimodule. Keywords: code, distributed storage systems, network coding, semimodule, max plus algebra
DEFF Research Database (Denmark)
Huber, D.; Bedding, T.R.; Stello, D.
2011-01-01
), and oscillation amplitudes. We show that the difference of the Δν-νmax relation for unevolved and evolved stars can be explained by different distributions in effective temperature and stellar mass, in agreement with what is expected from scaling relations. For oscillation amplitudes, we show that neither (L/M) s......We have analyzed solar-like oscillations in ~1700 stars observed by the Kepler Mission, spanning from the main sequence to the red clump. Using evolutionary models, we test asteroseismic scaling relations for the frequency of maximum power (νmax), the large frequency separation (Δν...... scaling nor the revised scaling relation by Kjeldsen & Bedding is accurate for red-giant stars, and demonstrate that a revised scaling relation with a separate luminosity-mass dependence can be used to calculate amplitudes from the main sequence to red giants to a precision of ~25%. The residuals show...
RRM Strategies in LTE&WiMAX Interworking System
DEFF Research Database (Denmark)
Zakrzewska, Anna; Ruepp, Sarah Renée; Berger, Michael Stübert
, that could be applied in 4G systems (LTE interworking with WiMAX is considered). Furthermore, it will also discuss the Radio Resource Management (RRM) problem addressing the challenges of designing a RRM system for such a multi-RAT wireless environment. Different functionalities and possibilities...
Bouchard, C; An, P; Rice, T; Skinner, J S; Wilmore, J H; Gagnon, J; Pérusse, L; Leon, A S; Rao, D C
1999-09-01
The aim of this study was to test the hypothesis that individual differences in the response of maximal O(2) uptake (VO(2max)) to a standardized training program are characterized by familial aggregation. A total of 481 sedentary adult Caucasians from 98 two-generation families was exercise trained for 20 wk and was tested for VO(2max) on a cycle ergometer twice before and twice after the training program. The mean increase in VO(2max) reached approximately 400 ml/min, but there was considerable heterogeneity in responsiveness, with some individuals experiencing little or no gain, whereas others gained >1.0 l/min. An ANOVA revealed that there was 2.5 times more variance between families than within families in the VO(2max) response variance. With the use of a model-fitting procedure, the most parsimonious models yielded a maximal heritability estimate of 47% for the VO(2max) response, which was adjusted for age and sex with a maternal transmission of 28% in one of the models. We conclude that the trainability of VO(2max) is highly familial and includes a significant genetic component.
Directory of Open Access Journals (Sweden)
T. Hult
2008-12-01
Full Text Available The performance obtained from providing worldwide interoperability for microwave access (WiMAX from high altitude platforms (HAPs with multiple antenna payloads is investigated, and the coexistence capability with multiple-operator terrestrial WiMAX deployments is examined. A scenario composed of a single HAP and coexisting multiple terrestrial WiMAX base stations deployed inside the HAP coverage area (with radius of 30 km to provide services to fixed users with the antenna mounted on the roof with a directive antenna to receive signals from HAPs is proposed. A HAP cellular configuration with different possible reuse patterns is established. The coexistence performance is assessed in terms of HAP downlink and uplink performance, interfered by terrestrial WiMAX deployment. Simulation results show that it is effective to deliver WiMAX via HAPs and share the spectrum with terrestrial systems.
Few-layer molybdenum disulfide transistors and circuits for high-speed flexible electronics.
Cheng, Rui; Jiang, Shan; Chen, Yu; Liu, Yuan; Weiss, Nathan; Cheng, Hung-Chieh; Wu, Hao; Huang, Yu; Duan, Xiangfeng
2014-10-08
Two-dimensional layered materials, such as molybdenum disulfide, are emerging as an exciting material system for future electronics due to their unique electronic properties and atomically thin geometry. Here we report a systematic investigation of MoS2 transistors with optimized contact and device geometry, to achieve self-aligned devices with performance including an intrinsic gain over 30, an intrinsic cut-off frequency fT up to 42 GHz and a maximum oscillation frequency fMAX up to 50 GHz, exceeding the reported values for MoS2 transistors to date (fT~0.9 GHz, fMAX~1 GHz). Our results show that logic inverters or radio frequency amplifiers can be formed by integrating multiple MoS2 transistors on quartz or flexible substrates with voltage gain in the gigahertz regime. This study demonstrates the potential of two-dimensional layered semiconductors for high-speed flexible electronics.
Few-layer molybdenum disulfide transistors and circuits for high-speed flexible electronics
Cheng, Rui; Jiang, Shan; Chen, Yu; Liu, Yuan; Weiss, Nathan; Cheng, Hung-Chieh; Wu, Hao; Huang, Yu; Duan, Xiangfeng
2014-01-01
Two-dimensional layered materials, such as molybdenum disulfide, are emerging as an exciting material system for future electronics due to their unique electronic properties and atomically thin geometry. Here we report a systematic investigation of MoS2 transistors with optimized contact and device geometry, to achieve self-aligned devices with performance including an intrinsic gain over 30, an intrinsic cut-off frequency fT up to 42 GHz and a maximum oscillation frequency fMAX up to 50 GHz, exceeding the reported values for MoS2 transistors to date (fT ~ 0.9 GHz, fMAX ~ 1 GHz). Our results show that logic inverters or radio frequency amplifiers can be formed by integrating multiple MoS2 transistors on quartz or flexible substrates with voltage gain in the gigahertz regime. This study demonstrates the potential of two-dimensional layered semiconductors for high-speed flexible electronics. PMID:25295573
Wakefield, Jerome C
2007-01-01
Recently derestricted Freud Archive interviews with Max and Herbert Graf and Herbert's wife shed new light on Max Graf's article, "Reminiscences of Professor Sigmund Freud," published in The Psychoanalytic Quarterly in 1942. To explain discrepancies between the interviews and the earlier article, the author postulates that, in the article, Max Graf purposely distorted or omitted certain details in order not to reveal Herbert's identity as "Little Hans" (Freud 1909). The interviews place incidents reported in the article in a new and more complex light, and also underscore the intensely personal nature of the intellectual development of the psychoanalytic movement.
The Max b-HLH-LZ can transduce into cells and inhibit c-Myc transcriptional activities.
Directory of Open Access Journals (Sweden)
Martin Montagne
Full Text Available The inhibition of the functions of c-Myc (endogenous and oncogenic was recently shown to provide a spectacular therapeutic index in cancer mouse models, with complete tumor regression and minimal side-effects in normal tissues. This was achieved by the systemic and conditional expression of omomyc, the cDNA of a designed mutant of the b-HLH-LZ of c-Myc named Omomyc. The overall mode of action of Omomyc consists in the sequestration of Max and the concomitant competition of the Omomyc/Max complex with the endogenous c-Myc/Max heterodimer. This leads to the inhibition of the transactivation of Myc target genes involved in proliferation and metabolism. While this body of work has provided extraordinary insights to guide the future development of new cancer therapies that target c-Myc, Omomyc itself is not a therapeutic agent. In this context, we sought to exploit the use of a b-HLH-LZ to inhibit c-Myc in a cancer cell line in a more direct fashion. We demonstrate that the b-HLH-LZ domain of Max (Max* behaves as a bona fide protein transduction domain (PTD that can efficiently transduce across cellular membrane via through endocytosis and translocate to the nucleus. In addition, we show that the treatment of HeLa cells with Max* leads to a reduction of metabolism and proliferation rate. Accordingly, we observe a decrease of the population of HeLa cells in S phase, an accumulation in G1/G0 and the induction of apoptosis. In agreement with these phenotypic changes, we show by q-RT-PCR that the treatment of HeLa cells with Max* leads to the activation of the transcription c-Myc repressed genes as well as the repression of the expression of c-Myc activated genes. In addition to the novel discovery that the Max b-HLH-LZ is a PTD, our findings open up new avenues and strategies for the direct inhibition of c-Myc with b-HLH-LZ analogs.
Ranking Based Locality Sensitive Hashing Enabled Cancelable Biometrics: Index-of-Max Hashing
Jin, Zhe; Lai, Yen-Lung; Hwang, Jung-Yeon; Kim, Soohyung; Teoh, Andrew Beng Jin
2017-01-01
In this paper, we propose a ranking based locality sensitive hashing inspired two-factor cancelable biometrics, dubbed "Index-of-Max" (IoM) hashing for biometric template protection. With externally generated random parameters, IoM hashing transforms a real-valued biometric feature vector into discrete index (max ranked) hashed code. We demonstrate two realizations from IoM hashing notion, namely Gaussian Random Projection based and Uniformly Random Permutation based hashing schemes. The disc...
Max Weber and the atom of Sociology: a moderate methodological individualism?
Sell, Carlos Eduardo
2016-01-01
Qual a natureza do individualismo metodológico de Max Weber? Para esclarecer essa questão o artigo revisa o debate entre holistas e individualistas, destacando as tentativas de aproximação entre essas posições. Em seguida, com base em Economia e sociedade, busca-se determinar, de maneira imanente, a compreensão weberiana sobre o individualismo como método. Na parte final discutem-se criticamente as tentativas de releitura da Sociologia de Max Weber à luz da controvérsia entre as perspectivas ...
Plan estratégico Limpi Max S.A.C. 2015-2019
Aniceto Prado, Fabiola Virginia; Barcelona Zakimi, Antoane Andre; Tokashiki Zakimi, Javier Elias; Yutaka Yino Oshiro, Daniel Alberto
2015-01-01
El presente plan estratégico ha sido elaborado para la empresa Limpi Max S.A.C. para el periodo comprendido entre los años 2015 a 2019, cuya actividad económica está especializada en el cristalizado de superficies y suelos calcáreos. El mercado del cristalizado se enfoca en centros comerciales, tiendas por departamento y hoteles que cuenten con las superficies mencionadas líneas arriba. El mayor problema que enfrenta Limpi Max es la reducida o nula cultura empresarial en nuestro país de reali...
Directory of Open Access Journals (Sweden)
Narkis S. Morales
2017-03-01
Full Text Available Environmental niche modeling (ENM is commonly used to develop probabilistic maps of species distribution. Among available ENM techniques, MaxEnt has become one of the most popular tools for modeling species distribution, with hundreds of peer-reviewed articles published each year. MaxEnt’s popularity is mainly due to the use of a graphical interface and automatic parameter configuration capabilities. However, recent studies have shown that using the default automatic configuration may not be always appropriate because it can produce non-optimal models; particularly when dealing with a small number of species presence points. Thus, the recommendation is to evaluate the best potential combination of parameters (feature classes and regularization multiplier to select the most appropriate model. In this work we reviewed 244 articles published between 2013 and 2015 to assess whether researchers are following recommendations to avoid using the default parameter configuration when dealing with small sample sizes, or if they are using MaxEnt as a “black box tool.” Our results show that in only 16% of analyzed articles authors evaluated best feature classes, in 6.9% evaluated best regularization multipliers, and in a meager 3.7% evaluated simultaneously both parameters before producing the definitive distribution model. We analyzed 20 articles to quantify the potential differences in resulting outputs when using software default parameters instead of the alternative best model. Results from our analysis reveal important differences between the use of default parameters and the best model approach, especially in the total area identified as suitable for the assessed species and the specific areas that are identified as suitable by both modelling approaches. These results are worrying, because publications are potentially reporting over-complex or over-simplistic models that can undermine the applicability of their results. Of particular importance
MaxAlign: maximizing usable data in an alignment
DEFF Research Database (Denmark)
Oliveira, Rodrigo Gouveia; Sackett, Peter Wad; Pedersen, Anders Gorm
2007-01-01
Align. In this paper we also introduce a new simple measure of tree similarity, Normalized Symmetric Similarity (NSS) that we consider useful for comparing tree topologies. CONCLUSION: We demonstrate how MaxAlign is helpful in detecting misaligned or defective sequences without requiring manual inspection. We also...
The Statue of Liberty Peter Max Style!
Cunningham, Kathy
2012-01-01
The author's school is only 30 minutes from New York City, so every year when second-graders study towns and cities, the students do a project based on New York City landmarks. This year was the Statue of Liberty. The author introduced Peter Max's famous Pop art to her students, and explained that, as the art world kept changing, artists decided…
Tapered composite likelihood for spatial max-stable models
Sang, Huiyan
2014-05-01
Spatial extreme value analysis is useful to environmental studies, in which extreme value phenomena are of interest and meaningful spatial patterns can be discerned. Max-stable process models are able to describe such phenomena. This class of models is asymptotically justified to characterize the spatial dependence among extremes. However, likelihood inference is challenging for such models because their corresponding joint likelihood is unavailable and only bivariate or trivariate distributions are known. In this paper, we propose a tapered composite likelihood approach by utilizing lower dimensional marginal likelihoods for inference on parameters of various max-stable process models. We consider a weighting strategy based on a "taper range" to exclude distant pairs or triples. The "optimal taper range" is selected to maximize various measures of the Godambe information associated with the tapered composite likelihood function. This method substantially reduces the computational cost and improves the efficiency over equally weighted composite likelihood estimators. We illustrate its utility with simulation experiments and an analysis of rainfall data in Switzerland.
Effective Bandwidth Allocation for WiMAX Mesh Network
Directory of Open Access Journals (Sweden)
Hung-Chin Jang
2010-04-01
Full Text Available The aim of this paper is to reduce the media access delay in a WiMAX mesh network. We observe that as the number of subscriber stations (SS in a neighborhood increases, the processes of transmission opportunity (TO competition and 3- way handshake are easy to fail. This may degrade transmission efficiency and increase packet transmission delay. Besides, the minislot allocation defined in the WiMAX mesh mode may cause many lower priority services reserve earlier minislots than that of higher priority services like rtPS. This may cause great negative impact on delay-sensitive traffic. In this paper, we design a QoS classifier to enqueue packets according to different QoS service classes, present a dynamic holdoff exponent mechanism to reduce control subframe delay, and propose a Neighborhood-Based Minislot Allocation (NBMA mechanism to reduce data subframe delay. Simulations show that the proposed methodology outperforms that of IEEE 802.16 and Baye's DynExp in delay, jitter and throughput.
Tapered composite likelihood for spatial max-stable models
Sang, Huiyan; Genton, Marc G.
2014-01-01
Spatial extreme value analysis is useful to environmental studies, in which extreme value phenomena are of interest and meaningful spatial patterns can be discerned. Max-stable process models are able to describe such phenomena. This class of models is asymptotically justified to characterize the spatial dependence among extremes. However, likelihood inference is challenging for such models because their corresponding joint likelihood is unavailable and only bivariate or trivariate distributions are known. In this paper, we propose a tapered composite likelihood approach by utilizing lower dimensional marginal likelihoods for inference on parameters of various max-stable process models. We consider a weighting strategy based on a "taper range" to exclude distant pairs or triples. The "optimal taper range" is selected to maximize various measures of the Godambe information associated with the tapered composite likelihood function. This method substantially reduces the computational cost and improves the efficiency over equally weighted composite likelihood estimators. We illustrate its utility with simulation experiments and an analysis of rainfall data in Switzerland.
On the Potential of MAX phases for Nuclear Applications
Tallman, Darin Joseph
Materials within nuclear reactors experience some of the harshest environments currently known to man, including long term operation in extreme temperatures, corrosive media, and fast neutron fluences with up to 100 displacements per atom, dpa. In order to improve the efficiency and safety of current and future reactors, new materials are required to meet these harsh demands. The M n+1AXn phases, a growing family of ternary nano-layered ceramics, possess a desirable combination of metallic and ceramic properties. They are composed of an early transition metal (M), a group 13--16 element (A), and carbon and/or nitrogen (X). The MAX phases are being proposed for use in such extreme environments because of their unique combination of high fracture toughness values and thermal conductivities, machinability, oxidation resistance, and ion irradiation damage tolerance. Previous ion irradiation studies have shown that Ti3SiC2 and Ti3AlC2 resist irradiation damage, maintaining crystallinity up to 50 dpa. The aim of this work was to explore the effect of neutron irradiation, up to 9 dpa and at temperatures of 100 to 1000 °C, on select MAX phases for the first time. The MAX phases Ti3SiC2, Ti 3AlC2, Ti2AlC, and Ti2AlN were synthesized, and irradiated in test reactors that simulate in-pile conditions of nuclear reactors. X-ray diffraction, XRD, pattern refinements of samples revealed a distortion of the crystal lattice after low temperature irradiation, which was not observed after high temperature irradiations. Additionally, the XRD results indicated that Ti3AlC2 and Ti2AlN dissociated after relatively low neutron doses. This led us to focus on Ti 3SiC2 and Ti2AlC. For the first time, dislocation loops were observed in Ti3SiC 2 and Ti2AlC as a result of neutron irradiation. At 1 x 1023 loops/m3, the loop density in Ti2 AlC after irradiation to 0.1 dpa at 700°C was 1.5 orders of magnitude greater than that observed in Ti3SiC2, at 3 x 1021 loops/m3. The Ti2AlC composition
High-Intensity Interval Training Increases Cardiac Output and V˙O2max.
Astorino, Todd A; Edmunds, Ross M; Clark, Amy; King, Leesa; Gallant, Rachael A; Namm, Samantha; Fischer, Anthony; Wood, Kimi M
2017-02-01
Increases in maximal oxygen uptake (V˙O2max) frequently occur with high-intensity interval training (HIIT), yet the specific adaptation explaining this result remains elusive. This study examined changes in V˙O2max and cardiac output (CO) in response to periodized HIIT. Thirty-nine active men and women (mean age and V˙O2max = 22.9 ± 5.4 yr and 39.6 ± 5.6 mL·kg·min) performed HIIT and 32 men and women (age and V˙O2max = 25.7 ± 4.5 yr and 40.7 ± 5.2 mL·kg·min) were nonexercising controls (CON). The first 10 sessions of HIIT required eight to ten 60 s bouts of cycling at 90%-110% percent peak power output interspersed with 75 s recovery, followed by randomization to one of three regimes (sprint interval training (SIT), high-volume interval training (HIITHI), or periodized interval training (PER) for the subsequent 10 sessions. Before, midway, and at the end of training, progressive cycling to exhaustion was completed during which V˙O2max and maximal CO were estimated. Compared with CON, significant (P HIIT + SIT (39.8 ± 7.3 mL·kg·min to 43.6 ± 6.1 mL·kg·min), HIIT + HIITHI (41.1 ± 4.9 mL·kg·min to 44.6 ± 7.0 mL·kg·min), and HIIT + PER (39.5 ± 5.6 mL·kg·min to 44.1 ± 5.4 mL·kg·min) occurred which were mediated by significant increases in maximal CO (20.0 ± 3.1 L·min to 21.7 ± 3.2 L·min, P = 0.04). Maximal stroke volume was increased with HIIT (P = 0.04), although there was no change in maximal HR (P = 0.88) or arteriovenous O2 difference (P = 0.36). These CO data are accurate and represent the mean changes from pre- to post-HIIT across all three training groups. Increases in V˙O2max exhibited in response to different HIIT regimes are due to improvements in oxygen delivery.
Directory of Open Access Journals (Sweden)
Rafael Alves de Aguiar
2013-03-01
Full Text Available O presente estudo comparou o tempo mantido acima de 90% (t90VO2max e de 95% VO2max (t95VO2max em três diferentes intensidades de exercício. Após a realização de um teste incremental para determinar o VO2max, oito estudantes de educação física ativos (23 ± 3 anos executaram três sessões de exercícios intermitentes (100, 110 e 120% da velocidade do VO2max (vVO2max com razão esforço:recuperação de 30s:15s. O t95VO2max foi significantemente maior em 110%vVO2max (EI110% (218,1 ± 81,6 s quando comparado a 100%vVO2max (EI100% (91,9 ± 75,2s e a 120%vVO2max (EI120% (126,3 ± 29,4 s, porém sem diferença entre EI100% e EI120%. O t90VO2max somente apresentou diferença significante entre EI110% e EI120%. Portanto, conclui-se que durante exercício intermitente com razão 30s:15s, a intensidade de 110%vVO2max apresenta-se mais adequada para manter o VO2 próximo ou no VO2max por um tempo maior.The present study compared the time maintained above 90% (t90VO2max or 95% VO2max (t95VO2max in three different exercise intensities. After performing an incremental test to determine VO2max, eight physical education active students (23 ± 3 years performed three intermittent exercise sessions (100, 110 e 120% velocity of VO2max (vVO2max with ratio effort:recovery of 30s:15s. The t95%VO2max was significantly higher at 110%vVO2max (EI110% (218.1 ± 81.6s compared to 100% vVO2max (EI100% (91.9 ± 75.2s and 120%vVO2max (EI120% (126.3 ± 29.4s, but without differences between EI100% and EI120%. The t90%vVO2max was significantly different only between EI110% and 120%. Therefore, we conclude that during intermittent exercise with ratio 30s:15s, the intensity of 110%vVO2max appears more appropriate to maintain VO2max for a longer time.
Max Kaur vassib oma diplomitega / Ralf-Martin Soe
Soe, Ralf-Martin
2008-01-01
Eraülikooli prorektor Max Kaur kinnitas kohalikel valimistel allkirjaga, et on lõpetanud Moskva Riikliku Ülikooli, kuid pärast Äripäeva järelpärimist tunnistas selle info ekslikuks. Vt. samas: Vene ülikooli diplom 1200 dollariga; Ka Reimann valetas hariduse kohta
Time limit and VO2 slow component at intensities corresponding to VO2max in swimmers.
Fernandes, R J; Cardoso, C S; Soares, S M; Ascensão, A; Colaço, P J; Vilas-Boas, J P
2003-11-01
The purpose of this study was to measure, in swimming pool conditions and with high level swimmers, the time to exhaustion at the minimum velocity that elicits maximal oxygen consumption (TLim at vVO(2)max), and the corresponding VO(2) slow component (O(2)SC). The vVO(2)max was determined through an intermittent incremental test (n = 15). Forty-eight hours later, TLim was assessed using an all-out swim at vVO(2)max until exhaustion. VO(2) was measured through direct oximetry and the swimming velocity was controlled using a visual light-pacer. Blood lactate concentrations and heart rate values were also measured. Mean VO(2)max for the incremental test was 5.09 +/- 0.53 l/min and the corresponding vVO(2)max was 1.46 +/- 0.06 m/s. Mean TLim value was 260.20 +/- 60.73 s and it was inversely correlated with the velocity of anaerobic threshold (r = -0.54, p energy cost of the respiratory muscles (r = 0.51), for p swimming pool, in high level swimmers performing at vVO(2)max, and that higher TLim seems to correspond to higher expected O(2)SC amplitude. These findings seem to bring new data with application in middle distance swimming.
Dissociative attachment reactions of electrons with gas phase superacids
International Nuclear Information System (INIS)
Liu, X.
1992-01-01
Using the flowing afterglow Langmuir probe (FALP) technique, dissociative attachment coefficients β for reactions of electrons with gas phase superacids HCo(PF 3 ) 4 , HRh(PF 3 ) 4 and carbonyl hydride complexes HMn(CO) 5 , HRe(CO) 5 have been determined under thermal conditions over the approximate temperature range 300∼550 K. The superacids react relatively slowly ( max ) with free electrons in a thermal plasma, and the values of β obtained this far do not show a correlation between acidity and β. The pioneer researchers in this field had speculated that any superacid would be a rapid attacher of electrons; it was found that this speculation is not true in general. The product distribution of electron attachment reaction to HCo(PF 3 ) 4 was found to be independent of temperature even though the β[HCo(PF 3 ) 4 ] increases with temperature. This proposes that the electron attachment process occurs well before the excited complex dissociates. In addition, the activation energy of HCo(PF 3 ) 4 for electron attachment has been derived from the Arrhenius plots. The carbonyl hydride complexes, HMn(CO) 5 and HRe(CO) 5 , react relatively rapidly (>1/4 of β max ) with free electrons in thermal plasma. This indicates that these reactions cannot be significantly endothermic. Observation of rapid attachment for these non-superacids shows that the Mn-CO and Re-CO bonds are weaker than the Mn-H and Re-H bonds, respectively. Comparisons between the carbonyl and trifluorophosphine cases implies that fast electron capture is related more to the CO ligand than to the transition-metal species
V/V/sub max/ test for QSOs: comments on the paper by Hawkins and Stewart
International Nuclear Information System (INIS)
Wills, D.
1983-01-01
Hawkins and Stewart's interpretation of the results of the V/V/sub max/ test for QSO samples is shown to be invalid. Their suggestion that the high values of V/V/sub max/ at small redshifts result from the exclusion of nearby QSOs from the samples is examined quantitatively for the well-studied 3CR sample, and shown to have a negligible effect on the results. Their claim that the values of V/V/sub max/ at larger redshifts indicate a uniform space density of QSOs is not true after an error in their calculations is corrected. Although the V/V/sub max/ test is less sensitive to space density evolution at large redshifts, current results are in good agreement with the hypothesis that a single density evolution law describes the observations out to a redshift of at least 2.5
Using the Min/Max Method for Replenishment of Picking Locations
Directory of Open Access Journals (Sweden)
Apsalons Raitis
2017-03-01
Full Text Available The irregularity of removing quantities from a definite picking location in a warehouse very often results in the stock out in the particular picking address. In practice, the Red Card principle is used to determine a critical level for each picking location when it is necessary to start the replenishment of stock in the picking address. The question is how to calculate an adequate critical level. The guidelines in this paper explain in detail the solution of the problem using the Min/Max stock control method and mathematical algorithms adjusted by authors. In order to check the validity of these mathematical algorithms of the Min/Max method, the simulation modelling has been also done and presented.
On Max-Plus Algebra and Its Application on Image Steganography
Directory of Open Access Journals (Sweden)
Kiswara Agung Santoso
2018-01-01
Full Text Available We propose a new steganography method to hide an image into another image using matrix multiplication operations on max-plus algebra. This is especially interesting because the matrix used in encoding or information disguises generally has an inverse, whereas matrix multiplication operations in max-plus algebra do not have an inverse. The advantages of this method are the size of the image that can be hidden into the cover image, larger than the previous method. The proposed method has been tested on many secret images, and the results are satisfactory which have a high level of strength and a high level of security and can be used in various operating systems.
Wilhite, Daniel P; Mickleborough, Timothy D; Laymon, Abigail S; Chapman, Robert F
2013-02-01
The purpose of this study was to estimate the percentage of the increase in whole body maximal oxygen consumption (.VO(2max)) that is accounted for by increased respiratory muscle oxygen uptake after altitude training. Six elite male distance runners (.VO(2max) = 70.6 ± 4.5 ml kg(-1) min(-1)) and one elite female distance runner (.VO(2max)) = 64.7 ml kg(-1) min(-1)) completed a 28-day "live high-train low" training intervention (living elevation, 2,150 m). Before and after altitude training, subjects ran at three submaximal speeds, and during a separate session, performed a graded exercise test to exhaustion. A regression equation derived from published data was used to estimate respiratory muscle .VO(2) (.VO(2RM)) using our ventilation (.VE) values. .VO(2RM) was also estimated retrospectively from a larger group of distance runners (n = 22). .VO(2max) significantly (p altitude (196 ± 59 ml min(-1)), while (.VE) at .VO(2max) also significantly (p altitude (201 ± 36 ml min(-1)), along with a 10.8 ± 2.1 l min(-1) increase in (.VE), thus requiring an estimated 27 % of Δ .VO(2max) Our data suggest that a substantial portion of the improvement in .VO(2max) with chronic altitude training goes to fuel the respiratory muscles as opposed to the musculature which directly contributes to locomotion. Consequently, the time-course of decay in ventilatory acclimatization following return to sea-level may have an impact on competitive performance.
Directory of Open Access Journals (Sweden)
Chetna Mathur
2015-12-01
Full Text Available ABSTRACT In the present study, the potential of seaweed liquid fertilizer (SLF of marine algae Enteromorpha intestinalis was evaluated for its effect on seed germination, yield, biochemical parameters and pigment characteristics of Glycine maxE. intestinalis was collected form Mandapam coast of Gulf of Mannar, Tamil Nadu, and the dried seaweeds were used for the preparation of SLF. G. max seeds were germinated with four different concentrations (20, 40, 60, and 100% of SLF; its growth and yield parameters were evaluated and compared with chemical fertilizer and control. The morphological and bio-chemical parameters such as seed germination (100%, root (6.6cm and shoot length (5.4 cm, carbohydrates (0.098 mg/g, protein (0.56 mg/g, pigment (0.444 mg/g chl a; 1.073 mg/g chl b; 3.70 mg/g carotenoids of the plant was found maximum at a concentration of 60% SLF. The phenol content (3.25 mg/g was maximum in 40% SLF. The GC-MS analysis of SLF revealed the presence of notable benzoic compounds involved in plant growth promotion. Results showed thatE. intestinalis derived SLF was potential biostimulant forG. max. Thus, marine algae based fertilizer could be an effective and alternate to the chemical fertilizers emphasizing the need for systematic evaluation programme for SLF on various crops.
Supervisory control of (max,+) automata: extensions towards applications
Czech Academy of Sciences Publication Activity Database
Lahaye, S.; Komenda, Jan; Boimond, J.-L.
2015-01-01
Roč. 88, č. 12 (2015), s. 2523-2537 ISSN 0020-7179 Institutional support: RVO:67985840 Keywords : discrete event systems * logical and timed behaviors * (max,+) automata * supervisory control Subject RIV: BA - General Mathematics Impact factor: 1.880, year: 2015 http://www.tandfonline.com/doi/full/10.1080/00207179.2015.1048295
Supervisory control of (max,+) automata: extensions towards applications
Czech Academy of Sciences Publication Activity Database
Lahaye, S.; Komenda, Jan; Boimond, J.-L.
2015-01-01
Roč. 88, č. 12 (2015), s. 2523-2537 ISSN 0020-7179 Institutional support: RVO:67985840 Keywords : discrete event systems * logical and time d behaviors * (max,+) automata * supervisory control Subject RIV: BA - General Mathematics Impact factor: 1.880, year: 2015 http://www.tandfonline.com/doi/full/10.1080/00207179.2015.1048295
Scalable and Flexible Multiview MAX-VAR Canonical Correlation Analysis
Fu, Xiao; Huang, Kejun; Hong, Mingyi; Sidiropoulos, Nicholas D.; So, Anthony Man-Cho
2017-08-01
Generalized canonical correlation analysis (GCCA) aims at finding latent low-dimensional common structure from multiple views (feature vectors in different domains) of the same entities. Unlike principal component analysis (PCA) that handles a single view, (G)CCA is able to integrate information from different feature spaces. Here we focus on MAX-VAR GCCA, a popular formulation which has recently gained renewed interest in multilingual processing and speech modeling. The classic MAX-VAR GCCA problem can be solved optimally via eigen-decomposition of a matrix that compounds the (whitened) correlation matrices of the views; but this solution has serious scalability issues, and is not directly amenable to incorporating pertinent structural constraints such as non-negativity and sparsity on the canonical components. We posit regularized MAX-VAR GCCA as a non-convex optimization problem and propose an alternating optimization (AO)-based algorithm to handle it. Our algorithm alternates between {\\em inexact} solutions of a regularized least squares subproblem and a manifold-constrained non-convex subproblem, thereby achieving substantial memory and computational savings. An important benefit of our design is that it can easily handle structure-promoting regularization. We show that the algorithm globally converges to a critical point at a sublinear rate, and approaches a global optimal solution at a linear rate when no regularization is considered. Judiciously designed simulations and large-scale word embedding tasks are employed to showcase the effectiveness of the proposed algorithm.
Beigi, P.; Mohammadi, P.
2017-11-01
In this study a reconfigurable antenna for WiMAX, WLAN, C-bands and SHF applications has been presented. The main body of antenna includes rectangular and L-shaped slotted ground plane and a rectangular patch with slotted feed line, for impedance bandwidth enhancement. In the proposed antenna, a PIN diode is used to adjust the frequency band to SHF, WiMAX, WLAN and C-bands applications. When PIN diode is forward-biased, the antenna covers the 3.5-31 GHz frequency range (i.e. a 160% bandwidth) and when the PIN diode is in its off-state, it operates between 3.4-5.8 GHz. The designed antenna, with a very small size of 12 × 18 × 1.6 mm3, has been fabricated and tested. The radiation pattern is approximately omnidirectional. Simulations and experimental results are in a good agreement with each other and suggest good performance for the presented antenna.
Sending Safety Video over WiMAX in Vehicle Communications
Directory of Open Access Journals (Sweden)
Jun Steed Huang
2013-10-01
Full Text Available This paper reports on the design of an OPNET simulation platform to test the performance of sending real-time safety video over VANET (Vehicular Adhoc NETwork using the WiMAX technology. To provide a more realistic environment for streaming real-time video, a video model was created based on the study of video traffic traces captured from a realistic vehicular camera, and different design considerations were taken into account. A practical controller over real-time streaming protocol is implemented to control data traffic congestion for future road safety development. Our driving video model was then integrated with the WiMAX OPNET model along with a mobility model based on real road maps. Using this simulation platform, different mobility cases have been studied and the performance evaluated in terms of end-to-end delay, jitter and visual experience.
Energy Technology Data Exchange (ETDEWEB)
Fischer, Ernst Peter
2010-06-15
The live of the physicist Max Planck was as exciting, conflicting, and rich on catastrophes as the epoch, in which he lived. Ernst Peter Fischer draws in this fascinatingly told biography the eventful history of the Nobel-price bearer and illustrates simultaneously the unique attainment of Planck, the quantum theory of whom not only revolted the science but also changed fundamentally our picture of the world.
Rectangular Ring Antenna Excited by Circular Disc Monopole for WiMAX System
Directory of Open Access Journals (Sweden)
Souphanna Vongsack
2014-01-01
Full Text Available This research presents a rectangular ring antenna excited by a circular disc monopole (CDM mounted in front of a square reflector. The proposed antenna is designed to cover a frequency range of 2.300–5.825 GHz and thereby is suitable for WiMAX applications. Multiple parametric studies were carried out using the CST Microwave Studio simulation program. A prototype antenna was fabricated and experimented. The measurements were taken and compared with the simulation results, which indicates good agreement between both results. The prototype antenna produces an impedance bandwidth (|S11| < −10 dB that covers the WiMAX frequency range and a constant unidirectional radiation pattern (θ=0° and ∅=90°. The minimum and maximum gains are 3.7 and 8.7 dBi, respectively. The proposed antenna is of compact size and has good unidirectional radiation performance. Thus, it is very suitable for a multitude of WiMAX applications.
Modeling high-Power Accelerators Reliability-SNS LINAC (SNS-ORNL); MAX LINAC (MYRRHA)
International Nuclear Information System (INIS)
Pitigoi, A. E.; Fernandez Ramos, P.
2013-01-01
Improving reliability has recently become a very important objective in the field of particle accelerators. The particle accelerators in operation are constantly undergoing modifications, and improvements are implemented using new technologies, more reliable components or redundant schemes (to obtain more reliability, strength, more power, etc.) A reliability model of SNS (Spallation Neutron Source) LINAC has been developed within MAX project and analysis of the accelerator systems reliability has been performed within the MAX project, using the Risk Spectrum reliability analysis software. The analysis results have been evaluated by comparison with the SNS operational data. Results and conclusions are presented in this paper, oriented to identify design weaknesses and provide recommendations for improving reliability of MYRRHA linear accelerator. The SNS reliability model developed for the MAX preliminary design phase indicates possible avenues for further investigation that could be needed to improve the reliability of the high-power accelerators, in view of the future reliability targets of ADS accelerators.
Supervisory Control of (max,+) automata: a behavioral approach
Czech Academy of Sciences Publication Activity Database
Komenda, Jan; Lahaye, S.; Boimond, J.-L.
2009-01-01
Roč. 19, č. 4 (2009), s. 525-549 ISSN 0924-6703 Grant - others:EU Projekt(XE) EU.ICT.DISC 224498 Institutional research plan: CEZ:AV0Z10190503 Keywords : timed discrete-event systems * supervisory control * formal power series * (max,+) * automata Subject RIV: BA - General Mathematics Impact factor: 0.921, year: 2009
HINS R and D Collaboration on Electron Cloud Effects: Midyear Report
International Nuclear Information System (INIS)
Furman, M.A.; Sonnad, K.; Vay, J.-L.
2006-01-01
We present a report on ongoing activities on electron-cloud R and D for the MI upgrade. These results update and extend those presented in Refs. 1, 2. In this report we have significantly expanded the parameter range explored in bunch intensity Nb, RMS bunch length σ z and peak secondary emission yield (SEY) (delta) max , but we have constrained our simulations to a field-free region. We describe the threshold behaviors in all of the above three parameters. For (delta) max (ge) 1.5 we find that, even for N b = 1 x 10 11 , the electron cloud density, when averaged over the entire chamber, exceeds the beam neutralization level, but remains significantly below the local neutralization level (ie., when the electron density is computed in the neighborhood of the beam). This 'excess' of electrons is accounted for by narrow regions of high concentration of electrons very close to the chamber surface, especially at the top and bottom of the chamber, akin to virtual cathodes. These virtual cathodes are kept in equilibrium, on average, by a competition between space-charge forces (including their images) and secondary emission, a mechanism that shares some features with the space-charge saturation of the current in a diode at high fields. For N b = 3 x 10 11 the electron cloud build-up growth rate and saturation density have a strong dependence on σ z as σ z decreases below ∼ 0.4 m, when the average electron-wall impact energy roughly reaches the energy E max where (delta) peaks. We also present improved results on emittance growth simulations of the beam obtained with the code WARP/POSINST in quasi-static mode, in which the beam-(electron cloud) interaction is lumped into N s 'stations' around the ring, where N s = 1, 2,..., 9. The emittance shows a rapid growth of ∼ 20% during the first ∼ 100 turns, followed by a much slower growth rate of ∼ 0.03%/turn. Concerning the electron cloud detection technique using microwave transmission, we present an improved
International Nuclear Information System (INIS)
Datz, H.; Horowitz, Y.S.; Epstein, L.; Oster, L.; Livingstone, J.; Horowitz, A.; Kol, M.; Margaliot, M.
2011-01-01
It is demonstrated that the supralinearity of the dose response of glow peaks 7, 8 in the glow curve of LiF:Mg,Ti (TLD-100) are very strongly dependent on photon/electron energy. Previously published data on f(D) max at photon energies of 1.25 MeV, 100 keV and 8.1 keV effective energy coupled with new data at ∼ 540 keV using 90 Sr/ 90 Y beta rays reveals that the maximum supralinearity f(D) max decreases from values of ∼200 and ∼30 at 1.25 MeV, through intermediate values at 540 keV and 100 keV, to values of ∼ 30 and ∼3 at 8.1 keV effective energy. The normalized dose response f(D) for all energies is modeled using the Unified Interaction Model and the dependence of f(D) max on energy is interpreted as arising from strong dependence of the relative intensity of localized recombination on particle energy (ionization density).
Relationship between Physical Activity and Age on the Main Categories of Cognitive Processes
Perrot , Alexandra; Maillot , Pauline; Gagnon , Christine; Bertsch , Jean
2011-01-01
Many transversal studies show a positive relationship between physical activity and a large panel of cognitive functions. However, the majority of studies in this domain separately investigated categories of cognitive functions (e.g., attention, executive functions, visuospatial abilities). Studies simultaneously addressing the main categories of cognitive functions are rare. Moreover, assessment methods to measure physical activity are diverse (i.e., direct method with VO2max or indirect met...
Directory of Open Access Journals (Sweden)
Gregorius Pito Wahyu Prakoso
2017-09-01
Abstract This study aims to determine: (1 differences in the influence of methods of circuit training and interval method of training on the increase in capacity VO2Max basketball (2 the difference of increase in capacity VO2Max basketball resilient tall limb muscle and muscular endurance leg lower the increase in capacity VO2Max basketball, and (3 the interaction between exercise and limb muscle endurance against the increase in capacity VO2Max basketball. This research method used experiments with 2 x 2 factorial design study. The research sample of 20 children trained were taken with purposive sampling technique. Data were analyzed using analysis of variants (ANOVA. The results of this study indicate that: (1 there is no significant difference between exercise training method circuit training and training methods interval training against the increase in capacity VO2Max basketball, (2 There are no significant differences in increase in capacity VO2Max basketball among students who have the endurance of leg muscle and durability of low leg muscle, (3 there is no interaction between the method of training (circuit training and interval training and leg muscle endurance against the increase in capacity VO2Max basketball.
Service Level Agreement for the QoS Guaranteed Mobile IPTV Services over Mobile WiMAX Networks
Chowdhury, Mostafa Zaman; Trung, Bui Minh; Jang, Yeong Min; Kim, Young-Il; Ryu, Won
2011-01-01
While mobile IPTV services are supported through the mobile WiMAX networks, there must need some guaranteed bandwidth for the IPTV services especially if IPTV and non-IPTV services are simultaneously supported by the mobile WiMAX networks. The quality of an IPTV service definitely depends on the allocated bandwidth for that channel. However, due to the high quality IPTV services and to support of huge non-IPTV traffic over mobile WiMAX networks, it is not possible to guarantee the sufficient ...
MAX: Development of a Laue diffraction lens for nuclear astrophysics
International Nuclear Information System (INIS)
Barriere, N.; Ballmoos, P. von; Skinner, G.; Smither, B.; Bastie, P.; Hinglais, E.; Abrosimov, N.; Alvarez, J.M.; Andersen, K.; Courtois, P.; Halloin, H.; Harris, M.; Isern, J.; Jean, P.; Knoedlseder, J.; Ubertini, P.; Vedrenne, G.; Weidenspointner, G.; Wunderer, C.
2006-01-01
The next generation of instrumentation for nuclear astrophysics will have to achieve an improvement in sensitivity by a factor of 10-100 over present technologies. With the focusing gamma-ray telescope MAX we take up this challenge and propose to combine the required sensitivity with high spectral and angular resolution, and the capability to measure the polarization of the photons. MAX is a space-borne crystal diffraction telescope, featuring a broad-band Laue lens optimized for the observation of compact sources in two wide energy bands of high astrophysical relevance. Gamma rays will be focused from the large collecting area of a crystal diffraction lens onto a very small detector volume. As a consequence, the signal to background ratio is greatly enhanced, leading to unprecedented sensitivities
Portrait Face-Off: Gilbert Stuart vs. Peter Max
Crumpecker, Cheryl
2012-01-01
When art classes are short and infrequent, it is always a challenge to meet required state and national standards. A unit comparing and contrasting Peter Max's Pop art portraits with the realistic style of Gilbert Stuart's presidential portraits provides an opportunity to address a huge number of these requirements. Focus can change with the age…
Temperature-dependent DC characteristics of AlInN/GaN high-electron-mobility transistors
Kim, Seongjun; Ahn, Kwang-Soon; Ryou, Jae-Hyun; Kim, Hyunsoo
2017-07-01
A 1.5 μm gate AlInN:Mg/GaN HEMT, exhibiting a maximum drain current ( I DS,max) of 700 mA/mm at a gate bias voltage ( V GS) of 0 V and a maximum transconductance ( g m,max) of 190 mS/mm at drain-source voltage ( V DS) of 5 V, was analyzed at temperatures ranging from 210 K to 420 K. It was found that I DS,max and g m,max have weak temperature dependence with a power-law relation of T -0.5, owing to suppressed optical phonon scattering. The threshold voltage ( V th) was found to be stable under increasing temperatures owing to the use of a semi-insulating AlInN:Mg barrier. This indicates that AlInN:Mg/GaN HEMTs are promising candidates for high-temperature electronics applications.[Figure not available: see fulltext.
Cosmological Constraints From SDSS MaxBCG Cluster Abundances
International Nuclear Information System (INIS)
Rozo, Eduardo; Wechsler, Risa H.; KICP, Chicago; Koester, Benjamin P.; McKay, Timothy A.; Evrard, August E.; Johnston, David; Sheldon, Erin S.; Annis, James; Frieman, Joshua A.
2007-01-01
We perform a maximum likelihood analysis of the cluster abundance measured in the SDSS using the maxBCG cluster finding algorithm. Our analysis is aimed at constraining the power spectrum normalization σ 8 , and assumes flat cosmologies with a scale invariant spectrum, massless neutrinos, and CMB and supernova priors (Omega) m h 2 = 0.128 ± 0.01 and h = 0.72 ± 0.05 respectively. Following the method described in the companion paper Rozo et al. (2007), we derive σ 8 = 0.92 ± 0.10 (1σ) after marginalizing over all major systematic uncertainties. We place strong lower limits on the normalization, σ 8 > 0.76 (95% CL) (> 0.68 at 99% CL). We also find that our analysis favors relatively low values for the slope of the Halo Occupation Distribution (HOD), α = 0.83 ± 0.06. The uncertainties of these determinations will substantially improve upon completion of an ongoing campaign to estimate dynamical, weak lensing, and X-ray cluster masses in the SDSS maxBCG cluster sample
Maks Kaur : "Uverenno idti dalshe!" / Max Kaur ; interv. Viktor Volohhov
Kaur, Max, 1969-
2006-01-01
Noor ja poliitikas aktiivselt tegev olnud Max Kaur jätkab Majandus- ja juhtimisinstituudi prorektorina. Senisest poliitilisest tegevusest, vene kultuuri arengust ja probleemidest Eestis, poliitikas osalejate keskmise vanuse langusest, isiklikest plaanidest
Jazõk do demokrati ne dovedjot / Max van der Stoel
Stoel, Max van der, 1924-2011
1999-01-01
OSCE vähemusrahvuste ülemkomissari Max van der Stoeli pöördumine Lennart Meri poole seoses riigikeele oskuse nõude sisseviimisega Riigikogu valimise ja kohaliku omavalitsuse volikogu valimise seadusesse
Energy Technology Data Exchange (ETDEWEB)
Laengst, W.; Lapp, A.; Stuebbe, K.; Schirmer, J.; Kraft, D. [Robert Bosch GmbH, Stuttgart (Germany). Zentralbereich Forschung und Vorausentwicklung
2003-07-01
The methodology introduced in this article is capable of describing a binary behavior of distributed discrete event systems. This is the basis for a safety analysis in early phases of system development and for an automated determination of failure dependencies. For this purpose a system equation similar to the state-space representation in system theory is used. The equation is evaluated applying the Max-Plus/Min-Plus algebra. The procedure is exemplified by a simplified braking system. (orig.) [German] In dem vorliegenden Artikel wird ein Verfahren zur binaeren Beschreibung von verteilten ereignisdiskreten Systemen vorgestellt. Dieses wird als Grundlage fuer eine Sicherheitsanalyse in einer fruehen Phase der Systementwicklung und zur automatisierten Ermittlung von Fehlerabhaengigkeiten eingesetzt. Hierzu wird eine Systemgleichung verwendet, die aehnlich zu der Zustandsraumdarstellung der konventionellen Systemtheorie ist. Dabei erfolgt die Auswertung der Systemgleichung durch Anwendung der Max-Plus/Min-Plus Algebra. Die Vorgehensweise wird anhand des Beispiels eines vereinfachten Bremssystems erlaeutert. (orig.)
Rescuing the MaxEnt treatment for q-generalized entropies
Plastino, A.; Rocca, M. C.
2018-02-01
It has been recently argued that the MaxEnt variational problem would not adequately work for Renyi's and Tsallis' entropies. We constructively show here that this is not so if one formulates the associated variational problem in a more orthodox functional fashion.
Two cytoplasmic male-sterile (CMS) oilseed sunflower (Helianthus annuus L.) genetic stocks, CMS GIG2 (Reg. No. xxx, PI xxxx), and CMS GIG2-RV (Reg. No. xxx, PI xxxx), and corresponding fertility restoration lines RF GIG2-MAX 1631 (Reg. No. xxx, PI xxxx) and RF GIG2-MAX 1631-RV (Reg. No. xxx, PI xxx...
Finnsjoen study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-12-01
The Finnsjoen study site was selected in 1977 to provide input to the KBS-1 and KBS-2 performance assessments. The site was later used as a test site for testing new instruments and new site characterization methods, as well as a research site for studying mainly groundwater flow and groundwater transport. All together, the Finnsjoen studies have involved 11 cored boreholes, down to max 700 m depth, and extensive borehole geophysical, geochemical and geohydraulic measurements, as well as rock stress measurements and tracer tests. This report presents the scope of the Finnsjoen studies together with main results. Conceptual uncertainties in assumptions and models are discussed with emphasis on the models used for the performance assessment SKB91. Of special interest for the Finnsjoen study site is the strong influence caused by a subhorizontal fracture zone on groundwater flow, transport and chemistry
Max Raphael, dialectics and Greek art
Healy, P.
2007-01-01
The article outlines what is required for a theory of art in the late work of Max Raphael, by showing that it is a response to a problematic first formulated, but left unanswered, by Marx, and which can be seen as developed by Raphael in his writing, especially the text he devoted to a dialectic interpretation of Greek art, with special reference to temple architecture. In detailing this latter study it is possible to see how Raphael’s understanding and analysis is guided by his account of an...
Directory of Open Access Journals (Sweden)
M. Louta
2014-01-01
Full Text Available WiMAX (Worldwide Interoperability for Microwave Access constitutes a candidate networking technology towards the 4G vision realization. By adopting the Orthogonal Frequency Division Multiple Access (OFDMA technique, the latest IEEE 802.16x amendments manage to provide QoS-aware access services with full mobility support. A number of interesting scheduling and mapping schemes have been proposed in research literature. However, they neglect a considerable asset of the OFDMA-based wireless systems: the dynamic adjustment of the downlink-to-uplink width ratio. In order to fully exploit the supported mobile WiMAX features, we design, develop, and evaluate a rigorous adaptive model, which inherits its main aspects from the reinforcement learning field. The model proposed endeavours to efficiently determine the downlink-to-uplinkwidth ratio, on a frame-by-frame basis, taking into account both the downlink and uplink traffic in the Base Station (BS. Extensive evaluation results indicate that the model proposed succeeds in providing quite accurate estimations, keeping the average error rate below 15% with respect to the optimal sub-frame configurations. Additionally, it presents improved performance compared to other learning methods (e.g., learning automata and notable improvements compared to static schemes that maintain a fixed predefined ratio in terms of service ratio and resource utilization.
Motion control system of MAX IV Laboratory soft x-ray beamlines
International Nuclear Information System (INIS)
Sjöblom, Peter; Lindberg, Mirjam; Forsberg, Johan; Persson, Andreas G.; Urpelainen, Samuli; Såthe, Conny
2016-01-01
At the MAX IV Laboratory, five new soft x-ray beamlines are under development. The first is Species and it will be used to develop and set the standard of the control system, which will be common across the facility. All motion axes at MAX IV will be motorized using stepper motors steered by the IcePAP motion controller and a mixture of absolute and incremental encoders following a predefined coordinate system. The control system software is built in Tango and uses the Python-based Sardana framework. The user controls the entire beamline through a synoptic overview and Sardana is used to run the scans.
Motion control system of MAX IV Laboratory soft x-ray beamlines
Energy Technology Data Exchange (ETDEWEB)
Sjöblom, Peter, E-mail: peter.sjoblom@maxlab.lu.se; Lindberg, Mirjam, E-mail: mirjam.lindberg@maxlab.lu.se; Forsberg, Johan, E-mail: johan.forsberg@maxlab.lu.se; Persson, Andreas G., E-mail: andreas-g.persson@maxlab.lu.se; Urpelainen, Samuli, E-mail: samuli.urpelainen@maxlab.lu.se; Såthe, Conny, E-mail: conny.sathe@maxlab.lu.se [MAX IV Laboratory, Photongatan 2, 225 92 Lund (Sweden)
2016-07-27
At the MAX IV Laboratory, five new soft x-ray beamlines are under development. The first is Species and it will be used to develop and set the standard of the control system, which will be common across the facility. All motion axes at MAX IV will be motorized using stepper motors steered by the IcePAP motion controller and a mixture of absolute and incremental encoders following a predefined coordinate system. The control system software is built in Tango and uses the Python-based Sardana framework. The user controls the entire beamline through a synoptic overview and Sardana is used to run the scans.
Availability and Usability of BHO Encounter Data in MAX 2009
U.S. Department of Health & Human Services — Availability and Usability of Behavioral Health Organization Encounter Data in MAX 2009, published in Volume 4, Issue 2 of Medicare and Medicaid Research Review,...
DEFF Research Database (Denmark)
Skov, Lone; Kragballe, Knud; Zachariae, Claus
2003-01-01
BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE......: To test safety and efficacy of a fully human monoclonal anti-CD4 antibody (HuMax-CD4) in the treatment of psoriasis. DESIGN: Multicenter, double-blind, placebo-controlled, randomized clinical trial. Patients Eighty-five patients with moderate to severe psoriasis. INTERVENTIONS: Subcutaneous infusions...... dose level, 6 (38%) of 16 patients obtained more than 25% reduction of PASI and 3 (19%) obtained more than 50% reduction of PASI. A dose-dependent decrease in total lymphocyte count was seen and was parallel to a dose-dependent decrease in CD4+ T cells. This decrease was due to a decrease in the memory...
Multimedia programming using Max/MSP and TouchDesigner
Lechner, Patrik
2014-01-01
If you want to learn how to use Max 6 and/or TouchDesigner, or work in audio-visual real-time processing, this is the book for you. It is intended for intermediate users of both programs and can be helpful for artists, designers, musicians, VJs, and researchers. A basic understanding of audio principles is advantageous.
Max Weber and the Iron Cage of Technology
Maley, Terry
2004-01-01
Max Weber is seen by mainstream social scientists as a sociologist, social theorist, and theorist of bureaucracy. In this reassessment of Weber's social science and its methodology, it is suggested that Weber can also be seen as a compelling early 20th-century critic of science and technology. The theme of technology, and Webers ambivalence about…
An optimal dynamic interval stabbing-max data structure?
DEFF Research Database (Denmark)
Agarwal, Pankaj Kumar; Arge, Lars; Yi, Ke
2005-01-01
In this paper we consider the dynamic stabbing-max problem, that is, the problem of dynamically maintaining a set S of n axis-parallel hyper-rectangles in Rd, where each rectangle s ∈ S has a weight w(s) ∈ R, so that the rectangle with the maximum weight containing a query point can be determined...
Proteomics Quality Control: Quality Control Software for MaxQuant Results.
Bielow, Chris; Mastrobuoni, Guido; Kempa, Stefan
2016-03-04
Mass spectrometry-based proteomics coupled to liquid chromatography has matured into an automatized, high-throughput technology, producing data on the scale of multiple gigabytes per instrument per day. Consequently, an automated quality control (QC) and quality analysis (QA) capable of detecting measurement bias, verifying consistency, and avoiding propagation of error is paramount for instrument operators and scientists in charge of downstream analysis. We have developed an R-based QC pipeline called Proteomics Quality Control (PTXQC) for bottom-up LC-MS data generated by the MaxQuant software pipeline. PTXQC creates a QC report containing a comprehensive and powerful set of QC metrics, augmented with automated scoring functions. The automated scores are collated to create an overview heatmap at the beginning of the report, giving valuable guidance also to nonspecialists. Our software supports a wide range of experimental designs, including stable isotope labeling by amino acids in cell culture (SILAC), tandem mass tags (TMT), and label-free data. Furthermore, we introduce new metrics to score MaxQuant's Match-between-runs (MBR) functionality by which peptide identifications can be transferred across Raw files based on accurate retention time and m/z. Last but not least, PTXQC is easy to install and use and represents the first QC software capable of processing MaxQuant result tables. PTXQC is freely available at https://github.com/cbielow/PTXQC .
Sympathy and the Non-human: Max Scheler's Phenomenology of ...
African Journals Online (AJOL)
German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy, arguing that sympathy enables not only ethical behaviour, but also knowledge of animate and inanimate others. Influenced by Catholicism and especially St Francis, Scheler envisioned a broad, cosmic sympathy ...
Long term ionospheric electron content variations over Delhi
Directory of Open Access Journals (Sweden)
J. K. Gupta
Full Text Available Ionospheric electron content (IEC observed at Delhi (geographic co-ordinates: 28.63°N, 77.22°E; geomagnetic co-ordinates: 19.08°N, 148.91°E; dip Latitude 24.8°N, India, for the period 1975–80 and 1986–89 belonging to an ascending phase of solar activity during first halves of solar cycles 21 and 22 respectively have been used to study the diurnal, seasonal, solar and magnetic activity variations. The diurnal variation of seasonal mean of IEC on quiet days shows a secondary peak comparable to the daytime peak in equinox and winter in high solar activity. IECmax (daytime maximum value of IEC, one per day shows winter anomaly only during high solar activity at Delhi. Further, IECmax shows positive correlation with F10.7 up to about 200 flux units at equinox and 240 units both in winter and summer; for greater F10.7 values, IECmax is substantially constant in all the seasons. IECmax and magnetic activity (Ap are found to be positively correlated in summer in high solar activity. Winter IECmax shows positive correlation with Ap in low solar activity and negative correlation in high solar activity in both the solar cycles. In equinox IECmax is independent of Ap in both solar cycles in low solar activity. A study of day-to-day variations in IECmax shows single day and alternate day abnormalities, semi-annual and annual variations controlled by the equatorial electrojet strength, and 27-day periodicity attributable to the solar rotation.
Key words: Ionosphere (equatorial ionosphere · Magnetospheric physics (magnetosphere · ionosphere interactions · Radio science (ionospheric physics
Ferrucci, Francesca; Ciaccio, Roberto; Monticelli, Sara; Pigini, Paolo; di Giacomo, Simone; Purgato, Stefania; Erriquez, Daniela; Bernardoni, Roberto; Norris, Murray; Haber, Michelle; Milazzo, Giorgio; Perini, Giovanni
2018-03-01
Childhood neuroblastoma, a disease of the sympathetic nervous system, is the most common solid tumour of infancy, remarkably refractory to therapeutic treatments. One of the most powerful independent prognostic indicators for this disease is the amplification of the MYCN oncogene, which occurs at high levels in approximately 25% of neuroblastomas. Interestingly, amplification and not just expression of MYCN has a strong prognostic value, although this fact appears quite surprising as MYCN is a transcription factor that requires dimerising with its partner MAX, to exert its function. This observation greatly suggests that the role of MYCN in neuroblastoma should be examined in the context of MAX expression. In this report, we show that, in contrast to what is found in normal cells, MAX expression is significantly different among primary NBs, and that its level appears to correlate with the clinical outcome of the disease. Importantly, controlled modulation of MAX expression in neuroblastoma cells with different extents of MYCN amplification, demonstrates that MAX can instruct gene transcription programs that either reinforce or weaken the oncogenic process enacted by MYCN. In general, our work illustrates that it is the MAX to MYCN ratio that can account for tumour progression and clinical outcome in neuroblastoma and proposes that such a ratio should be considered as an important criterion to the design and development of anti-MYCN therapies. Copyright © 2018 Elsevier B.V. All rights reserved.
Multivariate max-stable spatial processes
Genton, Marc G.; Padoan, S. A.; Sang, H.
2015-01-01
Max-stable processes allow the spatial dependence of extremes to be modelled and quantified, so they are widely adopted in applications. For a better understanding of extremes, it may be useful to study several variables simultaneously. To this end, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. We define a Poisson process construction and introduce multivariate versions of the Smith Gaussian extreme-value, the Schlather extremal-Gaussian and extremal-t, and the Brown–Resnick models. We develop inference for the models based on composite likelihoods. We present results of Monte Carlo simulations and an application to daily maximum wind speed and wind gust.
Multivariate max-stable spatial processes
Genton, Marc G.
2015-02-11
Max-stable processes allow the spatial dependence of extremes to be modelled and quantified, so they are widely adopted in applications. For a better understanding of extremes, it may be useful to study several variables simultaneously. To this end, we study the maxima of independent replicates of multivariate processes, both in the Gaussian and Student-t cases. We define a Poisson process construction and introduce multivariate versions of the Smith Gaussian extreme-value, the Schlather extremal-Gaussian and extremal-t, and the Brown–Resnick models. We develop inference for the models based on composite likelihoods. We present results of Monte Carlo simulations and an application to daily maximum wind speed and wind gust.
Luhmann, Janet; Hurt, Sarah; Shootman, Mario; Kennedy, Robert
2004-03-01
Peripheral intravenous catheter (PIV) insertion is a common, painful experience for many children in the pediatric emergency department. Although local anesthetics such as injected buffered lidocaine have been shown to be effective at reducing pain and anxiety associated with PIV insertion, they are not routinely used. ELA-Max, a topical local anesthetic, has the advantage of needle-free administration but has not been compared with buffered lidocaine for PIV insertion. To compare the reduction of pain and anxiety during PIV insertion provided by subcutaneous buffered 1% lidocaine or topical ELA-Max in children. A randomized trial in children 4 to 17 years old undergoing PIV insertion with 22-gauge catheters was conducted. Children received either buffered lidocaine or ELA-Max. Buffered lidocaine was administered by using 30-gauge needles to inject 0.1 to 0.2 mL subcutaneously just before PIV insertion. ELA-Max was applied to the skin and occluded with Tegaderm 30 minutes before PIV insertion. Self-reported Visual Analog Scale (VAS) questionnaires (rating on a scale of 1-10; 1 = no pain, anxiety) were completed by patients and their parents before PIV insertion to assess baseline perceptions about pain and anxiety associated with PIV insertion and immediately after PIV insertion to assess pain and anxiety associated with the experience. After PIV insertion, the nurse who inserted the PIV also completed a VAS questionnaire assessing technical difficulty and satisfaction with the local anesthesia. A blinded observer also completed a VAS questionnaire to assess pain and anxiety associated with the PIV insertion. Data were analyzed by using chi2 and t tests. Sixty-nine subjects were enrolled, and questionnaires were competed by all (mean age: 12.1 +/- 4.5 years; 61% female). There were no differences for buffered lidocaine and ELA-Max groups in age, gender, race, prior IV experience, or baseline pain and anxiety. There were no significant differences between buffered
Lifescience Database Archive (English)
Full Text Available oat Peroxidase; Glycine Max Molecule: Seed Coat Peroxidase; Chain: A, B, C; Engineered: Yes Oxidoreductase 1...LFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAI
Capacity Evaluation for IEEE 802.16e Mobile WiMAX
Directory of Open Access Journals (Sweden)
Chakchai So-In
2010-01-01
Full Text Available We present a simple analytical method for capacity evaluation of IEEE 802.16e Mobile WiMAX networks. Various overheads that impact the capacity are explained and methods to reduce these overheads are also presented. The advantage of a simple model is that the effect of each decision and sensitivity to various parameters can be seen easily. We illustrate the model by estimating the capacity for three sample applications—Mobile TV, VoIP, and data. The analysis process helps explain various features of IEEE 802.16e Mobile WiMAX. It is shown that proper use of overhead reducing mechanisms and proper scheduling can make an order of magnitude difference in performance. This capacity evaluation method can also be used for validation of simulation models.
The effect of Iron Supplying on VO2 MAX and Haematology Parameter on Menstrual Woman
Nailuvar Sinaga, Rika; Sari Harahap, Novita; Mediyana Sari, Rima
2018-03-01
One of the supporting factors to have good aerobic endurance requires high VO2 max levels supported by good quality and quantity level of Haematology parameter especially such as erythrocytes, hematocrit and hemoglobin. One of the components in hemoglobin is iron which functions as theoxygen transport to parts of all body required in the process of metabolism. The objective of this research was to find out the difference between VO2 Max and Haematology parameter between iron supplying and no iron supplyingonmenstrual woman. The type of this research is quasi experimental research with non-randomized control group Pretest-Postest Design. The subjectsarethe studentsat faculty of Sports Sciences, Medan State University with the criteria of female gender, monthly regular menstrual cycle, having the level of health and the level of training, willing to be a sample by filling out informed consent. The total number of research subjectsis twenty students, divided into two groups namely the treatment group and the control group. The hematology parameter was measuredby Haemotology analyzer and VO2 Max was measured by multi-stage run. The result showed that there was a significant effect of iron supplyingon the increase of erythrocyte level on menstrual women, hemotocrit, haemoglobin and an increase in VO2 Max. Iron supplying on menstrual woman has the effect on the increase of erythrocyte, hematocrit, hemoglobin level and VO2 Max
International Nuclear Information System (INIS)
Fieber, W.
2001-05-01
In the present work, solution structural and dynamic properties of the dimerization and DNA binding domains of the transcription factors v-Myc and Max were characterized by NMR and CD spectroscopy. It could be demonstrated that v-Myc in the absence of its authentic binding partner Max does not homodimerize, but exists in a monomeric and prestructured form. Two separated α-helical regions in the leucine zipper region and in the basic-H1 region, respectively, could be identified, while the latter appeared to be less stable. Both helices lack stabilizing tertiary side chain interactions and represent exceptional examples for loosely coupled, structured segments in a native protein. The structure of v-Myc is dynamic and can be described as a distribution of conformational substates. Motion within the substates comprise fast (picosecond to nanosecond) local backbone fluctuations like helical fraying, whereas motion between the substates comprise the relative orientation of the two helices and occur at larger time scales (microsecond to millisecond). The preformation of the specific protein and DNA binding sites, leucine zipper and the basic region, presumably allows rapid and accurate recognition of the respective binding partners. v-Myc-Max and Max-Max protein preparations were shown to form stable dimers. Thermodynamic analysis of the dissociation reactions of v-Myc-Max revealed a significant higher stability of the heterodimer than of the Max-Max homodimer over the whole temperature range. It could be demonstrated that the restricted conformational space of the v-Myc bHLHZip domain reduces the entropy penalty associated with dimerization and contributes to the preference of Max to form heterodimers with v-Myc rather than homodimers. (author)
Max-plus algebraic throughput analysis of synchronous dataflow graphs
de Groote, Robert; Kuper, Jan; Broersma, Haitze J.; Smit, Gerardus Johannes Maria
2012-01-01
In this paper we present a novel approach to throughput analysis of synchronous dataflow (SDF) graphs. Our approach is based on describing the evolution of actor firing times as a linear time-invariant system in max-plus algebra. Experimental results indicate that our approach is faster than
Soybean ( Glycine max ) as a versatile biocatalyst for organic ...
African Journals Online (AJOL)
A series of aliphatic and aromatic aldehydes and ketones were reduced using plant cell preparations of Glycine max seeds (soybean). The biotransformation of five aromatic aldehydes in water, at room temperature afforded the corresponding alcohols in excellent yields varying from 89 to 100%. Two prochiral aromatic ...
IMPROVEMENT OF THE RICHNESS ESTIMATES OF maxBCG CLUSTERS
International Nuclear Information System (INIS)
Rozo, Eduardo; Rykoff, Eli S.; Koester, Benjamin P.; Hansen, Sarah; Becker, Matthew; Bleem, Lindsey; McKay, Timothy; Hao Jiangang; Evrard, August; Wechsler, Risa H.; Sheldon, Erin; Johnston, David; Annis, James; Scranton, Ryan
2009-01-01
Minimizing the scatter between cluster mass and accessible observables is an important goal for cluster cosmology. In this work, we introduce a new matched filter richness estimator, and test its performance using the maxBCG cluster catalog. Our new estimator significantly reduces the variance in the L X -richness relation, from σ lnLx 2 = (0.86±0.02) 2 to σ lnLx 2 = (0.69±0.02) 2 . Relative to the maxBCG richness estimate, it also removes the strong redshift dependence of the L X -richness scaling relations, and is significantly more robust to photometric and redshift errors. These improvements are largely due to the better treatment of galaxy color data. We also demonstrate the scatter in the L X -richness relation depends on the aperture used to estimate cluster richness, and introduce a novel approach for optimizing said aperture which can easily be generalized to other mass tracers.
Boynton, R. J.; Mourenas, D.; Balikhin, M. A.
2017-11-01
Dropouts in electron fluxes at L ˜ 4.2 were investigated for a broad range of energies from 120 keV to 10 MeV, using 16 years of electron flux data from Combined X-ray Dosimeter on board Global Positioning System (GPS) satellites. Dropouts were defined as flux decreases by at least a factor 4 in 12 h, or 24 h during which a decrease by at least a factor of 1.5 must occur during each 12 h time bin. Such fast and strong dropouts were automatically identified from the GPS electron flux data and statistics of dropout magnitudes, and occurrences were compiled as a function of electron energy. Moreover, the Error Reduction Ratio analysis was employed to search for nonlinear relationships between electron flux dropouts and various solar wind and geomagnetic activity indices, in order to identify potential external causes of dropouts. At L ˜ 4.2, the main driving factor for the more numerous and stronger 1-10 MeV electron dropouts turns out to be the southward interplanetary magnetic field Bs, suggesting an important effect from precipitation loss due to combined electromagnetic ion cyclotron and whistler mode waves in a significant fraction of these events, supplementing magnetopause shadowing and outward radial diffusion which are also effective at lower energies.
Biophysical properties of regions flanking the bHLH-Zip motif in the p22 Max protein
International Nuclear Information System (INIS)
Pursglove, Sharon E.; Fladvad, Malin; Bellanda, Massimo; Moshref, Ahmad; Henriksson, Marie; Carey, Jannette; Sunnerhagen, Maria
2004-01-01
The Max protein is the central dimerization partner in the Myc-Max-Mad network of transcriptional regulators, and a founding structural member of the family of basic-helix-loop-helix (bHLH)-leucine zipper (Zip) proteins. Biologically important regions flanking its bHLH-Zip motif have been disordered or absent in crystal structures. The present study shows that these regions are resistant to proteolysis in both the presence and absence of DNA, and that Max dimers containing both flanking regions have significantly higher helix content as measured by circular dichroism than that predicted from the crystal structures. Nuclear magnetic resonance measurements in the absence of DNA also support the inferred structural order. Deletion of both flanking regions is required to achieve maximal DNA affinity as measured by EMSA. Thus, the previously observed functionalities of these Max regions in DNA binding, phosphorylation, and apoptosis are suggested to be linked to structural properties
Max Weber entre liberalismo y republicanismo
Directory of Open Access Journals (Sweden)
Villacañas Berlanga, José Luis
2005-12-01
Full Text Available This article attempts to analyze the differences between social democracy and political democracy as modern processes, as these were understood by Max Weber. The archetype of modernity resides, from this point of view, in a convergence of both processes, as occurred in countries like the USA and Great Britain. Weber's diagnosis is that, whereas social democracy can be organized around liberal arguments, political democracy cannot advance without republican concepts like those of virtue, rigour, responsability and representation. For Weber, these values could only become present in Germany thanks to an adequate and democratic reception of Nietzsche, and in some way this reception could make sense of the former's work.
Este artículo pretende analizar las diferencias entre democracia social y democracia política como procesos modernos, tal y como fueron comprendidos por Max Weber. Lo arquetípico de la modernidad reside, desde este punto de vista, en una convergencia de ambos procesos, tal y como se dio en países como USA y Gran Bretaña. El diagnóstico de Weber es que, mientras la democracia social puede organizarse sobre argumentos liberales, la democracia política no puede avanzar sin conceptos republicanos como el de virtud, rigor, responsabilidad y representación. Para Weber, estos valores sólo podrían hacerse presentes en Alemania a partir de una recepción adecuada y democrática de Nietzsche y en cierto modo esta recepción daría sentido a su obra.
Dual Y-Shaped Monopole Antenna for Dual-Band WLAN/WiMAX Operations
Directory of Open Access Journals (Sweden)
Huiqing Zhai
2014-01-01
Full Text Available A dual-band design of monopole antenna with two coupled Y-shaped strips for WLAN/WiMAX applications is presented. By the introduction of dual Y-shaped strips, two separated impedance bandwidths of 22.4% (3.28~4.10 GHz and 19.2% (4.90~5.94 GHz can be obtained to meet the specifications of the WLAN/WiMAX communication band applications. The proposed antenna is successfully simulated, designed, and measured, demonstrating the matched impedance and good radiation characteristics with an overall dimension of 17.7×26×1 mm3.
Fair Adaptive Bandwidth and Subchannel Allocation in the WiMAX Uplink
Directory of Open Access Journals (Sweden)
Antoni Morell
2009-01-01
Full Text Available In some modern communication systems, as it is the case of WiMAX, it has been decided to implement Demand Assignment Multiple Access (DAMA solutions. End-users request transmission opportunities before accessing the system, which provides an efficient way to share system resources. In this paper, we briefly review the PHY and MAC layers of an OFDMA-based WiMAX system, and we propose to use a Network Utility Maximization (NUM framework to formulate the DAMA strategy foreseen in the uplink of IEEE 802.16. Utility functions are chosen to achieve fair solutions attaining different degrees of fairness and to further support the QoS requirements of the services in the system. Moreover, since the standard allocates resources in a terminal basis but each terminal may support several services, we develop a new decomposition technique, the coupled-decompositions method, that obtains the optimal service flow allocation with a small number of iterations (the improvement is significant when compared to other known solutions. Furthermore, since the PHY layer in mobile WiMAX has the means to adapt the transport capacities of the links between the Base Station (BS and the Subscriber Stations (SSs, the proposed PHY-MAC cross-layer design uses this extra degree of freedom in order to enhance the network utility.
Directory of Open Access Journals (Sweden)
Lengenfelder, Anja
2009-06-01
Full Text Available The Max Planck Society (Max-Planck-Gesellschaft; MPG with equal weight supports both the Golden and Green Road to Open Access in practice and politically in a sustainable way.In the context of the Green Road it runs with eDoc a central institutional repository for the MPG. The software of the same name is an in-house development. Based on the experiences and wishes of the users, currently, a new application (PubMan which is built upon the eSciDoc framework is introduced within the institutes. eSciDoc is a co-operation with the FIZ Karlsruhe and is funded until 2009 by the BMBF. All applications and services are Open Source and can therefore be re-used and be further developed. Apart from the development and maintenance of technical infrastructures, the Green Road within the MPG is furthered via direct and indirect personal support for scientists during the publication process. In this regard the close exchange between single Max Planck Institutes, the Max Planck Digital Library and other national and international partners plays an important role. With the Berlin Declaration in 2003 and currently in the Priority Initiative “Digital Information” of the Alliance of the German Research Organizations this commitment for Open Access is also politically represented.In this article are introduced and explained both eDoc and PubMan respectively as well as the Open Access Policy of the MPG with a special focus on the activities within the Green Road.
Max Raphael: Dialectics and Greek Art
Directory of Open Access Journals (Sweden)
Patrick Healy
2014-07-01
Full Text Available The article outlines what is required for a theory of art in the late work of Max Raphael, by showing that it is a response to a problematic first formulated, but left unanswered, by Marx, and which can be seen as developed by Raphael in his writing, especially the text he devoted to a dialectic interpretation of Greek art, with special reference to temple architecture. In detailing this latter study it is possible to see how Raphael’s understanding and analysis is guided by his account of an empirical theory of art, and contributes to its further elaboration.
Constrained Balancing of Two Industrial Rotor Systems: Least Squares and Min-Max Approaches
Directory of Open Access Journals (Sweden)
Bin Huang
2009-01-01
Full Text Available Rotor vibrations caused by rotor mass unbalance distributions are a major source of maintenance problems in high-speed rotating machinery. Minimizing this vibration by balancing under practical constraints is quite important to industry. This paper considers balancing of two large industrial rotor systems by constrained least squares and min-max balancing methods. In current industrial practice, the weighted least squares method has been utilized to minimize rotor vibrations for many years. One of its disadvantages is that it cannot guarantee that the maximum value of vibration is below a specified value. To achieve better balancing performance, the min-max balancing method utilizing the Second Order Cone Programming (SOCP with the maximum correction weight constraint, the maximum residual response constraint as well as the weight splitting constraint has been utilized for effective balancing. The min-max balancing method can guarantee a maximum residual vibration value below an optimum value and is shown by simulation to significantly outperform the weighted least squares method.
Miniaturized CPW-Fed Triband Antenna with Asymmetric Ring for WLAN/WiMAX Applications
Directory of Open Access Journals (Sweden)
Shanshan Huang
2014-01-01
Full Text Available A compact CPW-fed triband slot antenna for WLAN/WiMAX applications is proposed. The proposed antenna is formed by an asymmetric ring, an inverted L-strip, and a straight strip. By employing these structures, the antenna can generate three operation bands with compact size and simple structure. The measured and simulated results show the presented antenna has impedance bandwidths of 100 MHz (2.39–2.49 GHz, 360 MHz (3.36–3.72 GHz, and 760 MHz (5.13–5.89 GHz, which covers both WLAN in the 2.4/5.2 GHz bands and WiMAX in the 3.5/5.5 GHz bands. The antenna is successfully simulated and measured, showing triple bands can be obtained by using three different radiators and also indicating that the proposed antenna is suitable for the WiMAX/WLAN applications.
["My Mirra, my world." Mirra Birens-Eitingon as a key to her husband Max Eitingon's persona].
Ginor, Isabella; Remez, Gideon
2015-01-01
New reseach in Russia, Germany and Israel has revealed the complex and multifaceted figure of Mirra Eitingon (1877-1947), the wife for 31 years of Dr. Max Eitingon. Her character and her background in the Russian-Jewish intelligentsia and theatrical milieu provided a lifelong inspiration for Max in his many cultural interests as well as in his psychoanalytic activities, in Berlin and later in Jerusalem. His devotion to Mirra as well as to her two sons from previous marriages (one of them was the leading Soviet nuclear physicist Yuli Khariton) also highlight Max's own generosity and kindness.
Directory of Open Access Journals (Sweden)
M. Rainer Lepsius
2012-01-01
Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.
Nurgapoliitik kavandab kasiinode alatut riigistamist / Max Kaur ; interv. Sulev Vedler
Kaur, Max, 1969-
2007-01-01
Edgar Savisaare endine nõunik Max Kaur esitleb röövkapitalismi ideed, et Eesti riik ei pikenda kasiinode tegevuslubasid ja võtab seejärel nende tegevuse odavalt üle. Kaart: Tallinna mängupõrgud 2007. Lisa
Induced mutation in soybean (Glycine max L.) breeding
International Nuclear Information System (INIS)
Tulmann Neto, A.; Menten, J.O.M.; Ando, A.
1984-01-01
The induced mutation in soybean (Glycine max, L.) breeding is studied. Seed treatment with gamma-rays or methanesulfonic acid ethyl ester (EMs) is used in the following varieties: Parana, Santa Rosa, UFV-1, Foscarin 31 and IAC-8. The study to obtain resistance to the soybean bud blight virus and mutants resistant to rust was done. Early mutants are also researched. (M.A.C.) [pt
Effect of etching time and resin bond on the flexural strength of IPS e.max Press glass ceramic.
Xiaoping, Luo; Dongfeng, Ren; Silikas, Nick
2014-12-01
To evaluate the effect of hydrofluoric acid (HFA) etching time and resin cement bond on the flexural strength of IPS e.max(®) Press glass ceramic. Two hundred and ten bars, 25mm×3mm×2mm, were made from IPS e.max(®) Press ingots through lost-wax, hot-pressed ceramic fabrication technology and randomly divided into five groups with forty-two per group after polishing. The ceramic surfaces of different groups were etched by 9.5% hydrofluoric acid gel for 0, 20, 40, 60 and 120s respectively. Two specimens of each group were selected randomly to examine the surface roughness and 3-dimensional topography with atomic force microscope (AFM), and microstructure was analyzed by the field emission scanning electron microscope (FE-SEM). Then each group were subdivided into two subgroups (n=20). One subgroup of this material was selected to receive a thin (approximately 0.1mm) layer of resin luting agent (Variolink N) whereas the other subgroup remained unaltered. Half of subgroup's specimens were thermocycled 10,000 times before a 3-point bending test in order to determine the flexural strength. Interface between resin cement and ceramic was examined with field emission scanning electronic microscope. Roughness values increased with increasing etching time. The mean flexural strength values of group 0s, 20s, 40s, 60s and 120s were 384±33, 347±43, 330±53, 327±67 and 317±41MPa respectively. Increasing HF etching times reduced the mean flexural strength (pglass ceramic, but resin cement bonding to appropriately etched surface would strengthen the dental ceramic. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Hemingway, Deborah; Eichenlaub, Mark; Losert, Wolfgang; Redish, Edward F.
2017-01-01
Student often face difficulties with using math in science, and this exploratory project seeks to address the underlying mechanisms that lead to these difficulties. This mixed-methods project includes the creation of two novel assessment surveys, the Mathematical Epistemic Games Survey (MEGS) and the Math Attitude and Expectations Survey (MAX). The MAX, a 30-question Likert-scale survey, focuses on the attitudes towards using mathematics of the students in a reformed introductory physics course for the life sciences (IPLS) which is part of the National Experiment in Undergraduate Education (NEXUS/Physics) developed at the University of Maryland (UMD). Preliminary results from the MAX are discussed with specific attention given to students' attitudes towards math and physics, opinions about interdisciplinarity, and the usefulness of physics in academic settings as well as in professional biological research and modern medicine settings.
International Nuclear Information System (INIS)
Grzetic, S; Weldon, M; Noa, K; Gupta, N
2016-01-01
Purpose: This study compares the newly released MaxFOV Revision 1 EFOV reconstruction algorithm for GE RT590 to the older WideView EFOV algorithm. Two radiotherapy overlays from Q-fix and Diacor, are included in our analysis. Hounsfield Units (HU) generated with the WideView algorithm varied in the extended field (beyond 50cm) and the scanned object’s border varied from slice to slice. A validation of HU consistency between the two reconstruction algorithms is performed. Methods: A CatPhan 504 and CIRS062 Electron Density Phantom were scanned on a GE RT590 CT-Simulator. The phantoms were positioned in multiple locations within the scan field of view so some of the density plugs were outside the 50cm reconstruction circle. Images were reconstructed using both the WideView and MaxFOV algorithms. The HU for each scan were characterized both in average over a volume and in profile. Results: HU values are consistent between the two algorithms. Low-density material will have a slight increase in HU value and high-density material will have a slight decrease in HU value as the distance from the sweet spot increases. Border inconsistencies and shading artifacts are still present with the MaxFOV reconstruction on the Q-fix overlay but not the Diacor overlay (It should be noted that the Q-fix overlay is not currently GE-certified). HU values for water outside the 50cm FOV are within 40HU of reconstructions at the sweet spot of the scanner. CatPhan HU profiles show improvement with the MaxFOV algorithm as it approaches the scanner edge. Conclusion: The new MaxFOV algorithm improves the contour border for objects outside of the standard FOV when using a GE-approved tabletop. Air cavities outside of the standard FOV create inconsistent object borders. HU consistency is within GE specifications and the accuracy of the phantom edge improves. Further adjustments to the algorithm are being investigated by GE.
DEFF Research Database (Denmark)
Pedersen, Morten Stejner; Rasmussen, Jesper; Nielsen, Stefan Kragh
2017-01-01
We demonstrate measurements of spectra of O-mode electron cyclotron resonance heating (ECRH) waves scattered collectively from microscopic plasma fluctuations in ASDEX Upgrade discharges with an ITER-like ECRH scenario. The measured spectra are shown to allow determination of the main ion...... temperature and plasma rotation velocity. This demonstrates that ECRH systems can be exploited for diagnostic purposes alongside their primary heating purpose in a reactor relevant scenario....
Training the Recurrent neural network by the Fuzzy Min-Max algorithm for fault prediction
International Nuclear Information System (INIS)
Zemouri, Ryad; Racoceanu, Daniel; Zerhouni, Noureddine; Minca, Eugenia; Filip, Florin
2009-01-01
In this paper, we present a training technique of a Recurrent Radial Basis Function neural network for fault prediction. We use the Fuzzy Min-Max technique to initialize the k-center of the RRBF neural network. The k-means algorithm is then applied to calculate the centers that minimize the mean square error of the prediction task. The performances of the k-means algorithm are then boosted by the Fuzzy Min-Max technique.
Functional conjugated pyridines via main-group element tuning.
Stolar, Monika; Baumgartner, Thomas
2018-03-29
Pyridine-based materials have seen widespread attention for the development of n-type organic materials. In recent years, the incorporation of main-group elements has also explored significant advantages for the development and tunability of organic conjugated materials. The unique chemical and electronic structure of main-group elements has led to several enhancements in conventional organic materials. This Feature article highlights recent main-group based pyridine materials by discussing property enhancements and application in organic electronics.
Comparison of the Danish step test and the watt-max test for estimation of maximal oxygen uptake
DEFF Research Database (Denmark)
Aadahl, Mette; Zacho, Morten; Linneberg, Allan René
2013-01-01
. Altogether, 795 eligible participants (response rate 35.8%) performed the watt max and the Danish step test. Correlation and agreement between the two VO(2max) test results was explored by Pearson's rho, Bland-Altman plots, Kappa(w), and gamma coefficients.Results: The correlation between VO(2max) (ml......Introduction: There is a need for simple and feasible methods for estimation of cardiorespiratory fitness (CRF) in large study populations, as existing methods for valid estimation of maximal oxygen consumption are generally time consuming and relatively expensive to administer. The Danish step...
International Nuclear Information System (INIS)
Cheng Xiaolei; Liu Fang; Ouyang Xiaoping
2012-01-01
The difficulty for estimating the NEMPI (electromagnetic pulsed interference caused by the nuclear reaction) on the electronic system in high-intensity pulsed radiation diagnosing is analyzed in this article. To solve the difficulty, a method called 'Extreme Condition Analyzing' is presented for estimating the NEMPI conservatively and reliably. Through an extreme condition hypothesizing which could be described as 'Entire Coupling of Electric Field Energy', the E max (maximum electric field intensity which could be endured by the electronic system in the high-intensity pulsed radiation) could be figured out without any other information of the EMP caused by the nuclear reaction. Then a feasibility inspection is introduced, to confirm that the EMPI shielding request according to E max is not too extreme to be achieved. (authors)
Finite Abstractions of Max-Plus-Linear Systems : Theory and Algorithms
Adzkiya, D.
2014-01-01
Max-Plus-Linear (MPL) systems are a class of discrete-event systems with a continuous state space characterizing the timing of the underlying sequential discrete events. These systems are predisposed to describe the timing synchronization between interleaved processes. MPL systems are employed in
International Nuclear Information System (INIS)
Furman, M.A.
2010-01-01
We present simulation results of the build-up of the electron-cloud density n e in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N t = (2-5) x 10 13 , and the beam kinetic energy in the range E k = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) (delta) max vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N t there is a clear threshold behavior of n e as a function of (delta) max in the range ∼ 1.1-1.3. (2) At fixed (delta) max , there is a threshold behavior of n e as a function of N t provided (delta) max is sufficiently high; the threshold value of N t is a function of the characteristics of the region being simulated. (3) The dependence on E k is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.
Commissioning and First Results of the Electron Beam Profiler in the Main Injector at Fermilab
Energy Technology Data Exchange (ETDEWEB)
Thurman-Keup, R. [Fermilab; Alvarez, M. [Fermilab; Fitzgerald, J. [Fermilab; Lundberg, C. [Fermilab; Prieto, P. [Fermilab; Zagel, J. [Fermilab; Blokland, W. [Oak Ridge
2017-08-01
The planned neutrino program at Fermilab requires large proton beam intensities in excess of 2 MW. Measuring the transverse profiles of these high intensity beams is challenging and often depends on non-invasive techniques. One such technique involves measuring the deflection of a probe beam of electrons with a trajectory perpendicular to the proton beam. A device such as this is already in use at the Spallation Neutron Source at ORNL and a similar device has been installed in the Main Injector at Fermilab. Commissioning of the device is in progress with the goal of having it operational by the end of the year. The status of the commissioning and initial results will be presented
Nanocrystalline MAX/Mg Composites with Exceptional Properties
2017-01-04
hardness was 3.4±0.3 GPa, and the ultimate compressive strengths was 1028±5 MPa. The enhancements in elastic and mechanical properties are attributed to...Barsoum. Enthalpy of Formation and Thermodynamic Parameters of the MAX Phase, V2AlC., J. Alloy Compds., ( ): 218. doi: Babak Anasori, El’ad N. Caspi...Paper TOTAL: 08/28/2012 08/28/2012 Received Book 1.00 4.00 Babak Anasori, Michel W. Barsoum. ON THE EFFECT OF Ti2AlC ON THE FORMATION OF THERMALLY
Pseudogap and cuprate superconductivity: MaxEnt-μSR studies
International Nuclear Information System (INIS)
Boekema, C.; Schwartz, R.; Love, A.; Browne, M.C.
2013-01-01
Highlights: • A magnetic origin of cuprate superconductivity is plausible. • Cuprate loop currents are observed, close to predictions. • Pseudogap effects are seen above and below T c . -- Abstract: The basic physics of cuprate superconductivity is still much deliberated after 27 years of research. In contrast to phononic or polaronic roots, Varma’s theory promotes a magnetic origin. To probe cuprate magnetism, we examine zero field (ZF) muon-spin-rotation (μSR) data of RBa 2 Cu 3 O 7−δ (RBCO; R = Gd, Eu) especially near T c . Possible weak effects are analyzed using Maximum Entropy (MaxEnt, ME) to transform our μSR time series. Concerning predicted pseudogap loop currents, we have observed μSR signals in zero field for GdBCO above and now also below T c . These are near predicted fields of about 100 Oe. Using MaxEnt, we analyze transverse field (TF) μSR data of optimal doped EuBCO. Our focus is also on a temperature interval above T c to comprehend precursor effects. Our results point toward magnetic roots of cuprate superconductivity
Electronic tongue system to evaluate flavor of soybean (Glycine Max (L. Merrill genotypes
Directory of Open Access Journals (Sweden)
Sandra Maria Zoldan
2014-10-01
Full Text Available An electronic tongue system was tested as a fast and efficient analytical tool for flavor evaluation of soybean genotypes. Grain samples of 25 soybean lines were analyzed using 0.25 g of milled samples added to 100 mL of distilled water and mixing for one minute on a magnetic stirrer. An aliquot (50 mL from the filtered liquid was used for the analysis on a pre-fixed frequency of 1 kHz and alternate tension of 50 mV. Two analyses were conducted in a complete randomized design with three replicates. Electrical response (capacitance of eight polymeric chemical sensors used to analyze the soybean lines were submitted to Principal Component Analysis (PCA. In the spatial distribution of the PCA graphic, the lines close to each other were similar, while the distant ones showed different characteristics. The electronic tongue system was efficient in discriminating flavor of soybean lines.
International Nuclear Information System (INIS)
Suetsugu, Y.; Kanazawa, K.; Shibata, K.; Hisamatsu, H.
2007-01-01
In order to obtain a method to suppress electron-cloud instability (ECI), the photoelectron and the secondary electron yields (PEY and SEY) of a TiN coating and an NEG (Ti-Zr-V) coating on copper have been studied so far by using the KEK B-factory (KEKB) positron ring. Recently, test chambers with these coatings were installed at a straight section of the ring where the irradiated photon density was considerably smaller than that at the arc section of a previous experiment. The number of electrons around beams was measured by an electron current monitor; this measurement was performed up to a stored beam current of approximately 1700 mA (1389 bunches). For the entire range of the beam current, the electron currents of the NEG-coated and the TiN-coated chambers were clearly smaller as compared to those of the uncoated copper chamber by the factors of 2-3 and 3-4, respectively. The small photon density, that is, the weak effect of photoelectrons, elucidated the differences in the SEYs of these coatings when compared to the measurements at the arc section. By assuming almost the same PEY (η e ) values obtained in the previous study, the maximum SEY (δ max ) for the TiN and NEG coatings and the copper chamber was again estimated based on a previously developed simulation. The evaluated δ max values for these three surfaces were in the ranges of 0.8-1.0, 1.0-1.15, and 1.1-1.25, respectively. These values were consistent with the values obtained so far. As an application of the simulation, the effective η e , η e-eff (which included the geometrical effect of the antechamber) and δ max values were also estimated for copper chambers with one or two antechambers. These chambers were installed in an arc section and a wiggler section, respectively. The evaluated η e-eff and δ max values were approximately 0.008 and 1.2, and 0.04 and 1.2, respectively, where η e =0.28 was assumed on the side wall. As expected, the η e-eff values were considerably smaller than those
Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress
2014-01-01
Background Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. Results M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. Conclusions MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress. PMID:24383424
Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress.
Chen, Zi-Hong; Xu, Ling; Yang, Feng-lian; Ji, Guang-Hai; Yang, Jing; Wang, Jian-Yun
2014-01-03
Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress.
Energy Technology Data Exchange (ETDEWEB)
Yan, Yu [Department of Nuclear Engineering and Management, Graduate School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-8656 (Japan); Lin, Mingzhang [Nuclear Science and Engineering Directorate, Japan Atomic Energy Agency, 2-4 Shirakata-Shirane, Tokai, Naka, Ibaraki 319-1195 (Japan); Katsumura, Yosuke, E-mail: katsu@n.t.u-tokyo.ac.j [Department of Nuclear Engineering and Management, Graduate School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-8656 (Japan); Nuclear Professional School, Graduate School of Engineering, University of Tokyo, 2-22 Shirakata-Shirane, Tokai, Naka, Ibaraki 319-1188 (Japan); Fu, Haiying; Muroya, Yusa [Nuclear Professional School, Graduate School of Engineering, University of Tokyo, 2-22 Shirakata-Shirane, Tokai, Naka, Ibaraki 319-1188 (Japan)
2010-12-15
The absorption spectra of solvated electrons in pentanol, hexanol and octanol are measured from 22 to 200, 22 to 175 and 50 to150 {sup o}C, respectively, at a fixed pressure of 15 MPa, using nanosecond pulse radiolysis technique. The results show that the peak positions of the absorption spectra have a red-shift (shift to longer wavelengths) as temperature increases, similar to water and other alcohols. Including the above mentioned data, a compilation of currently available experimental data on the energy of absorption maximum (E{sub max}) of solvated electrons changed with temperature in monohydric alcohols, diols and triol is presented. E{sub max} of solvated electron is larger in those alcohols that have more OH groups at all the temperatures. The molecular structure effect, including OH numbers, OH position and carbon chain length, is investigated. For the primary alcohols with same OH group number and position, the temperature coefficient increases with increase in chain length. For the alcohols with same chain length and OH numbers, temperature coefficient is larger for the symmetric alcohols than the asymmetric ones.
Putsathit, Papanin; Morgan, Justin; Bradford, Damien; Engelhardt, Nelly; Riley, Thomas V
2015-02-01
The Becton Dickinson (BD) PCR-based GeneOhm Cdiff assay has demonstrated a high sensitivity and specificity for detecting Clostridium difficile. Recently, the BD Max platform, using the same principles as BD GeneOhm, has become available in Australia. This study aimed to investigate the sensitivity and specificity of BD Max Cdiff assay for the detection of toxigenic C. difficile in an Australian setting. Between December 2013 and January 2014, 406 stool specimens from 349 patients were analysed with the BD Max Cdiff assay. Direct and enrichment toxigenic culture were performed on bioMérieux ChromID C. difficile agar as a reference method. isolates from specimens with discrepant results were further analysed with an in-house PCR to detect the presence of toxin genes. The overall prevalence of toxigenic C. difficile was 7.2%. Concordance between the BD Max assay and enrichment culture was 98.5%. The sensitivity, specificity, positive predictive value and negative predictive value for the BD Max Cdiff assay were 95.5%, 99.0%, 87.5% and 99.7%, respectively, when compared to direct culture, and 91.7%, 99.0%, 88.0% and 99.4%, respectively, when compared to enrichment culture. The new BD Max Cdiff assay appeared to be an excellent platform for rapid and accurate detection of toxigenic C. difficile.
Sulphur dioxide metabolism in soy-bean, Glycine max var. biloxi
International Nuclear Information System (INIS)
Garsed, S.G.; Read, D.J.
1977-01-01
First-trifoliate leaves of soybeans Glycine max (L.) Merr. were exposed to 35 SO 2 in the light or dark, and the chemical distribution of the radioactivity in the source leaves and in the remainder of the plant was determined after 1.5 and 24 h. Only 35 SO 4 2- was found in leachates in the light but substantial quantities of 35 SO 3 2- were present in the dark. Radioactivity was present in all fractions of the source leaves examined (insoluble, centrifuge pellet, soluble protein, chloroform-soluble and water-soluble). The main water-soluble compounds labelled were sulphate >glutathione >cysteine. Small quantities of sulphite were also recovered in the dark but not in the light. The ratio of soluble: insoluble radioactivity in the sink tissues was influenced more by leaf age than by light treatment. Sulphate, glutathione and cysteine were labelled in the petioles of the source leaves and 35 SO 4 2- was found in the nutrient solution after 1.5 h in both treatments. It is concluded that light is not necessary for the reduction of internal 35 SO 2 products. The results are discussed in relation to current knowledge of SO 2 metabolism. (author)
Color Processing using Max-trees : A Comparison on Image Compression
Tushabe, Florence; Wilkinson, M.H.F.
2012-01-01
This paper proposes a new method of processing color images using mathematical morphology techniques. It adapts the Max-tree image representation to accommodate color and other vectorial images. The proposed method introduces three new ways of transforming the color image into a gray scale image
A coincidence study between photo- and Auger electrons
International Nuclear Information System (INIS)
Ricz, S.; Koever, A.; Varga, D.; Molnar, J.; Aksela, S.; Jurvansuu, M.
2000-01-01
Complete text of publication follows. The investigation of double differential cross sections of photon induced Auger electrons provides very sensitive method for studying the rearrangement process, especially when the angular correlation between photo- and Auger electrons is also studied. Such type of measurements could reveal a new aspect in studying the electron-electron, hole-electron and photoelectron - Auger electron interactions. It enables one to separate the overlapping Auger lines belonging to different initial holes. The traditional coincidence measurement is very time consuming and causes serious calibration problems. In order to overcome these experimental difficulties a new electron-spectrometer (ESA-22) was developed in ATOMKI, Debrecen in cooperation with the Electron spectroscopy group of University of Oulu, Finland. The analyzer consists of a spherical and a cylindrical part. It is very similar to the ESA-21 analyzer. The main differences is that the focal ring can be set different diameters thus either a series of channel detectors can be used to detect the electrons at different angles or a position sensitive channel plate can be applied for simultaneous angular recording of electrons. Furthermore the outer sphere and cylinder are cut into two parts so the spectrometer is capable to analyze two independent angularly resolved electron spectra (in the 0 deg - 180 deg region) at different energy regions, simultaneously. A special electronic control and data handling electronics and software was worked out to control the analyzer. The first results were presented in. In the last year the ESA-22 electron-spectrometer was transported to the I411 beam line of MAX-II synchrotron in Lund, Sweden. The advanced properties of the spectrometer was investigated by measuring coincidences between the photoelectrons originated from the Ar L 3 subshell and the Ar Auger electrons in the 203-207 eV energy region. Fig. 1 shows the single and the coincidence spectra
MaxEnt-Based Ecological Theory: A Template for Integrated Catchment Theory
Harte, J.
2017-12-01
The maximum information entropy procedure (MaxEnt) is both a powerful tool for inferring least-biased probability distributions from limited data and a framework for the construction of complex systems theory. The maximum entropy theory of ecology (METE) describes remarkably well widely observed patterns in the distribution, abundance and energetics of individuals and taxa in relatively static ecosystems. An extension to ecosystems undergoing change in response to disturbance or natural succession (DynaMETE) is in progress. I describe the structure of both the static and the dynamic theory and show a range of comparisons with census data. I then propose a generalization of the MaxEnt approach that could provide a framework for a predictive theory of both static and dynamic, fully-coupled, eco-socio-hydrological catchment systems.
Neutron Damage and MAX Phase Ternary Compounds
Energy Technology Data Exchange (ETDEWEB)
Barsoum, Michael [Drexel Univ., Philadelphia, PA (United States); Hoffman, Elizabeth [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Sindelar, Robert [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Garcua-Duaz, Brenda [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Kohse, Gordon [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)
2014-06-17
The Demands of Gen IV nuclear power plants for long service life under neutron radiation at high temperature are severe. Advanced materials that would withstand high temperatures (up to 1000+ C) to high doses in a neutron field would be ideal for reactor internal structures and would add to the long service life and reliability of the reactors. The objective of this work is to investigate the response of a new class of machinable, conductive, layered, ternary transition metal carbides and nitrides - the so-called MAX phases - to low and moderate neutron dose levels.
Neutron Damage and MAX Phase Ternary Compounds
International Nuclear Information System (INIS)
Barsoum, Michael; Hoffman, Elizabeth; Sindelar, Robert; Garcua-Diaz, Brenda; Kohse, Gordon
2014-01-01
The Demands of Gen IV nuclear power plants for long service life under neutron radiation at high temperature are severe. Advanced materials that would withstand high temperatures (up to 1000+ C) to high doses in a neutron field would be ideal for reactor internal structures and would add to the long service life and reliability of the reactors. The objective of this work is to investigate the response of a new class of machinable, conductive, layered, ternary transition metal carbides and nitrides - the so-called MAX phases - to low and moderate neutron dose levels.
Traffic grooming in WDM optical network with grooming resources at Max Connectivity nodes
Paul, Partha; Rawat, Balbeer Singh; Ghorai, S. K.
2012-12-01
In this paper, we propose Max Connectivity grooming in WDM mesh networks under static lightpath connection requests. The grooming and wavelength conversion resources are placed at the nodes having maximum connections. We propose a heuristic genetic algorithm (GA) model to solve grooming, routing and wavelength assignment. The GA algorithm has been used to optimize the cost of grooming and wavelength conversion resources. The blocking probability has been investigated under different lightpath connections. The performance of Max Connectivity grooming has been compared with other grooming policies. Our results indicate the improvement of resource utilization with minimum blocking probability.
Developing an active emergency medical service system based on WiMAX technology.
Li, Shing-Han; Cheng, Kai-An; Lu, Wen-Hui; Lin, Te-Chang
2012-10-01
The population structure has changed with the aging of population. In the present, elders account for 10.63% of the domestic population and the percentage is still gradually climbing. In other words, the demand for emergency services among elders in home environment is expected to grow in the future. In order to improve the efficiency and quality of emergency care, information technology should be effectively utilized to integrate medical systems and facilities, strengthen human-centered operation designs, and maximize the overall performance. The improvement in the quality and survival rate of emergency care is an important basis for better life and health of all people. Through integrated application of medical information systems and information communication technology, this study proposes a WiMAX-based emergency care system addressing the public demands for convenience, speed, safety, and human-centered operation of emergency care. This system consists of a healthcare service center, emergency medical service hospitals, and emergency ambulances. Using the wireless transmission capability of WiMAX, patients' physiological data can be transmitted from medical measurement facilities to the emergency room and emergency room doctors can provide immediate online instructions on emergency treatment via video and audio transmission. WiMAX technology enables the establishment of active emergency medical services.
Initial Weekly HRV Response is Related to the Prospective Change in VO2max in Female Soccer Players.
Esco, M R; Flatt, A A; Nakamura, F Y
2016-06-01
The aim of this study was to determine whether the early response in weekly measures of HRV, when derived from a smartphone application, were related to the eventual change in VO2max following an off-season training program in female soccer athletes. 9 female collegiate soccer players participated in an 11-week off-season conditioning program. In the week immediately before and after the training program, each participant performed a test on a treadmill to determine maximal oxygen consumption (VO2max). Daily measures of the log-transformed root mean square of successive R-R intervals (lnRMSSD) were performed by the participants throughout week 1 and week 3 of the conditioning program. The mean and coefficient of variation (CV) lnRMSSD values of week 1 showed small (r=- 0.13, p=0.74) and moderate (r=0.57, p=0.11), respectively, non-significant correlations to the change in VO2max at the end of the conditioning program (∆VO2max). Significant and near-perfect correlation was found between the change in the weekly mean lnRMSSD values from weeks 1 and 3 (∆lnRMSSDM) and ∆VO2max (r=0.90, p=0.002). The current results have identified that the initial change in weekly mean lnRMSSD from weeks 1 to 3 of a conditioning protocol was strongly associated with the eventual adaptation of VO2max. © Georg Thieme Verlag KG Stuttgart · New York.
Reginatto, M; Neumann, S
2002-01-01
MAXED was developed to apply the maximum entropy principle to the unfolding of neutron spectrometric measurements. The approach followed in MAXED has several features that make it attractive: it permits inclusion of a priori information in a well-defined and mathematically consistent way, the algorithm used to derive the solution spectrum is not ad hoc (it can be justified on the basis of arguments that originate in information theory), and the solution spectrum is a non-negative function that can be written in closed form. This last feature permits the use of standard methods for the sensitivity analysis and propagation of uncertainties of MAXED solution spectra. We illustrate its use with unfoldings of NE 213 scintillation detector measurements of photon calibration spectra, and of multisphere neutron spectrometer measurements of cosmic-ray induced neutrons at high altitude (approx 20 km) in the atmosphere.
On the behaviour of classes of min-max-plus systems
Soto y Koelemeijer, G.
2003-01-01
Discrete Event Systems are systems, the time evolution of which can be described by the occurence of events. Well-known examples of DESs are manufacturing systems and transportation networks. An important class of DESs can be described by the so-called (max,+) algebra, in which, compared to the
A Limited Submuscular Direct-to-Implant Technique Utilizing AlloMax
Directory of Open Access Journals (Sweden)
Michal Brichacek, MD
2017-07-01
Full Text Available Background:. This study evaluates a novel limited submuscular direct-to-implant technique utilizing AlloMax where only the upper few centimeters of the implant is covered by the pectoralis, whereas the majority of the implant including the middle and lower poles are covered by acellular dermal matrix. Methods:. The pectoralis muscle is released off its inferior and inferior-medial origins and allowed to retract superiorly. Two sheets of AlloMax (6 × 16 cm are sutured together and secured to the inframammary fold, serratus fascia, and the superiorly retracted pectoralis. Thirty-seven breasts in 19 consecutive patients with follow-up at 6 months were reviewed. Results:. Nineteen consecutive patients with 37 reconstructed breasts were studied. Average age was 50 years, average BMI was 24.3. Ptosis ranged from grade 0–III, and average cup size was B (range, A–DDD. Early minor complications included 1 seroma, 3 minor postoperative hematomas managed conservatively, and 3 minor wound healing problems. Three breasts experienced mastectomy skin flap necrosis and were managed with local excision. There were no cases of postoperative infection, red breast, grade III/IV capsular contractures, or implant loss. A single patient complained of animation postoperatively. One patient desired fat grafting for rippling. Conclusions:. The limited submuscular direct-to-implant technique utilizing AlloMax appears to be safe with a low complication rate at 6 months. This technique minimizes the action of the pectoralis on the implant, reducing animation deformities but still providing muscle coverage of the upper limit of the implant. Visible rippling is reduced, and a vascularized bed remains for fat grafting of the upper pole if required.
Investigation of a new handover approach in LTE and WiMAX.
Hindia, Mohammad Nour; Reza, Ahmed Wasif; Noordin, Kamarul Ariffin
2014-01-01
Nowadays, one of the most important challenges in heterogeneous networks is the connection consistency between the mobile station and the base stations. Furthermore, along the roaming process between the mobile station and the base station, the system performance degrades significantly due to the interferences from neighboring base stations, handovers to inaccurate base station and inappropriate technology selection. In this paper, several algorithms are proposed to improve mobile station performance and seamless mobility across the long-term evolution (LTE) and Worldwide Interoperability for Microwave Access (WiMAX) technologies, along with a minimum number of redundant handovers. Firstly, the enhanced global positioning system (GPS) and the novel received signal strength (RSS) prediction approaches are suggested to predict the target base station accurately. Then, the multiple criteria with two thresholds algorithm is proposed to prioritize the selection between LTE and WiMAX as the target technology. In addition, this study also covers the intercell and cochannel interference reduction by adjusting the frequency reuse ratio 3 (FRR3) to work with LTE and WiMAX. The obtained results demonstrate high next base station prediction efficiency and high accuracy for both horizontal and vertical handovers. Moreover, the received signal strength is kept at levels higher than the threshold, while maintaining low connection cost and delay within acceptable levels. In order to highlight the combination of the proposed algorithms' performance, it is compared with the existing RSS and multiple criteria handover decision algorithms.
Electron donating and acid-base properties of cerium oxide and its mixed oxides with alumina
International Nuclear Information System (INIS)
Sugunan, S.; Jalaja, J.M.
1994-01-01
The electron donating properties of cerium oxide activated at 300, 500 and 800 degC and of its mixed oxides with alumina were examined based on the adsorption of electron acceptors exhibiting different electron affinities. The surface acidity/basicity of the oxides was determined by titrimetry; the H 0,max values are given. The limit of electron transfer from the oxide surface lies within the region of 1.77 and 2.40 eV in terms of the electron affinity of the electron acceptor. Cerium oxide promotes the electron donor nature of alumina while leaving the limit of electron transfer unchanged. 2 tabs., 4 figs., 13 refs
System-Level Model for OFDM WiMAX Transceiver in Radiation Environment
International Nuclear Information System (INIS)
Abdel Alim, O.; Elboghdadly, N.; Ashour, M.M.; Elaskary, A.M.
2008-01-01
WiMAX (Worldwide Inter operability for Microwave Access), an evolving standard for point-to-multipoint wireless networking, works for the l ast mile c onnections for replacing optical fiber technology network but with no need for adding more infra structure within crowded areas. Optical fiber technology is seriously considered for communication and monitoring applications in space and around nuclear reactors. Space and nuclear environments are characterized, in particular, by the presence of ionizing radiation fields. Therefore the influence of radiation on such networks needs to be investigated. This paper has the objective of building a System level model for a WiMAX OFDM (Orthogonal Frequency Division Multiplexing) based transceiver. Modeling irradiation noise as an external effect added to the Additive White Gaussian noise (AWGN). Then analyze, discuss the results based on qualitatively performance evaluation using BER calculations for radiation environment
Lifescience Database Archive (English)
Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI
Cosmological Constraints from the SDSS maxBCG Cluster Catalog
Energy Technology Data Exchange (ETDEWEB)
Rozo, Eduardo; /CCAPP; Wechsler, Risa H.; /KIPAC, Menlo Park /SLAC; Rykoff, Eli S.; /UC, Santa Barbara; Annis, James T.; /Fermilab; Becker, Matthew R.; /Chicago U. /KICP, Chicago; Evrard, August E.; /Michigan U. /Michigan U., MCTP; Frieman, Joshua A.; /Fermilab /KICP, Chicago /Chicago U.; Hansen, Sarah M.; /UC, Santa Cruz; Hao, Jia; /Michigan U.; Johnston, David E.; /Northwestern U.; Koester, Benjamin P.; /KICP, Chicago /Chicago U.; McKay, Timothy A.; /Michigan U. /Michigan U., MCTP; Sheldon, Erin S.; /Brookhaven; Weinberg, David H.; /CCAPP /Ohio State U.
2009-08-03
We use the abundance and weak lensing mass measurements of the SDSS maxBCG cluster catalog to simultaneously constrain cosmology and the richness-mass relation of the clusters. Assuming a flat {Lambda}CDM cosmology, we find {sigma}{sub 8}({Omega}{sub m}/0.25){sup 0.41} = 0.832 {+-} 0.033 after marginalization over all systematics. In common with previous studies, our error budget is dominated by systematic uncertainties, the primary two being the absolute mass scale of the weak lensing masses of the maxBCG clusters, and uncertainty in the scatter of the richness-mass relation. Our constraints are fully consistent with the WMAP five-year data, and in a joint analysis we find {sigma}{sub 8} = 0.807 {+-} 0.020 and {Omega}{sub m} = 0.265 {+-} 0.016, an improvement of nearly a factor of two relative to WMAP5 alone. Our results are also in excellent agreement with and comparable in precision to the latest cosmological constraints from X-ray cluster abundances. The remarkable consistency among these results demonstrates that cluster abundance constraints are not only tight but also robust, and highlight the power of optically-selected cluster samples to produce precision constraints on cosmological parameters.
Main refurbishment activities on electronic and electrical equipment for the FRG-1 research reactor
International Nuclear Information System (INIS)
Blom, K.H.; Krull, W.
1997-01-01
As GKSS intends to operate the research reactor FRG-1 safely and reliably for many years to come, the plant is constantly refurbished and upgraded both in the interests of safety and operational reasons. The following electronic and electrical systems have been replaced or improved since 1990: Information and signalling systems; Emergency power plant (permit applied for); External and internal lightning protection system; Reactor protection system (in part); Safety lighting; Alarm and staff locating system; Control room telephone system; Closed-circuit television system; Beam tube controls; Storage plant for radioactive liquid waste; Ambient dose rate measuring system; Meteorological measuring system; Control and measuring system for the primary cooling circuit; Control rod drives; Control rod control system; Soft start for the secondary pumps; Control and switching devices for the emergency power plant; Trailing cable installation for the reactor bridge; Main-voltage distribution systems/cable routes. (author). 13 figs, 1 tab
Modcomp MAX IV System Processors reference guide
Energy Technology Data Exchange (ETDEWEB)
Cummings, J.
1990-10-01
A user almost always faces a big problem when having to learn to use a new computer system. The information necessary to use the system is often scattered throughout many different manuals. The user also faces the problem of extracting the information really needed from each manual. Very few computer vendors supply a single Users Guide or even a manual to help the new user locate the necessary manuals. Modcomp is no exception to this, Modcomp MAX IV requires that the user be familiar with the system file usage which adds to the problem. At General Atomics there is an ever increasing need for new users to learn how to use the Modcomp computers. This paper was written to provide a condensed Users Reference Guide'' for Modcomp computer users. This manual should be of value not only to new users but any users that are not Modcomp computer systems experts. This Users Reference Guide'' is intended to provided the basic information for the use of the various Modcomp System Processors necessary to, create, compile, link-edit, and catalog a program. Only the information necessary to provide the user with a basic understanding of the Systems Processors is included. This document provides enough information for the majority of programmers to use the Modcomp computers without having to refer to any other manuals. A lot of emphasis has been placed on the file description and usage for each of the System Processors. This allows the user to understand how Modcomp MAX IV does things rather than just learning the system commands.
Design of polarization encoded all-optical 4-valued MAX logic gate and its applications
Chattopadhyay, Tanay; Nath Roy, Jitendra
2013-07-01
Quaternary maximum (QMAX) gate is one type of multi-valued logic gate. An all-optical scheme of polarization encoded quaternary (4-valued) MAX logic gate with the help of Terahertz Optical Asymmetric Demultiplexer (TOAD) based fiber interferometric switch is proposed and described. For the quaternary information processing in optics, the quaternary number (0, 1, 2, 3) can be represented by four discrete polarized states of light. Numerical simulation result confirming the described methods is given in this paper. Some applications of MAX gate in logical operation and memory device are also given.
Signaling-Free Max-Min Airtime Fairness in IEEE 802.11 Ad Hoc Networks
Directory of Open Access Journals (Sweden)
Youngsoo Lee
2016-01-01
Full Text Available We propose a novel media access control (MAC protocol, referred to as signaling-free max-min airtime fair (SMAF MAC, to improve fairness and channel utilization in ad hoc networks based on IEEE 802.11 wireless local area networks (WLANs. We introduce busy time ratio (BTR as a measure for max-min airtime fairness. Each node estimates its BTR and adjusts the transmission duration by means of frame aggregation and fragmentation, so that it can implicitly announce the BTR to neighbor nodes. Based on the announced BTR, each of the neighbor nodes controls its contention window. In this way, the SMAF MAC works in a distributed manner without the need to know the max-min fair share of airtime, and it does not require exchanging explicit control messages among nodes to attain fairness. Moreover, we successfully incorporate the hidden node detection and resolution mechanisms into the SMAF MAC to deal with the hidden node problem in ad hoc networks. The simulation results confirm that the SMAF MAC enhances airtime fairness without degrading channel utilization, and it effectively resolves several serious problems in ad hoc networks such as the starvation, performance anomaly, and hidden node problems.
Directory of Open Access Journals (Sweden)
Chakchai So-In
2010-10-01
Full Text Available Deficit Round Robin (DRR is a fair packet-based scheduling discipline commonly used in wired networks where link capacities do not change with time. However, in wireless networks, especially wireless broadband networks, i.e., IEEE 802.16e Mobile WiMAX, there are two main considerations violate the packet-based service concept for DRR. First, the resources are allocated per Mobile WiMAX frame. To achieve full frame utilization, Mobile WiMAX allows packets to be fragmented. Second, due to a high variation in wireless channel conditions, the link/channel capacity can change over time and location. Therefore, we introduce a Deficit Round Robin with Fragmentation (DRRF to allocate resources per Mobile WiMAX frame in a fair manner by allowing for varying link capacity and for transmitting fragmented packets. Similar to DRR and Generalized Processor Sharing (GPS, DRRF achieves perfect fairness. DRRF results in a higher throughput than DRR (80% improvement while causing less overhead than GPS (8 times less than GPS. In addition, in Mobile WiMAX, the quality of service (QoS offered by service providers is associated with the price paid. This is similar to a cellular phone system; the users may be required to pay air-time charges. Hence, we have also formalized a Generalized Weighted Fairness (GWF criterion which equalizes a weighted sum of service time units or slots, called temporal fairness, and transmitted bytes, called throughput fairness, for customers who are located in a poor channel condition or at a further distance versus for those who are near the base stations, or have a good channel condition. We use DRRF to demonstrate the application of GWF. These fairness criteria are used to satisfy basic requirements for resource allocation, especially for non real-time traffic. Therefore, we also extend DRRF to support other QoS requirements, such as minimum reserved traffic rate, maximum sustained traffic rate, and traffic priority. For real
Bayesian Modeling of Air Pollution Extremes Using Nested Multivariate Max-Stable Processes
Vettori, Sabrina; Huser, Raphaë l; Genton, Marc G.
2018-01-01
Capturing the potentially strong dependence among the peak concentrations of multiple air pollutants across a spatial region is crucial for assessing the related public health risks. In order to investigate the multivariate spatial dependence properties of air pollution extremes, we introduce a new class of multivariate max-stable processes. Our proposed model admits a hierarchical tree-based formulation, in which the data are conditionally independent given some latent nested $\\alpha$-stable random factors. The hierarchical structure facilitates Bayesian inference and offers a convenient and interpretable characterization. We fit this nested multivariate max-stable model to the maxima of air pollution concentrations and temperatures recorded at a number of sites in the Los Angeles area, showing that the proposed model succeeds in capturing their complex tail dependence structure.
Bayesian Modeling of Air Pollution Extremes Using Nested Multivariate Max-Stable Processes
Vettori, Sabrina
2018-03-18
Capturing the potentially strong dependence among the peak concentrations of multiple air pollutants across a spatial region is crucial for assessing the related public health risks. In order to investigate the multivariate spatial dependence properties of air pollution extremes, we introduce a new class of multivariate max-stable processes. Our proposed model admits a hierarchical tree-based formulation, in which the data are conditionally independent given some latent nested $\\\\alpha$-stable random factors. The hierarchical structure facilitates Bayesian inference and offers a convenient and interpretable characterization. We fit this nested multivariate max-stable model to the maxima of air pollution concentrations and temperatures recorded at a number of sites in the Los Angeles area, showing that the proposed model succeeds in capturing their complex tail dependence structure.
Exercise-induced prostacyclin release positively correlates with VO(2max) in young healthy men.
Zoladz, J A; Majerczak, J; Duda, K; Chłopicki, S
2009-01-01
In this study we have evaluated the effect of maximal incremental cycling exercise (IE) on the systemic release of prostacyclin (PGI(2)), assessed as plasma 6-keto-PGF(1alpha) concentration in young healthy men. Eleven physically active - untrained men (mean +/- S.D.) aged 22.7 +/- 2.1 years; body mass 76.3 +/- 9.1 kg; BMI 23.30 +/- 2.18 kg . m(-2); maximal oxygen uptake (VO(2max)) 46.5 +/- 3.9 ml . kg(-1) . min(-1), performed an IE test until exhaustion. Plasma concentrations of 6-keto-PGF(1alpha), lactate, and cytokines were measured in venous blood samples taken prior to the exercise and at the exhaustion. The net exercise-induced increase in 6-keto-PGF(1alpha) concentration, expressed as the difference between the end-exercise minus pre-exercise concentration positively correlated with VO(2max) (r=0.78, p=0.004) as well as with the net VO(2) increase at exhaustion (r=0.81, p=0.003), but not with other respiratory, cardiac, metabolic or inflammatory parameters of the exercise (minute ventilation, heart rate, plasma lactate, IL-6 or TNF-alpha concentrations). The exercise-induced increase in 6-keto-PGF(1alpha) concentration?? was significantly higher (p=0.008) in a group of subjects (n=5) with the highest VO(2max) when compared to the group of subjects with the lowest VO(2max), in which no increase in 6-keto-PGF(1alpha) concentration was found. In conclusion, we demonstrated, to our knowledge for the first time, that exercise-induced release of PGI(2) in young healthy men correlates with VO(2max), suggesting that vascular capacity to release PGI(2) in response to physical exercise represents an important factor characterizing exercise tolerance. Moreover, we postulate that the impairment of exercise-induced release of PGI(2) leads to the increased cardiovascular hazard of vigorous exercise.
On the likelihood function of Gaussian max-stable processes
Genton, M. G.; Ma, Y.; Sang, H.
2011-01-01
We derive a closed form expression for the likelihood function of a Gaussian max-stable process indexed by ℝd at p≤d+1 sites, d≥1. We demonstrate the gain in efficiency in the maximum composite likelihood estimators of the covariance matrix from p=2 to p=3 sites in ℝ2 by means of a Monte Carlo simulation study. © 2011 Biometrika Trust.
On the likelihood function of Gaussian max-stable processes
Genton, M. G.
2011-05-24
We derive a closed form expression for the likelihood function of a Gaussian max-stable process indexed by ℝd at p≤d+1 sites, d≥1. We demonstrate the gain in efficiency in the maximum composite likelihood estimators of the covariance matrix from p=2 to p=3 sites in ℝ2 by means of a Monte Carlo simulation study. © 2011 Biometrika Trust.
Reaction of some selected soybean varieties ( Glycine max (L) Merril)
African Journals Online (AJOL)
In nematode endemic ecological zones, TGX-1985 – 8F is therefore recommended as it proved to contain some specialized genes that conferred a higher level of tolerance against root- knot nematode, Meloidogyne incognita. Key Words: Glycine max, root – knot nematode, Dominant loci, Mi – 1.2, leucine zipper and R ...
Frank, Natia L.; Meade, Thomas J.
2003-01-01
Incorporation of metalated nucleosides into DNA through covalent modification is crucial to measurement of thermal electron-transfer rates and the dependence of these rates with structure, distance, and position. Here, we report the first synthesis of an electron donor-acceptor pair of 5' metallonucleosides and their subsequent incorporation into oligonucleotides using solid-phase DNA synthesis techniques. Large-scale syntheses of metal-containing oligonucleotides are achieved using 5' modified phosporamidites containing [Ru(acac)(2)(IMPy)](2+) (acac is acetylacetonato; IMPy is 2'-iminomethylpyridyl-2'-deoxyuridine) (3) and [Ru(bpy)(2)(IMPy)](2+) (bpy is 2,2'-bipyridine; IMPy is 2'-iminomethylpyridyl-2'-deoxyuridine) (4). Duplexes formed with the metal-containing oligonucleotides exhibit thermal stability comparable to the corresponding unmetalated duplexes (T(m) of modified duplex = 49 degrees C vs T(m) of unmodified duplex = 47 degrees C). Electrochemical (3, E(1/2) = -0.04 V vs NHE; 4, E(1/2) = 1.12 V vs NHE), absorption (3, lambda(max) = 568, 369 nm; 4, lambda(max) = 480 nm), and emission (4, lambda(max) = 720 nm, tau = 55 ns, Phi = 1.2 x 10(-)(4)) data for the ruthenium-modified nucleosides and oligonucleotides indicate that incorporation into an oligonucleotide does not perturb the electronic properties of the ruthenium complex or the DNA significantly. In addition, the absence of any change in the emission properties upon metalated duplex formation suggests that the [Ru(bpy)(2)(IMPy)](2+)[Ru(acac)(2)(IMPy)](2+) pair will provide a valuable probe for DNA-mediated electron-transfer studies.
2010-03-17
...-purpose subzone status for the upholstered furniture manufacturing facilities of Max Home, LLC (Max Home... additional manufacturing plant and warehouse (100 employees/ 26 acres/160,000 sq. ft.) are located at 1313... finished upholstered furniture (chairs, seats, sofas, sleep sofas, and sectionals). The additional...
Zoladz, Jerzy A; Majerczak, Joanna; Duda, Krzysztof; Chłopicki, Stefan
2010-01-01
In the present study, we evaluated the effect of 5 weeks of moderate-intensity endurance training on the basal and exercise-induced systemic release of prostacyclin (PGI(2)), as assessed by plasma 6-keto-PGF(1 alpha) concentration. Twelve physically active young men with the following characteristics participated in this study (the mean +/- SD): age, 22.7 +/- 2.0 years; body mass, 76.8 +/- 8.9 kg; BMI, 23.48 +/- 2.17 kg x m(-2); and maximal oxygen uptake (VO(2 max)), 46.1 +/- 4.0 ml x kg(-1) x min(-1). Plasma 6-keto-PGF(1 alpha) concentrations were measured in venous blood samples taken prior to the exercise and at exhaustion (at VO(2 max)) before and after completing the training protocol. On average, the training resulted in a significant increase in VO(2 max) (p = 0.03), power output at VO(2 max) (p = 0.001) and a significant increase (p = 0.05) in the net-exercise-induced increase in plasma 6-keto-PGF(1 alpha) concentration (Delta 6-keto-PGF(1 alpha) i.e., the difference between the end-exercise and pre-exercise 6-keto-PGF(1 alpha) concentrations). No effect of training on the basal PGI(2) concentration was found. Interestingly, within the study sample (n = 12), two subgroups could be defined with a differential pattern of response with respect to Delta 6-keto-PGF(1 alpha) concentrations. In one subgroup (n = 7), a significant increase in Delta 6-keto-PGF(1 alpha) concentration after training was found (p < 0.02) (responders). This enhancement in the exercise-induced PGI(2) release was accompanied by a significant (p < 0.05) increase in VO(2 max) after training. In contrast, in another subgroup (n = 5), there was no observed effect of training on the Delta 6-keto-PGF(1 alpha) concentration and the VO(2 max) after training (non-responders). In both of these subgroups, training did not influence the basal PGI(2) concentration. In conclusion, the endurance training resulted in the adaptive augmentation of the systemic release of PGI(2) in response to exercise
DEFF Research Database (Denmark)
Roessler, Kirsten Kaya; Birkebaek, Camilla; Ravn, Pernille
2013-01-01
with group counselling sessions on anthropometry and cardio-respiratory fitness in women with PCOS. DESIGN: Seventeen sedentary, overweight women with PCOS were randomized in a cross-over design to 16 weeks of intervention: Eight weeks high intensity aerobic exercise was followed by eight weeks group...... counselling (n=8) or vice versa (n=9). Fourteen of the women completed the tests. MAIN OUTCOME MEASURES: Waist circumference, body mass index and maximal aerobic capacity (VO(2max) ) were measured at baseline, cross-over and post-intervention. RESULTS: Waist circumference (119.9 vs. 106.5 cm) and body mass...
Max Tech and Beyond: Maximizing Appliance and Equipment Efficiency by Design
Energy Technology Data Exchange (ETDEWEB)
Desroches, Louis-Benoit; Garbesi, Karina
2011-07-20
It is well established that energy efficiency is most often the lowest cost approach to reducing national energy use and minimizing carbon emissions. National investments in energy efficiency to date have been highly cost-effective. The cumulative impacts (out to 2050) of residential energy efficiency standards are expected to have a benefit-to-cost ratio of 2.71:1. This project examined energy end-uses in the residential, commercial, and in some cases the industrial sectors. The scope is limited to appliances and equipment, and does not include building materials, building envelopes, and system designs. This scope is consistent with the scope of DOE's appliance standards program, although many products considered here are not currently subject to energy efficiency standards. How much energy could the United States save if the most efficient design options currently feasible were adopted universally? What design features could produce those savings? How would the savings from various technologies compare? With an eye toward identifying promising candidates and strategies for potential energy efficiency standards, the Max Tech and Beyond project aims to answer these questions. The analysis attempts to consolidate, in one document, the energy savings potential and design characteristics of best-on-market products, best-engineered products (i.e., hypothetical products produced using best-on-market components and technologies), and emerging technologies in research & development. As defined here, emerging technologies are fundamentally new and are as yet unproven in the market, although laboratory studies and/or emerging niche applications offer persuasive evidence of major energy-savings potential. The term 'max tech' is used to describe both best-engineered and emerging technologies (whichever appears to offer larger savings). Few best-on-market products currently qualify as max tech, since few apply all available best practices and components. The
On the Hitting Probability of Max-Stable Processes
Hofmann, Martin
2012-01-01
The probability that a max-stable process {\\eta} in C[0, 1] with identical marginal distribution function F hits x \\in R with 0 < F (x) < 1 is the hitting probability of x. We show that the hitting probability is always positive, unless the components of {\\eta} are completely dependent. Moreover, we consider the event that the paths of standard MSP hit some x \\in R twice and we give a sufficient condition for a positive probability of this event.
Min-Max decoding for non binary LDPC codes
Savin, Valentin
2008-01-01
Iterative decoding of non-binary LDPC codes is currently performed using either the Sum-Product or the Min-Sum algorithms or slightly different versions of them. In this paper, several low-complexity quasi-optimal iterative algorithms are proposed for decoding non-binary codes. The Min-Max algorithm is one of them and it has the benefit of two possible LLR domain implementations: a standard implementation, whose complexity scales as the square of the Galois field's cardinality and a reduced c...
Max Saunders, Ford Madox Ford: a Dual Life
Brasme, Isabelle
2014-01-01
Ford Madox Ford: A Dual Life is a welcome paperback reprint of Max Saunders’s authoritative monograph, which was initially published in 1996. The history of criticism and reception for Ford Madox Ford’s writing has been far from straightforward from the early twentieth to the early twenty-first century. Ford Hermann Hueffer, then Ford Madox Hueffer, then Ford Madox Ford (1873-1939), was at the centre of intellectual circles in the first three decades of the twentieth century. A prevalent figu...
Directory of Open Access Journals (Sweden)
Grace D
2008-01-01
Full Text Available Abstract We investigate the performance and coexistence techniques for worldwide interoperability for microwave access (WiMAX delivered from high altitude platforms (HAPs and terrestrial systems in shared 3.5 GHz frequency bands. The paper shows that it is possible to provide WiMAX services from individual HAP systems. The coexistence performance is evaluated by appropriate choice of parameters, which include the HAP deployment spacing radius, directive antenna beamwidths based on adopted antenna models for HAPs and receivers. Illustrations and comparisons of coexistence techniques, for example, varying the antenna pointing offset, transmitting and receiving antenna beamwidth, demonstrate efficient ways to enhance the HAP system performance while effectively coexisting with terrestrial WiMAX systems.
MonoMax Suture: A New Long-Term Absorbable Monofilament Suture Made from Poly-4-Hydroxybutyrate
Directory of Open Access Journals (Sweden)
Erich K. Odermatt
2012-01-01
Full Text Available A long-term absorbable monofilament suture was developed using poly-4-hydroxybutyrate (P4HB made from a biosynthetically produced homopolymer of the natural metabolite 4-hydroxybutyrate. The suture, called MonoMax, has prolonged strength retention. At 12 weeks, a size 3-0 MonoMax suture retains approximately 50% of its initial tensile strength in vivo and is substantially degraded in one year with minimal tissue reaction. In contrast, PDS II monofilament suture (Ethicon, Inc., Somerville, NJ has no residual strength in vivo after 12 weeks. In vivo, the MonoMax suture is hydrolyzed primarily by bulk hydrolysis, and is then degraded via the Krebs cycle. MonoMax is substantially more compliant than other monofilament sutures, and incorporates an element of elasticity. Its tensile modulus of 0.48 GPa is approximately one-third of the value of the PDS II fiber providing an exceptionally flexible and pliable fiber with excellent knot strength and security. These features are further enhanced by the fiber's elasticity, which also improves knot security and may help prevent wound dehiscence. Because of its performance advantages, this suture may find clinical utility in applications where prolonged strength retention, and greater flexibility are required, particularly in procedures like abdominal wall closure where wound dehiscence is still a significant post-surgical complication.
Directory of Open Access Journals (Sweden)
Rostam Alizadeh
2010-06-01
Full Text Available In some team sports such as soccer which is interval, athletes need to prepare themselves immediatelyfor the next activity. Therefore it is very important to have enough information on characteristics of recovery phase and quick recovery to the first situation and to have the minimum speed reduction. The purpose of this study was to determine the relationship between aerobic power and repeated sprint ability (RSA or decrementindex in young soccer players in three different levels of Vo2max. Methods: For this reason 41 volunteers were divided in to three groups with different levels of Vo2max ml.kg-1.min-1 low 37.22 ± 2.3 (n= 18, age 17.1 ± 0.9 year, height 170.6 ± 0.76 cm, weight 67.1 ± 5.05 kg medium 46.46± 1.97 ml.kg-1.min-1 (n= 13, age 17.6± 0.76year, height 173.8 ± 4.84 cm, weight 65.9 ± 4.92 kg and high 55.63 ± 1.52 ml.kg-1.min-1 (n=10, age 17.4 ±0.69 year, height 177 ± 3.23 cm, weight 71.4 ± 3.94 kg. To determine Vo2max a graded exercise test until volitional exhaustion on treadmill was used, and also RAST was used to measure RSA. The lactate accumulation was measured before and after RSA protocol. Pearson's correlation was used to determine the correlation between the aerobic power and RSA. The results indicated that there are significant relationship between Vo2max anddecremental index in low Vo2max group (r= 0.86, p= 0.001, no significant relationship medium Vo2max group (r= 0.14, p= 0.63 and negative significant relationship in high Vo2max group (r= - 0.64, p= 0.04. There are no significant relationship between Lactate accumulation and decremental index in medium (r= 0.005, p= 0.98 and high Vo2max groups (r=0.27, p= 0.45. Discussion: It is possible that the recovery of inter muscular resources relates to aerobic ability, but there are other factors effective in RSA rather than Vo2max and Lactate accumulation. The current study showed a normal curved relationship between Vo2max and RSA.
Bebop to the Boolean boogie an unconventional guide to electronics
Maxfield, Clive
2003-01-01
From reviews of the first edition:""If you want to be reminded of the joy of electronics, take a look at Clive (Max) Maxfield's book Bebop to the Boolean Boogie.""--Computer Design ""Lives up to its title as a useful and entertaining technical guide....well-suited for students, technical writers, technicians, and sales and marketing people.""--Electronic Design""Writing a book like this one takes audacity! ... Maxfield writes lucidly on a variety of complex topics without 'writing down' to his audience."" --EDN""A highly readable, well-illustrated guided tour
Ethical care of the other: Edith Stein and Max Scheler's contributions
Directory of Open Access Journals (Sweden)
Valdecyr Herdy Alves
2018-05-01
Full Text Available Abstract Objective: To analyze the empathy of Edith Stein and the sympathy of Max Scheler for an ethical care of the other. Method: A reflexive, philosophical study anchored in the philosopher Edith Stein's thoughts about empathy for the care of the human person, and likewise of the philosopher Max Scheler on sympathy. It intends to converge the thoughts of the thinkers with the intention of presenting the importance of the care with the person. Results: Stein's empathy leads the human being to perceive the experiences of others and the need for the ethical care of the other; Scheler, in relation to sympathy, brings love as the basis for the ethical care, essential in this relationship with the other. Conclusion: Life and care are become necessary for human relationships, and thus, according to Stein and Scheler's philosophies, each person is invited to perceive the other as a human being.
Directory of Open Access Journals (Sweden)
Marcos David Silva-Cavalcante
2013-01-01
Full Text Available O objetivo do estudo foi estimar as contribuições do metabolismo anaeróbio lático (MAL e alático (MAA em intensidades abaixo do consumo máximo de oxigênio (VO2max. Dez homens (23 ± 4 anos, 176,4 ± 6,8 cm, 72,4 ± 8,2 kg, 12,0 ± 4,5 % de gordura corporal realizaram um teste progressivo até a exaustão voluntária para identificação do VO2max, da potência correspondente ao VO2max (WVO2max e do segundo limiar ventilatório (LV2. Na segunda e na terceira visita foram realizados seis testes de cargas constantes (três testes por sessão com intensidades abaixo do VO2max. Houve uma predominância do MAL sobre o MAA durante os exercícios submáximos a partir da intensidade correspondente ao LV2, sendo significativamente maior em 90% VO2max (p The purpose this study was that estimated contributions of the anaerobic lactic (MAL and alactic (MAA metabolism during constant load exercises at intensities below the maximal oxygen capacity uptake (VO2max. Ten males (23 ± 4 years, 176.4 ± 6.8 cm, 72.4 ± 8.2 kg, 12.0 ± 4.5 % of fat body performed in the first visit a progressive test until exhaustion to identification of VO2max, power output corresponding to the VO2max (WVO2max and second ventilatory threshold (LV2. On the second and third visit, the participants performed six constant workload tests (3 per session with intensities below VO2max. There was a predominance of MAL about MAA during the exercises sub-maximal from intensity corresponding to the LV2, being significantly higher at 90% VO2max (p < 0.05. Thus, these results may help coaches to implement training loads appropriate to their athletes, according to the metabolic demand of the competition.
Energy Technology Data Exchange (ETDEWEB)
Furman, M. A.
2010-12-11
We present simulation results of the build-up of the electron-cloud density n{sub e} in three regions of the FNAL Main Injector (MI) for a beam fill pattern made up of 5 double booster batches followed by a 6th single batch. We vary the pulse intensity in the range N{sub t} = (2-5) x 10{sup 13}, and the beam kinetic energy in the range E{sub k} = 8-120 GeV. We assume a secondary electron emission model qualitatively corresponding to TiN, except that we let the peak value of the secondary electron yield (SEY) {delta}{sub max} vary as a free parameter in a fairly broad range. Our main conclusions are: (1) At fixed N{sub t} there is a clear threshold behavior of n{sub e} as a function of {delta}{sub max} in the range {approx} 1.1-1.3. (2) At fixed {delta}{sub max}, there is a threshold behavior of n{sub e} as a function of N{sub t} provided {delta}{sub max} is sufficiently high; the threshold value of N{sub t} is a function of the characteristics of the region being simulated. (3) The dependence on E{sub k} is weak except possibly at transition energy. Most of these results were informally presented to the relevant MI personnel in April 2010.
Kadir, Abdul
2015-01-01
: This research entitled Fundamental Principles of Max Weber's Rational Bureaucracy in Kendari City, South- East Sulawesi Province. The purpose of study is to explain and interpret the characteristics of Max Weber's bureaucracy that canastas an imperative control for officials ‘actions of Kendari City, South-East Sulawesi Province. This study utilizes a rational system perspective and applies qualitative research strategy with ethnography. The phenomenon of bureaucracy was explored naturally ...
Kadir, Abdul
2015-01-01
: This research entitled Fundamental Principles of Max Weber's Rational Bureaucracy in Kendari City, South- East Sulawesi Province. The purpose of study is to explain and interpret the characteristics of Max Weber's bureaucracy that canastas an imperative control for officials ‘actions of Kendari City, South-East Sulawesi Province. This study utilizes a rational system perspective and applies qualitative research strategy with ethnography. The phenomenon of bureaucracy was explored naturally ...
Analysis of high accuracy, quantitative proteomics data in the MaxQB database.
Schaab, Christoph; Geiger, Tamar; Stoehr, Gabriele; Cox, Juergen; Mann, Matthias
2012-03-01
MS-based proteomics generates rapidly increasing amounts of precise and quantitative information. Analysis of individual proteomic experiments has made great strides, but the crucial ability to compare and store information across different proteome measurements still presents many challenges. For example, it has been difficult to avoid contamination of databases with low quality peptide identifications, to control for the inflation in false positive identifications when combining data sets, and to integrate quantitative data. Although, for example, the contamination with low quality identifications has been addressed by joint analysis of deposited raw data in some public repositories, we reasoned that there should be a role for a database specifically designed for high resolution and quantitative data. Here we describe a novel database termed MaxQB that stores and displays collections of large proteomics projects and allows joint analysis and comparison. We demonstrate the analysis tools of MaxQB using proteome data of 11 different human cell lines and 28 mouse tissues. The database-wide false discovery rate is controlled by adjusting the project specific cutoff scores for the combined data sets. The 11 cell line proteomes together identify proteins expressed from more than half of all human genes. For each protein of interest, expression levels estimated by label-free quantification can be visualized across the cell lines. Similarly, the expression rank order and estimated amount of each protein within each proteome are plotted. We used MaxQB to calculate the signal reproducibility of the detected peptides for the same proteins across different proteomes. Spearman rank correlation between peptide intensity and detection probability of identified proteins was greater than 0.8 for 64% of the proteome, whereas a minority of proteins have negative correlation. This information can be used to pinpoint false protein identifications, independently of peptide database
Max-Planck-Institut fuer Plasmaphysik. Annual report 1993
International Nuclear Information System (INIS)
1993-01-01
In 1993 the first particle injector of the ASDEX Upgrade divertor tokamak was put into operation up to 6 MW of heating power. The main diagnostics were put into operation as also was a newly developed pellet centrifuge. At the Wendelstein 7-AS stellarator experiment the cooperation with Russian and German research institutes an electron cyclotron resonance heating was successful. The works of the Berlin Division of IPP and the coordination of research efforts with Kernforschungszentrum Karlsruhe are reported. (DG)
Model predictive control for Max-Plus-Linear and piecewise affine systems
Necoara, I.
2006-01-01
This Ph.D. thesis considers the development of new analysis and control techniques for special classes of hybrid systems and discrete event systems. Two particular classes of hybrid systems (piecewise affine systems and max-min-plus-scaling systems), and two particular classes of discrete event
International Nuclear Information System (INIS)
Ling, Yang; Yue, Hao; Xiao-Hua, Ma; Jing-Jing, Ma; Cheng, Zhu
2010-01-01
The degradation of AlGaN/GaN high electron mobility transistors (HEMTs) has a close relationship with a model of traps in AlGaN barriers as a result of high electric field. We mainly discuss the impacts of strong electrical field on the AlGaN barrier thickness of AlGaN/GaN HEMTs. It is found that the device with a thin AlGaN barrier layer is more easily degraded. We study the degradation of four parameters, i.e. the gate series resistance R Gate , channel resistance R channel , gate current I G,off at V GS = −5 and V DS = 0.1 V, and drain current I D,max at V GS = 2 and V DS = 5 V. In addition, the degradation mechanisms of the device electrical parameters are also investigated in detail. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Resource management framework for QoS scheduling in IEEE 802.16 WiMAX networks
DEFF Research Database (Denmark)
Wang, Hua; Dittmann, Lars
2009-01-01
IEEE 802.16, also known as WiMAX, has received much attention recently for its capability to support multiple types of applications with diverse Quality-of-Service (QoS) requirements. Beyond what the standard has defined, radio resource management (RRM) still remains an open issue, which plays...... an important role in QoS provisioning for different types of services. In this chapter, we propose a downlink resource management framework for QoS scheduling in OFDMA based WiMAX systems. Our framework consists of a dynamic resource allocation (DRA) module and a connection admission control (CAC) module...
Downlink resource management for QoS scheduling in IEEE 802.16 WiMAX networks
DEFF Research Database (Denmark)
Wang, Hua; Dittmann, Lars
2010-01-01
IEEE 802.16, also known as WiMAX, has received much attention recently for its capability to support multiple types of applications with diverse Quality-of-Service (QoS) requirements. Beyond what the standard has defined, radio resource management (RRM) still remains an open issue, which plays...... an important role in QoS provisioning for different types of services. In this paper, we propose a downlink resource management framework for QoS scheduling in OFDMA based WiMAX systems. Our framework consists of a dynamic resource allocation (DRA) module and a connection admission control (CAC) module. A two...
Huser, Raphaë l; Opitz, Thomas; Thibaud, Emeric
2018-01-01
Extreme-value theory for stochastic processes has motivated the statistical use of max-stable models for spatial extremes. However, fitting such asymptotic models to maxima observed over finite blocks is problematic when the asymptotic stability
IPP Max Planck Institute of Plasma of Physics at Garching
International Nuclear Information System (INIS)
1979-01-01
The cost accounting system of the IPP Max Planck Institute of Plasma Physics at Garching is described with all details as there are cost class accounting, cost centers, cost units and resulting overall cost summary. Detailed instructions are given about the implementation of this cost accounting system into the organisational structure of the IPP. (A.N.)
Fabrication of fiber composites with a MAX phase matrix by reactive melt infiltration
International Nuclear Information System (INIS)
Lenz, F; Krenkel, W
2011-01-01
Due to the inherent brittleness of ceramics it is very desirable to increase the damage tolerance of ceramics. The ternary MAX phases are a promising group of materials with high fracture toughness. The topic of this study is the development of ceramic matrix composites (CMCs) with a matrix containing MAX phases, to achieve a damage tolerant structural composite material. For this purpose carbon fiber reinforced preforms with a carbon-titanium carbide matrix (C/C-TiC) were developed and infiltrated with silicon by a pressureless reactive melt infiltration. Finally liquid silicon caused the formation of SiC, TiSi 2 and Ti 3 SiC 2 in the matrix of the composite.
International Nuclear Information System (INIS)
Beckmann, J.D.; Frerman, F.E.
1985-01-01
The oxidative half-reaction of electron-transfer flavoprotein (ETF), electron transfer from ETF to electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO), is dependent on complementary surface charges on the two proteins. ETF is the positively charged member of the redox pair. The evidence is based on the pH and ionic strength dependencies of the comproportionation of oxidized ETF and ETF hydroquinone catalyzed by ETF-QO and on the effects of chemical modification of ETF on the comproportionation reaction. Acetylation of one and five epsilon-amino groups of lysyl residues results in 3- and 13-fold increases, respectively, in the K/sub m/ of ETF-QO for ETF but no change in V/sub max/. Amidination, which maintains positive charge at modified loci, has no effect on steady-state kinetic constants. These chemical modifications have no effect on the equilibrium constant for equilibration of ETF redox states. The K/sub m/ of ETF-QO for ETF is pH dependent above pH 8.5, suggesting titration of lysyl residues. The ionic strength dependence of TN/KmETF for the reaction follows the limiting Bronsted equation. The ETF-QO-catalyzed comproportionation reaction exhibits a primary deuterium isotope effect in D 2 O, perhaps indicating the participation of solvent water in the electron-transfer reaction
Chong, Jihyo; Kim, Young J; Gu, Myojeong; Wagner, Thomas; Song, Chul H
2016-01-01
Ground-based MAX-DOAS measurements have been used to retrieve column densities of atmospheric absorbers such as NO2, SO2, HCHO, and O3. In this study, mobile MAX-DOAS measurements were conducted to map the 2-D distributions of atmospheric NO2 in the western coastal areas of the Korean peninsula. A Mini-MAX-DOAS instrument was mounted on the rooftop of a mobile lab vehicle with a telescope mounted parallel to the driving direction, pointing forward. The measurements were conducted from 21 to 24 December 2010 along the western coastal areas from Gomso harbor (35.59N, 126.61E) to Gunsan harbor (35.98N, 126.67E). During mobile MAX-DOAS observations, high elevation angles were used to avoid shades from nearby obstacles. For the determination of the tropospheric vertical column density (VCD), the air mass factor (AMF) was retrieved by the so-called geometric approximation. The NO2 VCDs from 20 and 45 degree elevation angles were retrieved from mobile MAX-DOAS measurements. The tropospheric NO2 VCDs derived from mobile MAX-DOAS measurements were compared directly to those retrieved by the OMI satellite observations. Mobile MAX-DOAS VCD was in good agreement with OMI tropospheric VCD on most days. However, OMI tropospheric VCD was much higher than that of mobile MAX-DOAS on 23 December 2010. One probable reason for this difference is that OMI retrieval might overestimate NO2 VCD under haze conditions, when a pollution plume was transported over the measurement site. The mobile MAX-DOAS observations reveal much finer spatial patterns of NO2 distributions, which can provide useful information for the validation of satellite observation of atmospheric trace gases. Copyright © 2015 Elsevier Ltd. All rights reserved.
Laemers, S.A.M.
2017-01-01
Max J. Friedländer (1867-1958). Art and Connoisseurship, a Life dedicated to Early Netherlandish Painting, aims to elucidate the life and work of Max Friedländer on the basis of a number of themes, especially his connoisseurship and its meaning for the exploration of early Netherlandish painting.
Directory of Open Access Journals (Sweden)
D. Grace
2008-11-01
Full Text Available We investigate the performance and coexistence techniques for worldwide interoperability for microwave access (WiMAX delivered from high altitude platforms (HAPs and terrestrial systems in shared 3.5 GHz frequency bands. The paper shows that it is possible to provide WiMAX services from individual HAP systems. The coexistence performance is evaluated by appropriate choice of parameters, which include the HAP deployment spacing radius, directive antenna beamwidths based on adopted antenna models for HAPs and receivers. Illustrations and comparisons of coexistence techniques, for example, varying the antenna pointing offset, transmitting and receiving antenna beamwidth, demonstrate efficient ways to enhance the HAP system performance while effectively coexisting with terrestrial WiMAX systems.
EVALUATION AND COMPARISON OF VO2MAX ASSESSMENT MODELS IN HIGH SCHOOL STUDENTS
Directory of Open Access Journals (Sweden)
Bolboli Lotfali
2013-04-01
Full Text Available The purpose of this study was to evaluation and comparison of VO2max assessment models in students. Thirty students from high schools of Ardabil city were selected randomly and served as subjects in this study (age: 15.73±0.69 year, height: 169.46±8.1 cm, weight: 61.70±9.32 kg. Subjects were divided into two groups. In one group Rockport test was used to estimate their VO2 max and in other group Balk test was used for the same purpose. Also, the VO2max of both groups were examined by a standard treadmill test and the results were compared with the results of field tests. The one way of ANOVA and Tukey's post-hoc tests were used for data analysis (p>0/05. The results showed that there were significant differences between the results of the field tests and standard treadmill test (Bruce: 40.93±5.83 vs. Rockport: 58.71±2.73 and Balke: 52.09± 6.18. As a result of these findings it was concluded that the regression equations used in this study used is not suitable for 15-17 (yr boys and does not estimate their aerobic power correctly.
Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).
Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R
2016-03-01
Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).
An Overlapping Communities Detection Algorithm via Maxing Modularity in Opportunistic Networks
Directory of Open Access Journals (Sweden)
Gao Zhi-Peng
2016-01-01
Full Text Available Community detection in opportunistic networks has been a significant and hot issue, which is used to understand characteristics of networks through analyzing structure of it. Community is used to represent a group of nodes in a network where nodes inside the community have more internal connections than external connections. However, most of the existing community detection algorithms focus on binary networks or disjoint community detection. In this paper, we propose a novel algorithm via maxing modularity of communities (MMCto find overlapping community structure in opportunistic networks. It utilizes contact history of nodes to calculate the relation intensity between nodes. It finds nodes with high relation intensity as the initial community and extend the community with nodes of higher belong degree. The algorithm achieves a rapid and efficient overlapping community detection method by maxing the modularity of community continuously. The experiments prove that MMC is effective for uncovering overlapping communities and it achieves better performance than COPRA and Conductance.
Architectural visualisation toolkit for 3D Studio Max users
Cooper , Neil
2012-01-01
Architectural Visualisation has become a vital part of the design process for architects and engineers. The process of modelling and rendering an architectural visualisation can be complex and time consuming with only a few tools available to assist novice modellers. This paper looks at available solutions for visualisation specialists including AutoCAD, 3D Studio Max and Google SketchUp as well as available solutions which attempt to automate the process including Batzal Roof ...
Adaptive Priority-Based Downlink Scheduling for WiMAX Networks
Wu, Shih-Jung; Huang, Shih-Yi; Huang, Kuo-Feng
2012-01-01
Supporting quality of service (QoS) guarantees for diverse multimedia services are the primary concerns for WiMAX (IEEE 802.16) networks. A scheduling scheme that satisfies QoS requirements has become more important for wireless communications. We propose a downlink scheduling scheme called adaptive priority-based downlink scheduling (APDS) for providing QoS guarantees in IEEE 802.16 networks. APDS comprises two major components: priority assignment and resource allocation. Different service-...
Koh, Jeffrey L; Harrison, Dale; Myers, Robert; Dembinski, Robert; Turner, Helen; McGraw, Terrence
2004-12-01
Topical anesthetics may help reduce discomfort associated with procedures involving needle-puncture, such as intravenous (i.v.) insertions, in children. EMLA cream has become a common, noninvasive therapy for topical anesthesia in children. ELA-Max is a recently introduced topical anesthetic cream marketed as being as effective in producing topical anesthesia after a 30-min application as EMLA is after a 60-min application. The purpose of this research was to compare ELA-Max at 30 min with EMLA at 60 min for providing topical anesthesia for i.v. insertions in children. Sixty children, ages 8-17 years, requiring an i.v. were randomized to receive either the 30 min application of ELA-Max (n = 30) or the 60 min application of EMLA (n = 30). Children rated any pain associated with the i.v. insertion using a 100-mm Visual Analog Scale (VAS). The anesthesiologist assessed the presence of blanching at the site and rated the difficulty of placing the i.v. There was no clinically or statistically significant difference in pain ratings (P = 0.87) between the ELA-Max (mean = 25.7) and the EMLA (mean = 26.8) groups. ELA-Max caused significantly (P = 0.04) less blanching than EMLA, however there was no difference in the anesthesiologists' rating of the difficulty of the i.v. placement between the groups (P = 0.73). Results from this study support the claim that a 30-min application of ELA-Max (with occlusion) is as effective as a 60-min application of EMLA (with occlusion) for producing topical anesthesia for i.v. insertion in children.
Monitoring shipping emissions in the German Bight using MAX-DOAS measurements
Seyler, André; Wittrock, Folkard; Kattner, Lisa; Mathieu-Üffing, Barbara; Peters, Enno; Richter, Andreas; Schmolke, Stefan; Burrows, John P.
2017-04-01
Shipping is generally the most energy efficient transportation mode, but, at the same time, it accounts for four fifths of the worldwide total merchandise trade volume. As a result, shipping contributes a significant part to the emissions from the transportation sector. The majority of shipping emissions occurs within 400 km of land, impacting on air pollution in coastal areas and harbor towns. The North Sea has one of the highest ship densities in the world and the vast majority of ships heading for the port of Hamburg sail through the German Bight and into the river Elbe. A three-year time series of ground-based MAX-DOAS measurements of NO2 and SO2 on the island Neuwerk in the German Bight has been analyzed for contributions from shipping emissions. Measurements of individual ship plumes as well as of background pollution are possible from this location, which is 6-7 kilometers away from the main shipping lane towards the harbor of Hamburg. More than 2000 individual ship plumes have been identified in the data and analyzed for the emission ratio of SO2 to NO2, yielding an average ratio of 0.3 for the years 2013/2014. Contributions of ships and land-based sources to air pollution levels in the German Bight have been estimated, showing that despite the vicinity to the shipping lane, the contribution of shipping sources to air pollution is only about 40%. Since January 2015, much lower fuel sulfur content limits of 0.1% (before: 1.0%) apply in the North and Baltic Sea Emission Control Area (ECA). Comparing MAX-DOAS measurements from 2015/2016 (new regulation) to 2013/2014 (old regulation), a large reduction in SO2/NO2 ratios in shipping emissions and a significant reduction (by a factor of eight) in ambient coastal SO2 levels have been observed. In addition to that, selected shipping emission measurements from other measurement sites and campaigns are presented. This study is part of the project MeSMarT (Measurements of Shipping emissions in the Marine Troposphere
Friedrich Max Müller and the Sacred Books of the East
Molendijk, Arie L.
2016-01-01
This volume offers a critical analysis of one the most ambitious editorial projects of late Victorian Britain: the edition of the fifty substantial volumes of the Sacred Books of the East (1879-1910). The series was edited and conceptualized by Friedrich Max Müller (1823-1900), a world-famous
Wifi, WiMax and LTE multi-hop mesh networks basic communication protocols and application areas
Wei, Hung-Yu; Dixit, Sudhir
2013-01-01
Wifi, WiMAX, and Cellular Multihop Networks presents an overview of WiFi-based and WiMAX-based multihop relay networks. As the first text to cover IEEE 802.16j multihop hop relay technology, this revolutionary resource explores the latest advances in multi-hop and ad-hoc networking. Not only does this reference provide the technological aspects, but also the applications for the emerging technology and architectural issues. Ranging from introductory material to advanced topics, this guidebook, plus PowerPoint slides, is essential for engineers, researchers, and students interested in
Comparison of IAEA protocols for clinical electron beam dosimetry
International Nuclear Information System (INIS)
Novotny, J.; Soukup, M.
2002-01-01
In most beam calibration protocols so far used in clinical practice, the method recommended for the determination of absorbed dose to water in high-energy electron beams is based on either an exposure or an air kerma calibration factor of an ionisation chamber in a C0 60 gamma-ray or 2 MV x-ray beam. These protocols are complex and the overall uncertainty in the absorbed dose to water under reference conditions is about 3-4%. The new generation of protocols, namely IAEA TRS 398, are based on absorbed dose-to-water standards in photon beams from Co 60 and accelerator beams. The possible errors in absorbed dose determination in reference conditions in practical clinical dosimetry caused by replacement of TRS 277 and TRS 381 protocols for a new TRS 398 protocol were carefully studied for clinical electron beams in energy range 6-20 MeV. All measurements were performed on Varian CLINAC 2100 C linear accelerator. The electron beam energy ranged from 6 to 20 MeV. Basically three different detectors were used for measurements: PTW Roos plane-parallel ionization chamber, calibrated PTW 30002 Farmer type, ionization, Scanditronix electron diode detector. Measurements of central axis percentage depth doses were made by diode using Wellhoefer WP700 beam scanner in 40 cm x 40 cm x 50 cm water phantom. A reference chamber or semiconductor diode mounted on electron treatment cone was used to correct beam output variations for a chamber or diode measurements during scanning. Absolute dose measurements were carried out with Roos plane-parallel chamber connected to PTW UNIDOS electrometer always for preselected number of monitor units. In a new IAEA dosimetry protocol clinical reference dosimetry for electron beam is performed at depth of d ref = 0.6R 50 - 0.1 [cm] instead of d max as in previous ones. To check the stability of electron beams for energy and to establish d ref and standard deviation for reference depth position, the depth dose curves obtained during the quality
Directory of Open Access Journals (Sweden)
R. Sinreich
2013-06-01
Full Text Available We present a novel parameterization method to convert multi-axis differential optical absorption spectroscopy (MAX-DOAS differential slant column densities (dSCDs into near-surface box-averaged volume mixing ratios. The approach is applicable inside the planetary boundary layer under conditions with significant aerosol load, and builds on the increased sensitivity of MAX-DOAS near the instrument altitude. It parameterizes radiative transfer model calculations and significantly reduces the computational effort, while retrieving ~ 1 degree of freedom. The biggest benefit of this method is that the retrieval of an aerosol profile, which usually is necessary for deriving a trace gas concentration from MAX-DOAS dSCDs, is not needed. The method is applied to NO2 MAX-DOAS dSCDs recorded during the Mexico City Metropolitan Area 2006 (MCMA-2006 measurement campaign. The retrieved volume mixing ratios of two elevation angles (1° and 3° are compared to volume mixing ratios measured by two long-path (LP-DOAS instruments located at the same site. Measurements are found to agree well during times when vertical mixing is expected to be strong. However, inhomogeneities in the air mass above Mexico City can be detected by exploiting the different horizontal and vertical dimensions probed by the MAX-DOAS and LP-DOAS instruments. In particular, a vertical gradient in NO2 close to the ground can be observed in the afternoon, and is attributed to reduced mixing coupled with near-surface emission inside street canyons. The existence of a vertical gradient in the lower 250 m during parts of the day shows the general challenge of sampling the boundary layer in a representative way, and emphasizes the need of vertically resolved measurements.
Comparison of Three Popular Exercise Modalities on V˙O2max in Overweight and Obese.
Bækkerud, Fredrik Hjulstad; Solberg, Frederic; Leinan, Ingeborg Megård; Wisløff, Ulrik; Karlsen, Trine; Rognmo, Øivind
2016-03-01
In this prospective randomized trial, we examined the effect of three popular exercise training modalities on maximal oxygen uptake (V˙O2max) in overweight and obese individuals. In addition, we examined possible concomitant adaptations in endurance exercise performance (time to exhaustion (TTE)), citrate synthase (CS) activity, venous and arterial function, blood volume, and calculated stroke volume (SV). Thirty subjects were recruited (age, 41 ± 9 yr; weight, 91 ± 14 kg; height, 173 ± 8 cm; body mass index, 30 ± 4 kg·m(-2)) and randomized to either 6 wk of 4 × 4-min high-intensity interval training (4HIIT) at 85%-95% of HRmax, 10 × 1-min HIIT (1HIIT) at V˙O2max load, or 45-min moderate-intensity continuous training (MICT) at 70% of HRmax. V˙O2max, TTE, CS activity, venous and arterial function, as well as blood volume were measured before and after the training period. O2 pulse was calculated and used to estimate SV. Analysis was conducted per protocol. Only 4HIIT increased V˙O2max (P HIIT (P = 0.04) and MICT (P = 0.03) (4HIIT, 10%; 1HIIT, 3.3%; and MICT, 3.1%). All groups increased TTE (4HIIT, 198%; 1HIIT, 116%; MICT, 52%), with a higher increase after 4HIIT compared with that after MICT (P = 0.02). Calculated SV increased only after 4HIIT (14.4%). Plasma volume and hemoglobin mass increased after 1HIIT only (5.6% and 6.5%); however, no group differences were found. All groups increased CS activity (4HIIT, 35%; 1HIIT, 35%; MICT, 56%), with no group differences. Arterial inflow (15.7%) and venous outflow (22.7%) decreased after MICT, but there were no group differences. 4HIIT was superior to 1HIIT and MICT in improving V˙O2max likely because of an increased SV.
DEFF Research Database (Denmark)
Calbet, J A L; Boushel, Robert Christopher; Radegran, G
2003-01-01
Acute hypoxia (AH) reduces maximal O2 consumption (VO2 max), but after acclimatization, and despite increases in both hemoglobin concentration and arterial O2 saturation that can normalize arterial O2 concentration ([O2]), VO2 max remains low. To determine why, seven lowlanders were studied at VO2......% of the cardiac output perfused the legs, in CH the legs received only 67%. Pulmonary VO2 max (4.1 +/- 0.3 l/min at SL) fell to 2.2 +/- 0.1 l/min in AH (P normalization...... of arterial [O2] is explained by two circulatory effects of altitude: 1) failure of cardiac output to normalize and 2) preferential redistribution of cardiac output to nonexercising tissues. Oxygen transport from blood to muscle mitochondria, on the other hand, appears unaffected by CH....
Directory of Open Access Journals (Sweden)
LUIS FELIPE DE SALLES ROSELINO
2014-04-01
Full Text Available Resumo: O tema da morte trágica, presente nos escritos de Liev Tolstói, auxiliou tanto a Max Weber como a György Lukács a caracterizarem o pathos moderno de pressentimento da morte como uma contemplação do vazio. Weber e Lukács encontraram, através das leituras de Tolstói, uma interessante maneira de questionar a autonomia da arte e da ciência moderna, considerando pela esfera estética, como se mostra sem sentido a recente realidade imanente. Ambos assumiram o tema central das obras de Tolstói segundo uma mesma imagem, derivada do contraste entre o mundo antigo e o moderno. Max Weber adequou esse tema a sua teoria do desencantamento do mundo e Lukács, de modo muito semelhante, seguindo seu conceito do paradoxo da necessidade religiosa.Palavras-chave: Tolstói – Weber – Lukács – Desencantamento – Necessidade Religiosa – L’Art Pour l’Art. Abstract: The tragic death in Tolstoy's writings has helped both Max Weber and György Lukács in characterizing the modern pathos as a tragic contemplation of the emptiness of life. Through Tolstoy's readings, Weber and Lukács found an interesting source of denying arts and modern sciences autonomy, considering, from the aesthetics sphere, the meaningless of this new immanent reality. Both has assumed Tolstoy main theme from the same perspective, contrasting ancient and modern worldviews. Max Weber presented this theme in his disenchantment of world theory and Lukács, in a very similar way, following the paradox of religious needing as a mainline.Keywords: Tolstoy – Weber – Lukács – Disenchantment – Religious Needing – L’Art Pour l’Art.
Max Planck Institute for Human Development and Education: Annual Report 1990.
Max-Planck-Institut fuer Bildungsforschung, Berlin (West Germany).
The Max Planck Institute for Human Development and Education in Germany consists of four research centers dealing with the following topics: sociology and the study of the life course; development and socialization; psychology and human development; and school systems and instruction. This English-language annual report of the Planck Institute,…
Los juegos narrativos de Max Aub en Juego de cartas
Directory of Open Access Journals (Sweden)
Valles Calatrava, José R.
2007-12-01
Full Text Available After reviewing the dates of writing and edition, the illustrations of the cards and the different thematic relationships among the 106 epistles that integrate Juego de Cartas (1964 by Max Aub, this article successively studies the playful and experimental dimensions of the novel and its opened plot, analyzing in a detailed way the narrative technical procedures used by Aub in its composition: dissociation of the author and apocryphal play, limitless retextualization of story (scattered text and opened montage, greatest interactivity and kaleidoscopic design.Tras examinar las fechas de escritura y publicación, las ilustraciones de los naipes y las vinculaciones temáticas de las 106 epístolas que integran la obra de Max Aub Juego de cartas (1964, este artículo estudia las dimensiones lúdica y experimental de la novela y su estructura abierta, analizando sucesivamente de modo detallado los procedimientos técnicos narrativos empleados por Aub en su composición: disociación autoral y presencia del apócrifo, retextualización ilimitada de la historia narrativa (texto diseminado y montaje abierto, máxima interactividad, diseño caleidoscópico.
International Nuclear Information System (INIS)
Arulkumaran, S.; Liu, Z.H.; Ng, G.I.; Cheong, W.C.; Zeng, R.; Bu, J.; Wang, H.; Radhakrishnan, K.; Tan, C.L.
2007-01-01
The influence of temperature (- 50 deg. C to + 200 deg. C) was studied on the DC and microwave characteristics of AlGaN/GaN high-electron-mobility transistors (HEMTs) on high resistivity Si substrate for the first time. The AlGaN/GaN HEMTs exhibited a current-gain cut-off frequency (f T ) of 11.8 GHz and maximum frequency of oscillation (f max ) of 27.5 GHz. When compared to room temperature values, about 4% and 10% increase in f T and f max and 23% and 39.5% decrease in f T and f max were observed when measured at - 50 deg. C and 200 deg. C, respectively. The improvement of I D , g m f T , and f max at - 50 deg. C is due to the enhancement of 2DEG mobility and effective electron velocity. The anomalous drain current reduction in the I-V curves were observed at low voltage region at the temperature ≤ 10 deg. C but disappeared when the temperature reached ≥ 25 deg. C. A positive threshold voltage (V th ) shift was observed from - 50 deg. C to 200 deg. C. The positive shift of V th is due to the occurrence of trapping effects in the devices. The drain leakage current decreases with activation energies of 0.028 eV and 0.068 eV. This decrease of leakage current with the increase of temperature is due to the shallow acceptor initiated impact ionization
Management of Groin Abcess with Flaminal Forte and KerraMax Care
Directory of Open Access Journals (Sweden)
Maggie Pugh
2016-04-01
Full Text Available The patient’s dressing plan using Flaminal Forte and KerraMax Care successfully managed the complexities of his wound, absorbing exudate, reducing pain on dressing, malodour and wound bioburden. Moreover, the plan encouraged patient concordance, reduced nursing consultation time and subsequently altered treatment plans for our patients with abscesses
Max Headroom, Ad Man of the Eighties: When Commercial Becomes Cult.
Wassmuth, Birgit L.; Carr, Douglas J.
With Coca-Cola's selection of a digital, computer-constructed "spokesthing" named Max Headroom, came a dramatic shift toward a reliance on high technology to deliver the advertising message. Headroom was developed in Britain, and made his debut on the Home Box Office television network in 1985. Coca-Cola then bought the rights to…
Un manuscrito del taller de Max Aub
Directory of Open Access Journals (Sweden)
Javier Lluch Prats
2002-11-01
Full Text Available Max Aub's legacy has recently helped to find some of the author's autograph testimonies than enlighten his printed work. The manuscript of the historical novel Campo del Moro (1963 is here described and the contributions of a modern manuscript to a critical-genetic edition are also appreciated. The composition elements of Campo del Moro are particularly analyzed the title, the quotations, the working plan and the notes about the characters. All this results in a better knowledge of the novel, gíving us the possibility of describing the process of its writing so as to facilitate the narration of its editorial vicissitiudes. i.e. genesis, preparation, edition and, publication.
A comparison of VO2max and metabolic variables between treadmill running and treadmill skating.
Koepp, Kriston K; Janot, Jeffrey M
2008-03-01
The purpose of this study was to determine differences in VO2max and metabolic variables between treadmill running and treadmill skating. This study also examined VO2max responses during a continuous skating treadmill protocol and a discontinuous skating treadmill protocol. Sixteen male high school hockey players, who had a mean age of 16 +/- 1 years and were of an above-average fitness level, participated in this study. All subjects completed 4 exercise trials: a 1-hour skating treadmill familiarization trial, a treadmill running trial, and 2 randomized skating treadmill trials. Minute ventilation (VE), oxygen consumption VO2), carbon dioxide production VCO2), respiratory exchange ratio (RER), and heart rate were averaged every 15 seconds up to VO2max for each exercise test. The results showed that there was a significant difference (P skating treadmill protocol. There was also a significant difference for maximal RER between the discontinuous and continuous skating treadmill protocol and between the discontinuous skating treadmill protocol and running treadmill protocol. In conclusion, the running treadmill elicited a greater VO2max (mL.kg.min) than the skating treadmill did, but when it comes to specificity of ice skating, the skating treadmill may be ideal. Also, there was no significant difference between the discontinuous and continuous skating treadmill protocols. Therefore, a continuous protocol is possible on the skating treadmill without compromising correct skating position and physiologic responses. However, the continuous skating treadmill protocol should undergo validation before other scientists, coaches, and strength and conditioning professionals can apply it correctly.
Wier, Larry T.; Jackson, Allen W.; Jackson, Andrew S.
2009-01-01
The physical activity guidelines (PAG) established by the US Dept. of Health and Human Services in 2008 is consistent with a rating of >/= 6 on the 11-point NASA Physical Activity Status Scale (PASS). Wier, et. al. developed non-exercise models for estimating VO2(sub max) from a combination of PASS, age, gender and either waist girth (WG) (R = 0.810, SEE= 4.799 ml/kg/min), %Fat (R = 0. 817, SEE = 4.716 ml/kg/min) or BMI (R = 0.802, SEE = 4.900 ml . kg-1. min -1 ). PURPOSE: to develop non-exercise models to estimate VO2max from age, gender, body composition (WG, %Fat, BMI) and PASS dichotomized at meets or does not meet the PAG (PAG-PASS), and to compare the accuracy of the PAG-PASS models with the models using the 11-point PASS. METHODS: 2417 men and 384 women were measured for VO2max by indirect calorimetry (RER >1.1); age (yr), gender by M = 1, W = 0; WG at the umbilicus; %fat by skin-folds, BMI by weight (kg) divided by height squared (m 2 ) , and PAGPASS by PASS 6 = 1. RESULTS: Three models were developed by multiple regression to estimate VO2(sub max) from age, gender, PAG-PASS and either WG (R = 0.790, SEE=5.019 ml/kg/min), %FAT (R= 0.080, SEE = 4.915 ml/kg/min) or BMI (R = 0.777, SEE = 5.162ml/kg/min). Cross-validation by the PRESS technique confirmed these statistics. Simple correlations between measured VO2(sub max) and estimates from the PAG-PASS models with WG, %Fat and BMI were 0.790, 0.800 and 0.777, minimally different from the correlations obtained with the PASS models (0.810, 0.810, and 0.802). PAG-PASS and PASS model constant errors were also similar: gender, PASS and for VO2(sub max) between 30 and 50 ml/kg/min (70% of the sample) but > 1 ml/kg/min for VO2(sub max) 50 ml/kg/min. CONCLUSIONS: Non-exercise models using the combined effects of age, gender, body composition and the dichotomized PAG-PASS provide estimates of VO2(sub max) that are accurate for most adults, and the accuracy of these models are similar to previously published models using
Oxidation of Alumina-Forming MAX Phases in Turbine Environments
Smialek, James; Garg, Anita; Harder, Bryan; Nesbitt, James; Gabb, Timothy; Gray, SImon
2017-01-01
Protective coatings for high temperature turbine components are based on YSZ thermal barriers and oxidation resistant, alumina-forming NiAl or NiCoCrAlY bond coats. Ti2AlC and Cr2AlC MAX phases are thus of special interest because of good oxidation resistance and CTE that can match Al2O3 and YSZ. Their alumina scales grow according to cubic kinetics due to grain growth in the scale, with initial heating dominated by fast TiO2 growth. Protective cubic kinetics are also found in high pressure burner rig tests of MAXthal 211 Ti2AlC, but with reduced rates due to volatile TiO(OH)2 formation in water vapor. YSZ-coatings on bulk Ti2AlC exhibit remarkable durability up to 1300C in furnace tests and at least a 25x life advantage compared to superalloys. At another extreme, Cr2AlC is resistant to low temperature Na2SO4 hot corrosion and exhibits thermal cycling stability bonded to a superalloy disk material. Accordingly, sputtered Cr2AlC coatings on disk specimens prevented hot corrosion detriments on LCF. Breakaway oxidation (Ti2AlC), scale spallation (Cr2AlC), interdiffusion, and processing as coatings still present serious challenges. However the basic properties of MAX phases provide some unusual opportunities for use in high temperature turbines.
An ab initio study on compressibility of Al-containing MAX-phase carbides
International Nuclear Information System (INIS)
Bai, Yuelei; He, Xiaodong; Wang, Rongguo; Zhu, Chuncheng
2013-01-01
The compressibility of Al-containing MAX carbides was investigated in details using first-principle calculations based on density functional theory. The bond stiffness and bond angle as a function of pressure were examined. The M-Al bond stiffness is about 1/3–1/2 of M-C bond stiffness. The M-C bond close to Al atoms has the highest bond stiffness in M 3 AlC 2 and M 4 AlC 3 phases, with the similar bond stiffness of the other two bonds in the latter. Generally, the bond stiffness of the strongest M-C bond increases with increasing VEC (Valence Electron Concentration), which also affects the bond stiffness of other bonds. Of most importance, the bulk moduli are 0.256 of the mean bond stiffness for three series. With increasing pressure, M-Al bond angle increases, but M-C bond angles decreases, which indicates that M-Al and M-C bonds shift towards basal plane and along c-axis, respectively. As a result, the compressibility becomes more difficult along c-axis than a-axis. Some abnormal phenomena in the compressibility of Al-containing M n+1 AlX n phases with VEC = 6 are attributed to the thermodynamical instability of these compounds
May, Ryan D.; Garg, Sanjay
2012-01-01
Current aircraft engine control logic uses a Min-Max control selection structure to prevent the engine from exceeding any safety or operational limits during transients due to throttle commands. This structure is inherently conservative and produces transient responses that are slower than necessary. In order to utilize the existing safety margins more effectively, a modification to this architecture is proposed, referred to as a Conditionally Active (CA) limit regulator. This concept uses the existing Min-Max architecture with the modification that limit regulators are active only when the operating point is close to a particular limit. This paper explores the use of CA limit regulators using a publicly available commercial aircraft engine simulation. The improvement in thrust response while maintaining all necessary safety limits is demonstrated in a number of cases.
Kersbergen, B.
2015-01-01
The operation of many systems can be described by the timing of events. When the system behavior can be described by equations that are "linear'' in the max-plus algebra, which has maximization and addition as its basic operations, the system is called a max-plus-linear system. In many of these
An Analysis of the Max-Min Texture Measure.
1982-01-01
PANC 33 D2 Confusion Matrices for Scene A, IR 34 D3 Confusion Matrices for Scene B, PANC 35 D4 Confusion Matrices for Scene B, IR 36 D5 Confusion...Matrices for Scene C, PANC 37 D6 Confusion Matrices for Scene C, IR 38 D7 Confusion Matrices for Scene E, PANC 39 D8 Confusion Matrices for Scene E, IR 40...D9 Confusion Matrices for Scene H, PANC 41 DIO Confusion Matrices for Scene H, JR 42 3 .D 10CnuinMtie o cn ,IR4 AN ANALYSIS OF THE MAX-MIN TEXTURE
Chain rules for smooth min-and max-entropies
DEFF Research Database (Denmark)
Vitanov, Alexande; Dupont-Dupuis, Fréderic; Tomamichel, Marco
2013-01-01
The chain rule for the Shannon and von Neumann en- tropy, which relates the total entropy of a system to the entropies of its parts, is of central importance to information theory. Here, we consider the chain rule for the more general smooth min- and max-entropies, used in one-shot in formation...... theory. For these en- tropy measures, the chain rule no longer holds as an equality. How- ever, the standard chain rule for the von Neum ann entropy is re- trieved asymptotically when evaluating the smooth entropies for many identical and independently distributed states....
NiMax system for hadronic event generators in HEP
International Nuclear Information System (INIS)
Amelin, N.S.; Komogorov, M.E.
2001-01-01
We have suggested a new approach to the development and use of Monte Carlo event generators in high-energy physics (HEP). It is a component approach, when a complex numerical model is composed of standard components. Our approach opens a way to organize a library of HEP model components and provides a great flexibility for the construction of very powerful and realistic numerical models. To support this approach we have designed the NiMax software system (framework) written in C++
Numerical Analysis of Strongly Nonlinear Oscillation Systems using He's Max-Min Method
DEFF Research Database (Denmark)
Babazadeh, H; Domairry, G; Barari, Amin
2011-01-01
Nonlinear functions are crucial points and terms in engineering problems. Actual and physical problems can be solved by solving and processing such functions. Thus, most scientists and engineers focus on solving these equations. This paper presents a novel method called the max-min method...
International Nuclear Information System (INIS)
Cavallo, A.; Hsuan, H.; Boyd, D.; Grek, B.; Johnson, D.; Kritz, A.; Mikkelsen, D.; LeBlanc, B.; Takahashi, H.
1984-10-01
During first harmonic electron cyclotron heating (ECH) on the Princeton Divertor Experiment (PDX) (R 0 = 137 cm, a = 40 cm), electron temperature was monitored using a grating polychromator which measured second harmonic electron cyclotron emission from the low field side of the tokamak. Interference from the high power heating pulse on the broadband detectors in the grating instrument was eliminated by using a waveguide filter in the transmission line which brought the emission signal to the grating instrument. Off-axis (approx. 4 cm) location of the resonance zone resulted in heating without sawtooth or m = 1 activity. However, heating with the resonance zone at the plasma center caused very large amplitude sawteeth accompanied by strong m = 1 activity: ΔT/T/sub MAX/ approx. = 0.41, sawtooth period approx. = 4 msec, m = 1 period approx. = 90 μ sec, (11 kHz). This is the first time such intense MHD activity driven by ECH has been observed. (For both cases there was no sawtooth activity in the ohmic phase of the discharge before ECH.) At very low densities there is a clear indication that a superthermal electron population is created during ECH
Wu, Ming-Yan; He, Lan; Chen, Jia-Li; Dong, Guang; Cheng, Wu-Xue
2017-11-01
Research on predictive distribution and planting GAP of Cyathula officinalis in China is helpful to provide scientific basis for its protection and planting popularization. According to the data in 63 distribution sites and 49 ecological variables, using MaxEnt ecological niche model and 3S technology, we performed a quantitative analysis of suitable distribution and planting GAP of C. officinalis in China. Our results show that: ① the area of suitable distribution of C. officinalis is about 634 385.80 km² in total, and mainly in Northeastern and Southeastern Sichuan, Northern and Southeastern Yunnan, Western and Southwestern Guizhou, Southwestern and Northeastern Chongqing, Southwestern Shaanxi, Southeastern Gansu, Western Guangxi, Southeastern Tibet. ② The main ecological factors determining the potential distribution are precipitation, altitude, minimum temperature of coldest month, soil type, monthly mean temperature. ③ The planting GAP region are mainly in Guangyuan, Mianyang, Ya'an, Leshan, Liangshan, Panzhihua of Sichuan province, Hanzhong of Shaanxi province, Dali, Nujiang, Chuxiong, Baoshan, Qujing, Wenshan of Yunnan province, southwestern autonomous prefecture in Guizhou province. The results are of great significance for realizing the growth environment, predicting the potential distribution and promoting planting popularization for C. officinalis. Copyright© by the Chinese Pharmaceutical Association.
A alquimia em "Uma semana de bondade" de Max Ernst
Directory of Open Access Journals (Sweden)
Bernadette Lyra
1994-12-01
Full Text Available Neste trabalho, a minha tentativa de estabelecer liames intertextuais entre Uma Semana de Bondade ou Os Sete Elementos Capitais -livro de colagens de Max Ernst - e os procedimentos alquimícos parte de estudos sobre a intertextualidade, tal como esse processo se encaixa no espaço semiótico, tomado este último como " um mecanismo único (senão como um organismo"(LOTMAN, 1991, p. 5.
International Nuclear Information System (INIS)
Oh, J H; Han, M; Baek, Y H; Moon, S W; Rhee, J K; Kim, S D
2009-01-01
Effects of the Si 3 N 4 passivation on the dc and RF characteristics of a 0.1 µm metamorphic high-electron-mobility transistor (HEMT) are investigated for narrow and wide gate-recess structures. Maximum drain-source saturation current (I dss,max ) and maximum extrinsic transconductance (g m,max ) are reduced by ∼14.8 and ∼11.6%, respectively, in the wide gate-recess structure after the passivation; on the other hand, only ∼5.7 and ∼4.9% reductions are measured from I dss,max and g m,max , respectively, in the narrow gate-recess structure. We examine the passivation-induced degradation by using a modified charge control model assuming the charged surface states on the Si 3 N 4 interface and a comparative study of the hydrodynamic device simulation with the experimental measurement. From the analysis, it is proposed that the difference of degradation in two different gate structures is due to an approximately three times higher charged surface state density of ∼4.5 × 10 11 cm −2 in the wide gate-recess structure than ∼1.6 × 10 11 cm −2 in the narrow gate-recess structure. The cut-off frequency (f T ) of the wide gate-recess structure also exhibits a greater reduction of ∼14.5%, while the f T of the narrow gate-recess structure is reduced by only ∼6.6% after the passivation. This is mainly due to the passivation-induced surface states of a higher density in the wide gate-recess structure. A great increase of the gate-to-drain parasitic capacitance in the wide gate-recess structure makes a major contribution to ∼13.5% degradation of the maximum frequency of oscillation
Game Art Complete All-in-One; Learn Maya, 3ds Max, ZBrush, and Photoshop Winning Techniques
Gahan, Andrew
2008-01-01
A compilation of key chapters from the top Focal game art books available today - in the areas of Max, Maya, Photoshop, and ZBrush. The chapters provide the CG Artist with an excellent sampling of essential techniques that every 3D artist needs to create stunning game art. Game artists will be able to master the modeling, rendering, rigging, and texturing techniques they need - with advice from Focal's best and brightest authors. Artists can learn hundreds of tips, tricks and shortcuts in Max, Maya, Photoshop, ZBrush - all within the covers of one complete, inspiring reference
Using Max-Plus Algebra for the Evaluation of Stochastic Process Algebra Prefixes
Cloth, L.; de Alfaro, L.; Gilmore, S.; Bohnenkamp, H.C.; Haverkort, Boudewijn R.H.M.
2001-01-01
In this paper, the concept of complete finite prefixes for process algebra expressions is extended to stochastic models. Events are supposed to happen after a delay that is determined by random variables assigned to the preceding conditions. Max-plus algebra expressions are shown to provide an
[A failed experiment - Carl Friedrich von Weizsäcker, Jürgen Habermas and the Max-Planck Society].
Leendertz, Ariane
2014-01-01
From 1970 to 1980 Carl Friedrich von Weizsäcker headed the Max-Planck-lnstitut zur Erforschung der Lebensbedingungen der wissenschaftlich-technischen Welt (MPI for the study of the living conditions of the world of science and technology) in Starnberg, jointly with Jürgen Habermas since 1971. From the start, the Max Planck Society regarded the new institute as an experiment that might perhaps be aborted a few years later. This is exactly what happened. With the retirement of Weizsäcker, his section was closed and the whole institute was renamed. In 1981. Habermas resigned, and then the institute was closed. This paper focusses on some of the problem constellations within the institute that partly explain its development and eventual closure: its birth out of the idea of scientific policy advice, the debates within the Max Planck Society and the complex relationship between Weizsäcker and Jürgen Habermas.
Effects of chronic nitric oxide synthase inhibition on V'O2max and exercise capacity in mice.
Wojewoda, M; Przyborowski, K; Sitek, B; Zakrzewska, A; Mateuszuk, L; Zoladz, J A; Chlopicki, S
2017-03-01
Acute inhibition of NOS by L-NAME (N ω -nitro-L-arginine methyl ester) is known to decrease maximal oxygen consumption (V'O 2max ) and impair maximal exercise capacity, whereas the effects of chronic L-NAME treatment on V'O 2max and exercise performance have not been studied so far. In this study, we analysed the effect of L-NAME treatment, (LN2 and LN12, respectively) on V'O 2max and exercise capacity (in maximal incremental running and prolonged sub-maximal incremental running tests), systemic NO bioavailability (plasma nitrite (NO 2 - ) and nitrate (NO 3 - )) and prostacyclin (PGI 2 ) production in C57BL6/J mice. Mice treated with L-NAME for 2 weeks (LN2) displayed higher V'O 2max and better running capacity than age-matched control mice. In LN2 mice, NO bioavailability was preserved, as evidenced by maintained NO 2 - plasma concentration. PGI 2 production was activated (increased 6-keto-PGF 1α plasma concentration) and the number of circulating erythrocytes (RBC) and haemoglobin concentration were increased. In mice treated with L-NAME for 12 weeks (LN12), NO bioavailability was decreased (lower NO 2 - plasma concentration), and 6-keto-PGF 1α plasma concentration and RBC number were not elevated compared to age-matched control mice. However, LN12 mice still performed better during the maximal incremental running test despite having lower V'O 2max . Interestingly, the LN12 mice showed poorer running capacity during the prolonged sub-maximal incremental running test. To conclude, short-term (2 weeks) but not long-term (12 weeks) treatment with L-NAME activated robust compensatory mechanisms involving preservation of NO2- plasma concentration, overproduction of PGI 2 and increased number of RBCs, which might explain the fully preserved exercise capacity despite the inhibition of NOS.
Energy Technology Data Exchange (ETDEWEB)
Olivero, J.; Toxopeus, A.G.; Skidmore, A.K.; Real, R.
2016-07-01
Statistical downscaling is used to improve the knowledge of spatial distributions from broad–scale to fine–scale maps with higher potential for conservation planning. We assessed the effectiveness of downscaling in two commonly used species distribution models: Maximum Entropy (MaxEnt) and the Favourability Function (FF). We used atlas data (10 x 10 km) of the fire salamander Salamandra salamandra distribution in southern Spain to derive models at a 1 x 1 km resolution. Downscaled models were assessed using an independent dataset of the species’ distribution at 1 x 1 km. The Favourability model showed better downscaling performance than the MaxEnt model, and the models that were based on linear combinations of environmental variables performed better than models allowing higher flexibility. The Favourability model minimized model overfitting compared to the MaxEnt model. (Author)
Wier, Larry T.; Jackson, Allen W.; Jackson, Andrew S.
2009-01-01
The physical activity guidelines (PAG) established by the US Dept. of Health and Human Services in 2008 is consistent with a rating of >/= 6 on the 11-point NASA Physical Activity Status Scale (PASS). Wier, et. al. developed non-exercise models for estimating VO2(sub max) from a combination of PASS, age, gender and either waist girth (WG) (R = 0.810, SEE= 4.799 ml/kg/min), %Fat (R = 0. 817, SEE = 4.716 ml/kg/min) or BMI (R = 0.802, SEE = 4.900 ml . kg-1. min -1 ). PURPOSE: to develop non-exercise models to estimate VO2max from age, gender, body composition (WG, %Fat, BMI) and PASS dichotomized at meets or does not meet the PAG (PAG-PASS), and to compare the accuracy of the PAG-PASS models with the models using the 11-point PASS. METHODS: 2417 men and 384 women were measured for VO2max by indirect calorimetry (RER >1.1); age (yr), gender by M = 1, W = 0; WG at the umbilicus; %fat by skin-folds, BMI by weight (kg) divided by height squared (m 2 ) , and PAGPASS by PASS 6 = 1. RESULTS: Three models were developed by multiple regression to estimate VO2(sub max) from age, gender, PAG-PASS and either WG (R = 0.790, SEE=5.019 ml/kg/min), %FAT (R= 0.080, SEE = 4.915 ml/kg/min) or BMI (R = 0.777, SEE = 5.162ml/kg/min). Cross-validation by the PRESS technique confirmed these statistics. Simple correlations between measured VO2(sub max) and estimates from the PAG-PASS models with WG, %Fat and BMI were 0.790, 0.800 and 0.777, minimally different from the correlations obtained with the PASS models (0.810, 0.810, and 0.802). PAG-PASS and PASS model constant errors were also similar: 1 ml/kg/min for VO2(sub max) 50 ml/kg/min. CONCLUSIONS: Non-exercise models using the combined effects of age, gender, body composition and the dichotomized PAG-PASS provide estimates of VO2(sub max) that are accurate for most adults, and the accuracy of these models are similar to previously published models using the 11-point PASS.
[Max Weber. Poliitika kui elukutse ja kutsumus. Teadus kui elukutse ja kutsumus] / Hermo Kuusk
Kuusk, Hermo, 1976-
2011-01-01
Tutvustus: Weber, Max. Poliitika kui elukutse ja kutsumus ; Teadus kui elukutse ja kutsumus / tõlkijad: Jaan Isotamm, Henn Käärik, Kaia Sisask. Tallinn : TLU Press, 2010. (Bibliotheca controversiarum)
A new stage of nuclear electronics-particle electronics
International Nuclear Information System (INIS)
Xi Deming
1987-01-01
The rapid development of high energy physics experiments has pushed the nuclear electronics to a new stage, i.e. the particle electronics. In this paper the background, main features and recent trends of the particle electronics are expounded
[Max Hirsch founder of rheumatology in Germany: banished and murdered].
Keitel, W
2014-08-01
The Jewish physician and scientist Dr. Max Hirsch (1875-1941) made a substantial contribution to consolidation of the foundations of his professional discipline, balneology, and in particular developed the social aspects. He recognized the economic significance of diseases of the musculoskeletal system very early on and gathered important ideas from abroad. Together with the department head in the Prussian Ministry of Education and Cultural Affairs, the Privy Councillor Prof. Dr. Eduard Dietrich and later alone, he was editor of various balneological journals. He worked as general secretary of the Deutsche Gesellschaft für Rheumatologie (German Society of Rheumatology) from the beginning of its existence (1927) and created the publication series Veröffentlichungen der Deutschen Gesellschaft für Rheumabekämpfung (Publications of the German Society against Rheumatism) and Rheuma-Jahrbuch (Annual review of rheumatology) in 1929, 1930 and 1931 and organized seven rheumatology congresses up to 1933. After the accession to power of the National Socialists, Max Hirsch and Eduard Dietrich were deposed from office. Hirsch emigrated to Latvia via Switzerland and the Soviet Union with his wife and one son where they were murdered in the course of the Jewish pogrom. The second son escaped with his family to Sweden.
Yuwono, T
2014-01-01
The development of telecommunicationtechnology and services is very rapid. One oftelecommunication technology that is beingdeveloped is WiMax (Worldwide Interoperabilityfor Microwave Access). The advantages of WiMaxis it possess much range and can operate in non -LOS conditions. So it fits implemented inIndonesia to accelerate the internet penetration.Some features of WiMax technology is higherbandwidth and further range/area. SNRImprovement is The effort to increase the rangeand improve the ...
Dietary fish oil (MaxEPA) enhances pancreatic carcinogenesis in azaserine-treated rats
Appel, M.J.; Woutersen, R.A.
1996-01-01
In the present study the putative chemopreventive effect of dietary fish oil (MaxEPA) on azaserine-induced pancreatic carcinogenesis in rats was investigated. Groups of rats were maintained on a semipurified low-fat (LF; 5 wt%) diet or on semipurified high-fat (HF; 25 wt%) diets containing 5 wt%
Premarket evaluations of the IMDx C. difficile for Abbott m2000 Assay and the BD Max Cdiff Assay.
Stellrecht, K A; Espino, A A; Maceira, V P; Nattanmai, S M; Butt, S A; Wroblewski, D; Hannett, G E; Musser, K A
2014-05-01
Clostridium difficile-associated diarrhea is a well-recognized complication of antibiotic use. Historically, diagnosing C. difficile has been difficult, as antigen assays are insensitive and culture-based methods require several days to yield results. Nucleic acid amplification tests (NAATs) are quickly becoming the standard of care. We compared the performance of two automated investigational/research use only (IUO/RUO) NAATs for the detection of C. difficile toxin genes, the IMDx C. difficile for Abbott m2000 Assay (IMDx) and the BD Max Cdiff Assay (Max). A prospective analysis of 111 stool specimens received in the laboratory for C. difficile testing by the laboratory's test of record (TOR), the BD GeneOhm Cdiff Assay, and a retrospective analysis of 88 specimens previously determined to be positive for C. difficile were included in the study. One prospective specimen was excluded due to loss to follow-up discrepancy analysis. Of the remaining 198 specimens, 90 were positive by all three methods, 9 were positive by TOR and Max, and 3 were positive by TOR only. One negative specimen was initially inhibitory by Max. The remaining 95 specimens were negative by all methods. Toxigenic C. difficile culture was performed on the 12 discrepant samples. True C. difficile-positive status was defined as either positive by all three amplification assays or positive by toxigenic culture. Based on this definition, the sensitivity and specificity were 96.9% and 95% for Max and 92.8% and 100% for IMDx. In summary, both highly automated systems demonstrated excellent performance, and each has individual benefits, which will ensure that they will both have a niche in clinical laboratories.
Directory of Open Access Journals (Sweden)
I. Iskandar
2014-11-01
Full Text Available Deploying WiMAX through High Altitude Platform Station (HAPS system is a new means of wireless delivery method and thus attracting much the attention in a telecommunication society. However delivering WiMAX through the terrestrial network has already been started a few years ago. Therefore, we need to look at the scenario of coexistence system both of HAPS and terrestrial in delivering WiMAX services. This paper evaluates the performance of coexistence system between cellular HAPS and terrestrial for the downlink scenario when they are transmitting WiMAX mobile 802.16e services. Our evaluation is based on the performance simulation of coexistence model using two methods. First method is a footprint exchange between the two systems.The second method is a combination of footprint exchange and HAPS footprint enhancement. The proposed methodsare then evaluated by computer simulation in terms of carrier to interference plus noise ratio (CINR performance. In general, both methods resulting performance enhancement in CINR quality compared with coexistence deployment with normal scenario of the cell configuration used by HAPS and terrestrial. The method of combining footprint exchange and HAPS footprint enhancement is able to improve CINR more than 10 dB compared with the normal footprint configuration for all users location inside the coverage.
Taking Your iPhoto '11 to the Max
Grothaus, Michael
2011-01-01
Taking Your iPhoto '11 to the Max walks users through Apple's most popular software application in the iLife suite - iPhoto. This book helps readers use iPhoto to its fullest to organize and create digital memories and keepsakes. * Learn all about Apple's newest version of iPhoto - iPhoto '11 * Explore iPhoto, one menu button at a time * Walk-through tutorials guide you step-by-step What you'll learn * How to import existing photo libraries from popular Windows applications * How to organize and edit your photos * How to tag your photos using iPhoto's Faces and Places features * How to create
Directory of Open Access Journals (Sweden)
Olivero, J.
2016-03-01
Full Text Available Statistical downscaling is used to improve the knowledge of spatial distributions from broad–scale to fine–scale maps with higher potential for conservation planning. We assessed the effectiveness of downscaling in two commonly used species distribution models: Maximum Entropy (MaxEnt and the Favourability Function (FF. We used atlas data (10 x 10 km of the fire salamander Salamandra salamandra distribution in southern Spain to derive models at a 1 x 1 km resolution. Downscaled models were assessed using an independent dataset of the species’ distribution at 1 x 1 km. The Favourability model showed better downscaling performance than the MaxEnt model, and the models that were based on linear combinations of environmental variables performed better than models allowing higher flexibility. The Favourability model minimized model overfitting compared to the MaxEnt model.
International Nuclear Information System (INIS)
Rehman, A.; Hamid, N.; Jawaid, F.
2010-01-01
Seeds of Glycine max (soybean) were inoculated with N-fixing bacterium Bradyrhizobium japonicum and grown in growth chamber to investigate interactive effects of atmospheric CO/sub 2/ and plants Nitrogen status on root and shoot length and biomass, nodule formation and Nitrogen concentration. Plants were grown with CO/sub 2/ at 3500 and 1000 ppm with or without Bradyrhizobium japonicum inoculation. Root and shoot length and dry mass of Glycine max increased significantly with CO/sub 2/ enrichment provided with Bradyrhizobium japonicum as compared to deficient Nitrogen fixing bacterium. While ambient and enriched CO/sub 2/ levels resulted in increased Nitrogen concentration of Glycine max shoot and root which is inoculated with N-fixing bacterium. Nodule formation was also enhanced in plants supplied with Bradyrhizobium japonicum as compared to plants which is Bradyrhizobium japonicum deficient at both CO/sub 2/ concentrations. (author)
Gamma radiation effect on the anatomical structure of soybean (Glycine max. Merr)
International Nuclear Information System (INIS)
Bhikuningputra, W.
1976-01-01
Gamma radiation effects on soybean plant (Glycine max. Merr) have been studied by using radiation doses of 0, 20, 25, 30, and 35 Krad. Investigation is carried out after each treatment. It proves that each treatment causes different morphological changes on leaves, stems, roots, and fibres of the treated plants. (SMN)
Kalberg, Stephen
1980-01-01
Explores rationality in Max Weber's works and identifies four types of rationality which play major roles in his writing--practical, theoretical, substantive, and formal. Implications for society and education are discussed. (DB)
3ds Max design architectural visualization for intermediate users
Smith, Brian L
2012-01-01
Learn time-saving techniques and tested production-ready tips for maximum speed and efficiency in creating professional-level architectural visualizations in 3ds Max. Move from intermediate to an advanced level with specific and comprehensive instruction with this collaboration from nine different authors from around the world. Get their experience and skills in this full-color book, which not only teaches more advanced features, but also demonstrates the practical applications of those features to get readers ready for a real production environment. Fully updated for the most recent version o
International Nuclear Information System (INIS)
Farhataziz, M.
1984-01-01
A recent theoretical treatment of the absorption spectrum of the solvated electron, e - sub(s), maintains that rigorously μ 0 >= -0.75 Esub(av), which gives empirical relationship, μ 0 >= -(0.93 +- 0.02)Esub(max). For e - sub(s) in a particular solvent at a temperature and pressure, μ 0 , Esub(av) and Esub(max) are standard chemical potential, average energy of the absorption spectrum and the energy at the absorption maximum respectively. The temperature and pressure effects on the absorption spectrum of e - sub(s) in water and liquid ammonia do not support the equality sign in the above cited relationships. The implications of inequality expressed above are discussed for e - sub(s) in water and liquid ammonia. (author)
Max Phase Materials And Coatings For High Temperature Heat Transfer Applications
Energy Technology Data Exchange (ETDEWEB)
Martinez-Rodriguez, M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Garcia-Diaz, B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Olson, L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Fuentes, R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Sindelar, R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2015-10-19
Molten salts have been used as heat transfer fluids in a variety of applications within proposed Gen IV nuclear designs and in advanced power system such as Concentrating Solar Power (CSP). However, operating at elevated temperatures can cause corrosion in many materials. This work developed coating technologies for MAX phase materials on Haynes-230 and characterized the corrosion of the coatings in the presence of commercial MgCl2-KCl molten salt. Cold spraying of Ti2AlC and physical vapor deposition (PVD) of Ti2AlC or Zr2AlC were tested to determine the most effective form of coating MAX phases on structural substrates. Corrosion testing at 850°C for 100 hrs showed that 3.9 μm Ti2AlC by PVD was slightly protective while 117 μm Ti2AlC by cold spray and 3.6 μm Zr2AlC by PVD were completely protective. None of the tests showed decomposition of the coating (Ti or Zr) into the salt
Miniature Variable Pressure Scanning Electron Microscope for In-Situ Imaging and Chemical Analysis
Gaskin, Jessica A.; Jerman, Gregory; Gregory, Don; Sampson, Allen R.
2012-01-01
NASA Marshall Space Flight Center (MSFC) is leading an effort to develop a Miniaturized Variable Pressure Scanning Electron Microscope (MVP-SEM) for in-situ imaging and chemical analysis of uncoated samples. This instrument development will be geared towards operation on Mars and builds on a previous MSFC design of a mini-SEM for the moon (funded through the NASA Planetary Instrument Definition and Development Program). Because Mars has a dramatically different environment than the moon, modifications to the MSFC lunar mini-SEM are necessary. Mainly, the higher atmospheric pressure calls for the use of an electron gun that can operate at High Vacuum, rather than Ultra-High Vacuum. The presence of a CO2-rich atmosphere also allows for the incorporation of a variable pressure system that enables the in-situ analysis of nonconductive geological specimens. Preliminary testing of Mars meteorites in a commercial Environmental SEM(Tradmark) (FEI) confirms the usefulness of lowcurrent/low-accelerating voltage imaging and highlights the advantages of using the Mars atmosphere for environmental imaging. The unique capabilities of the MVP-SEM make it an ideal tool for pursuing key scientific goals of NASA's Flagship Mission Max-C; to perform in-situ science and collect and cache samples in preparation for sample return from Mars.
Directory of Open Access Journals (Sweden)
Sungyul Chang
Full Text Available Soybean (Glycine max L. Mer., like many cultivated crops, has a relatively narrow genetic base and lacks diversity for some economically important traits. Glycine latifolia (Benth. Newell & Hymowitz, one of the 26 perennial wild Glycine species related to soybean in the subgenus Glycine Willd., shows high levels of resistance to multiple soybean pathogens and pests including Alfalfa mosaic virus, Heterodera glycines Ichinohe and Sclerotinia sclerotiorum (Lib. de Bary. However, limited information is available on the genomes of these perennial Glycine species. To generate molecular resources for gene mapping and identification, high-density linkage maps were constructed for G. latifolia using single nucleotide polymorphism (SNP markers generated by genotyping by sequencing and evaluated in an F2 population and confirmed in an F5 population. In each population, greater than 2,300 SNP markers were selected for analysis and segregated to form 20 large linkage groups. Marker orders were similar in the F2 and F5 populations. The relationships between G. latifolia linkage groups and G. max and common bean (Phaseolus vulgaris L. chromosomes were examined by aligning SNP-containing sequences from G. latifolia to the genome sequences of G. max and P. vulgaris. Twelve of the 20 G. latifolia linkage groups were nearly collinear with G. max chromosomes. The remaining eight G. latifolia linkage groups appeared to be products of multiple interchromosomal translocations relative to G. max. Large syntenic blocks also were observed between G. latifolia and P. vulgaris. These experiments are the first to compare genome organizations among annual and perennial Glycine species and common bean. The development of molecular resources for species closely related to G. max provides information into the evolution of genomes within the genus Glycine and tools to identify genes within perennial wild relatives of cultivated soybean that could be beneficial to soybean
Max Aub revisitado: Lugares en (torno a La gallina ciega
Directory of Open Access Journals (Sweden)
Federico Gerhardt
2006-11-01
Full Text Available In La gallina ciega, Max Aub recollects and re-elaborates impressions (of his own and of others caused by his returning to Spain in 1969, after thirty years of exile in Mexico. This article analyses some of the manifestations of the dynamic relation between memory and literature, within La gallina ciega (in Aub's trips through the peninsular geography and also in the (rereadings of Aub's work, that show its position in the Spanish modern canon.
O historiador Max Weber: indologia e historicismo na obra weberiana
Directory of Open Access Journals (Sweden)
Arilson Silva de Oliveira
2010-06-01
Full Text Available Max Weber assumed the methodological requirements of German historicism against all natural illuminist philosophy and all the idealistic philosophy of history. He improved them in order to prevent the conclusions of the romanticism and the psychological deviations of the neo-historicism. Here, we observe how he equipped himself with a particular method, rescued rationality and applied it as a parameter to historically understand Indian society in opposition to the disenchanted historicism of his time.
Running Performance, VO2max, and Running Economy: The Widespread Issue of Endogenous Selection Bias.
Borgen, Nicolai T
2018-05-01
Studies in sport and exercise medicine routinely use samples of highly trained individuals in order to understand what characterizes elite endurance performance, such as running economy and maximal oxygen uptake VO 2max . However, it is not well understood in the literature that using such samples most certainly leads to biased findings and accordingly potentially erroneous conclusions because of endogenous selection bias. In this paper, I review the current literature on running economy and VO 2max , and discuss the literature in light of endogenous selection bias. I demonstrate that the results in a large part of the literature may be misleading, and provide some practical suggestions as to how future studies may alleviate endogenous selection bias.
Evaluation of the coagulometer STA R Max® (Stago) for routine coagulation parameters.
Brulé, Justine; Sinegre, Thomas; Pereira, Bruno; Berger, Marc G; Serre-Sapin, Anne-Françoise; Lebreton, Aurélien
2018-04-01
The STA R Max ® is a fully automated multiparameter coagulometer using clotting (viscosity-based detection system), chromogenic and immunologic assays. STA R Max ® is equipped with an innovative software (STA Coag Expert ® ) designed to assist laboratory in accreditation. The aim of this study was to evaluate its performances for the certification according to ISO 15189 quality standard in the haemostasis unit of our university hospital. The following tests were evaluated: prothrombin time (PT), activated partial thromboplastin time (aPTT), kaolin cephalin clotting time (KCCT), fibrinogen, anti-Xa assay and D-dimers. In normal and pathological range, the intra-assay coefficients of variation (CV) for PT, aPTT, KCCT and fibrinogen were below 4.0%. Intra-assay CV was of 4.0% for the anti-Xa assay and intra-assay CV was of 7.9% for D-dimers. Inter-assay CV were below 5.0% for PT, aPPT, KCCT and fibrinogen, 14.9% for anti-Xa assay and 8.6% for D-dimers. The interlaboratory comparisons were below 8.7% for PT, aPPT and KCCT, 5.0% for fibrinogen and 15.5% for anti-Xa assay. All results were acceptable according to suitable CV established by GFHT and the provider. The concordance between all coagulometers was excellent, with correlation coefficient close to 1 (0.99 for all parameters except for aPPT which was 0.98) calculated thanks to an intra-class correlation study. In conclusion, the STA R Max ® analyser is suitable for haemostasis laboratories and facilitates certification of a laboratory.
Directory of Open Access Journals (Sweden)
Magnus F Kaffarnik
Full Text Available To investigate the relationship between the degree of liver dysfunction, quantified by maximal liver function capacity (LiMAx test and endothelin-1, TNF-α and IL-6 in septic surgical patients.28 septic patients (8 female, 20 male, age range 35-80y were prospectively investigated on a surgical intensive care unit. Liver function, defined by LiMAx test, and measurements of plasma levels of endothelin-1, TNF-α and IL-6 were carried out within the first 24 hours after onset of septic symptoms, followed by day 2, 5 and 10. Patients were divided into 2 groups (group A: LiMAx ≥100 μg/kg/h, moderate liver dysfunction; group B: LiMAx <100 μg/kg/h, severe liver dysfunction for analysis and investigated regarding the correlation between endothelin-1 and the severity of liver failure, quantified by LiMAx test.Group B showed significant higher results for endothelin-1 than patients in group A (P = 0.01, d5; 0.02, d10. For TNF-α, group B revealed higher results than group A, with a significant difference on day 10 (P = 0.005. IL-6 showed a non-significant trend to higher results in group B. The Spearman's rank correlation coefficient revealed a significant correlation between LiMAx and endothelin-1 (-0.434; P <0.001, TNF-α (-0.515; P <0.001 and IL-6 (-0.590; P <0.001.Sepsis-related hepatic dysfunction is associated with elevated plasma levels of endothelin-1, TNF-α and IL-6. Low LiMAx results combined with increased endothelin-1 and TNF-α and a favourable correlation between LiMAx and cytokine values support the findings of a crucial role of Endothelin-1 and TNF-α in development of septic liver failure.
A Hybrid Shared-Memory Parallel Max-Tree Algorithm for Extreme Dynamic-Range Images
Moschini, Ugo; Meijster, Arnold; Wilkinson, Michael
Max-trees, or component trees, are graph structures that represent the connected components of an image in a hierarchical way. Nowadays, many application fields rely on images with high-dynamic range or floating point values. Efficient sequential algorithms exist to build trees and compute
Functional and in silico assessment of MAX variants of unknown significance
DEFF Research Database (Denmark)
Comino-Méndez, Iñaki; Leandro-García, Luis J; Montoya, Guillermo
2015-01-01
UNLABELLED: The presence of germline mutations affecting the MYC-associated protein X (MAX) gene has recently been identified as one of the now 11 major genetic predisposition factors for the development of hereditary pheochromocytoma and/or paraganglioma. Little is known regarding how missense v...
77 FR 20445 - eMax Worldwide, Inc.; Order of Suspension of Trading
2012-04-04
... Trading April 2, 2012. It appears to the Securities and Exchange Commission that the public interest and... shareholders of record. eMax Worldwide, Inc. is quoted on OTC Markets Group Inc. under the ticker EMXC. The Commission is of the opinion that the public interest and the protection of investors require a suspension of...
Dual Band Metamaterial Antenna For LTE/Bluetooth/WiMAX System.
Hasan, Md Mehedi; Faruque, Mohammad Rashed Iqbal; Islam, Mohammad Tariqul
2018-01-19
A compact metamaterial inspired antenna operate at LTE, Bluetooth and WiMAX frequency band is introduced in this paper. For the lower band, the design utilizes an outer square metallic strip forcing the patch to radiate as an equivalent magnetic-current loop. For the upper band, another magnetic current loop is created by adding metamaterial structure near the feed line on the patch. The metamaterial inspired antenna dimension of 42 × 32 mm 2 compatible to wireless devices. Finite integration technique based CST Microwave Studio simulator has been used to design and numerical investigation as well as lumped circuit model of the metamaterial antenna is explained with proper mathematical derivation. The achieved measured dual band operation of the conventional antenna are sequentially, 0.561~0.578 GHz, 2.346~2.906 GHz, and 2.91~3.49 GHz, whereas the metamaterial inspired antenna shows dual-band operation from 0.60~0.64 GHz, 2.67~3.40 GHz and 3.61~3.67 GHz, respectively. Therefore, the metamaterial antenna is applicable for LTE and WiMAX applications. Besides, the measured metamaterial antenna gains of 0.15~3.81 dBi and 3.47~3.75 dBi, respectively for the frequency band of 2.67~3.40 GHz and 3.61~3.67 GHz.
Validation of a ramp running protocol for determination of the true VO2max in mice
Directory of Open Access Journals (Sweden)
Mohamed Ayachi
2016-08-01
Full Text Available In the field of comparative physiology, it remains to be established whether the concept of VO2max is valid in the mouse and, if so, how this value can be accurately determined. In humans, VO2max is generally considered to correspond to the plateau observed when VO2 no longer rises with an increase in workload. In contrast, the concept of VO2peak tends to be used in murine studies. The objectives of the present study were to determine whether (i a continuous ramp protocol yielded a higher VO2peak than a stepwise, incremental protocol, and (ii the VO2peak measured in the ramp protocol corresponded to VO2max. The three protocols (based on intensity-controlled treadmill running until exhaustion with eight female FVB/N mice were performed in random order: (a an incremental protocol that begins at 10 m.min-1 speed and increases by 3 m.min-1 every 3 min. (b a ramp protocol with slow acceleration (3 m.min-2, and (c a ramp protocol with fast acceleration (12 m.min-2. Each protocol was performed with two slopes (0° and 25°. Hence, each mouse performed six exercise tests. We found that the value of VO2peak was protocol-dependent (p 8 mmol.l-1 and a respiratory exchange ratio >1. The total duration of the 3 m.min-2 0° ramp protocol was shorter than that of the incremental protocol. Taken as a whole, our results suggest that VO2max in the mouse is best determined by applying a ramp exercise protocol with slow acceleration and no treadmill slope.
International Nuclear Information System (INIS)
Sameshima, R.
1996-01-01
The linear relationship between the amount of absorbed radiation and dry matter production by crop communities has long been known, and the proportionality constant between them is known as the radiation use efficiency (RUE). To analyze and predict crop production using RUE, the assumption is often made that RUE is not sensitive to radiation intensity and that dry matter production rate (DMPR) is a linear function of radiation intensity.However, there is evidence in opposition to this assumption, including reports of increasing RUE in shade tests, and hyperbolic response of photosynthetic rate to radiation intensity. The following model was developed and used to analyze the response of DMPR and RUE to daily radiation R S : DMPR = DMPR max (R S ) * g(α) where DMPR max (R S ) is the DMPR of a hypothetical soybean community absorbing all radiation, and g(α) represents the effect of radiation absorptivity (α). A hyperbolic curve and a straight line were employed for DMPR max (R S ) and g(α), respectively. Field experimental data including shade tests were used to determine the parameters for the model. Two sets of parameters were required to cover the entire experimental period. DMPR max (R S ) had an apparent curvilinear relationship with R S . The model successfully described dry matter production under successive low radiation conditions, which could not be estimated by a model with RUE insensitive to radiation. (author)
MAX-DOAS measurements of NO2, HCHO and CHOCHO at a rural site in Southern China
Li, X.; Brauers, T.; Hofzumahaus, A.; Lu, K.; Li, Y. P.; Shao, M.; Wagner, T.; Wahner, A.
2013-02-01
We performed MAX-DOAS measurements during the PRIDE-PRD2006 campaign in the Pearl River Delta region (PRD), China, for 4 weeks in July 2006 at a site located 60 km north of Guangzhou. The vertical distributions of NO2, HCHO, and CHOCHO were independently retrieved by an automated iteration method. The NO2 mixing ratios measured by MAX-DOAS showed reasonable agreement with the simultaneous, ground based in-situ data. The tropospheric NO2 vertical column densities (VCDs) observed by OMI on board EOS-Aura satellite were higher than with those by MAX-DOAS. The 3-D chemical transport model CMAQ overestimated the NO2 VCDs as well as the surface concentrations by about 65%. From this observation, a reduction of NOx emission strength in CMAQ seems to be necessary in order to well reproduce the NO2 observations. The average mixing ratios of HCHO and CHOCHO were 7 ppb and 0.4 ppb, respectively, higher than in other rural or semirural environments. The high ratio of 0.062 between CHOCHO and HCHO corresponds to the high VOCs reactivity and high HOx turnover rate consistent with other observations during the campaign.
Keitel, Wolfgang; Olsson, Leif; Matteson, Eric L
2016-09-01
To elucidate the connections between balneology and rheumatology in the founding period of the discipline of rheumatology, and describe the contributions of Max Hirsch, MD in the formation of professional rheumatology societies. Historical documents from the medical history collection of Vogelsang-Gommern, Germany, and original personal documents of the Hirsch family and information from the medical and historical period literature were used in developing this report. The first efforts at organizing rheumatology as a recognized clinical and academic discipline took place in the 1920s. Many of the first proponents were balneologists who cared for patients with chronic arthritic conditions without the benefit of effective medications. Max Hirsch, MD was a major figure in the development of modern rheumatology as it emerged from the provenance of balneology and orthopedics as a recognized organized medical discipline, contributing to the founding of the German Society for Rheumatology and the International League Against Rheumatism. Max Hirsch made significant contributions to scientific and organized rheumatology in the early days of the discipline. His contributions to the field and his fate as a Jewish physician have only recently come to light.
Taking Your iPhone 4 to the Max
Sadun, Erica
2010-01-01
Unleash your iPhone and take it to the limit using powerful tips and techniques from tech consultant Steve Sande and gadget hacker Erica Sadun. Fast and fun to read, Taking Your iPhone 4 to the Max shows you how to get the most out of Apple's new iPhone 4. You'll find all the best undocumented tricks as well as the most efficient and enjoyable introduction to the iPhone available. Starting with an introduction to iPhone basics, you'll quickly move on to discover the iPhone's hidden potential, like how to connect to a TV, use Voice Control, have video chats with FaceTime, and call friends overs
Distinct transcriptional profiles of ozone stress in soybean (Glycine max) flowers and pods
Tropospheric ozone (O3) is a secondary air pollutant and anthropogenic greenhouse gas. Concentrations of tropospheric O3 ([O3] have more than doubled since the Industrial Revolution, and are high enough to damage plant productivity. Soybean (Glycine max L. Merr.) is the world's most important legume...
Effects of long-term storage on the quality of soybean, Glycine max ...
African Journals Online (AJOL)
Soybean, Glycine max (L.) Merrill, is one of the five most important legumes in the tropics and provides the protein eaten by most people in the region. One of the major constraints to soybean production is that the seed quality deteriorates rapidly during storage. This study was undertaken to assess the effect of some storage ...
The bumpy road Max Planck from radiation theory to the quantum (1896-1906)
Badino, Massimiliano
2015-01-01
This book examines the different areas of knowledge, traditions, and conceptual resources that contributed to the building of Max Planck’s theory of radiation. It presents an insightful comparative analysis that not only sheds light upon a fundamental chapter in the history of modern physics, but also enlarges our understanding of how theoreticians work. Coverage offers a deep investigation into the technical aspects behind the theory and extends in time the notion of quantum revolution. It also presents a full-fledged discussion of the combinatorial part of Planck’s theory and places emphasis on the epistemological role of mathematical practices. By painstakingly reconstructing both the electromagnetic and the combinatorial part of Planck’s black-body theory, the author shows how some apparently merely technical resources, such as the Fourier series, effectively contributed to shape the final form of Planck’s theory. For decades, historians have debated the conditions of possibility of Max Planck’s...
Dose properties of x-ray beams produced by laser-wakefield-accelerated electrons
International Nuclear Information System (INIS)
Kainz, K K; Hogstrom, K R; Antolak, J A; Almond, P R; Bloch, C D
2005-01-01
Given that laser wakefield acceleration (LWFA) has been demonstrated experimentally to accelerate electron beams to energies beyond 25 MeV, it is reasonable to assess the ability of existing LWFA technology to compete with conventional radiofrequency linear accelerators in producing electron and x-ray beams for external-beam radiotherapy. We present calculations of the dose distributions (off-axis dose profiles and central-axis depth dose) and dose rates of x-ray beams that can be produced from electron beams that are generated using state-of-the-art LWFA. Subsets of an LWFA electron energy distribution were propagated through the treatment head elements (presuming an existing design for an x-ray production target and flattening filter) implemented within the EGSnrc Monte Carlo code. Three x-ray energy configurations (6 MV, 10 MV and 18 MV) were studied, and the energy width ΔE of the electron-beam subsets varied from 0.5 MeV to 12.5 MeV. As ΔE increased from 0.5 MeV to 4.5 MeV, we found that the off-axis and central-axis dose profiles for x-rays were minimally affected (to within about 3%), a result slightly different from prior calculations of electron beams broadened by scattering foils. For ΔE of the order of 12 MeV, the effect on the off-axis profile was of the order of 10%, but the central-axis depth dose was affected by less than 2% for depths in excess of about 5 cm beyond d max . Although increasing ΔE beyond 6.5 MeV increased the dose rate at d max by more than 10 times, the absolute dose rates were about 3 orders of magnitude below those observed for LWFA-based electron beams at comparable energies. For a practical LWFA-based x-ray device, the beam current must be increased by about 4-5 orders of magnitude. (note)
Directory of Open Access Journals (Sweden)
Putut Hargiyarto
2014-10-01
Full Text Available The objectives of this study were to assess the risks involved in workshops, to apply the Seiso, Seiton, Seiri, Seiketsu, Shitsuke (5S concept for workshops development and to develop the fabrication workshop for the Department of Mechanical Engineering Education, Faculty of Engineering, YSU using the 3DS Max simulation application. This study was categorised into Research and Development. The first steps were designing and creating the product using 3DS Max application. The next step was testing the product by implementing it to perform the workshops policy. The results of this study showed the risks consisted of noise, strong light, harmful gases and the mechanical hazards due to falling and moving objects. The implementation of 5S concept, K3 and ergonomics were required to maintain the regularity, efficiency and work discipline, to prevent and to minimize workplace accidents. The development of fabrication workshops using the 3DS Max simulation applicationis is beneficial for implementing the aspects of 5S, K3, ergonomics and provides a reference in redesigning a workshop.
Energy Technology Data Exchange (ETDEWEB)
Huber, D.; Bedding, T. R.; Stello, D. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Hekker, S. [Astronomical Institute ' Anton Pannekoek' , University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Mathur, S. [High Altitude Observatory, NCAR, P.O. Box 3000, Boulder, CO 80307 (United States); Mosser, B. [LESIA, CNRS, Universite Pierre et Marie Curie, Universite Denis, Diderot, Observatoire de Paris, 92195 Meudon cedex (France); Verner, G. A.; Elsworth, Y. P.; Hale, S. J.; Chaplin, W. J. [School of Physics and Astronomy, University of Birmingham, Birmingham B15 2TT (United Kingdom); Bonanno, A. [INAF Osservatorio Astrofisico di Catania (Italy); Buzasi, D. L. [Eureka Scientific, 2452 Delmer Street Suite 100, Oakland, CA 94602-3017 (United States); Campante, T. L. [Centro de Astrofisica da Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Kallinger, T. [Department of Physics and Astronomy, University of British Columbia, Vancouver (Canada); Silva Aguirre, V. [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Str. 1, 85748 Garching (Germany); De Ridder, J. [Instituut voor Sterrenkunde, K.U.Leuven (Belgium); Garcia, R. A. [Laboratoire AIM, CEA/DSM-CNRS, Universite Paris 7 Diderot, IRFU/SAp, Centre de Saclay, 91191, Gif-sur-Yvette (France); Appourchaux, T. [Institut d' Astrophysique Spatiale, UMR 8617, Universite Paris Sud, 91405 Orsay Cedex (France); Frandsen, S. [Danish AsteroSeismology Centre (DASC), Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Houdek, G., E-mail: dhuber@physics.usyd.edu.au [Institute of Astronomy, University of Vienna, 1180 Vienna (Austria); and others
2011-12-20
We have analyzed solar-like oscillations in {approx}1700 stars observed by the Kepler Mission, spanning from the main sequence to the red clump. Using evolutionary models, we test asteroseismic scaling relations for the frequency of maximum power ({nu}{sub max}), the large frequency separation ({Delta}{nu}), and oscillation amplitudes. We show that the difference of the {Delta}{nu}-{nu}{sub max} relation for unevolved and evolved stars can be explained by different distributions in effective temperature and stellar mass, in agreement with what is expected from scaling relations. For oscillation amplitudes, we show that neither (L/M){sup s} scaling nor the revised scaling relation by Kjeldsen and Bedding is accurate for red-giant stars, and demonstrate that a revised scaling relation with a separate luminosity-mass dependence can be used to calculate amplitudes from the main sequence to red giants to a precision of {approx}25%. The residuals show an offset particularly for unevolved stars, suggesting that an additional physical dependency is necessary to fully reproduce the observed amplitudes. We investigate correlations between amplitudes and stellar activity, and find evidence that the effect of amplitude suppression is most pronounced for subgiant stars. Finally, we test the location of the cool edge of the instability strip in the Hertzsprung-Russell diagram using solar-like oscillations and find the detections in the hottest stars compatible with a domain of hybrid stochastically excited and opacity driven pulsation.
International Nuclear Information System (INIS)
Castro, J.J.B. de.
1988-12-01
It is presented an investigation of different phenomena that occur in the gyrotron: 1) generation and transport of helical electron beams, 2) interaction of electrons in cyclotron motion with a transverse electric mode in resonant cavities operating near cutoff and 3) electron deposition over the collector active region. An exact ballistic model, which points out the nonlinear attributes of the relativistic equation of electron cyclotron motion and that includes a complex formulation for the longitudinal electric field distribution in weakly irregular waveguides, is used. Physically realizable RF field profiles are studied with the objective of maximizing gyrotron efficiency. For this purpose, an investigation is made of the resonant properties of truncated cones cavities and a new resonator type, with a profile described in terms of a continuous function, is developed. High perpendicular efficiencies (η perpendicular MAX =0.86) have been calculated for interaction at the fundamental 1 cyclotron harmonic and for uniform external magnetic field. A maximum efficiency scaling parameter S has been introduced, by which scaling relations η perpendicular MAX = η perpendicular MAX (S) are applicable to a variety of field profiles. The conceptual design of a 35 GHz gyrotron gives emphasis to selection criteria of operating parameters in compliance with technical constraints and with the requirement of soft self-excited oscillations. The proposed gyrotron operates in the azimuthally symetrical mode TE 021 and is able to produce, with an electronic efficiency of 40%, an output power of 100 kW, in pulses of 20 ms, with a duty factor of 0.04%. (author) [pt
CSIR Research Space (South Africa)
Leenen, L
2007-12-01
Full Text Available The authors present a variant of the Weighted Maximum Satisfiability Problem (Weighted Max-SAT), which is a modeling of the Semiring Constraint Satisfaction framework. They show how to encode a Semiring Constraint Satisfaction Problem (SCSP...
[Establishment of database with standard 3D tooth crowns based on 3DS MAX].
Cheng, Xiaosheng; An, Tao; Liao, Wenhe; Dai, Ning; Yu, Qing; Lu, Peijun
2009-08-01
The database with standard 3D tooth crowns has laid the groundwork for dental CAD/CAM system. In this paper, we design the standard tooth crowns in 3DS MAX 9.0 and create a database with these models successfully. Firstly, some key lines are collected from standard tooth pictures. Then we use 3DS MAX 9.0 to design the digital tooth model based on these lines. During the design process, it is important to refer to the standard plaster tooth model. After some tests, the standard tooth models designed with this method are accurate and adaptable; furthermore, it is very easy to perform some operations on the models such as deforming and translating. This method provides a new idea to build the database with standard 3D tooth crowns and a basis for dental CAD/CAM system.
Diffusion of Ag, Au and Cs implants in MAX phase Ti3SiC2
Energy Technology Data Exchange (ETDEWEB)
Jiang, Weilin; Henager, Charles H.; Varga, Tamas; Jung, Hee Joon; Overman, Nicole R.; Zhang, Chonghong; Gou, Jie
2015-05-16
MAX phases (M: early transition metal; A: elements in group 13 or 14; X: C or N), such as titanium silicon carbide (Ti3SiC2), have a unique combination of both metallic and ceramic properties, which make them attractive for potential nuclear applications. Ti3SiC2 has been considered as a possible fuel cladding material. This study reports on the diffusivities of fission product surrogates (Ag and Cs) and a noble metal Au (with diffusion behavior similar to Ag) in this ternary compound at elevated temperatures, as well as in dual-phase nanocomposite of Ti3SiC2/3C-SiC and polycrystalline CVD 3C-SiC for behavior comparisons. Samples were implanted with Ag, Au or Cs ions and characterized with various methods, including x-ray diffraction, electron backscatter diffraction, energy dispersive x-ray spectroscopy, Rutherford backscattering spectrometry, helium ion microscopy, and transmission electron microscopy. The results show that in contrast to immobile Ag in 3C-SiC, there is a significant outward diffusion of Ag in Ti3SiC2 within the dual-phase nanocomposite during Ag ion implantation at 873 K. Similar behavior of Au in polycrystalline Ti3SiC2 was also observed. Cs out-diffusion and release from Ti3SiC2 occurred during post-implantation thermal annealing at 973 K. This study suggests caution and further studies in consideration of Ti3SiC2 as a fuel cladding material for advanced nuclear reactors operating at very high temperatures.
Measuring main-ion temperatures in ASDEX upgrade using scattering of ECRH radiation
DEFF Research Database (Denmark)
Pedersen, Morten Stejner; Nielsen, Stefan Kragh; Jacobsen, Asger Schou
2016-01-01
We demonstrate that collective Thomson scattering of millimeter wave electron cyclotron resonance heating radiation can be used for measurements of the main-ion temperature in the ASDEX Upgrade tokamak.......We demonstrate that collective Thomson scattering of millimeter wave electron cyclotron resonance heating radiation can be used for measurements of the main-ion temperature in the ASDEX Upgrade tokamak....
Fast Beam-ion Instabilities in CLIC Main Linac Vacuum Specifications
Oeftiger, Adrian
2011-01-01
Specifications for the vacuum pressure in the CLIC electron Main Linac are determined by the onset of the fast beam-ion instability (FBII). When the electron beam is accelerated in the Main Linac, it ionizes the residual gas in the chamber through scattering ionization. If the density of ions around the beam exceeds a certain threshold, a resonant motion between the electron beam and the ions can be excited. A two-stream instability appears and as a result the beam acquires a coherent motion, which can quickly lead to beam quality degradation or even complete loss. Thus, the vacuum pressure must be kept below this threshold to prevent the excitation of FBII. The CLIC Main Linac poses an additional challenge with respect to previous FBII situations, because the gas ionization does not solely occur via scattering. The submicrometric beam sizes lead to extremely high electric fields around the beam and therefore result in field ionization beyond a certain threshold. The residual gas in the corresponding volume a...
Electron Beam Welding of Gear Wheels by Splitted Beam
Directory of Open Access Journals (Sweden)
Dřímal Daniel
2014-06-01
Full Text Available This contribution deals with the issue of electron beam welding of high-accurate gear wheels composed of a spur gearing and fluted shaft joined with a face weld for automotive industry. Both parts made of the high-strength low-alloy steel are welded in the condition after final machining and heat treatment, performed by case hardening, whereas it is required that the run-out in the critical point of weldment after welding, i. e. after the final operation, would be 0.04 mm max..
NRAO Astronomer Wins Max-Planck Research Award
2005-04-01
Dr. Christopher Carilli, a National Radio Astronomy Observatory (NRAO) astronomer in Socorro, New Mexico, has been chosen to receive the prestigious Max Planck Research Award from the Alexander von Humboldt Foundation and the Max Planck Society in Germany. Christopher Carilli Dr. Christopher Carilli Click on image for more photos CREDIT: NRAO/AUI/NSF Carilli, a radio astronomer, and German particle physicist Christof Wetterich are the 2005 recipients of the award, conferred on "one researcher working in Germany and one working abroad who have already gained an international reputation and who are expected to produce outstanding achievements in the framework of international collaboration," according to an announcement from the Humboldt Foundation. "This is a great honor for Chris, and we are proud to see him receive such important international recognition for the excellence of his research," said NRAO Director Fred K.Y. Lo. Carilli's research has focused on studying very distant galaxies in the early Universe, and a quest to find the first luminous objects, such as stars or galaxies, to emerge. His most recent interests focus on unveiling the mysteries of what cosmologists call the "Epoch of Reionization," when the first stars and galaxies ionized the neutral hydrogen that pervaded the young Universe. Carilli and his research colleagues have used NRAO's Very Large Array and other radio telescopes to discover that the molecular raw material for star formation already was present in a galaxy seen as it was about 800 million years after the Big Bang, less than 1/16 the current age of the Universe. The Max Planck Research Award provides 750,000 Euros (currently about $900,000), to be used over five years, for research. The funding is provided by the German Ministry of Education and Research. Carilli will use the funding to support young researchers and to build scientific instrumentation, with a focus on fostering radio studies of cosmic reionization and the first
Dark current and radiation shielding studies for the ILC main linac
Energy Technology Data Exchange (ETDEWEB)
Mokhov, Nikolai V. [Fermilab; Rakhno, I. L. [Fermilab; Solyak, N. A. [Fermilab; Sukhanov, A. [Fermilab; Tropin, I. S. [Fermilab
2016-12-05
Electrons of dark current (DC), generated in high-gradient superconducting RF cavities (SRF) due to field emission, can be accelerated up to very high energies—19 GeV in the case of the International Linear Collider (ILC) main linac—before they are removed by focusing and steering magnets. Electromagnetic and hadron showers generated by such electrons can represent a significant radiation threat to the linac equipment and personnel. In our study, an operational scenario is analysed which is believed can be considered as the worst case scenario for the main linac regarding the DC contribution to the radiation environment in the main linac tunnel. A detailed modelling is performed for the DC electrons which are emitted from the surface of the SRF cavities and can be repeatedly accelerated in the high-gradient fields in many SRF cavities. Results of MARS15 Monte Carlo calculations, performed for the current main linac tunnel design, reveal that the prompt dose design level of 25 μSv/hr in the service tunnel can be provided by a 2.3-m thick concrete wall between the main and service ls.
Managing the transition to a truly value-creating economy : Max Havelaar Lecture 2013
R.J.M. van Tulder (Rob); J. Post (Julia); A. de Groot-Ruiz (Adrian); P. Blom (Peter)
2014-01-01
markdownabstractIt goes without debate that international supply or value chains only add real value to a selected group of companies and people. Cost and benefits are difficult to assess and even more difficult to be distributed in a ‘fair’ manner. The 2013 Max Havelaar lecture brought these three
The Emergence of a Root Metaphor in Modern Physics: Max Planck's "Quantum" Metaphor.
Johnson-Sheehan, Richard D.
1997-01-01
Uses metaphorical analysis to determine whether or not Max Planck invented the quantum postulate. Demonstrates how metaphorical analysis can be used to analyze the rhetoric of revolutionary texts in science. Concludes that, in his original 1900 quantum paper, Planck considered the quantum postulate to be important, but not revolutionary. (PA)
Taking Your iPod touch to the Max
Sadun, Erica
2010-01-01
Unleash your iPhone and take it to the limit using secret tips and techniques from gadget hacker Erica Sadun. Fast and fun to read, Taking Your iPod touch 4 to the Max is fully updated to show you how get the most out of Apple's new OS 4. You'll find all the best undocumented tricks as well as the most efficient and enjoyable introduction to the iPhone available. Starting with an introduction to iPod touch 4 basics, you'll quickly move on to discover the iPod touch's hidden potential, like how to connect to a TV, get contract-free VOIP, and hack OS 4 so it will run apps on your iPod touch. Fro
Sadun, Erica; Sande, Steve
2011-01-01
iPad 2: It looks different. It acts different. It connects to the world, yet it is as personal as a well-worn book. And now it has two cameras!. Taking Your iPad 2 to the Max is written so that anyone can quickly get up to speed on Apple's latest hit. As bloggers at The Unofficial Apple Weblog (TUAW.com), the authors have the happy privilege of working with Apple products every day, and they'll guide you through all of the perks of being an iPad 2 owner. This book takes you from selecting and buying an iPad, to connecting it to the Internet, to using the incredible power of the iPad and all it
NASA/Max Planck Institute Barium Ion Cloud Project.
Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.
1973-01-01
NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.
CP-even and CP-odd transverse polarization of the electron in the muon decay
International Nuclear Information System (INIS)
Kuznetsov, A.V.
1981-01-01
In the most general weak interaction model with intermediate vector bosons, allowing CP breaking in the muon decay, CP- even and CP-odd transverse polarization of the μ-decay electrons is calculated taking into account the radiative corrections. It is shown that such corrections are essential only at the beginning of the spectrum reducing the observed transverse polarization effects. When the electron energy is close to its maximum and the emission angles are small, the transverse polarization considerably grows. Search for CP-even and CP-odd transverse polarization of the electrons should be carried out at energies Esub(e) approximately equal to O.975 Esub(e)sup(max) and emission angles THETA approximately equal to 25+35 deg [ru
Stages in Educational Reform; The Max Planck Institute Has Produced a Report on Education.
Pfeffer, Gottfried
1981-01-01
Outlines the Max Planck Institute's exhaustive report on West German educational trends since World War II. An analysis of the effects of changing social values and demographic factors on educational policy, school organization, enrollment trends, curriculum design, and teaching methods is included. (AM)
International Nuclear Information System (INIS)
Lefevre, Roger; Roquefort, Henri
1970-02-01
The authors report the study of several typical and simple connections which are present between an ionizing radiation detector and the electronic sub-assembly, and can be adequate in most of the cases. They also study recommended outputs of the different types of detectors and their possible connections with electronic functional elements. Thus, they address connections for general use, detector outputs, inputs and outputs of amplifiers and of sub-assemblies, amplifier inputs, commonly used connectors
Synthesis and Characterization of MAX Ceramics (MAXCERs)
Nelson, Johnny Carl
This research has focused on the design and development of novel multifunctional MAX reinforced ceramics (MAXCERs). These MAXCERs were manufactured with 1-50 vol% ratios of ceramics to MAX phases. Chapter II reports on the synthesis and tribological behavior of Ti3SiC2 matrix composites by incorporating (1 and 6 vol%) Al2O3, (1 and 5 vol%) BN, and (1 and 5 vol%) B4C ceramic particulate additives in the matrix. All the composites were fabricated by pressureless sintering by using 1 wt% Ni as a sintering agent at 1550 °C for 2 hours. SEM and XRD studies showed that Al2O3 is relatively inert in the Ti3SiC 2 matrix whereas BN and B4C reacted significantly with the Ti3 SiC2 matrix to form TiB2. Detailed tribological studies showed that Ti3SiC2-1wt%Ni (baseline) samples showed dual type tribological behavior where the friction coefficient (micro) was low ( 0.2) during stage 1, thereafter micro increased sharply and transitioned into stage 2 ( 0.8). The addition of Al2O3 as an additive had little effect on the tribological behavior, but the addition of B4C and BN was able to enhance the tribological behavior by increasing the transition distance (TD). Chapter III reports on the synthesis and tribological behavior of TiB2 matrix composites by incorporating (10, 30, and 50 vol%) Ti3SiC2 ceramic particulate additives in the matrix. The fabrication parameters were similar to the Ti3SiC2 samples from Chapter II. There was minimal reaction between the TiB2 and the Ti3SiC2. Detailed tribological studies showed that TiB2 (baseline) and TiB2-10%Ti 3SiC2 samples showed an average micro of 0.29 and 0.28, respectively. TiB2-30%Ti3SiC2 and TiB 2-50%Ti3SiC2 showed dual-type tribological behavior where micro was low ( 0.25) during stage 1, thereafter micro increased gradually and transitioned into stage 2 ( 0.6). Low wear rates were seen for all samples.
Arpad Gerster and Max Thorek contributions to American surgery.
Langer, Robert M
2009-01-01
The legacy and the influence on American surgery is discussed of two Hungarian born surgeons: Arpad Gerster (1848-1923) and Max Thorek (1880-1960). Both of them were born in Northern Hungary, then part of the Austro-Hungarian Monarchy, today Slovakia. Gerster got his medical education in Vienna The influence of Theodor Billroth left everlasting impressions in him. In 1874 he arrived in New York and became the first doctor in town who practiced exclusively surgery. He became an attending surgeon in The German Hospital and later at Mount Sinai Hospital. Gerster modernized the hospital's functions and services, introducing the rotation system, and also made the original observation that dissemination of cancer may be caused by surgery. His aseptic methods were revolutionary at the time. Max Thorek arrived in Chicago in 1897. With a fantastic endurance he overwhelmed all barriers and became a doctor. He started his practice in one of Chicago's poor immigrant neighborhoods, but stepwise he could excel and in 1911 he co-founded The American Hospital. His ideas of modernizing surgery became reality. Thorek is one of the first who practiced plastic surgery, and his contribution by writing about surgical errors and safeguards became a great success. He founded the International College of Surgeons, a result of his widespread relations among surgeons all over the world. The parallels in the lives of these great surgeons: solid education, knowledge of languages, talent for music, literature, and arts, creative thinking combined with hard work, good humor, as well as a social conscience led them to make groundbreaking contributions to American and international surgery.
A multi-analyzer crystal spectrometer (MAX) for pulsed neutron sources
International Nuclear Information System (INIS)
Tajima, K.; Ishikawa, Y.; Kanai, K.; Windsor, C.G.; Tomiyoshi, S.
1982-03-01
The paper describes the principle and initial performance of a multi-analyzer crystal spectrometer (MAX) recently installed at the KENS spallation neutron source at Tsukuba. The spectrometer is able to make time of flight scans along a desired direction in reciprocal space, covering a wide range of the energy transfers corresponding to the fifteen analyzer crystals. The constant Q or constant E modes of operation can be performed. The spectrometer is particularly suited for studying collective excitations such as phonons and magnons to high energy transfers using single crystal samples. (author)
Directory of Open Access Journals (Sweden)
I Nym Saputra Wahyu Wijaya
2016-01-01
Full Text Available In order to decrease handoff latency and increase the successful of HHO conventional scheme, a development of handover scheme is done in standard protocol WiMAX IEEE 802.16e by adding mobility pattern. The superiority of handover scheme with mobility pattern can reduce handoff latency up to 50%, mean while the weakness of this scheme is a wrong act in determining target base station are often happen. Simulation can not showing the cause of that error. So, we do formal verification in to hard handover model with mobility pattern. In this research, behaviour system is modeled with continuous-time Markov chain (CTMC. The model is foccused to aproximating the influence of mobility pattern in to handoff latency from WiMAX hard handover mechanism. In order to set up a series markov chain models handover system can follow steps, such as: represents the state space, give a number in all transitions, generate the rate transition matrix (infinitesimal generator. Probabilistic model checking in the research are using quantitative properties and qualitative properties. Formal verification concerning properties has relation with handover in WiMAX network showing that 70% from mobile station which doing scanning with mobility pattern are success doing handover. 24% of them doing scanning conventional as a result of wrongness in act determining target base station, so handoff latency which is pictured will bigger than a system that is only use conventional scanning method.
CP-even and CP-odd transverse polarization of the electron in muon decay
International Nuclear Information System (INIS)
Kuznetsov, A.
1981-01-01
A model of the weak interaction which contains intermediate vector bosons of the most general form and which admits CP violation in muon decay is used to calculate the CP-even and CP-odd transverse polarization of the μ-decay electrons with inclusion of radiative corrections. It is shown that these corrections are important only at the beginning of the spectrum, and their contribution reduces the observed effects of the transverse polarization. The transverse polarization grows appreciably at electron energies close to the maximum energy and at small emission angles. It is expedient to search for the CP-even and CP-odd transverse polarization of the electrons at energies E/sub e/ = 0.975E/sup max//sub e/ and emission angles theta = 25--35 0
Receding-horizon control for max-plus linear systems with discrete actions using optimistic planning
Xu, J.; Busoniu, L; van den Boom, A.J.J.; De Schutter, B.H.K.; Cassandras, Christos G.; Giua, Alessandro; Li, Zhiwu
2016-01-01
This paper addresses the infinite-horizon optimal control problem for max-plus linear systems where the considered objective function is a sum of discounted stage costs over an infinite horizon. The minimization problem of the cost function is equivalently transformed into a maximization problem of
Sur quelques aspects de la production du soja (Glycine max L. au Congo : essais préliminaires
Directory of Open Access Journals (Sweden)
Mandimba, GR.
1991-01-01
Full Text Available About some cropping systems of soybean (Glycine max. L. in Congo : first results. Field experiments were conducted to assess the response of soybean Glycine max cv. FN3 to N fertilization and inoculation respectively. In the first experiment, the effects of different levels of N fertilizer (0 ; 20 ; 40 and 80 kg N/ha with or without liming were studied. Soybean podyield were related to N fertilization only when liming was added to the soil In the second one, the effects of four Bradyrhizobium japonicum strains F A3 ; 3-40 ; SA 1 and G3S on nodulation and yields were also studied. Inoculation has significant effect on nodulation and plant top dry weight at full bloom, and seed yield at harvest when compared to the control. However, the Bradyrhizobium japonicum strains tested had various symbiotic effectiveness on Glycine max cv. FN3. In addition, soybean plants inoculated with G3S strain and those fertilized with 100 kg N/ha produced similar seed yield. Our study illustrated that G3S strain had the better adaptability in environmental conditions of Congo soil.
Energy Technology Data Exchange (ETDEWEB)
Ha, Seung Cheol; Roh, Jong-Lyel; Choi, Seung-Ho; Nam, Soon Yuhl; Kim, Sang Yoon [University of Ulsan College of Medicine, Departments of Otolaryngology, Asan Medical Center, Songpa-gu, Seoul (Korea, Republic of); Oh, Jungsu S.; Moon, Hyojeong; Kim, Jae Seung [University of Ulsan College of Medicine, Departments of Nuclear Medicine, Asan Medical Center, Seoul (Korea, Republic of); Cho, Kyung-Ja [University of Ulsan College of Medicine, Departments of Pathology, Asan Medical Center, Seoul (Korea, Republic of)
2017-01-15
Head and neck soft tissue sarcoma (HNSTS) is a rare type of tumor with various histological presentations and clinical behaviors. {sup 18}F-FDG PET/CT is being increasingly used for staging, grading, and predicting treatment outcomes in various types of human cancers, although this modality has been rarely studied in the survival prediction of HNSTS. Here we examined the prognostic value of tumor metabolic parameters measured using {sup 18}F-FDG PET/CT in patients with HNSTS. This study included 36 consecutive patients with HNSTS who underwent {sup 18}F-FDG PET/CT scanning prior to treatment at our institution. Tumor gross total volume (GTV) was measured from pretreatment contrast-enhanced CT scans, and maximum standardized uptake value (SUV{sub max}), metabolic tumor volume (MTV), and total lesion glycolysis (TLG) were measured using pretreatment {sup 18}F-FDG PET/CT scans. Univariate and multivariate Cox proportional hazard regression analyses were used to identify associations between imaging parameters and disease-specific survival (DSS) or overall survival (OS). Univariate analyses showed that SUV{sub max}, MTV, and TLG, but not GTV, were significantly associated with DSS and OS (all P < 0.05). After controlling for clinicopathological factors, SUV{sub max}, MTV, and TLG were significantly associated with DSS and OS (all P < 0.05). Patients with a tumor SUV{sub max} value of >7.0 experienced an approximately fivefold increase in mortality in terms of DSS and OS relative to those with a tumor SUV{sub max} <7.0. Quantitative metabolic measurements on pretreatment {sup 18}F-FDG PET/CT can yield values that are significantly predictive of survival after treatment for HNSTS. (orig.)
Löhr, Gebhard
2012-03-01
The article discusses a debate which unfolded in the early 1950s and 1960s between East German Marxist philosophers and historians of science and West German theologians and scientists. The subject treated was the attitude towards religion of famous physicist Max Planck who had died a few years earlier, in 1947. The article analyses the different positions of the contributors, mainly with a view to developing a categorial framework usable in descriptions and analyses of the religious attitudes of natural scientists. Moreover the different stages of the debate are outlined in order to exhibit their connections to the larger historical context, i.e. the unfolding of the cold war. In the light of this the debate can be regarded as a religious or ideological war, albeit a cold one, on German soil, which fortunately did not escalate into a hot conflict. It ended, as can be illustrated in a late contribution to the debate, with the collapse of the GDR in 1989 or shortly thereafter.
Max Weber's Contribution to the Sociology of Education: A Critical Appreciation
Rao, S. Srinivasa; Singh, Smriti
2018-01-01
Karl Emil Maximilian Weber (1864-1920), more widely known as Max Weber, is credited with numerous contributions to modern sociology and is considered one of the pillars of the discipline along with Karl Marx and Emile Durkheim. Marx (1818-1883) was an established predecessor from Germany whose study of the nineteenth-century European society was…
Butenandt, A
1977-01-01
This is lecture on the historical development of modern virus research in Germany to introduce a symposium dedicated to Prof. Werner Schäfer, Tübingen, on the occasion of his 65th birthday. The author was set the task of relating from his memories the beginning of modern virus research in Germany. This research has, since 1936, essentially taken place in the Kaiser-Wilhelm/Max-Planck-Society and in 1954 led to the founding of the Max-Planck-Institute for Virus Research in Tübingen, an institute which to the present day owes its scientific reputation in considerable part to the activity of Werner Schäfer. Since the author personally experienced and participated in the Institute's development from 1936-1954, his remarks are predominantly influenced by personal recollections, which have been sharpended by a renewed study of old records in the 'Library and Archive of the History of the Max-Planck-Gesellschaft', Berlin-Dahlem.
Spanos, Stephanie; Booth, Rebekah; Koenig, Heidi; Sikes, Kendra; Gracely, Edward; Kim, In K
2008-08-01
Peripheral intravenous (PIV) catheter insertion is a frequent, painful procedure that is often performed with little or no anesthesia. Current approaches that minimize pain for PIV catheter insertion have several limitations: significant delay for onset of anesthesia, inadequate anesthesia, infectious disease exposure risk from needlestick injuries, and patients' needle phobia. Comparison of the anesthetic effectiveness of J-Tip needle-free jet injection of 1% buffered lidocaine to the anesthetic effectiveness of topical 4% ELA-Max for PIV catheter insertion. A prospective, block-randomized, controlled trial comparing J-Tip jet injection of 1% buffered lidocaine to a 30-minute application of 4% ELA-Max for topical anesthesia in children 8 to 15 years old presenting to a tertiary care pediatric emergency department for PIV catheter insertion. All subjects recorded self-reported visual analog scale (VAS) scores for pain at time of enrollment and pain felt following PIV catheter insertion. Jet injection subjects also recorded pain of jet injection. Subjects were videotaped during jet injection and PIV catheter insertion. Videotapes were reviewed by a single blinded reviewer for observer-reported VAS pain scores for jet injection and PIV catheter insertion. Of the 70 children enrolled, 35 were randomized to the J-Tip jet injection group and 35 to the ELA-Max group. Patient-recorded enrollment VAS scores for pain were similar between groups (P = 0.74). Patient-recorded VAS scores were significantly different between groups immediately after PIV catheter insertion (17.3 for J-Tip jet injection vs 44.6 for ELA-Max, P ELA-Max, P = 0.23). J-Tip jet injection of 1% buffered lidocaine provided greater anesthesia than a 30-minute application of ELA-Max according to patient self-assessment of pain for children aged 8 to 15 years undergoing PIV catheter insertion.
Le procédé du collage dans l’oeuvre de Max Ernst
Directory of Open Access Journals (Sweden)
Márcia Maria Valle Arbex
2011-10-01
Full Text Available Considerado um dos inventores da colagem, no sentido moderno da palavra, Max Ernst desenvolve a técnica estendendo sua prática e transformando-a em conceito. Nossa reflexão aborda este “recurso” sob ângulo de sua relação com a noção de imagem surrealista, a partir de exemplos de trabalhos executados em 1919-1920, onde as imagens vêm acompanhadas de legendas, formando o que chamamos de poema-duplo.Considéré l’un des créateurs du collage dans le sens moderne du mot, Max Ernst développe cete technique en élargissant sa pratique et en la transformant en concept. Notre réflexion porte sur ce “procédé”, sous l’angle de ses rapports avec la notion d’image poétique surréaliste, à partir d’exemples de travaux réalisés en 1919-1920, où des légendes accompagnent les images formant une sorte poème-double.
An Application of Max Lusher's Theory of Colour Psychology in Forogh Farrokhzad's Poetry
Directory of Open Access Journals (Sweden)
M Alavi Moghaddam
2010-06-01
Full Text Available Colour is recognized as one of the criteria for personality analysis in modern psychology. Colours are a kind of energy and visible sounds which play an important role in one's life. Their influences on human's soul and mind are undeniable. In other words, colour can be considered as a reflection of one's mental and physical situation since colours have special influence on soul and body equally. Max Lusher's study of colours is among the most recent theories which deal with psychological analysis and character explication. In this method, colours are introduced as numbers. Those which are denied and those which are well- accepted are the reflection of oneâs thoughts and feelings. Hence, word selection and colour choice can help us to analyze the poet's personality and mind. Among the modern poets, Forogh Farrokhzad has repeatedly manipulated colours in her poems among which "black" is a specific one. This paper aims at interpreting Forogh Farrokhzad poetry in terms of colour analysis on Max Lusher's theory.
Rice cytochrome P450 MAX1 homologs catalyze distinct steps in strigolactone biosynthesis
Zhang, Yanxia; van Dijk, Aalt D J; Scaffidi, Adrian; Flematti, Gavin R.; Hofmann, Manuel; Charnikhova, Tatsiana; Verstappen, Francel; Hepworth, Jo; van der Krol, Sander; Leyser, Ottoline; Smith, Steven M.; Zwanenburg, Binne; Al-Babili, Salim; Ruyter-Spira, Carolien; Bouwmeester, Harro J.
2014-01-01
Strigolactones (SLs) are a class of phytohormones and rhizosphere signaling compounds with high structural diversity. Three enzymes, carotenoid isomerase DWARF27 and carotenoid cleavage dioxygenases CCD7 and CCD8, were previously shown to convert all-trans-β-carotene to carlactone (CL), the SL precursor. However, how CL is metabolized to SLs has remained elusive. Here, by reconstituting the SL biosynthetic pathway in Nicotiana benthamiana, we show that a rice homolog of Arabidopsis More Axillary Growth 1 (MAX1), encodes a cytochrome P450 CYP711 subfamily member that acts as a CL oxidase to stereoselectively convert CL into ent-2'-epi-5-deoxystrigol (B-C lactone ring formation), the presumed precursor of rice SLs. A protein encoded by a second rice MAX1 homolog then catalyzes the conversion of ent-2'-epi-5-deoxystrigol to orobanchol. We therefore report that two members of CYP711 enzymes can catalyze two distinct steps in SL biosynthesis, identifying the first enzymes involved in B-C ring closure and a subsequent structural diversification step of SLs.
Rice cytochrome P450 MAX1 homologs catalyze distinct steps in strigolactone biosynthesis
Zhang, Yanxia
2014-10-26
Strigolactones (SLs) are a class of phytohormones and rhizosphere signaling compounds with high structural diversity. Three enzymes, carotenoid isomerase DWARF27 and carotenoid cleavage dioxygenases CCD7 and CCD8, were previously shown to convert all-trans-β-carotene to carlactone (CL), the SL precursor. However, how CL is metabolized to SLs has remained elusive. Here, by reconstituting the SL biosynthetic pathway in Nicotiana benthamiana, we show that a rice homolog of Arabidopsis More Axillary Growth 1 (MAX1), encodes a cytochrome P450 CYP711 subfamily member that acts as a CL oxidase to stereoselectively convert CL into ent-2\\'-epi-5-deoxystrigol (B-C lactone ring formation), the presumed precursor of rice SLs. A protein encoded by a second rice MAX1 homolog then catalyzes the conversion of ent-2\\'-epi-5-deoxystrigol to orobanchol. We therefore report that two members of CYP711 enzymes can catalyze two distinct steps in SL biosynthesis, identifying the first enzymes involved in B-C ring closure and a subsequent structural diversification step of SLs.
20. YÜZYIL ALMAN RESİM SANATINDA BİR MODERNİST: MAX BECKMANN
Directory of Open Access Journals (Sweden)
Fatih Basbug
2012-02-01
Full Text Available 20th century is noticed as a process which is tried a new dimension to mind and scientific concepts in the whole world. Within these concepts; art, artist, community and art work was placed in the centre of events in which political events has become world-view and power has become ruling by a new impetus. In short while the art is following up the political events ambitiously moved the social events to the universal dimension.In this process;different trends and political power balances are taking place in German art. German social life, which is in a new formation and the balance of government has been abandoned to an oppressive and more hard management approach. Max Beckmann is one of the many German artists who witnessed closely to this social change.In this article, Max Beckmann,- who is called “Degenerate Artist”- in the period which he lived, his life ,work of arts and his silence criticism against to his own society will be analyzed.