Characterization, Washing, Leaching, and Filtration of C-104 Sludge
Energy Technology Data Exchange (ETDEWEB)
KP Brooks; PR Bredt; GR Golcar; SA Hartley; LK Jagoda; KG Rappe; MW Urie
2000-06-09
Approximately 1,400 g of wet Hanford Tank C-104 Sludge was evaluated by Battelle for the high-level waste (HLW) pretreatment processes of ultrafiltration, dilute caustic washing, and elevated-temperature caustic leaching. The filterability of diluted C-104 sludge was measured with a 0.1-{micro}m sintered metal Mott filter using a 24-inch-long, single-element, crossflow filtration system (cells unit filter [CUF]). While the filtrate was being recirculated prior to washing and leaching, a 6.9 wt% solids slurry was evaluated with a matrix of seven 1-hour conditions of varying trans-membrane pressure (30 to 70 psid) and axial velocity (9 to 15 ft/s). The filtrate flux and backpulse efficiency were determined for each condition. The slurry was concentrated to 23 wt% solids, a second matrix of six 1-hour conditions was performed, and data analogous to that recorded in the first matrix were obtained. The low-solids-concentration matrix produced filtrate flux rates that ranged from 0.038 to 0.083 gpm/ft{sup 2}. The high-solids-concentration matrix produced filtrate flux rates that ranged from 0.0095 to 0.0172 gpm/ft{sup 2}. In both cases, the optimum filtrate flux was at the highest axial velocity (15 ft/s) and transmembrane pressure had little effect. Nearly all of the measured filtrate fluxes were more than an order of magnitude greater than the required plant flux for C-104 of 0.00126 gpm/ft{sup 2}. In both matrices, the filtrate flux appeared to be proportional to axial velocity, and the permeability appeared to be inversely proportional to the trans-membrane pressure. The first test condition was repeated as the last test condition for each matrix. In both cases, there was a significant decrease in filtrate flux, indicating some filter fouling during the test matrix that could not be removed by backpulsing alone, although the backpulse number and duration were not optimized. Following testing of these two matrices, the material was washed within the CUF by
Sengur-Tasdemir, Reyhan; Mokkapati, Venkata R S S; Koseoglu-Imer, Derya Y; Koyuncu, Ismail
2018-05-01
Multi-walled carbon nanotubes (MWCNTs) can be used for the fabrication of mixed matrix polymeric membranes that can enhance filtration perfomances of the membranes by modifying membrane surface properties. In this study, detailed characterization and filtration performances of MWCNTs functionalized with COOH group, blended into polymeric flat-sheet membranes were investigated using different polymer types. Morphological characterization was carried out using atomic force microscopy, scanning electron microscopy and contact angle measurements. For filtration performance tests, protein, dextran, E. coli suspension, Xanthan Gum and real activated sludge solutions were used. Experimental data and analyses revealed that Polyethersulfone (PES) + MWCNT-COOH mixed matrix membranes have superior performance abilities compared to other tested membranes.
Particle filtration in consolidated granular systems
International Nuclear Information System (INIS)
Schwartz, L.M.; Wilkinson, D.J.; Bolsterli, M.; Hammond, P.
1993-01-01
Grain-packing algorithms are used to model the mechanical trapping of dilute suspensions of particles by consolidated granular media. We study the distribution of filtrate particles, the formation of a damage zone (internal filter cake), and the transport properties of the host--filter-cake composite. At the early stages of filtration, our simulations suggest simple relationships between the structure of the internal filter cake and the characteristics of the underlying host matrix. These relationships are then used to describe the dynamics of the filtration process. Depending on the grain size and porosity of the host matrix, calculated filtration rates may either be greater than (spurt loss) or less than (due to internal clogging) those predicted by standard surface-filtration models
Osmosis, filtration and fracture of porous media
International Nuclear Information System (INIS)
Suarez Antola, R.
2001-01-01
Filtration was produced in a small scale physical model of a granular porous medium of cylindrical shape.The same volume flow was obtained either applying a difference in hydrostatic pressure or in osmotic pressure.In the first case a process of sustained erosion ending in an hydraulic short circuit was observed,while in the second case the material remained stable.This paradoxical strength behaviour is explained using some results from differential geometry,classical field theory and thermo-kinetic theory.The fracture process of a continuous matrix in a porous medium under the combined effect of filtration and external mechanical loads in then considered.The obtained results can be applied to the textural and compressive strength of wet concrete
AL-PAM assisted filtration of mature fine tailings produced from oil sands development
Energy Technology Data Exchange (ETDEWEB)
Alamgir, A.; Masliyah, J.; Xu, Z. [Alberta Univ., Edmonton, AB (Canada). Dept. of Chemical and Materials Engineering
2010-07-01
The inventory of mature fine tailings (MFT) produced by the oil sands extraction process continues to grow, and is considered as a long-term environmental liability. Large amounts of water are trapped in the MFT, and the tailings ponds present a threat to local wildlife and ecosystems. This PowerPoint presentation discussed a research project that is being conducted to identify conditions for producing stackable MFT deposits. The study is investigating various types and dosages of polymers and evaluating the degrees of MFT dilution and process configurations needed to maximize re-usable water recovery. Polymeric flocculants include AL-PAM and Magnafloc 1011. Settling tests have demonstrated that 50 ppm is the optimum dosage for both polymers when MFT is diluted to 5 wt percent solids, while 75 ppm of AL-PAM and 100 ppm of MF1011 are optimum dosages for MFT diluted to 10 wt percent solids. A novel supernatant filtration method was then used to produce filtration cakes and water. The study showed that the supernatant can be used to further dilute the MFTs. tabs., figs.
Statistical data filtration in neutron coincidence counting
International Nuclear Information System (INIS)
Beddingfield, D.H.; Menlove, H.O.
1992-11-01
We assessed the effectiveness of statistical data filtration to minimize the contribution of matrix materials in 200-ell drums to the nondestructive assay of plutonium. Those matrices were examined: polyethylene, concrete, aluminum, iron, cadmium, and lead. Statistical filtration of neutron coincidence data improved the low-end sensitivity of coincidence counters. Spurious data arising from electrical noise, matrix spallation, and geometric effects were smoothed in a predictable fashion by the statistical filter. The filter effectively lowers the minimum detectable mass limit that can be achieved for plutonium assay using passive neutron coincidence counting
Challenges of Membrane Filtration for Produced Water Treatment in Offshore Oil & Gas Production
DEFF Research Database (Denmark)
Jepsen, Kasper Lund; Hansen, Leif; Mai, Christian
2016-01-01
struggling to their fundamental limit, therefore the membrane filtration technology turns to be a potential candidate for zero pollutant discharge. Membrane filtration technology suffers from the notorious fouling problem, where many methods for fouling prevention and removal are explored, the general idea...... is to guarantee that a relatively high permeability can be kept during filtration. Another crucial issue using membrane filtration technology is its huge energy consumption, for which there is little research has been done so far to systematically investigate and optimize the filtration system’s energy efficiency...
Filtration of aerosols produced by a sodium fire
International Nuclear Information System (INIS)
Duverger de Cuy, G.; Colome, J.
1977-01-01
The containment system of the Super Phenix reactor takes account of the possibility of contaminated sodium fires, particularly in the vicinity of the fuel storage drum. It is thus necessary to contain the emitted radioactivity associated with a quantity of sodium aerosols of the order of some 10 g/m 3 . Investigations previously carried out had shown that the retention capacity of high-efficiency asbestos filters was clearly insufficient. A new research programme on the filtration of sodium aerosols has thus been worked out with the aim of: gaining a better understanding of the granulometry of the aerosols produced by the fire; checking the efficiency of the new glass-fibre media of which high-efficiency filters are composed; selecting a prefiltering system which, in conjunction with the high-efficiency filter, would ensure a suitable retention capacity for the whole unit. The following prefilters are under investigation: agglomerating cyclones; fabric prefilters (dense filter media - variable density filters - bag filters); water prefilters; sand prefilters. The experimental equipment on which this programme has been based is presented. Results have so far been obtained for agglomerating cyclones (recirculating loop with a cyclone of 95% efficiency), for a number of textile prefilters and for the retention capacity of high-efficiency filters
Marrufo-Hernández, Norma Alejandra; Hernández-Guerrero, Maribel; Nápoles-Duarte, José Manuel; Palomares-Báez, Juan Pedro; Chávez-Rojo, Marco Antonio
2018-03-01
We present a computational model that describes the diffusion of a hard spheres colloidal fluid through a membrane. The membrane matrix is modeled as a series of flat parallel planes with circular pores of different sizes and random spatial distribution. This model was employed to determine how the size distribution of the colloidal filtrate depends on the size distributions of both, the particles in the feed and the pores of the membrane, as well as to describe the filtration kinetics. A Brownian dynamics simulation study considering normal distributions was developed in order to determine empirical correlations between the parameters that characterize these distributions. The model can also be extended to other distributions such as log-normal. This study could, therefore, facilitate the selection of membranes for industrial or scientific filtration processes once the size distribution of the feed is known and the expected characteristics in the filtrate have been defined.
EM Task 9 - Centrifugal membrane filtration
International Nuclear Information System (INIS)
Stepan, Daniel J.; Stevens, Bradley G.; Hetland, Melanie D.
1999-01-01
The overall project consists of several integrated research phases related to the applicability, continued development, demonstration, and commercialization of the SpinTek centrifugal membrane filtration process. Work performed during this reporting period consisted of Phase 2 evaluation of the SpinTek centrifugal membrane filtration technology and Phase 3, Technology Partnering. During Phase 1 testing conducted at the EERC using the SpinTek ST-IIL unit operating on a surrogate tank waste, a solids cake developed on the membrane surface. The solids cake was observed where linear membrane velocities were less than 17.5 ft/s and reduced the unobstructed membrane surface area up to 25%, reducing overall filtration performance. The primary goal of the Phase 2 research effort was to enhance filtration performance through the development and testing of alternative turbulence promoter designs. The turbulence promoters were designed to generate a shear force across the entire membrane surface sufficient to maintain a self-cleaning membrane capability and improve filtration efficiency and long-term performance. Specific Phase 2 research activities included the following: System modifications to accommodate an 11-in.-diameter, two-disk rotating membrane assembly; Development and fabrication of alternative turbulence promoter designs; Testing and evaluation of the existing and alternative turbulence promoters under selected operating conditions using a statistically designed test matrix; and Data reduction and analysis; The objective of Phase 3 research was to demonstrate the effectiveness of SpinTek's centrifugal membrane filtration as a pretreatment to remove suspended solids from a liquid waste upstream of 3M's WWL cartridge technology for the selective removal of technetium (Tc)
Characterization of lysozyme films produced by matrix assisted pulsed laser evaporation (MAPLE)
DEFF Research Database (Denmark)
Purice, Andreea; Schou, Jørgen; Kingshott, Peter
2007-01-01
Thin lysozyme films of thickness up to more than 100 nm have been produced in a dry environment by MAPLE (matrix assisted pulsed laser evaporation) from a water ice matrix. Analysis of the films demonstrates that a significant part of the lysozyme molecules is transferred to the substrate without...
Directory of Open Access Journals (Sweden)
Omar S. Qureshi
2017-10-01
Full Text Available Activated fibroblasts are considered major drivers of fibrotic disease progression through the production of excessive extracellular matrix (ECM in response to signals from damaged epithelial and inflammatory cells. Nevertheless, epithelial cells are capable of expressing components of the ECM, cross-linking enzymes that increase its stability and are sensitive to factors involved in the early stages of fibrosis. We therefore wanted to test the hypothesis that epithelial cells can deposit ECM in response to stimulation in a comparable manner to fibroblasts. We performed immunofluorescence analysis of components of stable, mature extracellular matrix produced by primary human renal proximal tubular epithelial cells and renal fibroblasts in response to cytokine stimulation. Whilst fibroblasts produced a higher basal level of extracellular matrix components, epithelial cells were able to deposit significant levels of fibronectin, collagen I, III and IV in response to cytokine stimulation. In response to hypoxia, epithelial cells showed an increase in collagen IV deposition but not in response to the acute stress stimuli aristolochic acid or hydrogen peroxide. When epithelial cells were in co-culture with fibroblasts we observed significant increases in the level of matrix deposition which could be reduced by transforming growth factor beta (TGF-β blockade. Our results highlight the role of epithelial cells acting as efficient producers of stable extracellular matrix which could contribute to renal tubule thickening in fibrosis.
Cross-flow filtration and axial filtration
International Nuclear Information System (INIS)
Kraus, K.A.
1974-01-01
Two relatively novel alternative solid-liquid-separation techniques of filtration are discussed. In cross-flow filtration, the feed is pumped past the filtering surface. While in axial filtration the filter, mounted on a rotor, is moved with respect to the feed. While large-scale application of the axial filter is still in doubt, it permits with little expenditure of time and money, duplication of many hydrodynamic aspects of cross-flow filtration for fine-particle handling problems. The technique has been applied to municipal wastes, low-level radioactive waste treatment plant, lead removal from industrial wastes, removal of pulp-mill contaminants, textile-mill wastes, and pretreatment of saline waters by lime-soda process in preparation for hyperfiltration. Economics and energy requirements are also discussed
Evolution of Emergent Technologies for Producing Nonwoven Fabrics for Air Filtration
Ou, Yingjie
2016-01-01
Nonwovens is a fast growing industry driven by technological research and development (R&D), and one of the major application areas for nonwovens is air filtration. Research on nonwovens technologies has mainly focused on the science and technology areas, but there is very little published research on technology management issues within the…
International Nuclear Information System (INIS)
Jimenez Rebagliati, Raul; Liberman, S.J.
1982-01-01
The magnetic filtration technique allows the removal of suspended magnetic species from a fluid at high flow rate and temperature. It is specially advantageous for water purification in systems such as thermonuclear and thermoelectric plants in which corrosion products must be removed from the heat transport and cooling circuits. Using diluted aqueous suspensions of magnetite, the behaviour of a ball matrix filter was studied as a function of flow rate, temperature and concentration of particles. The retention efficiency shows an exponential decay with fluid's velocity and viscosity in agreement with theory. Within the range of concentration considered, there is no change in the retention with concentration. Design parameters for filters according to plant's needs are obtained from the results of this study. (Author) [es
Niobium Carbide-Reinforced Al Matrix Composites Produced by High-Energy Ball Milling
Travessa, Dilermando Nagle; Silva, Marina Judice; Cardoso, Kátia Regina
2017-06-01
Aluminum and its alloys are key materials for the transportation industry as they contribute to the development of lightweight structures. The dispersion of hard ceramic particles in the Al soft matrix can lead to a substantial strengthening effect, resulting in composite materials exhibiting interesting mechanical properties and inspiring their technological use in sectors like the automotive and aerospace industries. Powder metallurgy techniques are attractive to design metal matrix composites, achieving a homogeneous distribution of the reinforcement into the metal matrix. In this work, pure aluminum has been reinforced with particles of niobium carbide (NbC), an extremely hard and stable refractory ceramic. Its use as a reinforcing phase in metal matrix composites has not been deeply explored. Composite powders produced after different milling times, with 10 and 20 vol pct of NbC were produced by high-energy ball milling and characterized by scanning electron microscopy and by X-ray diffraction to establish a relationship between the milling time and size, morphology, and distribution of the particles in the composite powder. Subsequently, an Al/10 pct NbC composite powder was hot extruded into cylindrical bars. The strength of the obtained composite bars is comparable to the commercial high-strength, aeronautical-grade aluminum alloys.
BWR condensate filtration studies
International Nuclear Information System (INIS)
Wilson, J.A.; Pasricha, A.; Rekart, T.E.
1993-09-01
Poor removal of particulate corrosion products (especially iron) from condensate is one of the major problems in BWR systems. The presence of activated corrosion products creates ''hot spots'' and increases piping dose rates. Also, fuel efficiency is reduced and the risk of fuel failure is increased by the deposit of corrosion products on the fuel. Because of these concerns, current EPRI guidelines call for a maximum of 2 ppb of iron in the reactor feedwater with a level of 0.5 ppb being especially desirable. It has become clear that conventional deep bed resins are incapable of meeting these levels. While installation of prefilter systems is an option, it would be more economical for plants with naked deep beds to find an improved bead resin for use in existing systems. BWR condensate filtration technologies are being tested on a condensate side stream at Hope Creek Nuclear Generating Station. After two years of testing, hollow fiber filters (HFF) and fiber matrix filters (FMF), and low crosslink cation resin, all provide acceptable results. The results are presented for pressure drop, filtration efficiency, and water quality measurements. The costs are compared for backwashable non-precoat HFF and FMF. Results are also presented for full deep bed vessel tests of the low crosslink cation resin
International Nuclear Information System (INIS)
Ying, T.Y.; Chin, C.J.; Lu, S.C.; Yiacoumi, S.
1997-10-01
Magnetic-seeding filtration consists of two steps: heterogeneous particle flocculation of magnetic and nonmagnetic particles in a stirred tank and high-gradient magnetic filtration (HGMF). The effects of various parameters affecting magnetic-seeding filtration (HGMF). The effects of various parameters affecting magnetic seeding filtration are theoretically and experimentally investigated. A trajectory model that includes hydrodynamic resistance, van der Waals, and electrostatic forces is developed to calculate the flocculation frequency in a turbulent-shear regime. Fractal dimension is introduced to simulate the open structure of aggregates. A magnetic-filtration model that consists of trajectory analysis, a particle build-up model, a breakthrough model, and a bivariate population-balance model is developed to predict the breakthrough curve of magnetic-seeding filtration. A good agreement between modeling results and experimental data is obtained. The results show that the model developed in this study can be used to predict the performance of magnetic-seeding filtration without using empirical coefficients or fitting parameters. 35 refs., 7 figs., 1 tab
International Nuclear Information System (INIS)
Fiskum, Sandra K.; Billing, Justin M.; Crum, J.V.; Daniel, Richard C.; Edwards, Matthew K.; Shimskey, Rick W.; Peterson, Reid A.; MacFarlan, Paul J.; Buck, Edgar C.; Draper, Kathryn E.; Kozelisky, Anne E.
2009-01-01
This is the final report in a series of eight reports defining characterization, leach, and filtration testing of a wide variety of Hanford tank waste sludges. The information generated from this series is intended to supplement the Waste Treatment and Immobilization Plant (WTP) project understanding of actual waste behaviors associated with tank waste sludge processing through the pretreatment portion of the WTP. The work described in this report presents information on a high-iron waste form, specifically the ferrocyanide tank waste sludge. Iron hydroxide has been shown to pose technical challenges during filtration processing; the ferrocyanide tank waste sludge represented a good source of the high-iron matrix to test the filtration processing
Energy Technology Data Exchange (ETDEWEB)
Fiskum, Sandra K.; Billing, Justin M.; Crum, J. V.; Daniel, Richard C.; Edwards, Matthew K.; Shimskey, Rick W.; Peterson, Reid A.; MacFarlan, Paul J.; Buck, Edgar C.; Draper, Kathryn E.; Kozelisky, Anne E.
2009-02-28
This is the final report in a series of eight reports defining characterization, leach, and filtration testing of a wide variety of Hanford tank waste sludges. The information generated from this series is intended to supplement the Waste Treatment and Immobilization Plant (WTP) project understanding of actual waste behaviors associated with tank waste sludge processing through the pretreatment portion of the WTP. The work described in this report presents information on a high-iron waste form, specifically the ferrocyanide tank waste sludge. Iron hydroxide has been shown to pose technical challenges during filtration processing; the ferrocyanide tank waste sludge represented a good source of the high-iron matrix to test the filtration processing.
Farina, Claudio; Arena, Fabio; Casprini, Patrizia; Cichero, Paola; Clementi, Massimo; Cosentino, Marina; Degl'Innocenti, Roberto; Giani, Tommaso; Luzzaro, Francesco; Mattei, Romano; Mauri, Carola; Nardone, Maria; Rossolini, Gian Maria; Serna Ortega, Paula Andrea; Vailati, Francesca
2015-04-01
Microbial identification from blood cultures is essential to institute optimal antibiotic therapy and improve survival possibilities. Matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) has been successfully applied to identify bacteria and yeasts from positive blood cultures broths. The aim of this multicentre study was to evaluate the reliability of the lysis-filtration technique associated with MALDI-TOF MS to directly identify microorganisms from 765 positive blood cultures collected in six Italian hospitals. Overall, 675/765 (78.1%) blood isolates were correctly identified at the species level, with significant differences between Gram-negative and Gram-positive bacteria (92.6%, and 69.8%, respectively). Some difficulties arise in identifying Streptococcus pneumoniae, Staphylococcus aureus, yeasts and anaerobes. The lysis-filtration protocol is a suitable procedure in terms of performance in identifying microorganisms, but it is quite expensive and technically time-consuming since the time of filtration is not regular for all the samples. The application of the MALDI-TOF MS technique to the direct microbial identification from positive blood cultures is a very promising approach, even if more experience must be gained to minimize errors and costs.
Ferreira, Rosana Gomes; Monteiro, Mychelle Alves; Pereira, Mararlene Ulberg; da Costa, Rafaela Pinto; Spisso, Bernardete Ferraz; Calado, Veronica
2016-08-01
The aim of this work was to study the feasibility of producing an egg matrix candidate reference material for salinomycin. Preservation techniques investigated were freeze-drying and spray drying dehydration. Homogeneity and stability studies of the produced batches were conducted according to ISO Guides 34 and 35. The results showed that all produced batches were homogeneous and both freeze-drying and spray drying techniques were suitable for matrix dehydrating, ensuring the material stability. In order to preserve the material integrity, it must be transported within the temperature range of -20 up to 25°C. The results constitute an important step towards the development of an egg matrix reference material for salinomycin is possible. Copyright © 2016 Elsevier B.V. All rights reserved.
Method of electrostatic filtration
International Nuclear Information System (INIS)
Devienne, F.M.
1975-01-01
Electrostatic filtration of secondary ions of mass m in a given mass ratio with a primary ion of mass M which has formed the secondary ions by fission is carried out by a method which consists in forming a singly-charged primary ion of the substance having a molecular mass M and extracting the ion at a voltage V 1 with respect to ground. The primary ion crosses a potential barrier V 2 , in producing the dissociation of the ion into at least two fragments of secondary ions and in extracting the fragment ion of mass m at a voltage V 2 . Filtration is carried out in an electrostatic analyzer through which only the ions of energy eV'' are permitted to pass, detecting the ions which have been filtered. The mass m of the ions is such that (M/m) = (V 1 - V 2 )/(V'' - V 2 )
Dynamic membrane filtration in tangential flow
International Nuclear Information System (INIS)
Anon.
1993-01-01
Oil-containing waste water is produced in many cleaning processes and also on production of compressed air. Dynamic membrane filtration in the tangential flow mode has proved effective in the treatment of these stable emulsions. The possible applications of ceramic membrane filters are illustrated for a variety of examples. (orig.) [de
Polymer aids for settling and filtration of oil sands tailings
Energy Technology Data Exchange (ETDEWEB)
Wang, X. [Alberta Univ., Edmonton, AB (Canada). Dept. of Chemical and Materials Engineering; Energy Resources Conservation Board, Calgary, AB (Canada). Oil Sands Section; Xu, Z.; Masliyah, J.H. [Alberta Univ., Edmonton, AB (Canada). Dept. of Chemical and Materials Engineering
2008-07-01
Oil sand tailings are segregated into coarse and fine tailings. High volumes of toxic fluids and tailings are created in the process. Tailings ponds are an environmental risk with high operating and maintenance costs. Current commercial technologies uses chemical additions to create recycled water and composite tailings (CT). Researchers are now investigating centrifuged and dry mature fine tailings (MFT). Filtration processes with flocculants are used to separate the tailings into warm recycle water and dried cakes that can be used in reclamation processes. Studies are being conducted to find a polymer than can effectively flocculate and filter whole oil sands tailings. The filtration procedure uses pressure to produce released water. Polymers include magnafloc and Al-PAM polymer concentrations are used in slurry masses. Tests have been conducted to determine the settling rates of the polymers. The tests showed that Al-PAM filtered the tailings effectively. Paraffinic froth treatment tests have also been conducted to determine settling rates. A cake produced with froth treatment tailings of Al-PAM 400 ppm had a water content 42.5 wt per cent. The tests showed that while Magnafloc 1011 is a good settling aid, but a poor filtration addition. Al-PAM aided in both the flocculation and filtration processes. Higher Al-PAM dosages are needed for froth treatment tailings processes. It was concluded that dry cakes are produced with the addition of Al-PAM. tabs., figs.
GSPEL - Air Filtration Laboratory
Federal Laboratory Consortium — Evaluation capabilities for air filtration devicesThe Air Filtration Lab provides testing of air filtration devices to demonstrate and validate new or legacy system...
2010-07-01
... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...
Off-diagonal helicity density matrix elements for vector mesons produced at LEP
International Nuclear Information System (INIS)
Anselmino, M.; Bertini, M.; Quintairos, P.
1997-05-01
Final state q q-bar interactions may give origin to non zero values of the off-diagonal element ρ 1 of the helicity density matrix of vector mesons produced in e + e - annihilations, as confirmed by recent OPAL data on φ and D * 's. Predictions are given for ρ1,-1 of several mesons produced at large z and small PT, collinear with the parent jet; the values obtained for θ and D * are in agreement with data. (author)
International Nuclear Information System (INIS)
Ban, Ya.; Kotov, V.M.; Kharcharufkova, K.
1987-01-01
Algorithms for track signal filtration from bubble and streamer spark chambers read by CCD matrix with elements of 256x288 dimensions are described. The microprogrammed RISC processor is used for preliminary processing and filtration of data obtained. It makes possible to recognize and filter track elements in the zone of 0.25 mm 2 square during 0.17-0.20 s, that maintains it in real time operation
Origin of Matrix-Producing Cells That Contribute to Aortic Fibrosis in Hypertension.
Wu, Jing; Montaniel, Kim Ramil C; Saleh, Mohamed A; Xiao, Liang; Chen, Wei; Owens, Gary K; Humphrey, Jay D; Majesky, Mark W; Paik, David T; Hatzopoulos, Antonis K; Madhur, Meena S; Harrison, David G
2016-02-01
Various hypertensive stimuli lead to exuberant adventitial collagen deposition in large arteries, exacerbating blood pressure elevation and end-organ damage. Collagen production is generally attributed to resident fibroblasts; however, other cells, including resident and bone marrow-derived stem cell antigen positive (Sca-1(+)) cells and endothelial and vascular smooth muscle cells, can produce collagen and contribute to vascular stiffening. Using flow cytometry and immunofluorescence, we found that adventitial Sca-1(+) progenitor cells begin to produce collagen and acquire a fibroblast-like phenotype in hypertension. We also found that bone marrow-derived cells represent more than half of the matrix-producing cells in hypertension, and that one-third of these are Sca-1(+). Cell sorting and lineage-tracing studies showed that cells of endothelial origin contribute to no more than one fourth of adventitial collagen I(+) cells, whereas those of vascular smooth muscle lineage do not contribute. Our findings indicate that Sca-1(+) progenitor cells and bone marrow-derived infiltrating fibrocytes are major sources of arterial fibrosis in hypertension. Endothelial to mesenchymal transition likely also contributes, albeit to a lesser extent and pre-existing resident fibroblasts represent a minority of aortic collagen-producing cells in hypertension. This study shows that vascular stiffening represents a complex process involving recruitment and transformation of multiple cells types that ultimately elaborate adventitial extracellular matrix. © 2015 American Heart Association, Inc.
Sprifermin (rhFGF18) enables proliferation of chondrocytes producing a hyaline cartilage matrix.
Gigout, A; Guehring, H; Froemel, D; Meurer, A; Ladel, C; Reker, D; Bay-Jensen, A C; Karsdal, M A; Lindemann, S
2017-11-01
Fibroblast growth factor (FGF) 18 has been shown to increase cartilage volume when injected intra-articularly in animal models of osteoarthritis (OA) and in patients with knee OA (during clinical development of the recombinant human FGF18, sprifermin). However, the exact nature of this effect is still unknown. In this study, we aimed to investigate the effects of sprifermin at the cellular level. A combination of different chondrocyte culture systems was used and the effects of sprifermin on proliferation, the phenotype and matrix production were evaluated. The involvement of MAPKs in sprifermin signalling was also studied. In monolayer, we observed that sprifermin promoted a round cell morphology and stimulated both cellular proliferation and Sox9 expression while strongly decreasing type I collagen expression. In 3D culture, sprifermin increased the number of matrix-producing chondrocytes, improved the type II:I collagen ratio and enabled human OA chondrocytes to produce a hyaline extracellular matrix (ECM). Furthermore, we found that sprifermin displayed a 'hit and run' mode of action, with intermittent exposure required for the compound to fully exert its anabolic effect. Finally, sprifermin appeared to signal through activation of ERK. Our results indicate that intermittent exposure to sprifermin leads to expansion of hyaline cartilage-producing chondrocytes. These in vitro findings are consistent with the increased cartilage volume observed in the knees of OA patients after intra-articular injection with sprifermin in clinical studies. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Process of producing a ceramic matrix composite article and article formed thereby
Corman, Gregory Scot [Ballston Lake, NY; McGuigan, Henry Charles [Duanesburg, NY; Brun, Milivoj Konstantin [Ballston Lake, NY
2011-10-25
A CMC article and process for producing the article to have a layer on its surface that protects a reinforcement material within the article from damage. The method entails providing a body containing a ceramic reinforcement material in a matrix material that contains a precursor of a ceramic matrix material. A fraction of the reinforcement material is present and possibly exposed at a surface of the body. The body surface is then provided with a surface layer formed of a slurry containing a particulate material but lacking the reinforcement material of the body. The body and surface layer are heated to form the article by converting the precursor within the body to form the ceramic matrix material in which the reinforcement material is contained, and by converting the surface layer to form the protective layer that covers any fraction of the reinforcement material exposed at the body surface.
Titanium Matrix Composite Ti/TiN Produced by Diode Laser Gas Nitriding
Directory of Open Access Journals (Sweden)
Aleksander Lisiecki
2015-01-01
Full Text Available A high power direct diode laser, emitting in the range of near infrared radiation at wavelength 808–940 nm, was applied to produce a titanium matrix composite on a surface layer of titanium alloy Ti6Al4V by laser surface gas nitriding. The nitrided surface layers were produced as single stringer beads at different heat inputs, different scanning speeds, and different powers of laser beam. The influence of laser nitriding parameters on the quality, shape, and morphology of the surface layers was investigated. It was found that the nitrided surface layers consist of titanium nitride precipitations mainly in the form of dendrites embedded in the titanium alloy matrix. The titanium nitrides are produced as a result of the reaction between molten Ti and gaseous nitrogen. Solidification and subsequent growth of the TiN dendrites takes place to a large extent at the interface of the molten Ti and the nitrogen gas atmosphere. The direction of TiN dendrites growth is perpendicular to the surface of molten Ti. The roughness of the surface layers depends strongly on the heat input of laser nitriding and can be precisely controlled. In spite of high microhardness up to 2400 HV0.2, the surface layers are crack free.
Gong, Jian; Viswanathan, Sandeep; Rothamer, David A; Foster, David E; Rutland, Christopher J
2017-10-03
Motivated by high filtration efficiency (mass- and number-based) and low pressure drop requirements for gasoline particulate filters (GPFs), a previously developed heterogeneous multiscale filtration (HMF) model is extended to simulate dynamic filtration characteristics of GPFs. This dynamic HMF model is based on a probability density function (PDF) description of the pore size distribution and classical filtration theory. The microstructure of the porous substrate in a GPF is resolved and included in the model. Fundamental particulate filtration experiments were conducted using an exhaust filtration analysis (EFA) system for model validation. The particulate in the filtration experiments was sampled from a spark-ignition direct-injection (SIDI) gasoline engine. With the dynamic HMF model, evolution of the microscopic characteristics of the substrate (pore size distribution, porosity, permeability, and deposited particulate inside the porous substrate) during filtration can be probed. Also, predicted macroscopic filtration characteristics including particle number concentration and normalized pressure drop show good agreement with the experimental data. The resulting dynamic HMF model can be used to study the dynamic particulate filtration process in GPFs with distinct microstructures, serving as a powerful tool for GPF design and optimization.
International Nuclear Information System (INIS)
Md Shahid Ayub; Roslan Mohd Ali; Kamarudin Samuding
1996-01-01
The filtration velocity of the groundwater was determine by introducing I mCi Br-82 into a borehole. Br-82 was in the form of potassium bromide. The result showed that the filtration velocity varies from 2.3 to 4.5 cm/day depending on the soil matrix with the clayey layer posting more resistance to flow. Au-198 in the form of aurium chloride was introduce into two other boreholes to determine the direction of flow. The general trend of flow was in the direction between N140E and N160E
Directory of Open Access Journals (Sweden)
Ali Akbari
2016-09-01
Full Text Available Because most contaminants in water create strong interactions with hydrophobic surfaces, there are usually problems such as flux decline and pore blocking in polyethylene (PE membranes due to irreversible adsorption of foulants on their intrinsic hydrophobic surface. Therefore, in this work, attempts were made to improve the properties of PE membranes in terms of water flux and membrane fouling resistance by dispersion of silica nanoparticles (NPs. First, NPs were synthesized by sol-gel method at two concentrations of ammonia (0.5 and 1 mol/L. The synthesized NPs with smaller size were used to fabricate the mixed matrix PE membranes containing 0, 0.5, 1 and 2 wt% NPs. FE-SEM and EDX analyses were employed to evaluate the morphology and structure of the fabricated membranes and confirmed the presence of NPs in the membranes matrix. The results of pure water flux test revealed that the membrane containing 1 wt% NPs displayed the maximum flux of 30 L/m2.h. Furthermore, the performance and fouling behaviors of membranes during filtration of humic acid solution, one of the most important contaminants of water resources, were studied using a classical fouling model. Fouling mechanism analysis showed that for neat and NPs-embedded membranes containing 0.5 and 2 wt% NPs, the best fit of the data was obtained by cake layer formation as well as the intermediate blocking mechanisms. However, the best fit of the experimental data of NPs-embedded membrane containing 1 wt% occurred with only cake layer formation mechanism. The investigation on membrane fouling resistance showed that 1 wt% NPs-embedded membrane displayed 58% maximum flux recovery and 52% reversibility to total fouling ratio, respectively.
Simulations of Microbial-Enhanced Oil Recovery: Adsorption and Filtration
DEFF Research Database (Denmark)
Nielsen, Sidsel Marie; Nesterov, Igor; Shapiro, Alexander
2014-01-01
In the context of microbial-enhanced oil recovery (MEOR) with injection of surfactant-producing bacteria into the reservoir, different types of bacteria attachment and growth scenarios are studied using a 1D simulator. The irreversible bacteria attachment due to filtration similar to the deep bed...... applied to filtration model provides formation of two oil banks during recovery. This feature is not reproduced by application of REA model or DBF with growth in attached phase. This makes it possible to select a right model based on the qualitative analysis of the experimental data. A criterion...... is introduced to study the process efficiency: the dimensionless time at which average recovery between pure water injection and maximum surfactant effect is reached. This characteristic recovery period (CRP) was studied as a function of the different MEOR parameters such as bacterial activity, filtration...
Primary effluent filtration for coastal discharges
Energy Technology Data Exchange (ETDEWEB)
Cooper-Smith, G.D. [Yorkshire Water Services, Huddersfield (United Kingdom); Rundle, H. [The Capital Controls Group, Nottingham (United Kingdom)
1998-12-31
The use of a Tetra Deep Bed filter demonstration unit to treat primary effluent (Primary Effluent Filtration, PEF) was investigated. PEF proved capable of achieving the UWWTD primary standard, even when the primary stage performs poorly, but is not a cost-effective alternative to chemically assisted settlement. Results demonstrated that using a 1.5 to 2.2 mm grade medium, a filtration rate of 5 m/h, three backwashes a day and dosing 40 mg/l of PAXXL60 (a polyaluminium silicte) an average effluent quality of 20 mg/l BOD and 15 mgl/l total solid could be achieved. UV disinfection produced an effluent which complied with the Bathing Water Directive imperative requirement. A high enterovirus kill was also achieved. However, considerable additional work would be required before PEF could be considered suitable for full-scale applications. (orig.)
Filtration behaviors of rod-shaped bacterial broths in unsteady-state phase of cross-flow filtration
Energy Technology Data Exchange (ETDEWEB)
Tanaka, T.; Usui, K.; Koda, K.; Nakanishi, K. [Okayama University, Okayama (Japan). Faculty of Engineering
1996-12-20
Filtration behaviors in the unsteady-state phase of crossflow filtration of broths of Bacillus subtilis, Escherichia coli, and Lactobacillus delbrueckii, which are rod-shaped, were studied from the viewpoint of the changes in the specific resistance and in the structure of the microbial cake formed on the membrane surface. The permeation flux followed the cake filtration law at the initial stage of the crossflow filtration of the broths of B. subtilis and E. coli, where the cells deposited randomly on the membrane. In the case of the crossflow filtration of a L. delbrueckii broth, the period of random deposition was shorter. The specific resistance for the cake formed at the initial stage agreed with that measured in dead-end filtration. Then, the specific resistance started to increase in comparison with that measured in dead-end filtration due to shear-induced arrangement of the cells. The extent of the increase in specific resistance became higher and the time taken to start the cell arrangement became shorter with increasing circulation flow rate. The increase in specific resistance due to the shear-induced arrangement was more appreciable in the crossflow filtration of the broth of L. delbrueckii than that of B. subtilis and E. coli. The average permeation flux was increased considerably by applying periodical backwashing with appropriate time intervals. The permeation flux was well predicted by the cake filtration law, since the cells deposited in a way similar to that for dead-end filtration during a sufficiently short period of crossflow filtration in a backwashing mode. 21 refs., 11 figs.
Silica incorporated membrane for wastewater based filtration
Fernandes, C. S.; Bilad, M. R.; Nordin, N. A. H. M.
2017-10-01
Membrane technology has long been applied for waste water treatment industries due to its numerous advantages compared to other conventional processes. However, the biggest challenge in pressure driven membrane process is membrane fouling. Fouling decreases the productivity and efficiency of the filtration, reduces the lifespan of the membrane and reduces the overall efficiency of water treatment processes. In this study, a novel membrane material is developed for water filtration. The developed membrane incorporates silica nanoparticles mainly to improve its structural properties. Membranes with different loadings of silica nanoparticles were applied in this study. The result shows an increase in clean water permeability and filterability of the membrane for treating activated sludge, microalgae solution, secondary effluent and raw sewage as feed. Adding silica into the membrane matrix does not significantly alter contact angle and membrane pore size. We believe that silica acts as an effective pore forming agent that increases the number of pores without significantly altering the pore sizes. A higher number of small pores on the surface of the membrane could reduce membrane fouling because of a low specific loading imposed to individual pores.
Filtration and compression of organic materials
DEFF Research Database (Denmark)
Christensen, Morten Lykkegaard; Keiding, Kristian
is to use more simple systems. Dextran-MnO2 particles and polystyrene particles with a water-swollen polyacrylic acid shell have therefore been synthesised. These particles have been filtered and used to study the non-linear filtration behaviour. The compressibility of the formed cake has been investigated......The conventional filtration theory has been based on filtrations of incompressible particles such as anatase, kaolin and clay. The filtration models have later been used for organic slurries but can often not explain the observed experimental data. At constant pressure, the filtrate volume does...... and the discrepancy between the filtration theory and the observed filtration behaviour explained as a time-dependent collapse of the formed cake (creep). Thus, the creep phenomenon has been adopted in the conventional filtration models and it will be shown that the model can be used to simulate filtration data...
DEFF Research Database (Denmark)
Yuan, Hao; Shapiro, Alexander
There is a considerable and ongoing effort aimed at understanding the transport and the deposition of suspended particles in porous media, especially non-Fickian transport and non-exponential deposition of particles. In this work, the influential parameters in filtration models are studied...... to understand their effects on the non-Fickian transport and the non-exponential deposition. The filtration models are validated by the comparisons between the modelling results and the experimental data.The elliptic equation with distributed filtration coefficients may be applied to model non-Fickian transport...... and hyperexponential deposition. The filtration model accounting for the migration of surface associated particles may be applied for non-monotonic deposition....
Filtration Efficiency of Functionalized Ceramic Foam Filters for Aluminum Melt Filtration
Voigt, Claudia; Jäckel, Eva; Taina, Fabio; Zienert, Tilo; Salomon, Anton; Wolf, Gotthard; Aneziris, Christos G.; Le Brun, Pierre
2017-02-01
The influence of filter surface chemistry on the filtration efficiency of cast aluminum alloys was evaluated for four different filter coating compositions (Al2O3—alumina, MgAl2O4—spinel, 3Al2O3·2SiO2—mullite, and TiO2—rutile). The tests were conducted on a laboratory scale with a filtration pilot plant, which facilitates long-term filtration tests (40 to 76 minutes). This test set-up allows the simultaneous use of two LiMCAs (before and after the filter) for the determination of the efficiency of inclusion removal. The four tested filter surface chemistries exhibited good thermal stability and mechanical robustness after 750 kg of molten aluminum had been cast. All four filter types exhibited a mean filtration efficiency of at least 80 pct. However, differences were also observed. The highest filtration efficiencies were obtained with alumina- and spinel-coated filter surfaces (>90 pct), and the complete removal of the largest inclusions (>90 µm) was observed. The efficiency was slightly lower with mullite- and rutile-coated filter surfaces, in particular for large inclusions. These observations are discussed in relation to the properties of the filters, in particular in terms of, for example, the surface roughness.
Hepatocyte produced matrix metalloproteinases are regulated by CD147 in liver fibrogenesis.
Calabro, Sarah R; Maczurek, Annette E; Morgan, Alison J; Tu, Thomas; Wen, Victoria W; Yee, Christine; Mridha, Auvro; Lee, Maggie; d'Avigdor, William; Locarnini, Stephen A; McCaughan, Geoffrey W; Warner, Fiona J; McLennan, Susan V; Shackel, Nicholas A
2014-01-01
The classical paradigm of liver injury asserts that hepatic stellate cells (HSC) produce, remodel and turnover the abnormal extracellular matrix (ECM) of fibrosis via matrix metalloproteinases (MMPs). In extrahepatic tissues MMP production is regulated by a number of mechanisms including expression of the glycoprotein CD147. Previously, we have shown that CD147 is expressed on hepatocytes but not within the fibrotic septa in cirrhosis [1]. Therefore, we investigated if hepatocytes produce MMPs, regulated by CD147, which are capable of remodelling fibrotic ECM independent of the HSC. Non-diseased, fibrotic and cirrhotic livers were examined for MMP activity and markers of fibrosis in humans and mice. CD147 expression and MMP activity were co-localised by in-situ zymography. The role of CD147 was studied in-vitro with siRNA to CD147 in hepatocytes and in-vivo in mice with CCl4 induced liver injury using ãCD147 antibody intervention. In liver fibrosis in both human and mouse tissue MMP expression and activity (MMP-2, -9, -13 and -14) increased with progressive injury and localised to hepatocytes. Additionally, as expected, MMPs were abundantly expressed by activated HSC. Further, with progressive fibrosis there was expression of CD147, which localised to hepatocytes but not to HSC. Functionally significant in-vitro regulation of hepatocyte MMP production by CD147 was demonstrated using siRNA to CD147 that decreased hepatocyte MMP-2 and -9 expression/activity. Further, in-vivo α-CD147 antibody intervention decreased liver MMP-2, -9, -13, -14, TGF-β and α-SMA expression in CCl4 treated mice compared to controls. We have shown that hepatocytes produce active MMPs and that the glycoprotein CD147 regulates hepatocyte MMP expression. Targeting CD147 regulates hepatocyte MMP production both in-vitro and in-vivo, with the net result being reduced fibrotic matrix turnover in-vivo. Therefore, CD147 regulation of hepatocyte MMP is a novel pathway that could be targeted by
Hepatocyte produced matrix metalloproteinases are regulated by CD147 in liver fibrogenesis.
Directory of Open Access Journals (Sweden)
Sarah R Calabro
Full Text Available The classical paradigm of liver injury asserts that hepatic stellate cells (HSC produce, remodel and turnover the abnormal extracellular matrix (ECM of fibrosis via matrix metalloproteinases (MMPs. In extrahepatic tissues MMP production is regulated by a number of mechanisms including expression of the glycoprotein CD147. Previously, we have shown that CD147 is expressed on hepatocytes but not within the fibrotic septa in cirrhosis [1]. Therefore, we investigated if hepatocytes produce MMPs, regulated by CD147, which are capable of remodelling fibrotic ECM independent of the HSC.Non-diseased, fibrotic and cirrhotic livers were examined for MMP activity and markers of fibrosis in humans and mice. CD147 expression and MMP activity were co-localised by in-situ zymography. The role of CD147 was studied in-vitro with siRNA to CD147 in hepatocytes and in-vivo in mice with CCl4 induced liver injury using ãCD147 antibody intervention.In liver fibrosis in both human and mouse tissue MMP expression and activity (MMP-2, -9, -13 and -14 increased with progressive injury and localised to hepatocytes. Additionally, as expected, MMPs were abundantly expressed by activated HSC. Further, with progressive fibrosis there was expression of CD147, which localised to hepatocytes but not to HSC. Functionally significant in-vitro regulation of hepatocyte MMP production by CD147 was demonstrated using siRNA to CD147 that decreased hepatocyte MMP-2 and -9 expression/activity. Further, in-vivo α-CD147 antibody intervention decreased liver MMP-2, -9, -13, -14, TGF-β and α-SMA expression in CCl4 treated mice compared to controls.We have shown that hepatocytes produce active MMPs and that the glycoprotein CD147 regulates hepatocyte MMP expression. Targeting CD147 regulates hepatocyte MMP production both in-vitro and in-vivo, with the net result being reduced fibrotic matrix turnover in-vivo. Therefore, CD147 regulation of hepatocyte MMP is a novel pathway that could be
MULTILAYER POROUS COMPOSITE FROM WASTE GLASS FOR WATER FILTRATION
Directory of Open Access Journals (Sweden)
M. P. Aji
2015-07-01
Full Text Available Multilayer porous composite have been produced through the heating process at temperature T=700oC for 2.5 h. Single layered porous composite was made with a varied mass percentage of from PEG polymer 1% to 10%. Double-layered porous composite were made by the arrangement of porosity (4:3%, (4:2% and (3:2%, while the three-layers porous composite have an arrangement (4:3:2%. Performance of multilayer porous composite for water filtration with pollutants of methylene blue 100 ppm was estimated from the absorbance spectrum. Rejection of methylene blue pollutants from single layered porous composite increases when the fraction of PEG polymer tend to be smaller in the matrix. Meanwhile, the double layered porous composite has a degradation of methylene blue pollutants are better than one layer. Triple layered porous composite have good performance for the water filtration where all the pollutants of methylene blue be able to be filtered. Komposit pori berlapis telah dihasilkan dengan proses pemanasan pada temperatur T=700oC selama 2.5 jam. Komposit pori satu lapis dibuat dengan variasi persen massa polimer PEG 1% hingga 10%. Komposit pori dua lapis dibuat dengan susunan porositas (4:3%, (4:2% dan (3:2%, sedangkan komposit pori tiga lapis memiliki susunan porositas (4:3:2%. Kinerja komposit pori berlapis untuk filter air dengan polutan methylene blue 100 ppm diestimasi dari spektrum absorbansi. Rejeksi polutan methylene blue dari komposit pori satu lapis meningkat saat fraksi polimer PEG cenderung lebih kecil dalam matrik komposit. Sedangkan, komposit pori dua lapis memiliki kemampuan untuk degradasi polutan methylene blue yang lebih baik dari satu lapis. Komposit pori tiga lapis memiliki kinerja yang baik untuk filter air dimana seluruh polutan methylene blue mampu disaring.
PROBLEMS OF NONSTATIONARY FILTRATION
Directory of Open Access Journals (Sweden)
Vsevolod A. Shabanov
2018-03-01
Full Text Available he article deals with the classical hydrodynamic theory of filtration. Discusses models of soil, fluid and nature of fluid flow that formed the basis for the creation of the classic filtration theory. Also discusses the assumptions made for the linearization of the equations. Evaluated the scope of the classical filtration theory. Proposed a new model of filtration through a porous medium, based on the application of the laws of theoretical mechanics. It is based on the classical model of soil: the soil is composed of capillaries with ..parallel axes, in which the liquid moves. For tasks of infiltration equations of motion. Considered special cases of unsteady motion of a finite volume of liquid. Numerical example a machine experiment.
Friedman, Lisa; Kolter, Roberto
2004-07-01
Pseudomonas aeruginosa forms biofilms, which are cellular aggregates encased in an extracellular matrix. Molecular genetics studies of three common autoaggregative phenotypes, namely wrinkled colonies, pellicles, and solid-surface-associated biofilms, led to the identification of two loci, pel and psl, that are involved in the production of carbohydrate-rich components of the biofilm matrix. The pel gene cluster is involved in the production of a glucose-rich matrix material in P. aeruginosa strain PA14 (L. Friedman and R. Kolter, Mol. Microbiol. 51:675-690, 2004). Here we investigate the role of the pel gene cluster in P. aeruginosa strain ZK2870 and identify a second genetic locus, termed psl, involved in the production of a mannose-rich matrix material. The 11 predicted protein products of the psl genes are homologous to proteins involved in carbohydrate processing. P. aeruginosa is thus able to produce two distinct carbohydrate-rich matrix materials. Either carbohydrate-rich matrix component appears to be sufficient for mature biofilm formation, and at least one of them is required for mature biofilm formation in P. aeruginosa strains PA14 and ZK2870. Copyright 2004 American Society for Microbiology
Monaci, Linda; Quintieri, Laura; Caputo, Leonardo; Visconti, Angelo; Baruzzi, Federico
2016-01-15
Several Bacillus strains, typically isolated from different food sources, represent renowned producers of a multitude of low and high molecular weight compounds, including lipopeptides and macrolactones, with an importance for their antimicrobial activity. The high homology shared by many of these compounds also occurring as closely related isoforms poses a challenge in their prompt detection. Identification and structural elucidation is generally achieved by matrix-assisted laser desorption/ionization (MALDI) or liquid chromatography (LC) coupled to mass spectrometry (MS) after a pre-fractionation and/or purification step of the extract. In this paper we report the application of a method based on LC separation and high-resolution Orbitrap™-based MS for the rapid screening of raw filtrate of the strain Bacillus subtilis TR50 endowed with antimicrobial activity, without requiring any sample pre-treatment. Upon direct analysis of the cell-free filtrate of Bacillus subtilis TR50 by high-resolution mass spectrometry (HRMS), different compounds families, that proved to exert a remarked antimicrobial activity against several foodborne pathogens, can be readily displayed along the chromatographic run. Among them, three different classes were identified and characterized belonging to the iturin, fengycin and surfactin groups. The high resolving power and accurate mass accuracy provided by the HRMS system in use ensured an enhanced selectivity compared to other mass spectrometers. In addition, after activation of the HCD cell, the HR-MS/MS spectra can provide insights in the structural elucidation of several compounds. The acquisition of HRMS spectra of raw filtrates of subtilis strains allows untargeted analysis of the major classes of compounds produced to be performed, thus facilitating identification of other unknown bioactive molecules after retrospective analysis. These features make this approach a fast tool applicable to the rapid screening and further
Assessment of endophytic fungi cultural filtrate on soybean seed ...
African Journals Online (AJOL)
Soybean seeds have high amount of isoflavones but its germination is often confronted with a variety of environmental problems resulting in low germination rate and growth. To overcome this in eco-friendly manner, we investigated the influence of cultural filtrate (CF) of gibberellins-producing endophytic fungi on soybean ...
Corrosion-product filtration in PWRs: Topical report
International Nuclear Information System (INIS)
Balakrishnan, P.V.; Buckley, L.P.
1988-04-01
As part of a programme on the optimization of pressurized water reactor (PWR) secondary side water treatment, laboratory-scale studies on filtration of the feedwater using materials having chemically active adsorbing surfaces were carried out. Graphite, zirconia and titania were identified, from a review of existing literature, as suitable filtration media, the last two because of their ion-exchange capability. The efficiency of filters packed with granular graphite for filtration of simulated feed train corrosion products and the pressure drop across the filters were determined as functions of filter dimensions and operating parameters at room temperature. A rough sizing of a full-flow feedwater filter using granular graphite was done on the basis of observations from the room temperature tests. Further studies are suggested at low concentrations of the corrosion product and at high temperature typical of steam generator feedwater after the high pressure heaters to derive realistic design parameters for a filter for installation in the PWR secondary circuit. Zirconia was produced in the form of spherical particles using a sol-gel process. The zirconia behaved as an anion exchanger at low pH and as a cation exchanger at high pH. Its suitability for purification of water at high temperature should be determined by futher studies. 30 refs., 16 figs., 8 tabs
Polymer filtration: A new technology for selective metals recovery
Energy Technology Data Exchange (ETDEWEB)
Smith, B.F.; Robison, T.W.; Cournoyer, M.E.; Wilson, K.V.; Sauer, N.N.; Mullen, K.I.; Lu, M.T.; Jarvinen, J.J.
1995-04-01
Polymer Filtration (PF) was evaluated for the recovery of electroplating metal ions (zinc and nickel) from rinse waters. Polymer Filtration combines the use of water-soluble metal-binding polymers and ultrafiltration to concentrate metal ions from dilute rinse water solutions. The metal ions are retained by the polymers; the smaller, unbound species freely pass through the ultrafiltration membrane. By using this process the ultrafiltered permeate more than meets EPA discharge limits. The metal ions are recovered from the concentrated polymer solution by pH adjustment using diafiltration and can be recycled to the original electroplating baths with no deleterious effects on the test panels. Metal-ion recovery is accomplished without producing sludge.
International Nuclear Information System (INIS)
Gaubert, Eric
1997-01-01
This research thesis addresses the use of a membrane-based technique, nano-filtration, aided or not by complexation, for the processing of highly saline liquid effluents produced by radio-chemical decontamination. The objective is to separate non-radioactive elements (sodium nitrate) from radio-elements (caesium, strontium and actinides) in order to reduce the volume of wastes. Within the perspective of an industrial application, a system to concentrate the effluent is firstly defined. Different nano-filtration membranes are tested and reveal to be insufficient in highly saline environment. A stage of selective complexation of radio-elements is therefore considered before nano-filtration. The main factors affecting performance of nano-filtration-complexation (for a given membrane system) are identified: ionic force, pH, ligand content, trans-membrane pressure. Finally, a nano-filtration pilot is implemented to perform nano-filtration-complexation operations by remote handling on radioactive substances [fr
Filtrations of free groups as intersections
Efrat, Ido
2013-01-01
For several natural filtrations of a free group S we express the n-th term of the filtration as the intersection of all kernels of homomorphisms from S to certain groups of upper-triangular unipotent matrices. This generalizes a classical result of Grun for the lower central filtration. In particular, we do this for the n-th term in the lower p-central filtration of S.
Energy Technology Data Exchange (ETDEWEB)
Mailloux, Ryan J.; Yumvihoze, Emmanuel; Chan, Hing Man, E-mail: laurie.chan@uottawa.ca
2015-12-15
The mechanism of intracellular metabolism of methylmercury (MeHg) is not fully known. It has been shown that superoxide (O{sub 2}·{sup −}), the proximal reactive oxygen species (ROS) generated by mitochondria, is responsible for MeHg demethylation. Here, we investigated the impact of different mitochondrial respiratory inhibitors, namely rotenone and antimycin A, on the O{sub 2}·{sup −} mediated degradation of MeHg in human neuroblastoma cells SH-K-SN. We also utilized paraquat (PQ) which generates O{sub 2}·{sup −} in the mitochondrial matrix. We found that the cleavage of the carbon-metal bond in MeHg was highly dependent on the topology of O{sub 2}·{sup −} production by mitochondria. Both rotenone and PQ, which increase O{sub 2}·{sup −} in the mitochondrial matrix at a dose-dependent manner, enhanced the conversion of MeHg to inorganic mercury (iHg). Surprisingly, antimycin A, which prompts emission of O{sub 2}·{sup −} into the intermembrane space, did not have the same effect even though antimycin A induced a dose dependent increase in O{sub 2}·{sup −} emission. Rotenone and PQ also enhanced the toxicity of sub-toxic doses (0.1 μM) MeHg which correlated with the accumulation of iHg in mitochondria and depletion of mitochondrial protein thiols. Taken together, our results demonstrate that MeHg degradation is mediated by mitochondrial O{sub 2}·{sup −}, specifically within the matrix of mitochondria when O{sub 2}·{sup −} is in adequate supply. Our results also show that O{sub 2}·{sup −} amplifies MeHg toxicity specifically through its conversion to iHg and subsequent interaction with protein cysteine thiols (R-SH). The implications of our findings in mercury neurotoxicity are discussed herein. - Highlights: • Superoxide produced in the matrix of mitochondria degrades MeHg. • Superoxide produced in intermembrane space does not degrade MeHg. • Matrix-generated superoxide enhances Hg toxicity by converting MeHg to iHg.
Optimization of suspensions filtration with compressible cake
Directory of Open Access Journals (Sweden)
Janacova Dagmar
2016-01-01
Full Text Available In this paper there is described filtering process for separating reaction mixture after enzymatic hydrolysis to process the chromium tanning waste. Filtration of this mixture is very complicated because it is case of mixture filtration with compressible cake. Successful process strongly depends on mathematical describing of filtration, calculating optimal values of pressure difference, specific resistant of filtration cake and temperature maintenance which is connected with viscosity change. The mathematic model of filtration with compressible cake we verified in laboratory conditions on special filtration device developed on our department.
Radioactive slurry waste treatment (1) - flucculant dose effects on filtration
International Nuclear Information System (INIS)
Jung, K. H.; Park, S. K.; Jung, W. S.; Baek, S. T.; Jung, K. J.
1999-01-01
During the past four decades, the radioactive slurry liquid waste(RSLW) is produced by operation of TRIGA Mark - II and III research reactors, producing radioisotopes and studying on RI utilization. Vacuum filtration of RSLW and flocculated RSLW with cationic, anionic and nonionic flocculants has been investigated. Test results show that critical dose of flocculant is obtained by the estimation of settling rate, cake moisture content and specific cake residence
1986-01-01
American Water Corporation manufactures water filtration products which incorporate technology originally developed for manned space operations. The formula involves granular activated charcoal and other ingredients, and removes substances by catalytic reactions, mechanical filtration, and absorption. Details are proprietary. A NASA literature search contributed to development of the compound. The technology is being extended to a deodorizing compound called Biofresh which traps gas and moisture inside the unit. Further applications are anticipated.
A Brief Review of Filtration Studies for Waste Treatment at the Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Daniel, Richard C.; Schonewill, Philip P.; Shimskey, Rick W.; Peterson, Reid A.
2010-12-01
This document completes the requirements of Milestone 1-2, PNNL Draft Literature Review, discussed in the scope of work outlined in the EM-31 Support Project task plan WP-2.3.6-2010-1. The focus of task WP 2.3.6 is to improve the U.S. Department of Energy’s (DOE’s) understanding of filtration operations for high-level waste (HLW) to enhance filtration and cleaning efficiencies, thereby increasing process throughput and reducing the sodium demand (through acid neutralization). Developing the processes for fulfilling the cleaning/backpulsing requirements will result in more efficient operations for both the Hanford Tank Waste Treatment and Immobilization Plant (WTP) and the Savannah River Site (SRS), thereby increasing throughput by limiting cleaning cycles. The purpose of this document is to summarize Pacific Northwest National Laboratory’s (PNNL’s) literature review of historical filtration testing at the laboratory and of testing found in peer-reviewed journals. Eventually, the contents of this document will be merged with a literature review by SRS to produce a summary report for DOE of the results of previous filtration testing at the laboratories and the types of testing that still need to be completed to address the questions about improved filtration performance at WTP and SRS. To this end, this report presents 1) a review of the current state of crossflow filtration knowledge available in the peer-reviewed literature, 2) a detailed review of PNNL-related filtration studies specific to the Hanford site, and 3) an overview of current waste filtration models developed by PNNL and suggested avenues for future model development.
EM Task 9 - Centrifugal Membrane Filtration
International Nuclear Information System (INIS)
Stevens, B.G.; Stepan, D.J.; Hetland, M.D.
1998-01-01
This project is designed to establish the utility of a novel centrifugal membrane filtration technology for the remediation of liquid mixed waste streams at US Department of Energy (DOE) facilities in support of the DOE Environmental Management (EM) program. The Energy and Environmental Research Center (EERC) has teamed with SpinTek Membrane Systems, Inc., a small business and owner of the novel centrifugal membrane filtration technology, to establish the applicability of the technology to DOE site remediation and the commercial viability of the technology for liquid mixed waste stream remediation. The technology is a uniquely configured process that makes use of ultrafiltration and centrifugal force to separate suspended and dissolved solids from liquid waste streams, producing a filtered water stream and a low-volume contaminated concentrate stream. This technology has the potential for effective and efficient waste volume minimization, the treatment of liquid tank wastes, the remediation of contaminated groundwater plumes, and the treatment of secondary liquid waste streams from other remediation processes, as well as the liquid waste stream generated during decontamination and decommissioning activities
Health Benefits of Particle Filtration
Energy Technology Data Exchange (ETDEWEB)
Fisk, William J.
2013-10-01
The evidence of health benefits of particle filtration in homes and commercial buildings is reviewed. Prior reviews of papers published before 2000 are summarized. The results of 16 more recent intervention studies are compiled and analyzed. Also, reviewed are four studies that modeled health benefits of using filtration to reduce indoor exposures to particles from outdoors. Prior reviews generally concluded that particle filtration is, at best, a source of small improvements in allergy and asthma health effects; however, many early studies had weak designs. A majority of recent intervention studies employed strong designs and more of these studies report statistically significant improvements in health symptoms or objective health outcomes, particularly for subjects with allergies or asthma. The percent age improvement in health outcomes is typically modest, for example, 7percent to 25percent. Delivery of filtered air to the breathing zone of sleeping allergic or asthmatic persons may be more consistently effective in improving health than room air filtration. Notable are two studies that report statistically significant improvements, with filtration, in markers that predict future adverse coronary events. From modeling, the largest potential benefits of indoor particle filtration may be reductions in morbidity and mortality from reducing indoor exposures to particles from outdoor air.
Health Benefits of Particle Filtration
Energy Technology Data Exchange (ETDEWEB)
Fisk, William J.
2013-10-01
The evidence of health benefits of particle filtration in homes and commercial buildings is reviewed. Prior reviews of papers published before 2000 are summarized. The results of 16 more recent intervention studies are compiled and analyzed. Also reviewed are four studies that modeled health benefits of using filtration to reduce indoor exposures to particles from outdoors. Prior reviews generally concluded that particle filtration is, at best, a source of small improvements in allergy and asthma health effects; however, many early studies had weak designs. A majority of recent intervention studies employed strong designs and more of these studies report statistically significant improvements in health symptoms or objective health outcomes, particularly for subjects with allergies or asthma. The percentage improvement in health outcomes is typically modest, e.g., 7percent to 25percent. Delivery of filtered air to the breathing zone of sleeping allergic or asthmatic persons may be more consistently effective in improving health than room air filtration. Notable are two studies that report statistically significant improvements, with filtration, in markers that predict future adverse coronary events. From modeling, the largest potential benefits of indoor particle filtration may be reductions in morbidity and mortality from reducing indoor exposures to particles from outdoor air.
Filtration Behaviour and Fouling Mechanisms of Polysaccharides
Directory of Open Access Journals (Sweden)
Sondus Jamal
2014-07-01
Full Text Available This study investigated filtration behaviors of polysaccharides solutions, both alone and in mixture with proteins, in the short-time constant flux filtration with the focus on factors affecting the transmembrane pressure (TMP increase rate, the irreversible filtration resistance, and the membrane rejection behavior. The results showed that the TMP increase rates in the short-time constant flux filtration of alginate solutions were significantly affected by the calcium addition, alginate concentration, and flux. Although the addition of calcium resulted in a decrease in the TMP increase rate, it was found that the irreversible fouling developed during the filtration increased with the calcium addition, implying that the double-sided effect of calcium on membrane filtration and that the TMP increase rate observed in the filtration does not always reflect the irreversible membrane fouling development. It was also found that for the filtration of solutions containing mixed alginate and BSA, alginate exerted a dominant effect on the TMP increase rate and the membrane exhibited a reduced rejection to both alginate and BSA molecules compared to that in the filtration of the pure alginate or BSA.
Health Benefits of Particle Filtration
Fisk, William J.
2013-01-01
The evidence of health benefits of particle filtration in homes and commercial buildings is reviewed. Prior reviews of papers published before 2000 are summarized. The results of 16 more recent intervention studies are compiled and analyzed. Also reviewed are four studies that modeled health benefits of using filtration to reduce indoor exposures to particles from outdoors. Prior reviews generally concluded that particle filtration is, at best, a source of small improvements in allergy and as...
DEFF Research Database (Denmark)
McCloskey, Douglas; Utrilla, Jose; Naviaux, Robert K.
2015-01-01
, we develop a fast-filtration method using pressuredriven Swinnex filters. We show that the method is fast enough to provide an accurate snapshot of intracellular metabolism, reduces matrix interference from the media to improve the number of compounds that can be detected, and is applicable...... to anaerobic and aerobic liquid cultures grown in a variety of culturing systems. Furthermore, we apply the fast filtration method to investigate differences in the absolute intracellular metabolite levels of anaerobic cultures grown in minimal and complex media....
Relation Between Filtration and Soil Consolidation Theories
Directory of Open Access Journals (Sweden)
Strzelecki Tomasz
2015-03-01
Full Text Available This paper presents a different, than commonly used, form of equations describing the filtration of a viscous compressible fluid through a porous medium in isothermal conditions. This mathematical model is compared with the liquid flow equations used in the theory of consolidation. It is shown that the current commonly used filtration model representation significantly differs from the filtration process representation in Biot’s and Terzaghi’s soil consolidation models, which has a bearing on the use of the methods of determining the filtration coefficient on the basis of oedometer test results. The present analysis of the filtration theory equations should help interpret effective parameters of the non-steady filtration model. Moreover, equations for the flow of a gas through a porous medium and an interpretation of the filtration model effective parameters in this case are presented.
Health benefits of particle filtration.
Fisk, W J
2013-10-01
The evidence of health benefits of particle filtration in homes and commercial buildings is reviewed. Prior reviews of papers published before 2000 are summarized. The results of 16 more recent intervention studies are compiled and analyzed. Also, reviewed are four studies that modeled health benefits of using filtration to reduce indoor exposures to particles from outdoors. Prior reviews generally concluded that particle filtration is, at best, a source of small improvements in allergy and asthma health effects; however, many early studies had weak designs. A majority of recent intervention studies employed strong designs and more of these studies report statistically significant improvements in health symptoms or objective health outcomes, particularly for subjects with allergies or asthma. The percentage improvement in health outcomes is typically modest, for example, 7% to 25%. Delivery of filtered air to the breathing zone of sleeping allergic or asthmatic persons may be more consistently effective in improving health than room air filtration. Notable are two studies that report statistically significant improvements, with filtration, in markers that predict future adverse coronary events. From modeling, the largest potential benefits of indoor particle filtration may be reductions in morbidity and mortality from reducing indoor exposures to particles from outdoor air. Published 2013. This article is a US Government work and is in the public domain in the USA.
Filtration in ultrasonic field; Filtracao em campo ultrassonico
Energy Technology Data Exchange (ETDEWEB)
Rocha, Inaura Carolina C. da; Cortes, Marcela de Araujo H.; Marques, Jose Jailton [Universidade Federal de Sergipe (UFS), Aracaju, SE (Brazil). Dept. de Engenharia Quimica
2008-07-01
The production of water associated to the petroleum is an issue of big relevance in exploration areas classified as 'exhausted fields'. The current alternative in practice is the re-injection of the wastewater into the geological formation with the dual purpose of increasing oil recovery and pollution minimization. However, produced water presents several components that make impossible its direct re-injection, requiring a previous treatment. In this context, this work presents the state-of-art of filtration in ultrasonic field, in order to contribute to the development of a new treatment technology applicable to the produced water problem. (author)
Energy Technology Data Exchange (ETDEWEB)
Singer, Brett C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Delp, William W. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Black, Douglas R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Walker, Iain S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2016-12-01
This study evaluated nine ventilation and filtration systems in an unoccupied 2006 house located 250m downwind of the I-80 freeway in Sacramento, California. Systems were evaluated for reducing indoor concentrations of outdoor particles in summer and fall/winter, ozone in summer, and particles from stir-fry cooking. Air exchange rate was measured continuously. Energy use was estimated for year-round operation in California. Exhaust ventilation without enhanced filtration produced indoor PM2.5 that was 70% lower than outdoors. Supply ventilation with MERV13 filtration provided slightly less protection whereas supply MERV16 filtration reduced PM2.55 by 97-98% relative to outdoors. Supply filtration systems used little energy but provided no benefits for indoor-generated particles. Systems with MERV13-16 filters in the recirculating heating and cooling unit (FAU) operating continuously or 20 min/h reduced PM2.5 by 93-98%. Across all systems, removal percentages were higher for ultrafine particles and lower for black carbon, relative to PM2.5. Indoor ozone was 3-4% of outdoors for all systems except an electronic air cleaner that produced ozone. Filtration via the FAU or portable filtration units lowered PM2.5 by 25-75% when operated over the hour following cooking. The energy for year-round operation of FAU filtration with an efficient blower motor was estimated at 600 kWh/year.
Petrusevski, B.; Vlaski, A.; Van Breemen, A.N.; Alaerts, G.J.
1993-01-01
This presentation summarises basic information on direct filtration, and demonstrates the main research findings, related to the performance of simple in-line direct filtration. The results reported are part of a comprehensive ongoing research programm "Direct filtration of Biesbosch water"
Filtration approach to mitigate indoor Thoron progeny concentration
International Nuclear Information System (INIS)
Wang, J.; Meisenberg, O.; Karg, E.; Tschiersch, J.; Chen, Y.
2010-01-01
This study investigates filtration of air as potential mitigation method of thoron progeny exposure. The experiments were conducted in a model room (volume 7.1 m 3 ) which was equipped with a pump and an HEPA (high efficiency particulate air) filter. Filtration at a rate of 0.2, 0.4, 0.5 and 0.8 h -1 during 88 h proved an effective practice in reducing the total indoor thoron decay product concentration. The results indicate that 0.4-0.8 h -1 filtration rate had almost the same filtration efficiency in decreasing the total thoron EEC (equilibrium equivalent concentration) by 97% while 80% of total thoron EEC were reduced by 0.2 h -1 filtration rate; meanwhile, the unattached thoron EEC rose significantly by 190, 270, 290%, respectively under 0.4-0.8 h -1 filtration rate, whereas 0.2 h -1 filtration rate increased unattached thoron EEC by 40%. The aerosol number size distribution variation reveals that filtration operation removes smaller particles faster or earlier than the larger ones. The annual effective dose calculated was reduced by 91-92% at a filtration rate of 0.4-0.8 h -1 while 75% reduced at 0.2 h -1 filtration rate after 88 h filtration process. (authors)
Portable field water sample filtration unit
International Nuclear Information System (INIS)
Hebert, A.J.; Young, G.G.
1977-01-01
A lightweight back-packable field-tested filtration unit is described. The unit is easily cleaned without cross contamination at the part-per-billion level and allows rapid filtration of boiling hot and sometimes muddy water. The filtration results in samples that are free of bacteria and particulates and which resist algae growth even after storage for months. 3 figures
Problems of multiphase fluid filtration
Konovalov, AN
1994-01-01
This book deals with a spectrum of problems related to the mathematical modeling of multiphase filtration. Emphasis is placed on an inseparable triad: model - algorithm - computer code. An analysis of new and traditional filtration problems from the point of view of both their numerical implementation and the reproduction of one or another technological characteristics of the processes under consideration is given. The basic principles which underlie the construction of efficient numerical methods taking into account the filtration problems are discussed: non-evolutionary nature, degeneration,
Liu, Dejian; Hu, Peipei; Min, Guoqing
2015-06-01
Laser injection of ceramic particle was conducted to produce particulate reinforced metal matrix composites (MMCs) coating on Ti-6Al-4V alloy. Cast WC particle (WCp) was used as injection reinforcement to avoid excessive release of carbon atoms into the melt pool. The interfaces and boundaries between WC and Ti matrix were investigated by electron microscopy study. Compared with single crystal WCp, cast WCp was an appropriate solution to control the reaction products (TiC) in the matrix and the total amount of reaction products was significantly reduced. Irregular-shape reaction layers were formed around cast WCp. The reaction layers consist of a W2C layer and a mixed layer of W and TiC. Such reaction layers are effective in load transfer under an external load.
International Nuclear Information System (INIS)
Depaoli, D.
1996-01-01
This task will investigate the capabilities of magnetic-seeding filtration for the enhanced removal of magnetic and nonmagnetic particulates from liquids. This technology appies to a wide range of liquid wastes, including groundwater, process waters, and tank supernatant. Magnetic-seeding filtration can be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal-size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes
Latest aspects of mechanical filtration
Directory of Open Access Journals (Sweden)
Stanislav Koláček
2013-01-01
Full Text Available The aim of this study was to describe and unify all knowledge about mechanic filtration. The first part deals with the parameters and properties of filtration. Here some important basic concepts are explained such as pressure gradient, filter life, etc. There’s also a description of convenient filtration technology for coarse and fine materials, such as sand, smoke or soot. The second part primarily focuses on the real use and application of filters for liquid and gaseous media. The differences in construction between different types of filters for filtration of fuels, oils, hydraulic fluids, air and cabin filters are described. The last section is focused mainly on new materials for the production of filters. These materials are ceramic or nanomaterials, which can actually be enriched for example with antibacterial silver or some fungicides.
Production of a ruminant protein supplement by anaerobic fermentation of feedlot waste filtrate
Energy Technology Data Exchange (ETDEWEB)
Reddy, C.A.; Erdman, M.D.
1977-01-01
In studies initiated to develop simple and efficient procedures for the production of feed supplements, it was shown that the filtrate from feedlot wastes diluted with water and filtered could be fermented under anaerobic conditions by mixed rumen bacteria, Lactobacilli, or natural microflora from the feedlot wastes to produce a protein-rich feed supplement. The filtrate is low in carbohydrate and therefore supplemental carbohydrate in the form of whey, molasses, starch from potato processing wastes, or corn starch is necessary. Rigid anaerobic conditions need not be maintained nor must aseptic conditions be observed. (JSR)
Directory of Open Access Journals (Sweden)
A.P.S. Souza Filho
2007-03-01
germination and radicle and hypocotyl elongation of the weeds Mimosa pudica and Senna obtusifolia. The results showed potential inhibitory allelopathic activity of the Fusarium culture filtrate, varying according to concentration and receiving plants. The intensity of the inhibition effects promoted by the extracts was clearly associated to concentration, with the major effect being observed at 4%. Regardless of concentration and bioassays, Mimosa pudica was more sensitive to the toxin effects of the culture filtrate. Radicle elongation was more intensely inhibited by the culture filtrate toxins. The results showed potential for the use of the toxins produced by Fusarium solani f. sp. pipers, as an alternative source to control weeds. However, further studies should be carried out.
40 CFR 141.174 - Filtration sampling requirements.
2010-07-01
... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection... water system subject to the requirements of this subpart that provides conventional filtration treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Filtration sampling requirements. 141...
Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1997-09-01
Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization
2010-07-01
... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...
Controlling inclusions through filtration in investment casting process
International Nuclear Information System (INIS)
Ahmad, R.; Marshall, R.I.
2004-01-01
A technique for the placement of a ceramic foam filter in the feeding up of investment mould was developed which proved quite efficient in removing smaller and major inclusions through various filtration modes. Contaminated old aluminum scrap was used to prepare the melt without the addition of any cleansing and covering fluxes and the main reason was to produce more and more inclusions. Vigorous stirring was also intentionally carried out to form as much oxides as possible. During present research work effective filtration was observed. No leakage through sides of the filter occurred and similarly no choking was seen during feeding of molten metal. Microstructural studies showed the maximum retention of inclusions not only on the surface of filters but also within the various channels of the main body of the filter. The microstructures taken from the filtered test pieces were free from inclusions, which showed the effectiveness and proper placement of the filter. (author)
Godshaw, Joshua; Hopfer, Helene; Nelson, Jenny; Ebeler, Susan E
2017-09-25
Wine elemental composition varies by cultivar, geographic origin, viticultural and enological practices, and is often used for authenticity validation. Elemental analysis of wine by Inductively Coupled Plasma Mass Spectrometry (ICP-MS) is challenging due to the potential for non-spectral interferences and plasma instability arising from organic matrix components. Sample preparation mitigates these interferences, however, conflicting recommendations of best practices in ICP-MS analysis of wine have been reported. This study compared direct dilution, microwave-assisted acid digestion, and two filtration sample pretreatments, acidification prior to filtration and filtration followed by acidification, in elemental profiling of one white and three red table wines by ICP-MS. Of 43 monitored isotopes, 37 varied by sample preparation method, with significantly higher results of 17 isotopes in the microwave-digested samples. Both filtration treatments resulted in lower results for 11 isotopes compared to the other methods. Finally, isotope dilution determination of copper based on natural abundances and the 63 Cu: 65 Cu instrument response ratio agreed with external calibration and confirmed a significant sample preparation effect. Overall, microwave digestion did not compare favorably, and direct dilution was found to provide the best compromise between ease of use and result accuracy and precision, although all preparation strategies were able to differentiate the wines.
40 CFR 141.719 - Additional filtration toolbox components.
2010-07-01
... taken from a surface water or GWUDI source. A cap, such as GAC, on a single stage of filtration is not... separate stage of filtration if both filtration stages treat entire plant flow taken from a surface water... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Additional filtration toolbox...
International Nuclear Information System (INIS)
First, M.W.; Gilbert, H.
1981-01-01
Significant developments in high efficiency filtration for nuclear applications are reviewed for the period 1968 to 1980. Topics of special interest include factory (bench) and in-place test methods, new developments in paper and filter unit construction methods, vented containment air cleaning systems for LMFBR and light water moderated reactors, and decontamination of offgases from nuclear waste volume reduction processes. It is noted that standards development has been vigorously pursued during this period but that advances in filtration theory have been few. One of the significant changes likely to occur in the immediate future is adoption of the European style of HEPA filters for those that have been in service for the past three decades to obtain the benefits of having almost twice as much filter paper in the same filter cartridge. 71 references
Vistarakula, Krishna; Bergin, Mike; Hu, David
2010-11-01
Nearly every mammalian and avian eye is rimmed with lashes. We investigate experimentally the ability of lashes to reduce airborne particle deposition in the eye. We hypothesize that there is an optimum eyelash length that maximizes both filtration ability and extent of peripheral vision. This hypothesis is tested using a dual approach. Using preserved heads from 36 species of animals at the American Museum of Natural History, we determine the relationship between eye size and eyelash geometry (length and spacing). We test the filtration efficacy of these geometries by deploying outdoor manikins and measuring particle deposition rate as a function of eyelash length.
Directory of Open Access Journals (Sweden)
Shelley Rogers
2015-03-01
Full Text Available Microcystins are cyclic peptides produced by multiple cyanobacterial genera. After accumulation in the liver of animals they inhibit eukaryotic serine/threonine protein phosphatases, causing liver disease or death. Accurate detection/quantification of microcystins is essential to ensure safe water resources and to enable research on this toxin. Previous methodological comparisons have focused on detection and extraction techniques, but have not investigated the commonly used biomass enrichment steps. These enrichment steps could modulate toxin production as recent studies have demonstrated that high cyanobacterial cell densities cause increased microcystin levels. In this study, three microcystin-producing strains were processed using no cell enrichment steps (by direct freezing at three temperatures and with biomass enrichment (by centrifugation or GF/C filtration. After extraction, microcystins were analyzed using liquid chromatography-tandem mass spectrometry. All processing methods tested, except GF/C filtration, resulted in comparable microcystin quotas for all strains. The low yields observed for the filtration samples were caused by adsorption of arginine-containing microcystins to the GF/C filters. Whilst biomass enrichment did not affect microcystin metabolism over the time-frame of normal sample processing, problems associated with GF/C filtration were identified. The most widely applicable processing method was direct freezing of samples as it could be utilized in both field and laboratory environments.
Off-diagonal helicity density matrix elements for vector mesons produced in polarized e+e- processes
International Nuclear Information System (INIS)
Anselmino, M.; Murgia, F.; Quintairos, P.
1999-04-01
Final state q q-bar interactions give origin to non zero values of the off-diagonal element ρ 1,-1 of the helicity density matrix of vector mesons produced in e + e - annihilations, as confirmed by recent OPAL data on φ, D * and K * 's. New predictions are given for ρ 1,-1 of several mesons produced at large x E and small p T - i.e. collinear with the parent jet - in the annihilation of polarized 3 + and 3 - , the results depend strongly on the elementary dynamics and allow further non trivial tests of the standard model. (author)
Directory of Open Access Journals (Sweden)
YUSNITA
2005-06-01
Full Text Available Attempts to identify somaclonal variants of peanut with resistance to Sclerotium stem rot disease due to infection of S. rolfsii were conducted. The objectives of this study were to develop in vitro selection method using culture filtrates of S. rolfsii, identify culture filtrate-insensitive somatic embryo (SE of peanut after in vitro selection and regenerate peanut R0 lines originated from culture filtrate-insensitive SE. To achieve these objectives, peanut embryogenic tissues were cultured on selective medium containing various concentrations of S. rolfsii culture filtrates and sublethal concentration of the filtrates. Medium containing sublethal level of S. rolfsii culture filtrates was used to identify culture filtrate-insensitive SE of peanut. Subsequently, the selected SEs were germinated, plantlets were regenerated and preliminary tested against S. rolfsii. Results of the experiments showed that addition of S. rolfsii culture filtrates into medium for inducing peanut somatic embryos drastically reduced their growth and proliferation. S. rolfsii culture filtrates at 10% concentration has significantly reduced the number of proliferated SE per explant. However, sublethal level was achieved at 30% of culture filtrates concentration. Responses of five peanut cultivars against 30% of culture filtrates were similar, indicating they were similar in their susceptibility against S. rolfsii. A number of culture filtrate-insensitive SE were identified after culturing 1500 clumps of embryogenic tissue of peanut cv. Kelinci for three consecutive passages on medium containing 30% of culture filtrates. Germination of selected SE and regeneration of plantlet from culture filtrate-insensitive SE resulted in 50 peanut R0 lines. These lines have been grown in the plastic house and produced normal seeds for further evaluation. Results of S. rolfsii inoculation indicated the existence of chimera for insensitivity against S. rolfsii.
Side Stream Filtration for Cooling Towers
Energy Technology Data Exchange (ETDEWEB)
None
2012-10-20
This technology evaluation assesses side stream filtration options for cooling towers, with an objective to assess key attributes that optimize energy and water savings along with providing information on specific technology and implementation options. This information can be used to assist Federal sites to determine which options may be most appropriate for their applications. This evaluation provides an overview of the characterization of side stream filtration technology, describes typical applications, and details specific types of filtration technology.
Cake creep during filtration of flocculated manure
DEFF Research Database (Denmark)
Christensen, Morten Lykkegaard; Keiding, Kristian
is filtered. Hence, it is not possible to scale up the experiments, and it is therefore difficult to optimize the flocculation and estimate the needed filter media area. Similar problems have been observed when sewage sludge and synthetic core-shell colloids are filtered, and it has been suggested......, and the mixing procedure affect the result, and lab-scale experiments are often used to study how these pre-treatments influence the filtration process. However, the existing mathematical filtration models are based on filtration of inorganic particles and cannot simulate the filtration data obtained when manure...
21 CFR 177.2910 - Ultra-filtration membranes.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ultra-filtration membranes. 177.2910 Section 177... Components of Articles Intended for Repeated Use § 177.2910 Ultra-filtration membranes. Ultra-filtration membranes identified in paragraphs (a)(1), (a)(2), (a)(3), and (a)(4) of this section may be safely used in...
International Nuclear Information System (INIS)
First, M.W.; Gilbert, H.
1982-01-01
Significant developments in high-efficiency filtration for nuclear applications are reviewed for the period 1968 to 1980. Topics of special interest include (1) factory (bench) and in-place test methods, (2) new developments in paper and filter unit construction methods, (3) vented containment air cleaning systems for liquid-metal fast breeder reactors and light-water-moderated reactors, and (4) decontamination of off-gases from nuclear waste volume-reduction processes. Standards development has been vigorously pursued during this period, but advances in filtration theory have been few. One of the significant changes likely to occur in the immediate future is adoption of the European style of high-efficiency particulate air filters instead of those which have been in service for the past three decades to obtain the benefits of having almost twice as much filter paper in the same filter cartridge
Homogeneous metal matrix composites produced by a modified stir-casting technique
International Nuclear Information System (INIS)
Kennedy, A.R.; McCartney, D.G.; Wood, J.V.
1995-01-01
Al-based metal matrix composites have been made by a novel liquid processing route which is not only cheap and versatile but produces composites with extremely uniform distributions of the reinforcing phase. Particles of TiB 2 , TiC and B 4 C have been spontaneously incorporated, that is without the use of external mechanical agitation, into Al and Al-alloy melts in volume fractions as high as 0.3. This has been achieved through the use of wetting agents which produce K-Al-F based slags on the melt surface. Spontaneous particle entry and the chemistry of the slag facilitate the generation of good distributions of the reinforcing phase in the solidified composite castings. Non-clustered, near homogeneous distributions have been achieved irrespective of the casting conditions and the volume fraction, type or size of the reinforcement. The majority of the reinforcement becomes engulfed into the solid metal grains during solidification rather than, what is more commonly the case, being pushed to the inter-granular regions. This intra-granular distribution of the reinforcement is likely to improve the mechanical properties of the material
D'Urzo, Lucia; Bayana, Hareen; Vandereyken, Jelle; Foubert, Philippe; Wu, Aiwen; Jaber, Jad; Hamzik, James
2017-03-01
Specific "killer-defects", such as micro-line-bridges are one of the key challenges in photolithography's advanced applications, such as multi-pattern. These defects generate from several sources and are very difficult to eliminate. Pointof-use filtration (POU) plays a crucial role on the mitigation, or elimination, of such defects. Previous studies have demonstrated how the contribution of POU filtration could not be studied independently from photoresists design and track hardware settings. Specifically, we investigated how an effective combination of optimized photoresist, filtration rate, filtration pressure, membrane and device cleaning, and single and multilayer filter membranes at optimized pore size could modulate the occurrence of such defects [1, 2, 3 and 4]. However, the ultimate desired behavior for POU filtration is the selective retention of defect precursor molecules contained in commercially available photoresist. This optimal behavior can be achieved via customized membrane functionalization. Membrane functionalization provides additional non-sieving interactions which combined with efficient size exclusion can selectively capture certain defect precursors. The goal of this study is to provide a comprehensive assessment of membrane functionalization applied on an asymmetric ultra-high molecular weight polyethylene (UPE) membrane at different pore size. Defectivity transferred in a 45 nm line 55 nm space (45L/55S) pattern, created through 193 nm immersion (193i) lithography with a positive tone chemically amplified resist (PT-CAR), has been evaluated on organic under-layer coated wafers. Lithography performance, such as critical dimensions (CD), line width roughness (LWR) and focus energy matrix (FEM) is also assessed.
Polyamic Acid Nanofibers Produced by Needleless Electrospinning
Directory of Open Access Journals (Sweden)
Oldrich Jirsak
2010-01-01
Full Text Available The polyimide precursor (polyamic acid produced of 4,4′-oxydiphthalic anhydride and 4,4′-oxydianiline was electrospun using needleless electrospinning method. Nonwoven layers consisting of submicron fibers with diameters in the range about 143–470 nm on the polypropylene spunbond supporting web were produced. Filtration properties of these nanofiber layers on the highly permeable polypropylene support—namely filtration effectivity and pressure drop—were evaluated. Consequently, these polyamic acid fibers were heated to receive polyimide nanofibers. The imidization process has been studied using IR spectroscopy. Some comparisons with the chemically identical polyimide prepared as the film were made.
Projective Dimension in Filtrated K-Theory
DEFF Research Database (Denmark)
Bentmann, Rasmus Moritz
2013-01-01
Under mild assumptions, we characterise modules with projective resolutions of length n∈N in the target category of filtrated K-theory over a finite topological space in terms of two conditions involving certain Tor -groups. We show that the filtrated K-theory of any separable C∗dash-algebra over...... any topological space with at most four points has projective dimension 2 or less. We observe that this implies a universal coefficient theorem for rational equivariant KK-theory over these spaces. As a contrasting example, we find a separable C∗dash-algebra in the bootstrap class over a certain five......-point space, the filtrated K-theory of which has projective dimension 3. Finally, as an application of our investigations, we exhibit Cuntz-Krieger algebras which have projective dimension 2 in filtrated K-theory over their respective primitive spectrum....
The Usage of Crumb Rubber Filtration and UV Radiation for Ballast Water Treatment
Directory of Open Access Journals (Sweden)
Trika Pitana
2017-12-01
Full Text Available This research is aimed to build ship’s ballast water treatment prototipe that used to inactivate microbial water patogen in ballast water to produce unpolluted ballast water that can be standardised by IMO Ballast Water Management Convention. A simple concept that used in the development of this prototype is by draining ballast water with capacity at 5 lpm, 10 lpm and 20 lpm into alternative filtration crumb rubber and UV reactor. In the filtration process using crumb rubber, ballast water will be filtered with the precision filtration up to 50 micron, while in the UV reactor ballast water will be illuminated by UV-C with maksimum dose 16,58 mW/cm2. Finally,the study shows the performance of alternative filtration of crumb rubber and UV-C irradiation on microbial water phatogen, and at what UV-C dose ballast water treatment prototipe can inactivate microbial water phatogens, which are complying with IMO Ballast Water Management Convention ANNEX D. This research is aimed to build ship’s ballast water treatment prototipe that used to inactivate microbial water patogen in ballast water to produce unpolluted ballast water that can be standardised by IMO Ballast Water Management Convention. A simple concept that used in the development of this prototype is by draining ballast water with capacity at 5 lpm, 10 lpm and 20 lpm into alternative filtration crumb rubber and UV reactor. In the filtration process using crumb rubber, ballast water will be filtered with the precision filtration up to 50 micron, while in the UV reactor ballast water will be illuminated by UV-C with maksimum dose 16,58 mW/cm2. Finally,the study shows the performance of alternative filtration of crumb rubber and UV-C irradiation on microbial water phatogen, and at what UV-C dose ballast water treatment prototipe can inactivate microbial water phatogens, which are complying with IMO Ballast Water Management Convention ANNEX D. Normal 0 false false false EN-US X-NONE X
International Nuclear Information System (INIS)
Rajabi, Hamid; Ghaemi, Negin; Madaeni, Sayed S.; Daraei, Parisa; Astinchap, Bandar; Zinadini, Sirus; Razavizadeh, Sayed Hossein
2015-01-01
Graphical abstract: - Highlights: • ZnO nanofillers with different shape (nanorod and nanoparticle) were synthesized. • Mixed matrix PES membranes were fabricated by different concentrations of nanofillers. • Embedding nanofillers affected on morphology and hydrophilicity of PES membranes. • Nanorod MM membranes revealed the highest water flux and antifouling characteristic. • ZnO nanorod-embedded membrane showed an acceptable reusability and durability. - Abstract: Two different kinds of nano-ZnO (nanoparticle and nanorod) were synthesized, characterized, and embedded in a PES membrane matrix to investigate the effects of a nanofiller shape on the mixed matrix membrane characteristics and the antifouling capability. The mixed matrix membranes were fabricated by mixing different amounts of nanofillers with dope solution followed by a phase inversion precipitation technique. The effect of the shape of the embedded nanofillers on the morphology and performance of the fabricated membranes was studied in terms of pure water flux, fouling resistance, hydrophilicity, surface, and bulk morphology by means of permeation tests, milk powder solution filtration, water contact angle and porosity measurements, scanning electron microscopy (SEM), and atomic force microscopy (AFM) techniques. Water flux of the mixed matrix membranes significantly improved after the addition of both types of ZnO nanofillers due to a higher hydrophilicity and porosity of the prepared membranes. The water contact angle measurements confirmed the increased hydrophilicity of the modified membranes, particularly in the ZnO nanorod mixed membranes. Fouling resistance of the membranes assessed by powder milk solution filtration revealed that 0.1 wt% ZnO nanorod membrane has the best antifouling property. The prepared mixed matrix membranes embedded with 0.1 wt% of both types of ZnO nanofillers showed a remarkable durability and reusability during the filtration tests; however, the best
Energy Technology Data Exchange (ETDEWEB)
Rajabi, Hamid [Membrane Research Centre, Department of Chemical Engineering, Razi University, Tagh Bostan, 67149 Kermanshah (Iran, Islamic Republic of); Department of Civil Engineering, Razi University, 67149 Kermanshah (Iran, Islamic Republic of); Ghaemi, Negin, E-mail: negin_ghaemi@kut.ac.ir [Department of Chemical Engineering, Kermanshah University of Technology, 67178 Kermanshah (Iran, Islamic Republic of); Madaeni, Sayed S. [Membrane Research Centre, Department of Chemical Engineering, Razi University, Tagh Bostan, 67149 Kermanshah (Iran, Islamic Republic of); Daraei, Parisa [Department of Chemical Engineering, Kermanshah University of Technology, 67178 Kermanshah (Iran, Islamic Republic of); Astinchap, Bandar [Physics Department, Faculty of Science, University of Kurdistan, Sanandaj (Iran, Islamic Republic of); Zinadini, Sirus [Water and Wastewater Research Center (WWRC), Department of Applied Chemistry, Faculty of Chemistry, Razi University, Kermanshah (Iran, Islamic Republic of); Razavizadeh, Sayed Hossein [Department of Chemical Engineering, Kermanshah University of Technology, 67178 Kermanshah (Iran, Islamic Republic of)
2015-09-15
Graphical abstract: - Highlights: • ZnO nanofillers with different shape (nanorod and nanoparticle) were synthesized. • Mixed matrix PES membranes were fabricated by different concentrations of nanofillers. • Embedding nanofillers affected on morphology and hydrophilicity of PES membranes. • Nanorod MM membranes revealed the highest water flux and antifouling characteristic. • ZnO nanorod-embedded membrane showed an acceptable reusability and durability. - Abstract: Two different kinds of nano-ZnO (nanoparticle and nanorod) were synthesized, characterized, and embedded in a PES membrane matrix to investigate the effects of a nanofiller shape on the mixed matrix membrane characteristics and the antifouling capability. The mixed matrix membranes were fabricated by mixing different amounts of nanofillers with dope solution followed by a phase inversion precipitation technique. The effect of the shape of the embedded nanofillers on the morphology and performance of the fabricated membranes was studied in terms of pure water flux, fouling resistance, hydrophilicity, surface, and bulk morphology by means of permeation tests, milk powder solution filtration, water contact angle and porosity measurements, scanning electron microscopy (SEM), and atomic force microscopy (AFM) techniques. Water flux of the mixed matrix membranes significantly improved after the addition of both types of ZnO nanofillers due to a higher hydrophilicity and porosity of the prepared membranes. The water contact angle measurements confirmed the increased hydrophilicity of the modified membranes, particularly in the ZnO nanorod mixed membranes. Fouling resistance of the membranes assessed by powder milk solution filtration revealed that 0.1 wt% ZnO nanorod membrane has the best antifouling property. The prepared mixed matrix membranes embedded with 0.1 wt% of both types of ZnO nanofillers showed a remarkable durability and reusability during the filtration tests; however, the best
Air filtration in HVAC systems
Ginestet, Alain; Tronville, Paolo; Hyttinen, Marko
2010-01-01
Air filtration Guidebook will help the designer and user to understand the background and criteria for air filtration, how to select air filters and avoid problems associated with hygienic and other conditions at operation of air filters. The selection of air filters is based on external conditions such as levels of existing pollutants, indoor air quality and energy efficiency requirements.
Polyamic Acid Nanofibers Produced by Needleless Electro spinning
International Nuclear Information System (INIS)
Jirsak, O.; Sanetrnik, F.; Hruza, J.; Chaloupek, J.; Sysel, P.
2010-01-01
The polyimide precursor (polyamic acid) produced of 4,4'-oxydiphthalic anhydride and 4,4'-oxydianiline was electrospun using needleless electrospinning method. Nonwoven layers consisting of submicron fibers with diameters in the range about 143-470 nm on the polypropylene spunbond supporting web were produced. Filtration properties of these nanofiber layers on the highly permeable polypropylene support namely filtration effectivity and pressure drop were evaluated. Consequently, these polyamic acid fibers were heated to receive polyimide nanofibers. The imidization process has been studied using IR spectroscopy. Some comparisons with the chemically identical polyimide prepared as the film were made.
International Nuclear Information System (INIS)
Sciortino, J.
1991-01-01
In applications where the filtration of large quantities of mixed (liquid and solid) aerosols is desired, a multistage filtration system is often employed. This system consists of a prefilter, a High Efficiency Particulate Air (HEPA) filter, and any number of specialized filters particular to the filtration application. The prefilter removes liquids and any large particles from the air stream, keeping them from prematurely loading the HEPA filter downstream. The HEPA filter eliminates 99.97% of all particulates in the aerosol. The specialized filters downstream of the HEPA filter can be used to remove organic volatiles or other vapors. While the properties of HEPA filters have been extensively investigated, literature characterizing the prefilter is scarce. The purpose of this report is to characterize the efficiency of the prefilter as a function of particle size, nature of the particle (solid or liquid), and the gas flow rate across the face of the prefilter. 1 ref., 4 figs
Vibrating membrane filtration as improved technology for microalgae dewatering.
Nurra, Claudia; Clavero, Ester; Salvadó, Joan; Torras, Carles
2014-04-01
The effect of shear-enhanced filtration by vibratory process in microalgae dewatering is presented in this paper. The aim of this research was to investigate the technical performance and improvement of vibrating membrane filtration compared with conventional tangential cross-flow filtration in microalgae concentration. An industrial-scale available commercial set-up was used. Several membrane materials as polyethersulfone, polyacrylonitrile, etc., and mean pore sizes (from 7000Da to 0.2μm) were tested and compared in both filtration set-ups. Experiments were carried-out with Nannochloropsis gaditana and Phaeodactylum tricornutum microalgae. It has been demonstrated that, even if the choice of the membrane depends on its cut-off, its material and the type of microalgae filtrated, dynamic filtration is always the best technology over a conventional one. If with conventional filtration permeability values were in the vicinity of 10L/h/m(2)/bar in steady state phase, with dynamic filtration these values increased to 30L/h/m(2)/bar or more. Copyright © 2014 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Shewale, J G; Sadana, J C
1979-06-01
The hydrolysis of purified celluloses (cotton, Avicel, Cellulose-123, Solka Floc SW40) and cellulosic wastes (rice straw, sugarcane bagasse, wood powders, paper factory effluents) by Sclerotium rolfsii CPC 142 culture filtrate was studied. Factors which effect saccharification such as pH, temperature, enzyme concentration, substrate concentration, produce inhibition, adsorption, and inactivation of enzyme and particle size were studied. Virtually no inhibition (less than 3%) of cellulose hydrolysis by the culture filtrate was observed by cellobiose and glucose up to 100 mg/mL. Filter paper degrading enzyme(s) (but neither carboxymethylcellulase nor beta-glucosidase) was adsorbed on cellulose. The n value in the S. rolfsii system was calculated to be 0.32 for Avicel P.H. 101 and 0.53 for alkali-treated (AT) rice straw indicating penetration of cellulase into AT rice straw. In batch experiments at 10% substrate level, solutions containing 6 to 7%, 3.8 to 4.7%, 4.0 to 5.1%, and 4.2 to 4.9% reducing sugars were produced in 24 to 48 from AT rice straw. AT bagasse, alkali - peracetic acid treated mesta wood and paper factory sedimented sludge effluent, respectively. The main constituent in the hydrolysate from cellulose was glucose with little or no cellobiose, probably due to the high cellobiase content in the culture filtrate.
The effect of filter cake viscoelasticity on filtration
DEFF Research Database (Denmark)
Christensen, Morten Lykkegaard
, it is difficult to use the existing mathematical filtration models to simulate and optimise the filtration process. Activated sludge as well as synthetic model particles has been filtrated in this project. The study shows that compression of the formed filter cake is a time dependent process, and not only...
40 CFR 141.71 - Criteria for avoiding filtration.
2010-07-01
... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.71 Criteria for avoiding filtration. A public water system that uses a surface water source must meet all of...)(C)(iii), that filtration is required. A public water system that uses a ground water source under...
Design and Characterization of Electrospun Polyamide Nanofiber Media for Air Filtration Applications
Directory of Open Access Journals (Sweden)
Jonas Matulevicius
2014-01-01
Full Text Available Electrospun polyamide 6 (PA 6 and polyamide 6/6 (PA 6/6 nanofibers were produced in order to investigate their experimental characteristics with the goal of obtaining filtration relevant fiber media. The experimental design model of each PA nanofibers contained the following variables: polymer concentration, ratio of solvents, nanofiber media collection time, tip-to-collector distance, and the deposition voltage. The average diameter of the fibers, their morphology, basis weight, thickness, and resulting media solidity were investigated. Effects of each variable on the essential characteristics of PA 6/6 and PA 6 nanofiber media were studied. The comparative analysis of the obtained PA 6/6 and PA 6 nanofiber characteristics revealed that PA 6/6 had higher potential to be used in filtration applications. Based on the experimental results, the graphical representation—response surfaces—for obtaining nanofiber media with the desirable fiber diameter and basis weight characteristics were derived. Based on the modelling results the nanofiber filter media (mats were fabricated. Filtration results revealed that nanofiber filter media electrospun from PA6/6 8% (w/vol solutions with the smallest fiber diameters (62–66 nm had the highest filtration efficiency (PA6/6_30 = 84.9–90.9% and the highest quality factor (PA6/6_10 = 0.0486–0.0749 Pa−1.
Relation Between Filtration and Soil Consolidation Theories
Strzelecki Tomasz; Strzelecki Michał
2015-01-01
This paper presents a different, than commonly used, form of equations describing the filtration of a viscous compressible fluid through a porous medium in isothermal conditions. This mathematical model is compared with the liquid flow equations used in the theory of consolidation. It is shown that the current commonly used filtration model representation significantly differs from the filtration process representation in Biot’s and Terzaghi’s soil consolidation models, which has a bearing on...
Rotating Ceramic Water Filter Discs System for Water Filtration
Directory of Open Access Journals (Sweden)
Riyadh Z. Al Zubaidy
2017-04-01
Full Text Available This work aimed to design, construct and operate a new laboratory scale water filtration system. This system was used to examine the efficiency of two ceramic filter discs as a medium for water filtration. These filters were made from two different ceramic mixtures of local red clay, sawdust, and water. The filtration system was designed with two rotating interfered modules of these filters. Rotating these modules generates shear force between water and the surfaces of filter discs of the filtration modules that works to reduce thickness of layer of rejected materials on the filters surfaces. Each module consists of seven filtration units and each unit consists of two ceramic filter discs. The average measured hydraulic conductivity of the first module was 13.7mm/day and that for the second module was 50mm/day. Results showed that the water filtration system can be operated continuously with a constant flow rate and the filtration process was controlled by a skin thin layer of rejected materials. The ceramic water filters of both filtration modules have high removal efficiency of total suspended solids up to 100% and of turbidity up to 99.94%.
Salt disposition alternatives filtration at SRTC
International Nuclear Information System (INIS)
Walker, B. W.; Hobbs, D.
2000-01-01
Several of the prospective salt disposition alternative technologies require a monosodium titanate (MST) contact to remove strontium and actinides from inorganic salt solution feedstock. This feedstock also contains sludge solids from waste removal operations and may contain defoamers added in the evaporator systems. Filtration is required to remove the sludge and MST solids before sending the salt solution for further processing. This report describes testing performed using the Parallel Theological Experimental Filter (PREF). The PREF contains two single tube Mott sintered metal crossflow filters. For this test one filter was isolated so that the maximum velocities could be achieved. Previous studies showed slurries of MST and sludge in the presence of sodium tetraphenylborate (NaTPB) were filterable since the NaTPB slurry formed a filter cake which aided in removing the smaller MST and sludge particles. Some of the salt disposition alternative technologies do not use NaTPB raising the question of how effective crossflow filtration is with a feed stream containing only sludge and MST. Variables investigated included axial velocity, transmembrane pressure, defoamer effects, and solids concentration (MST and sludge). Details of the tests are outlined in the technical report WSRC-RP-98-O0691. Key conclusions from this study are: (1) Severe fouling of the Mott sintered metal filter did not occur with any of the solutions filtered. (2) The highest fluxes, in the range of .46 to 1.02 gpm/f 2 , were obtained when salt solution decanted from settled solids was fed to the filter. These fluxes would achieve 92 to 204 gpm filtrate production for the current ITP filters. The filtrate fluxes were close to the flux of 0.42 gpm/f 2 reported for In Tank Precipitation Salt Solution by Morrisey. (3) For the range of solids loading studied, the filter flux ranged from .04 to .17 gpm/f 2 which would result in a filtrate production rate of 9 to 31 gpm for the current HP filter. (4
Filtration Systems Design for Universal Oils in Agricultural Tractors
Directory of Open Access Journals (Sweden)
R. Majdan
2017-12-01
Full Text Available Three filtration systems using the tractor hydraulic circuit were proposed and verified during the tractors operation. Using the tractor-implement hydraulic system and filter body with accessories the universally useful filtration systems were designed. The designed filtration systems are the second stage of universal oil filtration whereas the first stage is the standard tractor filter. The decrease in the content of iron reached the values 25.53 %, 32.95 % and 41.55 % and the average decrease in oil contamination characterized by average value of decrease in content of iron, copper and silicium reached values 24.3 %, 24.7 % and 35.53 % in dependence on the filtration system and an oil contamination level. The decrease in contamination level verified the ability of designed filtration systems for agricultural tractors.
Directory of Open Access Journals (Sweden)
Karwiński A.
2014-08-01
Full Text Available Extremely intense development of civilization requires from foundry casting technologies very high quality and not expensive castings. In the foundries, there are many treatments that allow increasing of the final properties of produced castings such as refining, modification, heat treatment, etc. One of the methods of increasing the quality of the casting by removing inclusions from the liquid alloy is filtration. The use of ceramic-carbon foam filters in filtration process is still analysed phenomenon that allows improving the final properties of castings. A modern method of research, testing and synthesis of innovative chemical compositions allows improving the properties of such filters. In the paper the evaluation of application properties of developed ceramic-carbon bonded foam filters is presented. The quality of the foam filters is evaluated by Computer Tomography and foundry trials in pouring of liquid metal in test molds. Additionally computer simulations were made to visualize the flow characteristics in the foam filter. The analysed filters are the result of the research work of Foundry Research Institute and the Institute of Ceramics and Building Materials, Refractory Materials Department in Gliwice.
Determination of chromate ion in drilling mud filtrates
International Nuclear Information System (INIS)
Whitfill, D.
1980-01-01
A method of determining the amount of chromate ion in an aqueous drilling mud filtrate containing organic color bodies such as lignosulfate wherein the method comprises: (A) treating the aqueous filtrate with an effective amount of hydrogen peroxide to destroy said color bodies, and (B) measuring the amount of chromate ion in the filtrate by means of a spectrophotometer
Directory of Open Access Journals (Sweden)
I. Dinaharan
2016-06-01
Full Text Available Friction stir processing (FSP was applied to produce aluminum matrix composites (AMCs. Aluminum alloy AA6082 was used as the matrix material. Various ceramic particles, such as SiC, Al2O3, TiC, B4C and WC, were used as reinforcement particle. AA6082 AMCs were produced using a set of optimized process parameters. The microstructure was studied using optical microscopy, filed emission scanning electron microscopy and electron back scattered diagram. The results indicated that the type of ceramic particle did not considerably vary the microstructure and ultimate tensile strength (UTS. Each type of ceramic particle provided a homogeneous dispersion in the stir zone irrespective of the location and good interfacial bonding. Nevertheless, AA6082/TiC AMC exhibited superior hardness and wear resistance compared to other AMCs produced in this work under the same set of experimental conditions. The strengthening mechanisms and the variation in the properties are correlated to the observed microstructure. The details of fracture mode are further presented.
Filtration of Sludge and Sodium Nonatitanate Solutions
International Nuclear Information System (INIS)
Poirier, M.R.
2000-01-01
The proposed facility designs for the ion exchange and solvent extraction flowsheets under development to treat high level waste at the Savannah River Site use crossflow filtration to remove entrained sludge and monosodium titanate (MST). Bench-scale and pilot-scale testing performed with simulated feed streams showed much lower filtration rates than desired for the process. This report documents an investigation of the impact on filtration of using Honeywell sodium nonatitanate (ST), rather than MST, for strontium and actinide removal
The Perspective of Riverbank Filtration in China
Li, J.; Teng, Y.; Zhai, Y.; Zuo, R.
2014-12-01
Sustainable drinking water supply can affect the health of people, and the surrounding ecosystems. According to statistics of the monitoring program of drinking water sources in 309 at or above prefecture level of China in 2013, the major pollutants index were total phosphorus, ammonia and manganese in surface drinking water sources, respectively, iron, ammonia and manganese in groundwater drinking water sources, respectively. More than 150 drinking water emergency environmental accidents happened since 2006, 52 of these accidents led to the disruption of water supply in waterworks, and a population of over ten million were affected. It indicated that there is a potential risk for people's health by the use of river water directly and it is necessary to require alternative techniques such as riverbank filtration for improving the drinking water quality. Riverbank filtration is an inexpensive natural process, not only smoothing out normal pollutant concentration found in surface water but also significantly reducing the risk from such emergency events as chemical spill into the river. Riverbank filtration technique has been used in many countries more than 100 years, including China. In China, in 1950s, the bank infiltration technique was first applied in northeast of China. Extensive bank infiltration application was conducted in 1980s, and more than 300 drinking water sources utilities bank infiltration established mainly near the Songhua River Basin, the Yellow River Basin, Haihe River Basin. However, the comparative lack of application and researches on riverbank filtration have formed critical scientific data gap in China. As the performance of riverbank filtration technique depend on not only the design and setting such as well type, pumping rate, but also the local hydrogeology and environmental properties. We recommend more riverbank filtration project and studies to be conducted to collect related significant environmental geology data in China
Agee, Kelli A; Becker, Thomas D; Joyce, Anthony P; Rueggeberg, Frederick A; Borke, James L; Waller, Jennifer L; Tay, Franklin R; Pashley, David H
2006-11-01
The purpose of this work was to determine if nonaqueous methacrylate monomer/alcohol mixtures could expand dried collapsed demineralized dentin matrix. Thin disks (ca. 200 microm) of human dentin were demineralized and placed in wells beneath contact probes of linear variable differential transformers. The probes were placed on water-saturated expanded matrices to record the shrinkage associated with drying. Monomer mixtures containing hydroxyethyl methacrylate, 2,2-bis[4-(2-hydroxy-3 methacryloyloxy)propoxyphenyl] propane, or triethyleneglycol dimethacrylate were mixed with methanol or ethanol at alcohol/monomer mass fraction % of 90/10, 70/30, 50/50, or 30/70. They were randomly applied to the dried matrices to determine the rate and magnitude of expansion; then shrinkage was recorded during evaporation of the alcohols. The results indicated that matrix expansion was positively correlated with the Hoy's solubility parameters for hydrogen bonding forces (delta(h)) of the monomer/solvent mixtures (p methanol-containing than with ethanol-containing monomer mixtures. For the test solutions, triethyleneglycol dimethacrylate-containing mixtures produced the slowest rate of matrix expansion and hydroxyethyl methacrylate-containing mixtures the most rapid expansion. When the solvents were evaporated, the matrix shrank in proportion to the solvent content and the delta(h) of the monomer-solvent mixtures. The results indicate that expansion of dried, collapsed dentin matrices requires that the delta(h) of the mixtures be larger than 17 (J/cm(3))(1/2). The greater the delta(h) of the monomer solutions, the greater the rate and extent of expansion.
Hanford underground storage tank waste filtration process evaluation
International Nuclear Information System (INIS)
Walker, B.W.; McCabe, D.J.
1997-01-01
The purpose of this filter study was to evaluate cross-flow filtration as effective solid-liquid separation technology for treating Hanford wastes, outline operating conditions for equipment, examine the expected filter flow rates, and determine proper cleaning. Two Hanford waste processing applications have been identified as candidates for the use of cross-flow filtration. The first of the Hanford applications involves filtration of the decanted supernate from sludge leaching and washing operations. This process involves the concentration and removal of dilute (0.05 wt percent) fines from the bulk of the supernate. The second application involves filtration to wash and concentrate the sludge during out-of-tank processing. This process employs a relatively concentrated (8 wt percent) solids feed stream. Filter studies were conducted with simulants to evaluate whether 0.5 micron cross-flow sintered metal Mott filters and 0.1 micron cross-flow Graver filters can perform solid-liquid separation of the solid/liquid waste streams effectively. In cross-flow filtration the fluid to be filtered flows in parallel to the membrane surface and generates shearing forces and/or turbulence across the filter medium. This shearing influences formation of filter cake stabilizing the filtrate flow rate
Spontaneous water filtration of bio-inspired membrane
Kim, Kiwoong; Kim, Hyejeong; Lee, Sang Joon
2016-11-01
Water is one of the most important elements for plants, because it is essential for various metabolic activities. Thus, water management systems of vascular plants, such as water collection and water filtration have been optimized through a long history. In this view point, bio-inspired technologies can be developed by mimicking the nature's strategies for the survival of the fittest. However, most of the underlying biophysical features of the optimized water management systems remain unsolved In this study, the biophysical characteristics of water filtration phenomena in the roots of mangrove are experimentally investigated. To understand water-filtration features of the mangrove, the morphological structures of its roots are analyzed. The electrokinetic properties of the root surface are also examined. Based on the quantitatively analyzed information, filtration of sodium ions in the roots are visualized. Motivated by this mechanism, spontaneous desalination mechanism in the root of mangrove is proposed by combining the electrokinetics and hydrodynamic transportation of ions. This study would be helpful for understanding the water-filtration mechanism of the roots of mangrove and developing a new bio-inspired desalination technology. This research was financially supported by the National Research Foundation (NRF) of Korea (Contract Grant Number: 2008-0061991).
Efficient filtration system for paraffin-catalyst slurry separation
Directory of Open Access Journals (Sweden)
Khodagholi Mohammad Ali
2013-01-01
Full Text Available The filtration efficiency for separating liquid paraffin (or water from a slurry consisting of 25 weight% spherical alumina in a Slurry Bubble Column Reactor (SBCR comprised of a cylindrical tube of 10 cm diameter and 150 cm length was studied. Various differential pressures (ΔP were applied to two separate tubular sintered metal stainless steel filter elements with nominal pore size of 4 and 16μm. The experimental results disclosed that the rate of filtrations increased on applying higher differential pressure to the filter element. Albeit this phenomenon is limited to moderate ΔPs and for ΔP more than 1 bar is neither harmful nor helpful. The highest filtration rates at ΔPs higher than 1 bar were 170 and 248 ml/minute for 4 and 16μm respectively. Using water as the liquid in slurry the rate of filtration enhanced to 4 folds, and this issue reveals impact of viscosity on filtration efficiency clearly. In all situations, the total amount of particles present in the filtrate part never exceeded a few parts per million (ppm. The statistical analysis of the SEM image of the filtrate indicated that by applying higher pressure difference to the filter element the frequency percent of larger particle size increases. The operation of filter cake removing was performed with back flashing of 300 ml of clean liquid with pressures of 3-5 bar of N2 gas.
40 CFR 141.717 - Pre-filtration treatment toolbox components.
2010-07-01
... surface water or GWUDI source. (c) Bank filtration. Systems receive Cryptosporidium treatment credit for... paragraph. Systems using bank filtration when they begin source water monitoring under § 141.701(a) must... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Pre-filtration treatment toolbox...
Particle clogging in porous media. Filtration of a smectite solution
Energy Technology Data Exchange (ETDEWEB)
Richards, Tobias (Chalmers University of Technology, Goeteborg (Sweden))
2010-01-15
The goal of this project is to find out if it is possible for bentonite clay to self heal during leaching with deionized water. The investigation has focused on the formation of a filter cake made of accessory material from MX 80 and the separation of solid material when a smectite solution (1%) is pushed through the cake using a pressure difference of 5 bar. It was also in the scope of this project to design and build the necessary equipment for these experiments. In the literature review it was not found any example that the phenomenon of clogging has been used as a self-healing method previously. It was rather separated also between the clogging of a filter cake (deep bed filtration or cake filtration) and the filtration of colloidal particles. Probably because the latter are in such low concentrations in natural systems and the focus have mainly been in the transport properties of colloids within a filter cake or deep bed filter. An experimental equipment was designed and built. It consists of seven filtration cells that could operate in parallel. All of them are connected to the same source of pressure to ensure equal conditions. A system was also prepared to prevent air from dissolving in the solution because it could create an unwanted expansion in the filter cake due to lower solubility at lower pressure. The experiment showed good separation of smectite particles from the solution when it passed through the filter cake. In all tested cases, the separation was almost complete after long enough time, indicating that the cake has small enough pores to act as a geometrical hinder for the small particles. Comparison between the materials prepared at Chalmers University of Technology and at Clay Technology showed a very good agreement indicating similar properties of the produced smectite
Particle clogging in porous media. Filtration of a smectite solution
International Nuclear Information System (INIS)
Richards, Tobias
2010-01-01
The goal of this project is to find out if it is possible for bentonite clay to self heal during leaching with deionized water. The investigation has focused on the formation of a filter cake made of accessory material from MX 80 and the separation of solid material when a smectite solution (1%) is pushed through the cake using a pressure difference of 5 bar. It was also in the scope of this project to design and build the necessary equipment for these experiments. In the literature review it was not found any example that the phenomenon of clogging has been used as a self-healing method previously. It was rather separated also between the clogging of a filter cake (deep bed filtration or cake filtration) and the filtration of colloidal particles. Probably because the latter are in such low concentrations in natural systems and the focus have mainly been in the transport properties of colloids within a filter cake or deep bed filter. An experimental equipment was designed and built. It consists of seven filtration cells that could operate in parallel. All of them are connected to the same source of pressure to ensure equal conditions. A system was also prepared to prevent air from dissolving in the solution because it could create an unwanted expansion in the filter cake due to lower solubility at lower pressure. The experiment showed good separation of smectite particles from the solution when it passed through the filter cake. In all tested cases, the separation was almost complete after long enough time, indicating that the cake has small enough pores to act as a geometrical hinder for the small particles. Comparison between the materials prepared at Chalmers University of Technology and at Clay Technology showed a very good agreement indicating similar properties of the produced smectite
Novel matrix for REEs recovery from waste disposal
International Nuclear Information System (INIS)
Hareendran, K.; Singha, Mousumi; Roy, S.B.; Pal, Sangita
2014-01-01
Sorption of lanthanides (98%-99%) onto a novel matrix (polyacrylamide-carboxylate hydroxamate-PAMCHO) not only remove REE's before effluent disposal but also reduces the chance of contamination of potable water, nuclear plant generated shut down or gadolinium containing effluent during controlled fission reaction, in pharmaceutical diagnosis (MRI) and many other useful process effluents. By using such sorbent, 88% of the lanthanides can be recovered using HCl solution less than pH 1 from the laden matrix and can be concentrated more than 5 times. However, sorption into the interlayer's and diffusion of the REE's during leaching depends on the cross-linked structure of the gel matrix and tortuous path of the porous micro-channel (using scanning electron microscope-SEM study). The sequestration of matrix with REE's has been well established by using instrument FT-IR and gadolinium (cation-lanthanide) exchange method. To understand interaction of REE with sorbent, matrix have been prepared with cross-linking amount variation, such as 85:15, 90:10, 95:05 and 98:02 (matrix: cross-linker). A detailed sorption study of cross-linked matrix with gadolinium in feed solution (184 ppm), filtrate, leached and laden sorbent establishes mass balance (using ICP-AES for quantitative determination). This optimized sorbent (PAMCHO) indicates recovery of valuable REEs with elution factor of more than 0.9 when HCl solution of pH1.5 was used. (author)
Development of injection moulded, ultrasonically welded immiscible phase filtration devices
DEFF Research Database (Denmark)
Kistrup, Kasper
for ultrasonic welding, suitable for microfluidic systems. A methodology has been established where energy directors can be quickly added to existing mould inserts, using laser micromachining. The produced device was performance tested by isolating methicillin-resistant Staphylococcus aureus from bovine whole....... The device appliesmagnetic bead-based solid-phase extraction for nucleic acid extraction from biological samples, using the immiscible phase filtration (IPF) approach. Device development has employed injection moulding for part fabrication and ultrasonic welding for bonding. Rapid prototyping...
Dynamic optimization of dead-end membrane filtration
Blankert, B.; Betlem, Bernardus H.L.; Roffel, B.; Marquardt, Wolfgang; Pantelides, Costas
2006-01-01
An operating strategy aimed at minimizing the energy consumption during the filtration phase of dead-end membrane filtration has been formulated. A method allowing fast calculation of trajectories is used to allow incorporation in a hierarchical optimization scheme. The optimal trajectory can be
Producing accurate wave propagation time histories using the global matrix method
International Nuclear Information System (INIS)
Obenchain, Matthew B; Cesnik, Carlos E S
2013-01-01
This paper presents a reliable method for producing accurate displacement time histories for wave propagation in laminated plates using the global matrix method. The existence of inward and outward propagating waves in the general solution is highlighted while examining the axisymmetric case of a circular actuator on an aluminum plate. Problems with previous attempts to isolate the outward wave for anisotropic laminates are shown. The updated method develops a correction signal that can be added to the original time history solution to cancel the inward wave and leave only the outward propagating wave. The paper demonstrates the effectiveness of the new method for circular and square actuators bonded to the surface of isotropic laminates, and these results are compared with exact solutions. Results for circular actuators on cross-ply laminates are also presented and compared with experimental results, showing the ability of the new method to successfully capture the displacement time histories for composite laminates. (paper)
Filter aids influence on pressure drop across a filtration system
Hajar, S.; Rashid, M.; Nurnadia, A.; Ammar, M. R.; Hasfalina, C. M.
2017-06-01
Filter aids is commonly used to reduce pressure drop across air filtration system as it helps to increase the efficiency of filtration of accumulated filter cake. Filtration velocity is one of the main parameters that affect the performance of filter aids material. In this study, a formulated filter aids consisting of PreKot™ and activated carbon mixture (designated as PrekotAC) was tested on PTFE filter media under various filtration velocities of 5, 6, and 8 m/min at a constant material loading of 0.2 mg/mm2. Results showed that pressure drop is highly influenced by filtration velocity where higher filtration velocity leads to a higher pressure drop across the filter cake. It was found that PrekotAC performed better in terms of reducing the pressure drop across the filter cake even at the highest filtration velocity. The diversity in different particle size distribution of non-uniform particle size in the formulated PrekotAC mixture presents a higher permeability causes a lower pressure drop across the accumulated filter cake. The finding suggests that PrekotAC is a promising filter aids material that helps reducing the pressure drop across fabric filtration system.
Zhang, Huibin; Liu, Xinli; Jiang, Yao; Gao, Lin; Yu, Linping; Lin, Nan; He, Yuehui; Liu, C T
2017-09-15
A temperature-controlled selective filtration technology for synchronous removal of arsenic and recovery of antimony from the fume produced from reduction smelting process of lead anode slimes was proposed. The chromium (Cr) alloyed FeAl intermetallic with an asymmetric pore structure was developed as the high-temperature filter material after evaluating its corrosive resistance, structural stability and mechanical properties. The results showed that porous FeAl alloyed with 20wt.% Cr had a long term stability in a high-temperature sulfide-bearing environment. The separation of arsenic and antimony trioxides was realized principally based on their disparate saturated vapor pressures at specific temperature ranges and the asymmetric membrane of FeAl filter elements with a mean pore size of 1.8μm. Pilot-scale filtration tests showed that the direct separation of arsenic and antimony can be achieved by a one-step or two-step filtration process. A higher removal percentage of arsenic can reach 92.24% at the expense of 6∼7% loss of antimony in the two-step filtration process at 500∼550°C and 300∼400°C. The FeAl filters had still good permeable and mechanical properties with 1041h of uninterrupted service, which indicates the feasibility of this high-temperature filtration technology. Copyright © 2017. Published by Elsevier B.V.
Technology development for producing nickel metallic filters
International Nuclear Information System (INIS)
Hubler, C.H.
1990-01-01
A technology to produce metallic filters by Instituto de Engenharia Nuclear (IEN-Brazilian CNEN) providing the Instituto de Pesquisas Energeticas e Nucleares (IPEN-Brazilian CNEN) in obtaining nickel alloy filters used for filtration process of uranium hexafluoride, was developed. The experiences carried out for producing nickel conical trunk filters from powder metallurgy are related. (M.C.K.)
Wind Turbine Gearbox Oil Filtration and Condition Monitoring
Energy Technology Data Exchange (ETDEWEB)
Sheng, Shuangwen
2015-10-25
This is an invited presentation for a pre-conference workshop, titled advances and opportunities in lubrication: wind turbine, at the 2015 Society of Tribologists and Lubrication Engineers (STLE) Tribology Frontiers Conference held in Denver, CO. It gives a brief overview of wind turbine gearbox oil filtration and condition monitoring by highlighting typical industry practices and challenges. The presentation starts with an introduction by covering recent growth of global wind industry, reliability challenges, benefits of oil filtration and condition monitoring, and financial incentives to conduct wind operation and maintenance research, which includes gearbox oil filtration and condition monitoring work presented herein. Then, the presentation moves on to oil filtration by stressing the benefits of filtration, discussing typical main- and offline-loop practices, highlighting important factors considered when specifying a filtration system, and illustrating real-world application challenges through a cold-start example. In the next section on oil condition monitoring, a discussion on oil sample analysis, oil debris monitoring, oil cleanliness measurements and filter analysis is given based on testing results mostly obtained by and at NREL, and by pointing out a few challenges with oil sample analysis. The presentation concludes with a brief touch on future research and development (R and D) opportunities. It is hoping that the information presented can inform the STLE community to start or redirect their R and D work to help the wind industry advance.
Life Support Filtration System Trade Study for Deep Space Missions
Agui, Juan H.; Perry, Jay L.
2017-01-01
The National Aeronautics and Space Administrations (NASA) technical developments for highly reliable life support systems aim to maximize the viability of long duration deep space missions. Among the life support system functions, airborne particulate matter filtration is a significant driver of launch mass because of the large geometry required to provide adequate filtration performance and because of the number of replacement filters needed to a sustain a mission. A trade analysis incorporating various launch, operational and maintenance parameters was conducted to investigate the trade-offs between the various particulate matter filtration configurations. In addition to typical launch parameters such as mass, volume and power, the amount of crew time dedicated to system maintenance becomes an increasingly crucial factor for long duration missions. The trade analysis evaluated these parameters for conventional particulate matter filtration technologies and a new multi-stage particulate matter filtration system under development by NASAs Glenn Research Center. The multi-stage filtration system features modular components that allow for physical configuration flexibility. Specifically, the filtration system components can be configured in distributed, centralized, and hybrid physical layouts that can result in considerable mass savings compared to conventional particulate matter filtration technologies. The trade analysis results are presented and implications for future transit and surface missions are discussed.
Removal of heavy metals from aluminum anodic oxidation wastewaters by membrane filtration.
Ates, Nuray; Uzal, Nigmet
2018-05-27
Aluminum manufacturing has been reported as one of the largest industries and wastewater produced from the aluminum industry may cause significant environmental problems due to variable pH, high heavy metal concentration, conductivity, and organic load. The management of this wastewater with a high pollution load is of great importance for practitioners in the aluminum sector. There are hardly any studies available on membrane treatment of wastewater originated from anodic oxidation. The aim of this study is to evaluate the best treatment and reuse alternative for aluminum industry wastewater using membrane filtration. Additionally, the performance of chemical precipitation, which is the existing treatment used in the aluminum facility, was also compared with membrane filtration. Wastewater originated from anodic oxidation coating process of an aluminum profile manufacturing facility in Kayseri (Turkey) was used in the experiments. The characterization of raw wastewater was in very low pH (e.g., 3) with high aluminum concentration and conductivity values. Membrane experiments were carried out with ultrafiltration (PTUF), nanofiltration (NF270), and reverse osmosis (SW30) membranes with MWCO 5000, 200-400, and 100 Da, respectively. For the chemical precipitation experiments, FeCl 3 and FeSO 4 chemicals presented lower removal performances for aluminum and chromium, which were below 35% at ambient wastewater pH ~ 3. The membrane filtration experimental results show that, both NF and RO membranes tested could effectively remove aluminum, total chromium and nickel (>90%) from the aluminum production wastewater. The RO (SW30) membrane showed a slightly higher performance at 20 bar operating pressure in terms of conductivity removal values (90%) than the NF 270 membrane (87%). Although similar removal performances were observed for heavy metals and conductivity by NF270 and SW30, significantly higher fluxes were obtained in NF270 membrane filtration at any pressure
Dynamic optimization of a dead-end filtration trajectory: Blocking filtration laws
Blankert, B.; Betlem, Bernardus H.L.; Roffel, B.
2006-01-01
An operating model for dead-end membrane filtration is proposed based on the well-known blocking laws. The resulting model contains three parameters representing, the operating strategy, the fouling mechanism and the fouling potential of the feed. The optimal control strategy is determined by
International Nuclear Information System (INIS)
Lee, Hyung-Ok; Mullins, Stefanie R; Franco-Barraza, Janusz; Valianou, Matthildi; Cukierman, Edna; Cheng, Jonathan D
2011-01-01
Alterations towards a permissive stromal microenvironment provide important cues for tumor growth, invasion, and metastasis. In this study, Fibroblast activation protein (FAP), a serine protease selectively produced by tumor-associated fibroblasts in over 90% of epithelial tumors, was used as a platform for studying tumor-stromal interactions. We tested the hypothesis that FAP enzymatic activity locally modifies stromal ECM (extracellular matrix) components thus facilitating the formation of a permissive microenvironment promoting tumor invasion in human pancreatic cancer. We generated a tetracycline-inducible FAP overexpressing fibroblastic cell line to synthesize an in vivo-like 3-dimensional (3D) matrix system which was utilized as a stromal landscape for studying matrix-induced cancer cell behaviors. A FAP-dependent topographical and compositional alteration of the ECM was characterized by measuring the relative orientation angles of fibronectin fibers and by Western blot analyses. The role of FAP in the matrix-induced permissive tumor behavior was assessed in Panc-1 cells in assorted matrices by time-lapse acquisition assays. Also, FAP + matrix-induced regulatory molecules in cancer cells were determined by Western blot analyses. We observed that FAP remodels the ECM through modulating protein levels, as well as through increasing levels of fibronectin and collagen fiber organization. FAP-dependent architectural/compositional alterations of the ECM promote tumor invasion along characteristic parallel fiber orientations, as demonstrated by enhanced directionality and velocity of pancreatic cancer cells on FAP + matrices. This phenotype can be reversed by inhibition of FAP enzymatic activity during matrix production resulting in the disorganization of the ECM and impeded tumor invasion. We also report that the FAP + matrix-induced tumor invasion phenotype is β 1 -integrin/FAK mediated. Cancer cell invasiveness can be affected by alterations in the tumor
Energy Technology Data Exchange (ETDEWEB)
Beede, R L
1956-09-27
A continuous plutonium (IV) oxalate precipitation, filtration, and calcination process has been developed. Continuous and batch decomposition of the oxalate in the filtrates has been demonstrated. The processes have been demonstrated in prototype equipment. Plutonium (IV) oxalate was precipitated continuously at room temperature by the concurrent addition of plutonium (IV) nitrate feed and oxalic acid into the pan of a modified rotary drum filter. The plutonium (IV) oxalate was calcined to plutonium dioxide, which could be readily hydrofluorinated. Continuous decomposition of the oxalate in synthetic plutonium (IV) oxalate filtrates containing plutonium (IV) oxalate solids was demonstrated using co-current flow in a U-shaped reactor. Feeds containing from 10 to 100 g/1 Pu, as plutonium (IV) nitrate, and 1.0 to 6.5 M HNO/sub 3/, respectively, can be processed. One molar oxalic acid is used as the precipitant. Temperatures of 20 to 35/sup 0/C for the precipitation and filtration are satisfactory. Plutonium (IV) oxalate can be calcined at 300 to 400/sup 0/C in a screw-type drier-calciner to plutonium dioxide and hydrofluorinated at 450 to 550/sup 0/C. Plutonium dioxide exceeding purity requirements has been produced in the prototype equipment. Advantages of continuous precipitation and filtration are: uniform plutonium (IV) oxalate, improved filtration characteristics, elimination of heating and cooling facilities, and higher capacities through a single unit. Advantages of the screw-type drier-calciner are the continuous production of an oxide satisfactory for feed for the proposed plant vibrating tube hydrofluorinator, and ease of coupling continuous precipitation and filtration to this proposed hydrofluorinator. Continuous decomposition of oxalate in filtrates offers advantages in decreasing filtrate storage requirements when coupled to a filtrate concentrator. (JGB)
Kaiser, Adrian; Stark, Wendelin J.; Grass, Robert N.
2017-01-01
A chemistry laboratory experiment using everyday items and readily available chemicals is described to introduce advanced high school students and undergraduate college students to porous polymer membranes. In a three-step manufacturing process, a membrane is produced at room temperature. The filtration principle of the membrane is then…
Mitigation of radon and thoron decay products by filtration
International Nuclear Information System (INIS)
Wang Jin; Meisenberg, Oliver; Chen Yongheng; Karg, Erwin; Tschiersch, Jochen
2011-01-01
Inhalation of indoor radon ( 222 Rn) and thoron ( 220 Rn) decay products is the most important source of exposure to ionizing radiation for the human respiratory tract. Decreasing ventilation rates due to energy saving reasons in new buildings suggest additional active mitigation techniques to reduce the exposure in homes with high radon and thoron concentrations but poor ventilation. Filtration techniques with HEPA filters and simple surgical mask material have been tested for their potential to reduce the indoor exposure in terms of the total effective dose for mixed radon and thoron indoor atmospheres. The tests were performed inside an experimental room providing stable conditions. Filtration (at filtration rates of 0.2 h -1 and larger) removes attached radon and thoron decay products effectively but indoor aerosol as well. Therefore the concentration of unattached decay products (which have a higher dose coefficient) may increase. The decrease of the attached decay product concentrations could be theoretically described by a slowly decreasing exponential process. For attached radon decay products, it exhibited a faster but weaker removal process compared to attached thoron decay products (- 70% for attached radon decay products and - 80% for attached thoron decay products at a filtration rate of 0.5 h -1 with an HEPA filter). The concentration of unattached thoron decay products increased distinctly during the filtration process (+ 300%) while that of unattached radon decay products rose only slightly though at a much higher level (+ 17%). In the theoretical description these observed differences could be attributed to the different half-lives of the nuclides. Considering both effects, reduced attached and increased unattached decay product concentrations, filtration could significantly decrease the total effective dose from thoron whereas the overall effect on radon dose is small. A permanent filtration is recommended because of the slow decrease of the
A study of dynamic filtration; Um estudo sobre filtracao dinamica
Energy Technology Data Exchange (ETDEWEB)
Girao, Joaquim Helder S [PETROBRAS, Natal, RN (Brazil). Distrito de Perfuracao da Bacia Potiguar. Div. de Tecnicas de Perfuracao
1990-12-31
The problems that cause cost increase such as: formation damage and borehole swelling or caving lead us to study the filtration of the liquid part of formation drilling fluid. With the aim of comparing static and dynamic filtration rates, we developed a modest dynamic filtration equipment, consisting of a modified API filter, connected to reservoir by means of a positive injection pump. We carried out various tests, and the results were set in charts and tables. Through these, it is possible to notice how the static and dynamic filtration curves come apart for a same pressure value. We also evaluated the effects of circulation speed, starch concentration and counter pressure. This paper does not include calculations or mathematical models accounting for filtrate invasion radii, but it demonstrates, for example, that cleaning circulation will cause lower filtration rates at lower flows. (author) 5 refs., 11 figs., 14 tabs.
A study of dynamic filtration; Um estudo sobre filtracao dinamica
Energy Technology Data Exchange (ETDEWEB)
Girao, Joaquim Helder S. [PETROBRAS, Natal, RN (Brazil). Distrito de Perfuracao da Bacia Potiguar. Div. de Tecnicas de Perfuracao
1989-12-31
The problems that cause cost increase such as: formation damage and borehole swelling or caving lead us to study the filtration of the liquid part of formation drilling fluid. With the aim of comparing static and dynamic filtration rates, we developed a modest dynamic filtration equipment, consisting of a modified API filter, connected to reservoir by means of a positive injection pump. We carried out various tests, and the results were set in charts and tables. Through these, it is possible to notice how the static and dynamic filtration curves come apart for a same pressure value. We also evaluated the effects of circulation speed, starch concentration and counter pressure. This paper does not include calculations or mathematical models accounting for filtrate invasion radii, but it demonstrates, for example, that cleaning circulation will cause lower filtration rates at lower flows. (author) 5 refs., 11 figs., 14 tabs.
Removal of actinides from dilute waste waters using polymer filtration
International Nuclear Information System (INIS)
Smith, B.F.; Robison, T.W.; Gibson, R.R.
1995-01-01
More stringent US Department of Energy discharge regulations for waste waters containing radionuclides (30 pCi/L total alpha) require the development of new processes to meet the new discharge limits for actinide metal ions, particularly americium and plutonium, while minimizing waste. We have been investigating a new technology, polymer filtration, that has the potential for effectively meeting these new limits. Traditional technology uses basic iron precipitation which produces large amounts of waste sludge. The new technology is based on using water-soluble chelating polymers with ultrafiltration for physical separation. The actinide metal ions are selectively bound to the polymer and can not pass through the membrane. Small molecules and nonbinding metals pass through the membrane. Advantages of polymer filtration technology compared to ion, exchange include rapid kinetics because the binding is occurring in a homogenous solution and no mechanical strength requirement on the polymer. We will present our results on the systematic development of a new class of water-soluble chelating polymers and their binding ability from dilute acid to near neutral waters
Filtration of polydispersed colloids
International Nuclear Information System (INIS)
Nuttall, H.E.
1988-01-01
In this study, the dynamic microscopic form of the population balance model is applied to the problem of polydispersed particle capture in one spatial diffusion. This mathematical modeling approach can be applied to the difficult and potentially important problem of particulate (radiocolloid) transport in the groundwater surrounding a nuclear waste disposal site. To demonstrate the population balance methodology, the equations were developed and used to investigate transport and capture of polydispersed colloids in packed columns. Modeling simulations were compared to experimental column data. The multidimensional form of the population balance equation was used to analyze the transport and capture of polydispersed colloids. A numerical model was developed to describe transport of polydispersed colloids through a one-dimensional porous region. The effects of various size distributions were investigated in terms of capture efficiency. For simulating the column data, it was found by trial and error that as part of the population balance model a linear size dependent filtration function gave a good fit to the measured colloid concentration profile. The effects of constant versus size dependent filtration coefficients were compared and the differences illustrated by the calculated colloid profile within the column. Also observed from the model calculations was the dramatically changing liquid-phase colloid-size distribution which was plotted as a function of position down the column. This modeling approach was excellent for describing and understanding microscopic filtration in porous media
Filtration and retention capacities of filter aids
International Nuclear Information System (INIS)
Mellah, A.; Boualia, A.
1992-01-01
The present work involves the filtration of impure uranyl nitrate solutions by different filter aids such as kieselguhr, celite and bleaching clay. The retention of substances contained in uranyl nitrate solution was determined using the three filter aids. A study of the effects of granulometry and filter earths treatment (thermal and chemical) on the filtration rate was performed
Filter media properties of mineral fibres produced by plasma spray.
Prasauskas, Tadas; Matulevicius, Jonas; Kliucininkas, Linas; Krugly, Edvinas; Valincius, Vitas; Martuzevicius, Dainius
2016-01-01
The purpose of this study was to determine the properties of fibrous gas filtration media produced from mineral zeolite. Fibres were generated by direct current plasma spray. The paper characterizes morphology, chemical composition, geometrical structure of elementary fibres, and thermal resistance, as well as the filtration properties of fibre media. The diameter of the produced elementary fibres ranged from 0.17 to 0.90 μm and the length ranged from 0.025 to 5.1 mm. The release of fibres from the media in the air stream was noticed, but it was minimized by hot-pressing the formed fibre mats. The fibres kept their properties up to the temperature of 956°C, while further increase in temperature resulted in the filter media becoming shrunk and brittle. The filtration efficiency of the prepared filter mats ranged from 95.34% to 99.99% for aerosol particles ranging in a size between 0.03 and 10.0 μm. Unprocessed fibre media showed the highest filtration efficiency when filtering aerosol particles smaller than 0.1 µm. Hot-pressed filters were characterized by the highest quality factor values, ranging from 0.021 to 0.064 Pa(-1) (average value 0.034 Pa(-1)).
40 CFR 141.171 - Criteria for avoiding filtration.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...
Vibrating membrane filtration as improved technology for microalgae dewatering
Nurra, C.; Clavero, E.; Salvadó, J.; Torras, C.
2014-01-01
10.1016/j.biortech.2014.01.115 The effect of shear-enhanced filtration by vibratory process in microalgae dewatering is presented in this paper. The aim of this research was to investigate the technical performance and improvement of vibrating membrane filtration compared with conventional tangential cross-flow filtration in microalgae concentration. An industrial-scale available commercial set-up was used. Several membrane materials as polyethersulfone, polyacrylonitrile, etc., and mean ...
Directory of Open Access Journals (Sweden)
H.Z. Igamberdiyev
2014-07-01
Full Text Available Dynamic systems condition estimation regularization algorithms in the conditions of signals and hindrances statistical characteristics aprioristic uncertainty are offered. Regular iterative algorithms of strengthening matrix factor elements of the Kalman filter, allowing to adapt the filter to changing hindrance-alarm conditions are developed. Steady adaptive estimation algorithms of a condition vector in the aprioristic uncertainty conditions of covariance matrixes of object noise and the measurements hindrances providing a certain roughness of filtration process in relation to changing statistical characteristics of signals information parameters are offered. Offered practical realization results of the dynamic systems condition estimation algorithms are given at the adaptive management systems synthesis problems solution by technological processes of granulation drying of an ammophos pulp and receiving ammonia.
An antioxidant peptide produced by autolysis reactions from wheat ...
African Journals Online (AJOL)
An antioxidant peptide produced by autolysis reactions from wheat germ. ... African Journal of Biotechnology ... activity was purified using ultrafiltration, Sephadex G-25 gel filtration column and consecutive chromatographic methods.
Scaling and particulate fouling in membrane filtration systems
Boerlage, S.F.E.
2001-01-01
In the last decade, pressure driven membrane filtration processes; reverse osmosis, nano, ultra and micro-filtration have undergone steady growth. Drivers for this growth include desalination to combat water scarcity and the removal of various material from water to comply with increasingly
Vacuum distillation/vapor filtration water recovery
Honegger, R. J.; Neveril, R. B.; Remus, G. A.
1974-01-01
The development and evaluation of a vacuum distillation/vapor filtration (VD/VF) water recovery system are considered. As a functional model, the system converts urine and condensates waste water from six men to potable water on a steady-state basis. The system is designed for 180-day operating durations and for function on the ground, on zero-g aircraft, and in orbit. Preparatory tasks are summarized for conducting low gravity tests of a vacuum distillation/vapor filtration system for recovering water from urine.
Industrial Application of Open Pore Ceramic Foam for Molten Metal Filtration
Gauckler, L. J.; Waeber, M. M.; Conti, C.; Jacob-Dulière, M.
Ceramic foam filters were used for industrial filtration of aluminum. Results are compared with laboratory experiments which are in good agreement with trajectory analyses of deep bed filtration for the early stage of filtration.
Water quality and treatment of river bank filtrate
Directory of Open Access Journals (Sweden)
W. W. J. M. de Vet
2010-06-01
Full Text Available In drinking water production, river bank filtration has the advantages of dampening peak concentrations of many dissolved components, substantially removing many micropollutants and removing, virtually completely, the pathogens and suspended solids. The production aquifer is not only fed by the river bank infiltrate but also by water percolating through covering layers. In the polder areas, these top layers consist of peat and deposits from river sediments and sea intrusions.
This paper discusses the origin and fate of macro components in river bank filtrate, based on extensive full-scale measurements in well fields and treatment systems of the Drinking Water Company Oasen in the Netherlands. First, it clarifies and illustrates redox reactions and the mixing of river bank filtrate and PW as the dominant processes determining the raw water quality for drinking water production. Next, full-scale results are elaborated on to evaluate trickling filtration as an efficient and proven one-step process to remove methane, iron, ammonium and manganese. The interaction of methane and manganese removal with nitrification in these systems is further analyzed. Methane is mostly stripped during trickling filtration and its removal hardly interferes with nitrification. Under specific conditions, microbial manganese removal may play a dominant role.
Wang, Haolun; Lin, Sen; Yang, Shen; Yang, Xudong; Song, Jianan; Wang, Dong; Wang, Haiyang; Liu, Zhenglian; Li, Bo; Fang, Minghao; Wang, Ning; Wu, Hui
2018-05-01
Particulate matter (PM) is a major air pollutant in many regions, jeopardizing ecosystems and public health. Filtration at pollutant source is one of the most important ways to protect the environment, however, considering the high-temperature exhaust gas emissions, effective removal of PM and related pollutants from their sources remains a major challenge. In this study, a resilient, heat-resisting, and high-efficiency PM filter based on yttria-stabilized ZrO 2 (YSZ) nanofiber sponge produced with a scalable solution blow spinning process is reported. The porous 3D sponge composed of YSZ nanofibers is lightweight (density of 20 mg cm -3 ) and resilient at both room temperature and high temperatures. At room-temperature conditions, the YSZ nanofiber sponge exhibits 99.4% filtration efficiency for aerosol particles with size in the range of 20-600 nm, associated with a low pressure drop of only 57 Pa under an airflow velocity of 4.8 cm s -1 . At a high temperature of 750 °C, the ceramic sponge maintains a high filtration efficiency of 99.97% for PM 0.3-2.5 under a high airflow velocity of 10 cm s -1 . A practical vehicle exhaust filter to capture particles with filtration efficiency of >98.3% is also assembled. Hence, the YSZ nanofiber sponge has enormous potential to be applied in industry. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Dynamic optimization of a dead-end filtration trajectory: non-ideal cake filtration
Blankert, B.; Kattenbelt, C.; Betlem, Bernardus H.L.; Roffel, B.
2007-01-01
A control strategy aimed at minimizing energy consumption is formulated for non-ideal dead-end cake filtration with an inside-out hollow fiber ultrafiltration membrane system. The non-ideal behavior was assumed to originate from cake compression, non-linear cake resistance and a variable pump
Self Cleaning HEPA Filtration without Interrupting Process Flow
International Nuclear Information System (INIS)
Wylde, M.
2009-01-01
The strategy of protecting the traditional glass fibre HEPA filtration train from it's blinding contamination and the recovery of dust by the means of self cleaning, pre-filtration is a proven means in the reduction of ultimate disposal volumes and has been used within the Fuel Production Industry. However, there is an increasing demand in nuclear applications requiring elevated operating temperatures, fire resistance, moisture resistance and chemical composition that the existing glass fibre HEPA filtration cannot accommodate, which can be remedied by the use of a metallic HEPA filter media. Previous research (Bergman et al 1997, Moore et al 1992) suggests that the then costs to the DOE, based on a five year life cycle, was $29.5 million for the installation, testing, removal and disposal of glass fibre HEPA filtration trains. Within these costs, $300 was the value given to the filter and $4,450 was given to the peripheral activity. Development of a low cost, cleanable, metallic, direct replacement of the traditional filter train will the clear solution. The Bergman et al work has suggested that a 1000 ft 3 /min, cleanable, stainless HEPA could be commercially available for $5,000 each, whereas the industry has determined that the truer cost of such an item in isolation would be closer to $15,000. This results in a conflict within the requirement between 'low cost' and 'stainless HEPA'. By proposing a system that combines metallic HEPA filtration with the ability to self clean without interrupting the process flow, the need for a tradition HEPA filtration train will be eliminated and this dramatically reduces the resources required for cleaning or disposal, thus presenting a route to reducing ultimate costs. The paper will examine the performance characteristics, filtration efficiency, flow verses differential pressure and cleanability of a self cleaning HEPA grade sintered metal filter element, together with data to prove the contention. (authors)
Nye, Leanne C; Hungerbühler, Hartmut; Drewello, Thomas
2018-02-01
Inspired by reports on the use of pencil lead as a matrix-assisted laser desorption/ionization matrix, paving the way towards matrix-free matrix-assisted laser desorption/ionization, the present investigation evaluates its usage with organic fullerene derivatives. Currently, this class of compounds is best analysed using the electron transfer matrix trans-2-[3-(4-tert-butylphenyl)-2-methyl-2-propenylidene] malononitrile (DCTB), which was employed as the standard here. The suitability of pencil lead was additionally compared to direct (i.e. no matrix) laser desorption/ionization-mass spectrometry. The use of (DCTB) was identified as the by far gentler method, producing spectra with abundant molecular ion signals and much reduced fragmentation. Analytically, pencil lead was found to be ineffective as a matrix, however, appears to be an extremely easy and inexpensive method for producing sodium and potassium adducts.
Dong, Jianghu J; Wang, Liangliang; Gill, Jagbir; Cao, Jiguo
2017-01-01
This article is motivated by some longitudinal clinical data of kidney transplant recipients, where kidney function progression is recorded as the estimated glomerular filtration rates at multiple time points post kidney transplantation. We propose to use the functional principal component analysis method to explore the major source of variations of glomerular filtration rate curves. We find that the estimated functional principal component scores can be used to cluster glomerular filtration rate curves. Ordering functional principal component scores can detect abnormal glomerular filtration rate curves. Finally, functional principal component analysis can effectively estimate missing glomerular filtration rate values and predict future glomerular filtration rate values.
CALCULATION OF LONG-TERM FILTRATION IN A POROUS MEDIUM
Directory of Open Access Journals (Sweden)
Ludmila I. Kuzmina
2018-03-01
Full Text Available he filtration problem in a porous medium is an important part of underground hydromechanics. Filtration of suspensions and colloids determines the processes of strengthening the soil and creating waterproof walls in the ground while building the foundations of buildings and underground structures. It is assumed that the formation of a deposit is dominated by the size-exclusion mechanism of pore blocking: solid particles pass freely through large pores and get stuck at the inlet of pores smaller than the diameter of the particles. A one-dimensional mathematical model for the filtration of a monodisperse suspension includes the equation for the mass balance of suspended and retained particles and the kinetic equation for the growth of the deposit. For the blocking filtration coefficient with a double root, the exact solution is given implicitly. The asymptotics of the filtration problem is constructed for large time. The numerical calculation of the problem is carried out by the finite differences method. It is shown that asymptotic approximations rapidly converge to a solution with the increase of the expansion order.
International Nuclear Information System (INIS)
Eberstadt, P.L.
1981-10-01
Using a model for the two-compartmental open system and experiments on animals (rabbits and dogs) as well as on human healthy volunteers, an attempt was made to study the advantages and limitations of different radionuclide methods for glomerular filtration rate determination. Labelled compounds used in different combinations were: 3 H-inulin, sup(113m)In-EDTA, 131 I-iothalamate, sup(99m)Tc-DTPA and 14 C-creatinine. The results of the study lead to some working hypotheses concerning the value of creatinine and other labelled substances in the measurement of glomerular filtration rate in clinical practice. The advantages and disadvantages of individual methods summarized in the final report are generally in agreement with the present views of many research workers. Also the hypothesis can be justified that the different labelled compounds which have been studied might be handled independently by the membranes involved but at the long run produce similar homeostatic balance
De Ver Dye, Timothy; Apondi, Rose; Lugada, Eric; Kahn, James G; Sandiford-Day, Mary Ann; Dasbanerjee, Tania
2011-08-01
We qualitatively assessed beliefs, attitudes, and behaviors related to diarrhea and water filtration in rural Kenya. A public health campaign was conducted in rural western Kenya to give community members a comprehensive prevention package of goods and services, including a personal water filter or a household water filter (or both). Two months after the campaign, we conducted qualitative interviews with 34 campaign attendees to assess their beliefs, attitudes, and behaviors related to diarrhea and use of the filtration devices. Participants held generally correct perceptions of diarrhea causation. Participants provided positive reports of their experiences with using filters and of their success with obtaining clean water, reducing disease, and reducing consumption of resources otherwise needed to produce clean water. Several participants offered technical suggestions for device improvements, and most participants were still using the devices at the time of the assessment. Novel water filtration devices distributed as part of a comprehensive public health campaign rapidly proved acceptable to community members and were consistent with community practices and beliefs.
Ventilation and filtration techniques for handling aerosols produced by thermal cutting operations
International Nuclear Information System (INIS)
Bishop, A.
1989-01-01
This report describes the work done to characterize aerosols from thermal cutting operations and to develop suitable ventilation and filtration techniques. The work has been carried out under a research contract between the Windscale Laboratory and the Commission of the European Communities. The contract started in October 1984 and was completed in June 1988. The total cost of the work was UKL 132 000 of which 50% was funded by the Commission. This report has been compiled from the several progress reports submitted during the work period and details the main findings from the work programme. By working with colleagues from Commissariat a l'energie atomique, Saclay, France, additional useful data were collected. The bimodal size distribution of aerosols from oxypropane cutting was confirmed. Trials on various prefilters showed that the electrostatic precipitator (ESP) and the cartridge filter had excellent collection properties. From these trials the ESP was selected as the prefilter for the windscale advanced gas-cooled reactor (WAGR) decommissioning project. This work is presented in Appendix 1 to this report. Details are given of the proposals to modify the ESP to enable the safe removal of radioactive dust and contamined collector plates. Tests are described on aerosols generated by laser cutting and also trials on the ESP and high gradient magnetic separation prefilters. Finally, the measurement of filter burdens, aerosol concentrations and dust deposition rates from thermal cutting in a full-size ventilation rig are reported
Directory of Open Access Journals (Sweden)
Nayanci Portal
2011-04-01
Full Text Available Panama disease, caused by Fusarium oxysporum f. sp. cubense, is considered a destructive disease of economic importance in the genus Musa. The culture filtrates of the pathogen have been used to differentiate cultivars, but have not been identified metabolites involved in the differential response. The aim of this study was to purify phytotoxic metabolites present in the culture filtrate of Fusarium oxysporum f. sp. cubense GCV [01210] Race 1 for further chemical characterization. We used a culture filtrate of 15 days of incubation. The phytotoxic activity was tested with a leaf bioassay on the susceptible cultivar ‘Gros Michel’ and resistant ‘FHIA 01’. The organic extract was extracted and fractionated. It was partitioned with organic solvents of rising polarity and found the complexity of each of the fractions by TLC. The metabolites were purified by flash column chromatography. Two compounds were purified from the culture filtrate of the pathogen which not only differed in color (blue and pale yellow, but also in polarity. Fractions B (containing blue compound and E (containing yellow compound produced significant differences in lesion area between resistant and susceptible cultivar. These results are not conclusive but, it is the basis for the identification of compounds involved in the differential response of Musa spp. cultivars to the culture filtrate of Fusarium oxysporum f. sp. cubense. Key Words: phytotoxic activity, chromatography, organic extract, Panama disease, plantains and bananas
Particulate Matter Filtration Design Considerations for Crewed Spacecraft Life Support Systems
Agui, Juan H.; Vijayakumar, R.; Perry, Jay L.
2016-01-01
Particulate matter filtration is a key component of crewed spacecraft cabin ventilation and life support system (LSS) architectures. The basic particulate matter filtration functional requirements as they relate to an exploration vehicle LSS architecture are presented. Particulate matter filtration concepts are reviewed and design considerations are discussed. A concept for a particulate matter filtration architecture suitable for exploration missions is presented. The conceptual architecture considers the results from developmental work and incorporates best practice design considerations.
Immobilized Filters for Air Filtration
National Research Council Canada - National Science Library
Mahle, John J; Zaiee, Saeed
2002-01-01
... (settling performance) and attrition resistance. The fabricated filter samples will be analyzed in order to determine the physical and chemical factors affecting mechanical strength and chemical filtration...
Low Temperature Particle Filtration of Producer Gas with Low Tar Content
DEFF Research Database (Denmark)
Hindsgaul, Claus
This report describes the tests of different techniques for removing the particulates from producer gas from the 100 kW two-stage down-draft gasifier at DTU1 . The goal of the tests was to identify and implement methods to remove soot particles from producer gas with low tar content. During the f...
Pseudomonas biofilm matrix composition and niche biology
Mann, Ethan E.; Wozniak, Daniel J.
2014-01-01
Biofilms are a predominant form of growth for bacteria in the environment and in the clinic. Critical for biofilm development are adherence, proliferation, and dispersion phases. Each of these stages includes reinforcement by, or modulation of, the extracellular matrix. Pseudomonas aeruginosa has been a model organism for the study of biofilm formation. Additionally, other Pseudomonas species utilize biofilm formation during plant colonization and environmental persistence. Pseudomonads produce several biofilm matrix molecules, including polysaccharides, nucleic acids, and proteins. Accessory matrix components shown to aid biofilm formation and adaptability under varying conditions are also produced by pseudomonads. Adaptation facilitated by biofilm formation allows for selection of genetic variants with unique and distinguishable colony morphology. Examples include rugose small-colony variants and wrinkly spreaders (WS), which over produce Psl/Pel or cellulose, respectively, and mucoid bacteria that over produce alginate. The well-documented emergence of these variants suggests that pseudomonads take advantage of matrix-building subpopulations conferring specific benefits for the entire population. This review will focus on various polysaccharides as well as additional Pseudomonas biofilm matrix components. Discussions will center on structure–function relationships, regulation, and the role of individual matrix molecules in niche biology. PMID:22212072
DEFF Research Database (Denmark)
Bekö, Gabriel; Clausen, Geo; Weschler, Charles J.
2008-01-01
Estimates of costs and the corresponding benefits of particle filtration have been derived for a standard office building. Reduction in occupants’ exposure to particles during their workday is anticipated to reduce their morbidity and mortality. Filtration may also reduce the costs associated......, the sensitivity of the results to these parameters was evaluated as part of this study. The study also acknowledges that the benefits-to-costs ratio depends on the perspective of the stakeholder: the employer renting the building is impacted by occupant performance and building energy costs; the building owner...... is impacted by maintenance of the building and its HVAC system; society is impacted by the employees’ health and welfare. Regardless of perspective, particle filtration is anticipated to lead to annual savings significantly exceeding the running costs for filtration. However, economic losses resulting from...
Cross-flow micro-filtration using ceramic membranes
International Nuclear Information System (INIS)
Thern, Gerardo G.; Marajofsky, Adolfo; Rossi, Federico; La Gamma, Ana M.; Chocron, Mauricio
2004-01-01
Pressurized Heavy Water Reactors have a system devoted to the purification and upgrading of the collected heavy water leaks. The purification train is fed with different degradation ratios (D 2 O/H 2 O), activities and impurities. The water is distilled in a packed bed column filled with a mesh type packing. With the purpose of minimizing the column stack corrosion, the water is pre-treated in a train consisting on an activated charcoal bed-strong cationic-anionic resin and a final polishing anionic bed resin. Traces of oils are retained by the charcoal bed but some of them pass through and could be responsible for the resins fouling. The process of micro filtration using ceramic materials is particularly applied to the treatment of waters with oil micro droplets. We describe the development stages of single and double layer filtration ceramic tubes, their characterization and the adaptation to test equipment. The efficiency was evaluated by means of tangential ('cross-flow') filtration of aqueous solutions containing dodecane at the micrograms per ml concentration level. This compound simulates the properties of a typical oil contaminant. A 100-fold reduction in the amount of dodecane in water was observed after the filtration treatment. (author)
MATHEMATIC MODEL OF ELECTROMAGNETIC FILTRATION PROCESS OF TECHNOLOGICAL LIQUID AND GAS
R. A. Мouradova
2005-01-01
Electromagnetic filtration as a perspective method of filtration and purification of liquid and gas finds its wide application in oil and chemical industry. However absence of highly-reliable model of calculation that permits unambiguously main operational parameters of electromagnetic filtration and limits its wide application.
Aoyama-Araki, Yuka; Honjo, Megumi; Uchida, Takatoshi; Yamagishi, Reiko; Kano, Kuniyuki; Aoki, Junken; Aihara, Makoto
2017-04-01
To investigate levels of sphingosine-1-phosphate (S1P) in aqueous fluid samples taken before and after filtration surgery and S1P-induced human conjunctival fibroblast (HCF) responses. Levels of S1P and its related sphingophospholipids in aqueous fluid obtained immediately before and after filtration surgery were determined by liquid chromatography-tandem mass spectrometry. HCFs were used for all in vitro experiments. The expression of five S1P receptor subtypes in HCFs was examined by quantitative real-time PCR. The effect of S1P and receptor-specific antagonists on HCF viability and cell migration was assessed by WST-1 assay and scratch migration assay, respectively. Differentiation to myofibroblasts and extracellular matrix production was evaluated by examining changes in F-actin, α-smooth muscle actin (αSMA), and collagen expression with immunocytochemistry, Western blotting, and collagen accumulation assay, respectively. No significant S1P levels in the aqueous fluid samples were detectable immediately before surgery, but postoperative levels of several lysophospholipids, including S1P, dehydro-S1P, and sphingosine, were significantly increased to bioactive concentrations in aqueous fluid in the blebs (P S1P receptor subtypes was detected in HCFs. Although S1P levels did not influence HCF proliferation, S1P enhanced cell migration, which could be inhibited by the S1P2 antagonist JTE 013. F-actin, αSMA, and collagen expression was significantly increased by S1P stimulation and was reduced by JTE 013. Bioactive S1P concentrations were present in the aqueous fluid at the end of filtration surgery. S1P activated HCFs via S1P2 receptors. These results revealed the potential of S1P2 antagonists in preventing scarring after glaucoma filtration surgery.
Filtration system for nuclear power plant
International Nuclear Information System (INIS)
Otani, Takashi; Nakamizo, Hiroshi.
1991-01-01
The filtration system of the present invention comprises a filtering device incorporating ceramic filament element bundles, a pool return line for returning filtrates to a side banker pool or fuel storage pool, a waste sludge discharge line for discharging waste sludges captured in the filter elements by way of washing operation and a settling separation vessel. Ceramics of excellent radiation resistance and having an extremely thin multi-layered structure at the surface are used for the filter elements. Highly radioactive cruds captured at the surface of the elements by liquid passage are removed by supplying water or gas in a pulsative manner in the direction opposite to the liquid passage thereby cleaning the surface of the elements at a high speed. The thus removed high radioactive cruds are concentrically confined within the settling separation layer by gravitational settling separation. Thus, there is no more necessary for disposing the filtration element bundles after use, so that the amount of wastes can be reduced, the radiation dosage can be lowered and the facility can be simplified. (N.H.)
Evaluation of condensate filtration technologies in fossil plants
Energy Technology Data Exchange (ETDEWEB)
D' Angelo, Philip J. [JoDan Technologies Ltd., Glen Mills, PA (United States)
2009-09-15
Long-term protection of electric power generating station boilers depends upon the quality of their feedwater chemistry with respect to the transport and deposition of corrosion products to the boilers from various corrosion sources in the plant's condensate and feedwater cycle. It is in the utility's best interests to expand their programs to include ways to reduce the transport of corrosion products, especially those that occur during plant start-ups. Condensate filtration is a strategy employed by some utilities with demonstrable results in minimizing corrosion product transport and achieving a return on their investment. This paper provides a comparative review of available condensate filtration technologies as well as performance data from fossil plants with the new large diameter high flow filtration systems. Additionally, the paper identifies critical parameters to consider before installation as well as the necessity for agreement between utilities and suppliers on common filtration terminology definitions, to insure an ''apple-to-apple'' basis when comparing a system or technology from more than one supplier. (orig.)
Impact of Acidification on Pollutants Fate and Soil Filtration Function
Directory of Open Access Journals (Sweden)
Jarmila Makovniková
2014-12-01
Full Text Available The objective of this paper was to investigate the effects of simulated acid load on the fate of inorganic pollutants (Cd, Pb, soil sorption potential, soil filtration func-tion. We made use of a short-term acidification pot experiment with grown plant of spring barley cultivated at 4 different soil types (Fluvisol, Cambisol, Stagnosol, Podzol. The potential of soil filtration was evaluated according to the Eq.: [Soil filtration function]=[Potential of soil sorbents]+[Potential of total content of inor-ganic pollutants]. Potential of soil sorbents (PSS is defined by qualitative (pH, or-ganic matter quality - A400/600 and quantitative factors (carbon content-Cox, humus layer thickness-H according to the Eq.:[PSS]=F(pH+F(A465/665+F(Cox*F(H. Acid load significantly influenced soil sorption potential and thus affected increase in Cd and Pb mobility what was reflected in their transfer into the plants. Results of soil filtration function showed significant change of filtration function in Cambisol.
Water Treatment Technology - Filtration.
Ross-Harrington, Melinda; Kincaid, G. David
One of twelve water treatment technology units, this student manual on filtration provides instructional materials for six competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on the following areas: purposes of sedimentation basins and flocculation…
International Nuclear Information System (INIS)
Klein, M.; Goossens, W.R.A.; De Smet, M.; Trine, J.; Hertschap, M.
1984-01-01
This report summarizes the work on the development of fibre metallic prefilters to be placed upstream of HEPA filters for the exhaust gases of nuclear process plants. Investigations at ambient and high temperature were carried out. Measurements of the filtration performance of Bekipor porous webs and sintered mats were performed in the AFLT (aerosol filtration at low temperature) unit with a throughput of 15 m 3 /h. A parametric study on the influence of particle size, fibre diameter, number of layers and superficial velocity led to the optimum choice of the working parameters. Three selected filter types were then tested with polydisperse aerosols using a candle-type filter configuration or a flat-type filter configuration. The small-diameter candle type is not well suited for a spraying nozzles regeneration system so that only the flat-type filter was retained for high-temperature tests. A high-temperature test unit (AFHT) with a throughput of 8 to 10 m 3 /h at 400 0 C was used to test the three filter types with an aerosol generated by high-temperature calcination of a simulated nitric acid waste solution traced with 134 Cs. The regeneration of the filter by spray washing and the effect of the regeneration on the filter performance was studied for the three filter types. The porous mats have a higher dust loading capacity than the sintered web which means that their regeneration frequency can be kept lower
Directory of Open Access Journals (Sweden)
Prima Nanda Fauziah
2015-03-01
Full Text Available Lactobacillus bulgaricus produces lactic acid and bacteriocin which have been reported to have various pharmacologic properties, including their role an antibacterial agent. Klebsiella pneumoniae, as an agent of pneumonia, remains a public health problem in tropical countries. This study was aimed to observe the antibacterial activities of lactic acid filtrate and bacteriocins of L. bulgaricus toward againsts K. pneumoniae strains by in vitro experiment. The experiment took place in Microbiology Laboratory, Teaching Hospital, Padjadjaran University, Bandung, August–October 2012. In vitro laboratory analytic study has been conducted on lactic acid filtrate and bacteriocins of L. bulgaricus against the K. pneumoniae strains. The study used agar pour plate and agar disk diffusion method and analyzed by ANAVA followed by Duncan’s multiple range test (DMRT. The 30% lactic acid filtrate and 20% bacteriocins filtrate concentrations of L. bulgaricus showed bactericidal characteristics againts the growth of K. pneumoniae strains. Greater concentration of lactic acid filtrate and bacteriocins of L. bulgaricus led toincreasing effect of growth inhibition zones of K. pneumoniae strains. Statistical analysis of variance (ANOVA showed that the greatest concentration effect of L. bulgaricus filtratefor inhibiting K. pneumoniae strains was achieved in 90% lactic acid filtrate concentration treatment, whereas the greatest inhibition zones for K. pneumoniae ATCC 700603 was obtaubed in 90% bacteriocins filtrate concentration, amounting 16.667 mm. In conclusion, lactic acid filtrate and bacteriocins L. bulgaricus have antibacterial effects on K. pneumoniae. The level of antibacterial effect of L. bulgaricus against the growth of K. pneumoniae strains depends on the type of filtrate, L. bulgaricus filtrate concentration, and K. pneumoniae strain.
Analysis of filtration properties of locally sourced base oil for the ...
African Journals Online (AJOL)
This study examines the use of locally sourced oil like, groundnut oil, melon oil, vegetable oil, soya oil and palm oil as substitute for diesel oil in formulating oil base drilling fluids relative to filtration properties. The filtrate volumes of each of the oils were obtained for filtration control analysis. With increasing potash and ...
Additive Difference Schemes for Filtration Problems in Multilayer Systems
Ayrjan, E A; Pavlush, M; Fedorov, A V
2000-01-01
In the present paper difference schemes for solution of the plane filtration problem in multilayer systems are analyzed within the framework of difference schemes general theory. Attention is paid to splitting the schemes on physical processes of filtration along water-carring layers and vertical motion between layers. Some absolutely stable additive difference schemes are obtained the realization of which needs no software modification. Parallel algorithm connected with the solving of the filtration problem in every water-carring layer on a single processor is constructed. Program realization on the multi-processor system SPP2000 at JINR is discussed.
Malhotra, Chetan; Patil, Rajshree; Kausley, Shankar; Ahmad, Dilshad
2013-06-01
Rice-husk-ash is used as the base material for developing novel compositions to deal with the challenge of purifying drinking water in low-income households in India. For example, rice-husk-ash cast in a matrix of cement and pebbles can be formed into a filtration bed which can trap up to 95% of turbidity and bacteria present in water. This innovation was proliferated in villages across India as a do-it-yourself rural water filter. Another innovation involves embedding silver nanoparticles within the rice husk ash matrix to create a bactericidal filtration bed which has now been commercialized in India as a low-cost for-profit household water purifier. Other innovations include the impregnation of rice-husk-ash with iron hydroxide for the removal of arsenic from water and the impregnation of rice-husk ash with aluminum hydroxide for the removal of fluoride ions from water which together have the potential to benefit over 100 million people across India who are suffering from the health effects of drinking groundwater contaminated with arsenic and fluoride.
Energy Technology Data Exchange (ETDEWEB)
Kartal, S.N. [Istanbul University (Turkey). Forestry Faculty; Imamura, Y. [Kyoto University (Japan). Wood Research Institute; Tsuchiya, F.; Ohsato, K. [JGC Corporation, Yokohama (Japan)
2004-10-01
Biomass slurry fuel (BSF) production has recently been developed as a natural energy for the conversion of solid biomass into fuel. In addition to using fuel, filtrates from BSF production may also serve a chemical source with several organic compounds. There is an increasing interest in the research and application of biomass-based filtrates. In this study, fungicidal and termiticidal properties of filtrates from BSF production using sugi (Cryptomeria japonica) and acacia (Acacia mangium) wood were evaluated in laboratory decay and termite resistance tests. Wood blocks treated with the filtrates showed increased resistance against brown-rot fungus, Formitopsis palustris. However the filtrates from sugi wood processed at 270{sup o}C which contained less phenolic compounds than the other filtrates were effective against white-rot fungus, Trametes versicolor. Phenolic compounds of filtrates seemed to play a role in the decay resistance tests however the filtrates did not increase the durability of the wood blocks against subterranean termites Coptotermes formosanus. Despite high acetic and lactic acid content of the filtrates, vanillin content of the filtrates may have served as an additional food source and promoted termite attack. It can be concluded that filtrates with phenolic compounds from lignin degradation during BSF production can be considered for targeted inhibition of brown-rot. (author)
Properties of plastic filtration material
Energy Technology Data Exchange (ETDEWEB)
Paluch, W.
1988-01-01
Discusses properties of filters made of thermoplastic granulated material. The granulated plastic has a specific density of 10.3-10.6 kN/m/sup 3/ and a bulk density of about 6 kN/m/sup 3/. Its chemical resistance to acids, bases and salts is high but is it soluble in organic solvents. Filters made of this material are characterized by a porosity coefficient of 36.5% and a bulk density of 5.7-6.8 kN/m/sup 3/. Physical and mechanical properties of filter samples made of thermoplastic granulated material (50x50x50 mm) were investigated under laboratory conditions. Compression strength and influencing factors were analyzed (ambient temperature, manufacturing technology). Tests show that this filtration material developed by Poltegor is superior to other filtration materials used in Poland.
Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin
2013-11-27
Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.
Energy Technology Data Exchange (ETDEWEB)
Teir, Sebastian, E-mail: sebastian.teir@vtt.fi [VTT Technical Research Centre of Finland Ltd., Espoo (Finland); Auvinen, Toni [Outotec Dewatering Technology Center, Lappeenranta (Finland); Said, Arshe [Department of Energy Technology, School of Engineering, Aalto University, Espoo (Finland); Kotiranta, Tuukka; Peltola, Heljä [Outotec Research Center, Pori (Finland)
2016-02-22
In this work, experiments were performed to determine the filterability of calcium carbonate produced with an alternative calcium carbonate production concept. The concept uses steelmaking slag as raw material and has potential to fix CO{sub 2} emissions and utilize steelmaking slag, simultaneously. As calcium carbonate is precipitated in a solution containing ammonium chloride, calcium chloride, and ammonia, the product needs to be washed and hence filtered. In this work, different separation processes, including washing, filtering, and drying, were tested on two calcium carbonate slurries produced from steel converter slag and CO{sub 2} by a laboratory-scale pilot facility, with the aim of obtaining a solid product with a low chloride content using a minimum amount of washing water. The order of maximum filtration rates achievable of the calcium carbonate slurries was determined by experimental work. The tests included pressure filtration and vacuum filtration and the test series contained altogether 21 different filtration cycles with varying combinations of filtering, washing, and drying steps. The filtered cakes were analyzed by their residual moisture content, chloride content, and conductivity, and the filtrates by their residual solids content, chloride content, and conductivity. Pressure filtration gave a high capacity (400–460 kg/m{sup 2}h) and a low cake residual moisture content (12–14 wt-%). Vacuum filtration gave slightly higher filtration rates (500–610 kg/m{sup 2}h at the lowest residual chloride contents of the cakes), but the cake residual moisture also stayed higher (25–26 wt-%). As the vacuum filtration tests used a filter cloth with higher permeability than that of the pressure filtration tests, a slightly higher filtration rate was expected. However, both filtration technologies seem suitable for filtering and washing calcium carbonate prepared with the studied method as a residual chloride content as low as 10 ppm of the filtered
Lorente, E; Hapońska, M; Clavero, E; Torras, C; Salvadó, J
2017-08-01
In this study, the microalga Nannochloropsis gaditana was subjected to acid catalysed steam explosion treatment and the resulting exploded material was subsequently fractionated to separate the different fractions (lipids, sugars and solids). Conventional and vibrational membrane setups were used with several polymeric commercial membranes. Two different routes were followed: 1) filtration+lipid solvent extraction and 2) lipid solvent extraction+filtration. Route 1 revealed to be much better since the used membrane for filtration was able to permeate the sugar aqueous phase and retained the fraction containing lipids; after this, an extraction required a much lower amount of solvent and a better recovering yield. Filtration allowed complete lipid rejection. Dynamic filtration improved permeability compared to the tangential cross-flow filtration. Best membrane performance was achieved using a 5000Da membrane with the dynamic system, obtaining a permeability of 6L/h/m 2 /bar. Copyright © 2017 Elsevier Ltd. All rights reserved.
Purification of contaminated water by filtration through porous glass
Wydeven, T.; Leban, M. I.
1972-01-01
Method for purifying water that is contaminated with mineral salts and soluble organic compounds is described. Method consists of high pressure filtration of contaminated water through stabilized porous glass membranes. Procedure for conducting filtration is described. Types of materials by percentage amounts removed from the water are identified.
Pathogen filtration to control plant disease outbreak in greenhouse production
Jeon, Sangho; Krasnow, Charles; Bhalsod, Gemini; Granke, Leah; Harlan, Blair; Hausbeck, Mary; Zhang, Wei
2016-04-01
Previous research has been extensively focused on understanding the fate and transport of human microbial pathogens in soil and water environments. However, little is known about the transport of plant pathogens, although these pathogens are often found in irrigation waters and could cause severe crop damage and economical loss. Water mold pathogens including Phytophthora spp. and Pythium spp. are infective to a wide range of vegetable and floriculture crops, and they are primarily harbored in soils and disseminated through water flow. It is challenging to control these pathogens because they often quickly develop resistance to many fungicides. Therefore, this multi-scale study aimed to investigate physical removal of plant pathogens from water by filtration, thus reducing the pathogen exposure risks to crops. In column-scale experiments, we studied controlling factors on the transport and retention of Phytophthora capsici zoospores in saturated columns packed with iron oxide coated-sand and uncoated-sand under varying solution chemistry. Biflagellate zoospores were less retained than encysted zoospores, and lower solution pH and greater iron oxide content increased the retention of encysted zoospores. These results provided insights on environmental dispersal of Phytophthora zoospores in natural soils as well as on developing cost-effective engineered filtration systems for pathogen removal. Using small-scale greenhouse filtration systems, we further investigated the performance of varying filter media (i.e., granular sand, iron oxide coated ceramic porous media, and activated carbon) in mitigating disease outbreaks of Phytophthora and Pythium for greenhouse-grown squash and poinsettia, respectively, in comparison with fungicide treatment. For squash, filtration by iron oxide coated media was more effective in reducing the Phytophthora infection, comparing to sand filtration and fungicide application. For poinsettia, sand filtration performed better in controlling
International Nuclear Information System (INIS)
Park, J. B.; Park, J. W.; Lee, E. Y.; Kim, C. R.
2002-01-01
Colloid-facilitated radionuclide transport in the fractured rock is studies by considering radioactive decay chain and limited matrix diffusion into surrounding porous media. Semi-analytical solution in the Laplace domain is obtained from the mass balance equation of radionuclides and colloid particles. Numerical inversion of the Laplace solution is used to get the concentration profiles both in a fracture and in rock matrix. There issues are analyzed for the radionuclide concentration in a fracture by 1) formation constant of pseudo-colloid, 2) filtration coefficient of radio-colloid and 3) effective diffusion depth into the surrounding porous rock media
Horizontal-belt filtration at Randfontein Estates Mine
International Nuclear Information System (INIS)
Blendulf, K.A.G.; Everett, D.J.
1979-01-01
The paper describes tests on horizontal-belt filters for the filtration of gold and uranium. The promising results led to the installation of 17 such filters (ten of them 120 m 2 in size) in the mine's metallurgical plants, and their operation is discussed. Although several problems were encountered both in operation and maintenance, it is concluded that, with correct operation and suitable filter cloths, exceptionally good metallurgical recoveries can be achieved at filtration rates twice to three times higher than those on rotary filters [af
Soil and Waste Matrix Affects Spatial Heterogeneity of Bacteria Filtration during Unsaturated Flow
Directory of Open Access Journals (Sweden)
Adrian Unc
2015-02-01
Full Text Available Discontinuous flows resulting from discrete natural rain events induce temporal and spatial variability in the transport of bacteria from organic waste through soils in which the degree of saturation varies. Transport and continuity of associated pathways are dependent on structure and stability of the soil under conditions of variable moisture and ionic strength of the soil solution. Lysimeters containing undisturbed monoliths of clay, clay loam or sandy loam soils were used to investigate transport and pathway continuity for bacteria and hydrophobic fluorescent microspheres. Biosolids, to which the microspheres were added, were surface applied and followed by serial irrigation events. Microspheres, Escherichia coli, Enterococcus spp., Salmonella spp. and Clostridium perfringens were enumerated in drainage collected from 64 distinct collection areas through funnels installed in a grid pattern at the lower boundary of the monoliths. Bacteria-dependent filtration coefficients along pathways of increasing water flux were independent of flow volume, suggesting: (1 tracer or colloid dependent retention; and (2 transport depended on the total volume of contiguous pores accessible for bacteria transport. Management decisions, in this case resulting from the form of organic waste, induced changes in tortuosity and continuity of pores and modified the effective capacity of soil to retain bacteria. Surface application of liquid municipal biosolids had a negative impact on transport pathway continuity, relative to the solid municipal biosolids, enhancing retention under less favourable electrostatic conditions consistent with an initial increase in straining within inactive pores and subsequent by limited re-suspension from reactivated pores.
Landfill Leachate Treatment by Electrocoagulation and Fiber Filtration.
Li, Runwei; Wang, Boya; Owete, Owete; Dertien, Joe; Lin, Chen; Ahmad, Hafiz; Chen, Gang
2017-11-01
Landfilling is widely adopted as one of the most economical processes for solid waste disposal. At the same time, landfill leachate is also a great environmental concern owing to its complex composition and high concentrations of contaminants. This research investigated electrocoagulation and fiber filtration for the treatment of landfill leachate. Besides electrical current (i.e., current density) and reaction time, pH played a very important role in arsenic and phosphorus removal by electrocoagulation. The combination of electrocoagulation with fiber filtration achieved a 94% chemical oxygen demand (COD), 87% arsenic, 96% iron, and 86% phosphorus removal. During electrocoagulation, the micro-particles that could not be settled by gravity were removed by the first stage of fiber filtration. Organic contaminants in the leachate were further removed by biodegradation in the second stage of fiber biofiltration.
Penetration of sub-micron aerosol droplets in composite cylindrical filtration elements
International Nuclear Information System (INIS)
Geurts, Bernard J.; Pratte, Pascal; Stolz, Steffen; Stabbert, Regina; Poux, Valerie; Nordlund, Markus; Winkelmann, Christoph
2011-01-01
Advection-diffusion transport of aerosol droplets in composite cylindrical filtration elements is analyzed and compared to experimental data. The penetration, characterizing the fraction of droplets that passes through the pores of a filtration element, is quantified for a range of flow rates. The advection-diffusion transport in a laminar Poiseuille flow is treated numerically for slender pores using a finite difference approach in cylindrical coordinates. The algebraic dependence of the penetration on the Peclet number as predicted theoretically, is confirmed by experimental findings at a variety of aspect ratios of the cylindrical pores. The effective penetration associated with a composite filtration element consisting of a set of parallel cylindrical pores is derived. The overall penetration of heterogeneous composite filtration elements shows an algebraic dependence to the fourth power on the radii of the individual pores that are contained. This gives rise to strong variations in the overall penetration in cases with uneven distributions of pore sizes, highly favoring filtration by the larger pores. The overall penetration is computed for a number of basic geometries, providing a point of reference for filtration design and experimental verification.
“Zebrafishing” for Novel Genes Relevant to the Glomerular Filtration Barrier
Directory of Open Access Journals (Sweden)
Nils Hanke
2013-01-01
Full Text Available Data for genes relevant to glomerular filtration barrier function or proteinuria is continually increasing in an era of microarrays, genome-wide association studies, and quantitative trait locus analysis. Researchers are limited by published literature searches to select the most relevant genes to investigate. High-throughput cell cultures and other in vitro systems ultimately need to demonstrate proof in an in vivo model. Generating mammalian models for the genes of interest is costly and time intensive, and yields only a small number of test subjects. These models also have many pitfalls such as possible embryonic mortality and failure to generate phenotypes or generate nonkidney specific phenotypes. Here we describe an in vivo zebrafish model as a simple vertebrate screening system to identify genes relevant to glomerular filtration barrier function. Using our technology, we are able to screen entirely novel genes in 4–6 weeks in hundreds of live test subjects at a fraction of the cost of a mammalian model. Our system produces consistent and reliable evidence for gene relevance in glomerular kidney disease; the results then provide merit for further analysis in mammalian models.
OPTIMIZATION OF THE PROCESS OF DRYING THE FILTRATE DISTILLERY DREGS
Directory of Open Access Journals (Sweden)
A. A. Shevtsov
2013-01-01
Full Text Available The interactions of various factors affecting the process of drying the filtrate distillery dregs are investigated. Rational conditions for the process of drying the filtrate distillery dregs in a spray dryer are obtained.
Sieve plugs in fenestrae of glomerular capillaries--site of the filtration barrier?
DEFF Research Database (Denmark)
Rostgaard, Jørgen; Qvortrup, Klaus
2002-01-01
The exact location of the filtration barrier of the glomerular capillary wall, which consists of an endothelium, a basement membrane and a visceral epithelium, has not yet been determined. Apparent discrepancies between different investigators in the past could be explained if postmortem...... and a filamentous surface coat about 60 nm thick covered the interfenestral domains of the endothelial cell. Based on these purely morphological data, we dare to suggest that the fenestral plugs are the primary site of the glomerular filtration barrier - albeit highly speculative, nevertheless a logical location...... - and consequently that the glomerular filtration process is a 'tangential-flow' as opposed to a 'dead-end' filtration process. A tangential-flow filtration would minimize 'clogging' and 'concentration polarization' in the 'filter'....
Produced water irrigation changes the soil mesofauna community in a semiarid agroecosystem.
Ferreira, Raimundo Nonato Costa; Weber, Olmar Baller; Crisóstomo, Lindbergue Araujo
2015-08-01
The scarcity of water in semiarid regions requires alternative sources for irrigation to improve agricultural production. Here, we aimed to evaluate the effects of produced water from oil exploration on the structure of soil mesofauna during the dry and rainy seasons in irrigated sunflower and castor bean fields in a Brazilian semiarid region. Three irrigation treatments were applied on plots cultivated with castor beans and sunflowers: produced water treated by filtration (filtrated) or treated by reverse osmosis (reverse osmosis) and groundwater. The mesofauna under the biofuel crops was collected and identified during the dry and rainy seasons. Although the abundance and richness of the total fauna did not differ between seasons in sunflower plots, the community was altered. In castor beans, the abundance, richness, and community of mesofauna observed in plots irrigated with produced water differed from the groundwater treatment. Irrigation with produced water promotes important changes in soil fauna community that justify their assessment for the maintenance and monitoring of agroecosystems.
Oviposition Attractancy of Bacterial Culture Filtrates: response of Culex quinquefasciatus
Directory of Open Access Journals (Sweden)
S Poonam
2002-04-01
Full Text Available Oviposition attractants could be used for monitoring as well as controlling mosquitoes by attracting them to lay eggs at chosen sites. In the present study, culture filtrates of seven bacterial species were tested for their attractancy against gravid females of Culex quinquefasciatus. When their oviposition active indices (OAI were studied, the culture filtrates of Bacillus cereus and Pseudomonas fluorescens exhibited oviposition attractancy (OAI = >0.3 at 100 ppm and the OAI were respectively 0.70 and 0.47. Culture filtrates of B. thuringiensis var. israelensis (wild type, B. t. var. israelensis (mutant and B. sphaericus showed attractancy at 2000 ppm with OAI of respectively 0.71, 0.59 and 0.68. However, the OAI of B. megaterium as well as Azospirillum brasilense was 0.13 (at 2000 ppm, which was less than 0.3 required to be considered them as attractants. When the oviposition attractancy of the bacterial culture filtrates were compared with that of a known oviposition attractant, p-cresol (at 10 ppm, the culture filtrates of B. t. var. israelensis (wild type and B. cereus were found to be more active than p-cresol, respectively with 64.2 and 54.3% oviposition.
Filtration characteristics in membrane bioreactors
Evenblij, H.
2006-01-01
Causes of and remedies for membrane fouling in Membrane Bioreactors for wastewater treatment are only poorly understood and described in scientific literature. A Filtration Characterisation Installation and a measurement protocol were developed with the aim of a) unequivocally determination and
Filtration device for active effluents
International Nuclear Information System (INIS)
Guerin, M.; Meunier, G.
1994-01-01
Among the various techniques relating to solid/liquid separations, filtration is currently utilized for treating radioactive effluents. After testing different equipments on various simulated effluents, the Valduc Center has decided to substitute a monoplate filter for a rotative diatomite precoated filter
Formation of Liquid Products at the Filtration Combustion of Solid Fuels
Directory of Open Access Journals (Sweden)
E. A. Salgansky
2016-01-01
Full Text Available Yields of liquid and gaseous products of the filtration combustion of cellulose, wood, peat, coal, and rubber have been investigated. Experiments have shown that the gasification of solid fuels in the regime with superadiabatic heating yields liquid hydrocarbons with quantity and quality, which are close to those produced using other methods, for example, by pyrolysis. But in this case no additional energy supply is needed to carry out the gasification process. The low calorific combustible gas, which forms in this process, contains a substantial quantity of carbon monoxide and hydrogen, which are components of syngas.
Mixture based outlier filtration
Czech Academy of Sciences Publication Activity Database
Pecherková, Pavla; Nagy, Ivan
2006-01-01
Roč. 46, č. 2 (2006), s. 30-35 ISSN 1210-2709 R&D Projects: GA MŠk 1M0572; GA MDS 1F43A/003/120 Institutional research plan: CEZ:AV0Z10750506 Keywords : data filtration * system modelling * mixture models Subject RIV: BD - Theory of Information http://library.utia.cas.cz/prace/20060165.pdf
Hassan Fathabadi
2013-01-01
In this study, several novel numerical solutions are presented to solve the turbulent filtration equation and its special case called “Non-Newtonian mechanical filtration equation”. The turbulent filtration equation in porous media is a very important equation which has many applications to solve the problems appearing especially in mechatronics, micro mechanic and fluid mechanic. Many applied mechanical problems can be solved using this equation. For example, non-Newtonian mechanical filtrat...
Directory of Open Access Journals (Sweden)
Muthukumar Sampath
2014-12-01
Full Text Available Filtration steps are ubiquitous in biotech processes due to the simplicity of operation, ease of scalability and the myriad of operations that they can be used for. Microfiltration, depth filtration, ultrafiltration and diafiltration are some of the most commonly used biotech unit operations. For clean feed streams, when fouling is minimal, scaling of these unit operations is performed linearly based on the filter area per unit volume of feed stream. However, for cases when considerable fouling occurs, such as the case of harvesting a therapeutic product expressed in Pichia pastoris, linear scaling may not be possible and current industrial practices involve use of 20–30% excess filter area over and above the calculated filter area to account for the uncertainty in scaling. In view of the fact that filters used for harvest are likely to have a very limited lifetime, this oversizing of the filters can add considerable cost of goods for the manufacturer. Modeling offers a way out of this conundrum. In this paper, we examine feasibility of using the various proposed models for filtration of a therapeutic product expressed in Pichia pastoris at constant pressure. It is observed that none of the individual models yield a satisfactory fit of the data, thus indicating that more than one fouling mechanism is at work. Filters with smaller pores were found to undergo fouling via complete pore blocking followed by cake filtration. On the other hand, filters with larger pores were found to undergo fouling via intermediate pore blocking followed by cake filtration. The proposed approach can be used for more accurate sizing of microfilters and depth filters.
Non-filtration method of processing uranium ores
International Nuclear Information System (INIS)
Laskorin, B.N.; Vodolazov, L.I.; Tokarev, N.N.; Vyalkov, V.I.; Goldobina, V.A.; Gosudarstvennyj Komitet po Ispol'zovaniyu Atomnoj Ehnergii SSSR, Moscow)
1977-01-01
The development of the non-filtration sorption method has lead to procedures of the sorption leaching and the extraction desorption, which have made it possible to intensify the processing of uranium ores and to improve greatly the technical and economic indexes by eliminating the complex method of multiple filtration and re-pulping of cakes. This method makes it possible to involve more poor uranium raw materials, at the same time extracting valuable components such as molybdenum, vanadium, copper, etc. Considerable industrial experience has been acquired in the sorption of dense pulp with a solid-to-liquid phase ratio of 1:1. This has led to a plant production increase of 1.5-3.0 times, an increase of uranium extraction by 5-10%, a two- to- three-fold increase of labour capacity of the main workers, and to a several-fold decrease of reagents, auxiliary materials, electric energy and vapour. This non-filtration method is a continuous process in all its phases thanks to the use of high-yield and high-power equipment for high-density pulps. (author)
Ultra-filtration measurement using CT imaging technology
International Nuclear Information System (INIS)
Lu Junfeng; Lu Wenqiang
2009-01-01
As a functional unit in the hemodialysis process, dialyzer captured quite a few medical research interests since 1980s. In the design of dialyzer or in the ongoing hemodialysis process, to estimate the ultra-filtration amount of a dialyzer, the sideway loss of the running blood flow through hollow fibers or filtration channels should be measured. This further leads to the measurement of the blood flow inside the dialyzer. For this measurement, a non-invasive method is highly desired because of the high-dense bundled hollow fibers or packed channels inside the dialyzer. As non-invasive measurement tools, CT (Computed Tomography) technologies were widely used for tissue, bone, and cancerous clinical analyses etc .... Thus, in this paper, a CT system is adopted to predict the blood flow inside a hollow fiber dialyzer. In view of symmetric property of the hollow fiber dialyzer, the largest cutting plane that parallels to the cylindrical dialyzer was analyzed by the CT system dynamically. And then, a noninvasive image analysis method used to predict the ultra-filtration amount is proposed.
The Application of Homogenate and Filtrate from Baltic Seaweeds in Seedling Growth Tests
Directory of Open Access Journals (Sweden)
Izabela Michalak
2017-02-01
Full Text Available Algal filtrate and homogenate, obtained from Baltic seaweeds, were applied in seedling growth tests. Radish seeds were used in order to assess algal products phytotoxicity and their biostimulant effect on growth and nutrient uptake. Algal filtrate, at concentrations ranging from 5.0% to 100% was used for seed soaking and as a liquid biostimulant (soil and foliar application. Algal homogenate was developed for seed coating. Algal filtrate and homogenate were also enriched with Zn(II ions in order to examine the influence on metal ion complexation. The optimal doses of algal filtrate and homogenate, as well as soaking time were established. Multi-elemental analyses of the raw biomass, filtrate, homogenate, and radish were also performed using ICP-OES (Inductively Coupled Plasma—Optical Emission Spectrometry. The best results in terms of seedlings’ length and weight were obtained using clear filtrate at a concentration of 50% applied to the soil and for homogenate applied at a dose of 50 mg/g of seeds. Clear filtrate at a concentration of 50% used for seed soaking for one hour showed the best results. The applied algal products increased the content of elements in seedlings. Among the tested products, a concentration of 50% algal filtrate is recommended for future pot and field experiments.
Directory of Open Access Journals (Sweden)
Sidlof P.
2013-04-01
Full Text Available This paper deals with the method which calculates a filtration efficiency of nonwoven textiles from scattered light intensity by seeding particles. Thefiltration efficiency is commonly measured by particle counters. Samples of liquid or gas are taken during a test in front of and behind a filtration material. The concentration of particles is measured and the filtration efficiency is calculated. The filtration efficiency does not have to be uniform in itswhole surface. The uniformity of filtration is another indicator of a quality of filtration materials. Measurements described in this article were performed on a water filtration setup which enables optical access to the place where the filtration material is mounted. Pictures of illuminated seeding particles are made by a laser sheet and a camera. Visualisation of the filtration process enables measuring of the efficiency of separation versus time and also versus two-dimensional position in case of use of a traverse mechanism. The filtration textiles were tested by 1 μm seeding particles. Mean value of light intensity and number of bright pixels in evaluative areas during image analysis were obtained. On the basis of these data, the filtration efficiency iscalculated. The best image analysis method was chosen.
Process analysis and optimization of direct horizontal-row roughing filtration
Ahsan, T.
1995-01-01
There is a growing demand for appropriate water treatment technology for towns and small cities in developing countries. This study developed a pretreatment technology for highly turbid river water, called direct horizontal-flow roughing filtration, by combining the principles of direct filtration
Filtration of Nanoparticles: Evolution of Cake Structure and Pressure-Drop
DEFF Research Database (Denmark)
Elmøe, Tobias Dokkedal; Tricoli, Antonio; Grunwaldt, Jan-Dierk
2009-01-01
The detailed three-dimensional accumulation of deposits and the build-up of pressuredrop during filtration of compressible gases laden with nanoparticles (diameter dp=50 nm) through capillaries (1–4 micron radius) was investigated by Langevin dynamics (LD) at Peclet number, Pe, 0.01–10. At low Pe...... with constant solid volume fraction began to form, accompanied with build-up of pressuredrop which was in excellent agreement with classic cake filtration theory. An expression for the solid volume fraction of the cake (fsd,c) was obtained as a sole function of Pe. In addition, the filtration efficiency became...... 1 after clogging, since the cake acts as a perfectly efficient filter. Penetration of nanoparticles takes place until the onset of cake filtration at high Pe (1–10) while for smaller ones (0.01–0.1) it is negligible at the employed capillary radii and length (10 micron). Analytical expressions...
Demonstration of creep during filtration
DEFF Research Database (Denmark)
Christensen, Morten Lykkegaard; Bugge, Thomas Vistisen; Kirchheiner, Anders Løvenbalk
The classical filtration theory assumes a unique relationship between the local filter cake porosity and the local effective pressure. For a number of compressible materials, it has however been observed that during the consolidation stage this may not be the case. It has been found...... that the production of filtrate also depends on the characteristic time for the filter cake solids to deform. This is formulated in the Terzaghi-Voigt model in which a secondary consolidation is introduced. The secondary consolidation may be visualized by plots of the relative cake deformation (U) v.s. the square...... root of time. Even more clearly it is demonstrated by plotting the liquid pressure at the cake piston interface v.s. the relative deformation (to be shown). The phenomenon of a secondary consolidation processes is in short called creep. Provided that the secondary consolidation rate is of the same...
Energy Technology Data Exchange (ETDEWEB)
DePaoli, D.W.; Tsouris, C. [Oak Ridge National Lab., TN (United States); Yiacoumi, Sotira
1997-10-01
Magnetic-seeding filtration is a technology under development for the enhanced removal of magnetic and non-magnetic particulates from liquids. This process involves the addition of a small amount of magnetic seed particles (such as naturally occurring iron oxide) to a waste suspension, followed by treatment with a magnetic filter. Non-magnetic and weakly magnetic particles are made to undergo nonhomogeneous flocculation with the seed particles, forming flocs of high magnetic susceptibility that are readily removed by a conventional high-gradient magnetic filter. This technology is applicable to a wide range of liquid wastes, including groundwater, process waters, and tank supernatants. Magnetic-seeding filtration may be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes. Waste stream characteristics for which the technology may be applicable include (1) particle sizes ranging from relatively coarse (several microns) to colloidal particles, (2) high or low radiation levels, (3) broad-ranging flow rates, (4) low to moderate solids concentration, (5) cases requiring high decontamination factors, and (6) aqueous or non-aqueous liquids. At this point, the technology is at the bench-scale stage of development; laboratory studies and fundamental modeling are currently being employed to determine the capabilities of the process.
International Nuclear Information System (INIS)
DePaoli, D.W.; Tsouris, C.; Yiacoumi, Sotira.
1997-01-01
Magnetic-seeding filtration is a technology under development for the enhanced removal of magnetic and non-magnetic particulates from liquids. This process involves the addition of a small amount of magnetic seed particles (such as naturally occurring iron oxide) to a waste suspension, followed by treatment with a magnetic filter. Non-magnetic and weakly magnetic particles are made to undergo nonhomogeneous flocculation with the seed particles, forming flocs of high magnetic susceptibility that are readily removed by a conventional high-gradient magnetic filter. This technology is applicable to a wide range of liquid wastes, including groundwater, process waters, and tank supernatants. Magnetic-seeding filtration may be used in several aspects of treatment, such as (1) removal of solids, particularly those in the colloidal size range that are difficult to remove by conventional means; (2) removal of contaminants by precipitation processes; and (3) removal of contaminants by sorption processes. Waste stream characteristics for which the technology may be applicable include (1) particle sizes ranging from relatively coarse (several microns) to colloidal particles, (2) high or low radiation levels, (3) broad-ranging flow rates, (4) low to moderate solids concentration, (5) cases requiring high decontamination factors, and (6) aqueous or non-aqueous liquids. At this point, the technology is at the bench-scale stage of development; laboratory studies and fundamental modeling are currently being employed to determine the capabilities of the process
ACTINIDE REMOVAL PROCESS SAMPLE ANALYSIS, CHEMICAL MODELING, AND FILTRATION EVALUATION
Energy Technology Data Exchange (ETDEWEB)
Martino, C.; Herman, D.; Pike, J.; Peters, T.
2014-06-05
Filtration within the Actinide Removal Process (ARP) currently limits the throughput in interim salt processing at the Savannah River Site. In this process, batches of salt solution with Monosodium Titanate (MST) sorbent are concentrated by crossflow filtration. The filtrate is subsequently processed to remove cesium in the Modular Caustic Side Solvent Extraction Unit (MCU) followed by disposal in saltstone grout. The concentrated MST slurry is washed and sent to the Defense Waste Processing Facility (DWPF) for vitrification. During recent ARP processing, there has been a degradation of filter performance manifested as the inability to maintain high filtrate flux throughout a multi-batch cycle. The objectives of this effort were to characterize the feed streams, to determine if solids (in addition to MST) are precipitating and causing the degraded performance of the filters, and to assess the particle size and rheological data to address potential filtration impacts. Equilibrium modelling with OLI Analyzer{sup TM} and OLI ESP{sup TM} was performed to determine chemical components at risk of precipitation and to simulate the ARP process. The performance of ARP filtration was evaluated to review potential causes of the observed filter behavior. Task activities for this study included extensive physical and chemical analysis of samples from the Late Wash Pump Tank (LWPT) and the Late Wash Hold Tank (LWHT) within ARP as well as samples of the tank farm feed from Tank 49H. The samples from the LWPT and LWHT were obtained from several stages of processing of Salt Batch 6D, Cycle 6, Batch 16.
q-Virasoro constraints in matrix models
Energy Technology Data Exchange (ETDEWEB)
Nedelin, Anton [Dipartimento di Fisica, Università di Milano-Bicocca and INFN, sezione di Milano-Bicocca, Piazza della Scienza 3, I-20126 Milano (Italy); Department of Physics and Astronomy, Uppsala university,Box 516, SE-75120 Uppsala (Sweden); Zabzine, Maxim [Department of Physics and Astronomy, Uppsala university,Box 516, SE-75120 Uppsala (Sweden)
2017-03-20
The Virasoro constraints play the important role in the study of matrix models and in understanding of the relation between matrix models and CFTs. Recently the localization calculations in supersymmetric gauge theories produced new families of matrix models and we have very limited knowledge about these matrix models. We concentrate on elliptic generalization of hermitian matrix model which corresponds to calculation of partition function on S{sup 3}×S{sup 1} for vector multiplet. We derive the q-Virasoro constraints for this matrix model. We also observe some interesting algebraic properties of the q-Virasoro algebra.
Modeling of filtration of 2-types particles suspension in a porous medium
Directory of Open Access Journals (Sweden)
Galaguz Yuri
2017-01-01
Full Text Available The filtration problem describes the process of concreting loose soil with a liquefied concrete solution. The filtration of 2-types particles suspension in a homogeneous porous medium with a size-exclusion particles retention mechanism is considered. The difference in the filtration coefficients of 2-types particles leads to the separation of the filtration domain into two zones, in one of which two types of particles are deposited and in another – only particles of one type are deposited. In this paper, the mobile boundary of two zones is calculated, and numerical solution of the problem is calculated.
Renin-angiotensin system antagonists, glomerular filtration rate and blood pressure
Directory of Open Access Journals (Sweden)
D.D. Ivanov
2018-02-01
Full Text Available The article deals with the mModern data on the influence of renin-angiotensin system blockers on the glomerular filtration rate, the level of arterial pressure and the outcome of chronic kidney disease. The strategy of rennin-angiotensine blockade is offered to be changed depending on the criteria values of glomerular filtration rate: a combination of inhibitors of angiotensin-converting enzyme + angiotensin receptors blockers, monotherapy and drug withdrawal in glomerular filtration rate under 15–30 ml/min/m2. The formula BRIMONEL for treatment of chronic kidney disease is given.
Ultrasonic filtration of industrial chemical solutions
Cosma, T.
1974-01-01
The practical results obtained as a result of filtering industrial chemical solutions under continuous flow conditions with the aid of an ultrasonic filter are presented. The main part of the assembly consists of an ultrasonic generator with an output power of about 400 W and the filtration assembly, in which there is a magnetostrictive amplifier constructed for 20.5 kHz. In addition to ensuring a continuous flow of filtered solution, ultrasonic filters can be replaced or cleaned at intervals of time that are 8-10 times greater than in the case of mechanical filters. They yield considerably better results as far as the size of the filtered particles is concerned. The parameters on which filtration quality depends are also presented.
Everett, C.R.; Chin, Y.-P.; Aiken, G.R.
1999-01-01
A 1,000-Dalton tangential-flow ultrafiltration (TFUF) membrane was used to isolate dissolved organic matter (DOM) from several freshwater environments. The TFUF unit used in this study was able to completely retain a polystyrene sulfonate 1,800-Dalton standard. Unaltered and TFUF-fractionated DOM molecular weights were assayed by high-pressure size exclusion chromatography (HPSEC). The weight-averaged molecular weights of the retentates were larger than those of the raw water samples, whereas the filtrates were all significantly smaller and approximately the same size or smaller than the manufacturer-specified pore size of the membrane. Moreover, at 280 nm the molar absorptivity of the DOM retained by the ultrafilter is significantly larger than the material in the filtrate. This observation suggests that most of the chromophoric components are associated with the higher molecular weight fraction of the DOM pool. Multivalent metals in the aqueous matrix also affected the molecular weights of the DOM molecules. Typically, proton-exchanged DOM retentates were smaller than untreated samples. This TFUF system appears to be an effective means of isolating aquatic DOM by size, but the ultimate size of the retentates may be affected by the presence of metals and by configurational properties unique to the DOM phase.
DEFF Research Database (Denmark)
Madsen, Henrik Tækker; Søgaard, Erik Gydesen; Muff, Jens
2015-01-01
A significant challenge for large-scale use of electrochemical oxidation (EO) is high energy consumption, and for EO to become accepted as a standard technique, the amount of energy consumed in the process must be reduced. In this study, it was investigated how the energy consumption of EO could...... be lowered by combining the process with membrane filtration, in a setup where EO was applied to the membrane retentate stream. Use of two types of membranes, a nanofiltration (NF) and a reverse osmosis (RO) membrane, was investigated, and to provide realistic estimates on the energy consumption...... of the treatment, natural groundwater spiked with the pesticide residue 2,6-dichlorobenzamide (BAM) was used as matrix in the experiments. To understand the effect of the membranes on the energy consumption, their effect on the EO degradation efficiency was also determined. The results showed that membranes...
C-018H LERF filtration test plan. Revision 1
International Nuclear Information System (INIS)
Moberg, T.P.; King, C.V.
1994-01-01
The following outlines the plan to test the polymeric backwash filtration system at the LERF. These tests will determine if the ETF filter design is adequate. If the tests show that the design is adequate, the task will be complete. If the tests show that the technology is inadequate, it may be necessary to perform further tests to qualify other candidate filtration technologies (e.g., polymeric tubular ultrafiltration, centrifugal ultrafiltration). The criteria to determine the success or failure of the backwash filter will be based on the system's ability to remove the bacteria and inorganic contaminants from the evaporator process condensate. The tests are designed to qualify the design basis of the filtration technology that will be used in the ETF
C-018H LERF filtration test plan. Revision 1
Energy Technology Data Exchange (ETDEWEB)
Moberg, T.P.; King, C.V.
1994-08-26
The following outlines the plan to test the polymeric backwash filtration system at the LERF. These tests will determine if the ETF filter design is adequate. If the tests show that the design is adequate, the task will be complete. If the tests show that the technology is inadequate, it may be necessary to perform further tests to qualify other candidate filtration technologies (e.g., polymeric tubular ultrafiltration, centrifugal ultrafiltration). The criteria to determine the success or failure of the backwash filter will be based on the system`s ability to remove the bacteria and inorganic contaminants from the evaporator process condensate. The tests are designed to qualify the design basis of the filtration technology that will be used in the ETF.
Task 9 - Centrifugal membrane filtration. Semi-annual report, April 1 - September 30, 1997
International Nuclear Information System (INIS)
Stepan, D.J.; Grafsgaard, M.E.
1997-01-01
This project is designed to establish the utility of a novel centrifugal membrane filtration technology for the remediation of liquid mixed waste streams at US Department of Energy (DOE) facilities in support of the DOE Environmental Management (EM) program. The Energy and Environmental Research Center (EERC) has teamed with SpinTek Membrane Systems, Inc., a small business and owner of the novel centrifugal membrane filtration technology, to establish the applicability of the technology to DOE site remediation and the commercial viability of the technology for liquid mixed waste stream remediation. The technology is a uniquely configured process that makes use of ultrafiltration and centrifugal force to separate suspended and dissolved solids from liquid waste streams, producing a filtered water stream and a low-volume contaminated concentrate stream. This technology has the potential for effective and efficient waste volume minimization, the treatment of liquid tank wastes, the remediation of contaminated groundwater plumes, and the treatment of secondary liquid waste streams from other remediation processes, as well as the liquid waste stream generated during decontamination and decommissioning activities
The usage of filtration as fulfillment of acceptable indoor and optimal energy management
International Nuclear Information System (INIS)
Burroughs, H.E.
1993-01-01
The role of filtration is a significant factor in the prevention and mitigation of indoor air quality problems. ASHRAE Standard 62-89. Ventilation for Acceptable Indoor Air Quality, makes broad and non-specific references to filtration. This paper provides guidelines for the usage of filtration as a means of fulfillment of the Standard's requirements. The paper also references the specific authorities as iterated in the Standard. The discussion will include the usage of filtration in treating contaminated outside air, protection of equipment and systems, protection of occupants, reduction of ventilation air, and source control. The reduction of ventilation air through filtration has significant and positive energy management benefits. Other energy benefits accrue from clean heat exchange surfaces
Expanded uncertainty estimation methodology in determining the sandy soils filtration coefficient
Rusanova, A. D.; Malaja, L. D.; Ivanov, R. N.; Gruzin, A. V.; Shalaj, V. V.
2018-04-01
The combined standard uncertainty estimation methodology in determining the sandy soils filtration coefficient has been developed. The laboratory researches were carried out which resulted in filtration coefficient determination and combined uncertainty estimation obtaining.
Filtration effectiveness of HVAC systems at near-roadway schools.
McCarthy, M C; Ludwig, J F; Brown, S G; Vaughn, D L; Roberts, P T
2013-06-01
Concern for the exposure of children attending schools located near busy roadways to toxic, traffic-related air pollutants has raised questions regarding the environmental benefits of advanced heating, ventilation, and air-conditioning (HVAC) filtration systems for near-road pollution. Levels of black carbon and gaseous pollutants were measured at three indoor classroom sites and at seven outdoor monitoring sites at Las Vegas schools. Initial HVAC filtration systems effected a 31-66% reduction in black carbon particle concentrations inside three schools compared with ambient air concentrations. After improved filtration systems were installed, black carbon particle concentrations were reduced by 74-97% inside three classrooms relative to ambient air concentrations. Average black carbon particle concentrations inside the schools with improved filtration systems were lower than typical ambient Las Vegas concentrations by 49-96%. Gaseous pollutants were higher indoors than outdoors. The higher indoor concentrations most likely originated at least partially from indoor sources, which were not targeted as part of this intervention. Recent literature has demonstrated adverse health effects in subjects exposed to ambient air near major roadways. Current smart growth planning and infill development often require that buildings such as schools are built near major roadways. Improving the filtration systems of a school's HVAC system was shown to decrease children's exposure to near-roadway diesel particulate matter. However, reducing exposure to the gas-phase air toxics, which primarily originated from indoor sources, may require multiple filter passes on recirculated air. © 2012 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.
Peat, Tom; Galloway, Alexander; Toumpis, Athanasios; McNutt, Philip; Iqbal, Naveed
2017-02-01
This work reports on the erosion performance of three particle reinforced metal matrix composite coatings, co-deposited with an aluminium binder via cold-gas dynamic spraying. The deposition of ceramic particles is difficult to achieve with typical cold spray techniques due to the absence of particle deformation. This issue has been overcome in the present study by simultaneously spraying the reinforcing particles with a ductile metallic binder which has led to an increased level of ceramic/cermet particles deposited on the substrate with thick (>400 μm) coatings produced. The aim of this investigation was to evaluate the erosion performance of the co-deposited coatings within a slurry environment. The study also incorporated standard metallographic characterisation techniques to evaluate the distribution of reinforcing particles within the aluminium matrix. All coatings exhibited poorer erosion performance than the uncoated material, both in terms of volume loss and mass loss. The Al2O3 reinforced coating sustained the greatest amount of damage following exposure to the slurry and recorded the greatest volume loss (approx. 2.8 mm3) out of all of the examined coatings. Despite the poor erosion performance, the WC-CoCr reinforced coating demonstrated a considerable hardness increase over the as-received AA5083 (approx. 400%) and also exhibited the smallest free space length between adjacent particles. The findings of this study reveal that the removal of the AA5083 matrix by the impinging silicon carbide particles acts as the primary wear mechanism leading to the degradation of the coating. Analysis of the wear scar has demonstrated that the damage to the soft matrix alloy takes the form of ploughing and scoring which subsequently exposes carbide/oxide particles to the impinging slurry.
Mechanisms of formation damage in matrix-permeability geothermal wells
Energy Technology Data Exchange (ETDEWEB)
Bergosh, J.L.; Wiggins, R.B.; Enniss, D.O.
1982-04-01
Tests were conducted to determine mechanisms of formation damage that can occur in matrix permeability geothermal wells. Two types of cores were used in the testing, actual cores from the East Mesa Well 78-30RD and cores from a fairly uniform generic sandstone formation. Three different types of tests were run. The East Mesa cores were used in the testing of the sensitivity of core to filtrate chemistry. The tests began with the cores exposed to simulated East Mesa brine and then different filtrates were introduced and the effects of the fluid contrast on core permeability were measured. The East Mesa cores were also used in the second series of tests which tested formation sandstone cores were used in the third test series which investigated the effects of different sizes of entrained particles in the fluid. Tests were run with both single-particle sizes and distributions of particle mixes. In addition to the testing, core preparation techniques for simulating fracture permeability were evaluated. Three different fracture formation mechanisms were identified and compared. Measurement techniques for measuring fracture size and permeability were also developed.
Energy Technology Data Exchange (ETDEWEB)
Li, Y
1996-04-16
Filtration properties of model drilling fluids composed of water, clays, electrolytes and water soluble polymers have been studied in static and dynamic conditions on paper filters and rock slices. Filtration experiments combined with cake observations by cryo-S.E.M. and T.E.M., show the influence of the size shape of clay particles as well as their associating mode in suspension, on the texture of the cake, its permeability, and relaxation properties. These parameters depend on the nature of the electrolyte. The polymer reduces the cake permeability by enhancing the dispersion of the clay within the suspension, but mainly by plugging the porous network due its auto aggregation properties. The cake construction in dynamic conditions, is related to the state of aggregation of the initial suspension, its poly-dispersity, its sensitivity to shear rates, and also, to the permeability of the cake built at the beginning of the filtration. In all cases, the rate of thickening of the cake is slower and larger filtrate volumes are obtained compared to the static conditions. Shear rate has two effects: first, to dissociate the weak aggregates in suspension, second, to impose a size selection of the particles in the case of a poly-dispersed suspension. At high shear rates, a cake of constant thin thickness is quickly obtained. The thickness of this limiting cake depends on the fraction of small particles present in suspension, or that can be formed by dissociation of weak aggregates under shear rate. The permeability of this limiting cake formed in dynamic conditions is, as in static conditions, controlled by the size and the shape of the particles that form the cake or by the presence of a build loss reducer water soluble polymer. Filtrations carried out on Fontainebleau sandstones allow to visualize the internal cake and to precise the risks of formation damage by the drilling fluid. (author) 127 refs.
Steele, Maureen; Silins, Edmund; Flaherty, Ian; Hiley, Sarah; van Breda, Nick; Jauncey, Marianne
2018-01-01
Wheel-filtration of pharmaceutical opioid tablets is a recognised harm reduction strategy, but uptake of the practice among people who inject drugs is low. The study aimed to: (i) examine perceptions of filtration practices; (ii) provide structured education on wheel-filtration; and (iii) assess uptake of the practice. Frequent opioid tablet injectors (n = 30) attending a supervised injecting facility in Sydney, Australia, received hands-on instruction on wheel-filtration based on recommended practice. Pre-education, post-education and follow-up questionnaires were administered. Wheel-filtration was generally regarded as better than cotton-filtration (the typical method) in terms of perceived effects on health, ease of use and overall drug effect. Sixty-eight percent of those who said they would try wheel-filtration after the education had actually done so. Of those who usually used cotton-filtration, over half (60%) had used wheel-filtration two weeks later. Uptake of safer preparation methods for pharmaceutical opioid tablets increases after structured education in wheel-filtration. Findings suggest that SIFs are an effective site for this kind of education. Supervised injecting facility workers are uniquely positioned to provide harm reduction education at the time of injection. [Steele M, Silins E, Flaherty I, Hiley S, van Breda N, Jauncey M. Uptake of wheel-filtration among clients of a supervised injecting facility: Can structured education work? Drug Alcohol Rev 2018;37:116-120]. © 2017 Australasian Professional Society on Alcohol and other Drugs.
Facility of aerosol filtration
Energy Technology Data Exchange (ETDEWEB)
Duverger de Cuy, G; Regnier, J
1975-04-18
Said invention relates to a facility of aerosol filtration, particularly of sodium aerosols. Said facility is of special interest for fast reactors where sodium fires involve the possibility of high concentrations of sodium aerosols which soon clog up conventional filters. The facility intended for continuous operation, includes at the pre-filtering stage, means for increasing the size of the aerosol particles and separating clustered particles (cyclone separator).
Filtration aids in uranium ore processing
International Nuclear Information System (INIS)
Ford, H.L.; Levine, N.M.; Risdon, A.L.
1975-01-01
The patent describes a process whereby improved flocculation efficiency and filtration of carbonate leached uranium ore pulps are obtained by treating the filter feed slurry with an aqueous solution of hydroxyalkyl guar. (J.R.)
Fusion Kalman filtration with k-step delay sharing pattern
Directory of Open Access Journals (Sweden)
Duda Zdzisław
2015-09-01
Full Text Available A fusion hierarchical state filtration with k−step delay sharing pattern for a multisensor system is considered. A global state estimate depends on local state estimates determined by local nodes using local information. Local available information consists of local measurements and k−step delay global information - global estimate sent from a central node. Local estimates are transmitted to the central node to be fused. The synthesis of local and global filters is presented. It is shown that a fusion filtration with k−step delay sharing pattern is equivalent to the optimal centralized classical Kalman filtration when local measurements are transmitted to the center node and used to determine a global state estimate. It is proved that the k−step delay sharing pattern can reduce covariances of local state errors.
Industrial investigations of the liquid steel filtration
Directory of Open Access Journals (Sweden)
K. Janiszewski
2014-07-01
Full Text Available Hitherto existing investigations concerning the ceramic filter use in the steel making processes have given good results. The obtained results of filtration have proved that this method may be used as an effective and cheap way of steel filtration from non-metallic inclusions. Placing filters in the tundish is the best location considering the limitation of the possibility of secondary pollution of steel. Yet, the results presented in this paper, of an experiment prepared and carried out in the industrial environment, are the only positive results obtained, which are connected with so much quantities of liquid steel processed with use of the multi-hole ceramic filters.
Visscher, J.T.
2006-01-01
For more than a quarter of a century, IRC has been supporting the development of Slow Sand Filtration (SSF) and more recently, together with CINARA, the pioneering of Multi-Stage Filtration (MSF) - a combination of Gravel Filtration and SSF that has been shown to have great potential as an effective
Hanford phosphate precipitation filtration process evaluation
International Nuclear Information System (INIS)
Walker, B.W.; McCabe, D.J.
1997-01-01
The purpose of this filter study was to evaluate cross-flow filtration as effective solid-liquid separation technology for treating Hanford wastes, outline operating conditions for equipment, examine the expected filter flow rates, and determine proper cleaning. A proposed Hanford waste pre-treatment process uses sodium hydroxide at high temperature to remove aluminum from sludge. This process also dissolves phosphates. Upon cooling to 40 degrees centigrade the phosphates form a Na7(PO4)2F9H2O precipitate which must be removed prior to further treatment. Filter studies were conducted with a phosphate slurry simulant to evaluate whether 0.5 micron cross-flow sintered metal Mott filters can separate the phosphate precipitate from the wash solutions. The simulant was recirculated through the filters at room temperature and filtration performance data was collected
Correlations of filtration flux enhanced by electric fields in crossflow microfiltration
Energy Technology Data Exchange (ETDEWEB)
Okada, K.; Nagase, Y. [Kurashiki University of Science and the Arts, Okayama (Japan). Department of Chemical Technology; Ohnishi, Y.; Nishihan, A.; Akagi, Y. [Okayama University of Science, Okayama (Japan). Department of Applied Chemistry
1997-12-01
The steady state filtration flux in electrically-enhanced crossflow microfiltration is estimated using a correlation equation proposed for several kinds of suspensions. Baker`s yeast and Rhodotorula glutinis were used as model samples of microbial cells, and PMMA particles were used as samples of non-living solids. Application of the electric field in crossflow microfiltration is a useful method for improving the filtration flux of these samples. High flux levels for the cells were achieved when an electric field above 3000 V/m was applied. The effect of the electric field in increasing the filtration flux of the steady state was analyzed theoretically using a force balance model where the viscous drag force, F{sub J}, the electrophoretic force, F{sub E}, and the re-entraining force, F{sub B}, were considered to act on a particle on the membrane surface under a steady state of filtration, respectively. From force balance analysis, it is found that on application of an electric field, the electro-osmotic effect can be neglected in the present study, so that the filtration flux of the steady state, J{sub ES}, can be presented by, J{sub ES}=U{sub EP}E+J{sub OS} where U{sub EP} is the electrophoretic mobility of particles and E is the electric field applied. J{sub OS} is the filtration flux in the absence of an electric field, which is correlated with the operating parameters for suspensions tested. 22 refs., 7 figs., 1 tab.
Use of a tangential filtration unit for processing liquid waste from nuclear laundries
International Nuclear Information System (INIS)
Augustin, X.; Buzonniere, A. de; Barnier, H.
1993-01-01
Nuclear laundries produce large quantities of weakly contaminated effluents charged with insoluble and soluble products. In collaboration with CEA, TECHNICATOME has developed an ultrafiltration process for liquid waste from nuclear laundries, associated with prior in-solubilization of the radiochemical activity. This process 'seeded ultrafiltration' is based on the use of decloggable mineral filter media and combines very high separation efficiency with long membrane life. The efficiency of the tangential filtration unit which has been processing effluents from the Cadarache Nuclear Research Center (CEA-France) nuclear laundry since mid-1988, has been confirmed on several sites
76 FR 82323 - Design, Inspection, and Testing Criteria for Air Filtration and Adsorption Units
2011-12-30
... Filtration and Adsorption Units AGENCY: Nuclear Regulatory Commission. ACTION: Draft regulatory guide... for Air Filtration and Adsorption Units of Postaccident Engineered-Safety-Feature Atmosphere Cleanup... testing of air filtration and iodine adsorption units of engineered-safety-feature (ESF) atmosphere...
Hall, J. B., Jr.; Batten, C. E.; Wilkins, J. R.
1974-01-01
A combined filtration-reverse-osmosis water recovery system has been evaluated to determine its capability to reclaim domestic wash water for reuse as a commode water supply. The system produced water that met all chemical and physical requirements established by the U.S. Public Health Service for drinking water with the exception of carbon chloroform extractables, methylene blue active substances, and phenols. It is thought that this water is of sufficient quality to be reused as commode supply water. The feasibility of using a combined filtration and reverse-osmosis technique for reclaiming domestic wash water has been established. The use of such a technique for wash-water recovery will require a maintenance filter to remove solid materials including those less than 1 micron in size from the wash water. The reverse-osmosis module, if sufficiently protected from plugging, is an attractive low-energy technique for removing contaminants from domestic wash water.
Kardaş, Fatih; Cetin, Aysun; Solmaz, Musa; Büyükoğlan, Rüksan; Kaynar, Leylagül; Kendirci, Mustafa; Eser, Bülent; Unal, Ali
2012-12-01
The aim of this study was to report the efficacy of low-density lipoprotein cholesterol (LDL-C) apheresisusing a cascade filtration system in pediatric patients with homozygous familial hypercholesterolemia (FH), and toclarify the associated adverse effects and difficulties. LDL-C apheresis using a cascade filtration system was performed in 3 pediatric patientswith homozygous FH; in total, 120 apheresis sessions were performed. Cascade filtration therapy significantly reduced the mean LDL-C values from 418 ± 62 mg/dL to 145 ± 43 mg/dL (p= 0.011). We observed an acute mean reduction in the plasma level of total cholesterol (57.9%), LDL-C (70.8%),and high-density lipoprotein cholesterol (HDL-C) (40.7%). Treatments were well tolerated. The most frequent clinicaladverse effects were hypotension in 3 sessions (2.5%), chills (1.7%) in 2 sessions, and nausea/vomiting in 3 sessions(2.5%). Our experience using the cascade filtration system with 3 patients included good clinical outcomes andlaboratory findings, safe usage, and minor adverse effects and technical problems. None declared.
Noncausal two-stage image filtration at presence of observations with anomalous errors
S. V. Vishnevyy; S. Ya. Zhuk; A. N. Pavliuchenkova
2013-01-01
Introduction. It is necessary to develop adaptive algorithms, which allow to detect such regions and to apply filter with respective parameters for suppression of anomalous noises for the purposes of image filtration, which consist of regions with anomalous errors. Development of adaptive algorithm for non-causal two-stage images filtration at pres-ence of observations with anomalous errors. The adaptive algorithm for noncausal two-stage filtration is developed. On the first stage the adaptiv...
Riederer, Kathleen; Cruz, Kristian; Shemes, Stephen; Szpunar, Susan; Fishbain, Joel T
2015-06-01
Matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry has dramatically altered the way microbiology laboratories identify clinical isolates. Direct blood culture (BC) detection may be hampered, however, by the presence of charcoal in BC bottles currently in clinical use. This study evaluates an in-house process for extraction and MALDI-TOF identification of Gram-negative bacteria directly from BC bottles containing charcoal. Three hundred BC aliquots were extracted by a centrifugation-filtration method developed in our research laboratory with the first 96 samples processed in parallel using Sepsityper® kits. Controls were colonies from solid media with standard phenotypic and MALDI-TOF identification. The identification of Gram-negative bacteria was successful more often via the in-house method compared to Sepsityper® kits (94.7% versus 78.1%, P≤0.0001). Our in-house centrifugation-filtration method was further validated for isolation and identification of Gram-negative bacteria (95%; n=300) directly from BC bottles containing charcoal. Copyright © 2015 Elsevier Inc. All rights reserved.
Ortiz Martinez, Camila; Pereira Ruiz, Suelen; Carvalho Fenelon, Vanderson; Rodrigues de Morais, Gutierrez; Luciano Baesso, Mauro; Matioli, Graciette
2016-05-01
Agrobacterium sp. IFO 13140 cells were immobilized on a loofa sponge and used to produce curdlan over five successive cycles. The interaction between microbial cells and the loofa sponge as well as the produced curdlan were characterized by Fourier transform infrared-attenuated total reflectance (FTIR-ATR) spectrometry. The purity of the curdlan was also evaluated. The storage stability of the immobilized cells was assessed and the produced curdlan was used in a functional yogurt formulation. The average curdlan production by immobilized cells was 17.84 g L(-1) . The presence of the microorganism in the sponge was confirmed and did not cause alterations in the matrix, and the chemical structure of the curdlan was the same as that of commercial curdlan. The purity of both was similar. The immobilized cells remained active after 300 days of storage at -18 °C. The use of the produced curdlan in a functional yogurt resulted in a product with lower syneresis. A large number of cells physically adhered to the surface of loofa sponge fibers, and its use as an immobilization matrix to produce curdlan was effective. The use of the produced curdlan in yogurt allowed the development of a more stable product. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Kong, Meng; Li, Mingjie; Shang, Ruoxu; Wu, Jingyu; Yan, Peisong; Xu, Dongmei; Li, Chaoxu
2018-01-24
Marine shells not only represent a rapidly accumulating type of fishery wastes but also offer a unique sort of hybrid nanomaterials produced greenly and massively in nature. The elaborate "brick and mortar" structures of nacre enabled the synthesis of carbon nanomeshes with <1 nm thickness, hierarchical porosity, and high specific surface area through pyrolysis, in which two-dimensional (2D) organic layers served as the carbonaceous precursor and aragonite platelets as the hard template. Mineral bridges within 2D organic layers templated the formation of mesh pores of 20-70 nm. In contrast to other hydrophobic carbon nanomaterials, these carbon nanomeshes showed super dispersibility in diverse solvents and thus processability for membranes through filtration, patterning, spray-coating, and ink-writing. The carbon membranes with layered structures were capable of serving not only for high-flux filtration and continuous flow absorption but also for electrochemical and strain sensing with high sensitivity. Thus, utilization of marine shells, on one hand, relieves the environmental concern of shellfish waste, on the other hand, offers a facile, green, low-cost, and massive approach to synthesize unique carbon nanomeshes alternative to graphene nanomeshes and applicable in environmental adsorption, filtration, wearable sensors, and flexible microelectronics.
Jairam, Dharmananda; Kiewra, Kenneth A.; Kauffman, Douglas F.; Zhao, Ruomeng
2012-01-01
This study investigated how best to study a matrix. Fifty-three participants studied a matrix topically (1 column at a time), categorically (1 row at a time), or in a unified way (all at once). Results revealed that categorical and unified study produced higher: (a) performance on relationship and fact tests, (b) study material satisfaction, and…
Portable Hybrid Powered Water Filtration Device
Directory of Open Access Journals (Sweden)
Maria Lourdes V. Balansay
2015-08-01
Full Text Available The existing water filtration device has features that can be developed to be more useful and functional during emergency situations. The project’s development has been aided by following provisions in PEC, NEC, NEMA and Philippine National Standard for Safe Drinking Water provide standards for the construction of the project. These standards protect both the prototype and the user. These also served as guide for the maintenance of every component. The design of the portable hybrid powered water filtration device shows that the project has more advanced features such as portability and the power supply used such as photovoltaic module solar cells and manually operated generator. This also shows its effectiveness and reliability based on the results of discharging test, water quality test and water production test. Based on analysis of the overall financial aspects, the machine can be profitable and the amount of revenue and operating cost will increase as years pass. Using the proper machine/ tools and methods of fabrication helps in easy assembly of the project. The materials and components used are cost effective and efficient. The best time for charging the battery using solar panel is 9:00 am onwards while the hand crank generator is too slow because the generated current is little. The water filtration device is very efficient regarding the operating hours and water production. The machine may have a great effect to society and economy in generation of clean available water at less cost.
Development of filtration equipment to reuse PFC decontamination wastewater
International Nuclear Information System (INIS)
Kim, Gye Nam; Lee, Sung Yeol; Won, Hui Jun; Jung Chong Hun; Oh, Won Zin; Park, Jin Ho
2005-01-01
When PFC(Perfluorocarbonate) decontamination technology is applied to removal of radioactive contaminated particulate adhered at surface during the operation of nuclear research facilities, it is necessary to develop a filtration equipment to reuse of PFC solution due to high price, also to minimize the volume of second wastewater. Contaminated characteristics of hot particulate was investigated and a filtration process was presented to remove suspended radioactive particulate from PFC decontamination wastewater generated on PFC decontamination
High Temperature Particle Filtration Technology; TOPICAL
International Nuclear Information System (INIS)
Besmann, T.M.
2001-01-01
High temperature filtration can serve to improve the economic, environmental, and energy performance of chemical processes. This project was designed to evaluate the stability of filtration materials in the environments of the production of dimethyldichlorosilane (DDS). In cooperation with Dow Corning, chemical environments for the fluidized bed reactor where silicon is converted to DDS and the incinerator where vents are cornbusted were characterized. At Oak Ridge National Laboratory (ORNL) an exposure system was developed that could simulate these two environments. Filter samples obtained from third parties were exposed to the environments for periods up to 1000 hours. Mechanical properties before and after exposure were determined by burst-testing rings of filter material. The results indicated that several types of filter materials would likely perform well in the fluid bed environment, and two materials would be good candidates for the incinerator environment
Air filtration and indoor air quality
DEFF Research Database (Denmark)
Bekö, Gabriel
2006-01-01
Demands for better indoor air quality are increasing, since we spend most of our time indoors and we are more and more aware of indoor air pollution. Field studies in different parts of the world have documented that high percentage of occupants in many offices and buildings find the indoor air...... decent ventilation and air cleaning/air filtration, high indoor air quality cannot be accomplished. The need for effective air filtration has increased with increasing evidence on the hazardous effects of fine particles. Moreover, the air contains gaseous pollutants, removal of which requires various air...... cleaning techniques. Supply air filter is one of the key components in the ventilation system. Studies have shown that used ventilation filters themselves can be a significant source of indoor air pollution with consequent impact on perceived air quality, sick building syndrome symptoms and performance...
Are vacuum-filtrated reduced graphene oxide membranes symmetric?
Tang, Bo; Zhang, Lianbin; Li, Renyuan; Wu, Jinbo; Hedhili, Mohamed Neijib; Wang, Peng
2015-01-01
Graphene or reduced graphene oxide (rGO) membrane-based materials are promising for many advanced applications due to their exceptional properties. One of the most widely used synthesis methods for rGO membranes is vacuum filtration of graphene oxide (GO) on a filter membrane, followed by reduction, which shows great advantages such as operational convenience and good controllability. Despite vacuum-filtrated rGO membranes being widely used in many applications, a fundamental question is overlooked: are the top and bottom surfaces of the membranes formed at the interfaces with air and with the filter membrane respectively symmetric or asymmetric? This work, for the first time, reports the asymmetry of the vacuum-filtrated rGO membranes and discloses the filter membranes’ physical imprint on the bottom surface of the rGO membrane, which takes place when the filter membrane surface pores have similar dimension to GO sheets. This result points out that the asymmetric surface properties should be cautiously taken into consideration while designing the surface-related applications for GO and rGO membranes.
Are vacuum-filtrated reduced graphene oxide membranes symmetric?
Tang, Bo
2015-12-02
Graphene or reduced graphene oxide (rGO) membrane-based materials are promising for many advanced applications due to their exceptional properties. One of the most widely used synthesis methods for rGO membranes is vacuum filtration of graphene oxide (GO) on a filter membrane, followed by reduction, which shows great advantages such as operational convenience and good controllability. Despite vacuum-filtrated rGO membranes being widely used in many applications, a fundamental question is overlooked: are the top and bottom surfaces of the membranes formed at the interfaces with air and with the filter membrane respectively symmetric or asymmetric? This work, for the first time, reports the asymmetry of the vacuum-filtrated rGO membranes and discloses the filter membranes’ physical imprint on the bottom surface of the rGO membrane, which takes place when the filter membrane surface pores have similar dimension to GO sheets. This result points out that the asymmetric surface properties should be cautiously taken into consideration while designing the surface-related applications for GO and rGO membranes.
Modeling the filtration ability of stockpiled filtering facepiece
Rottach, Dana R.
2016-03-01
Filtering facepiece respirators (FFR) are often stockpiled for use during public health emergencies such as an infectious disease outbreak or pandemic. While many stockpile administrators are aware of shelf life limitations, environmental conditions can lead to premature degradation. Filtration performance of a set of FFR retrieved from a storage room with failed environmental controls was measured. Though within the expected shelf life, the filtration ability of several respirators was degraded, allowing twice the penetration of fresh samples. The traditional picture of small particle capture by fibrous filter media qualitatively separates the effect of inertial impaction, interception from the streamline, diffusion, settling, and electrostatic attraction. Most of these mechanisms depend upon stable conformational properties. However, common FFR rely on electrets to achieve their high performance, and over time heat and humidity can cause the electrostatic media to degrade. An extension of the Langevin model with correlations to classical filtration concepts will be presented. The new computational model will be used to predict the change in filter effectiveness as the filter media changes with time.
Crossflow Filtration: EM-31, WP-2.3.6
International Nuclear Information System (INIS)
Duignan, M.; Nash, C.; Poirier, M.
2011-01-01
In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several
CROSSFLOW FILTRATION: EM-31, WP-2.3.6
Energy Technology Data Exchange (ETDEWEB)
Duignan, M.; Nash, C.; Poirier, M.
2011-02-01
In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several
Some observations on air filtration
Kluyver, A.J.; Visser, J.
1950-01-01
1. A method has been developed for testing the filtration efficiency of some filter materials. For each of the materials investigated — cotton wool, stillite and carbon — a suitable filter has been devised. 2. The filtered air was analyzed as to its germ content with the aid of a set of 3 capillary
Bargeman, Gerrald; Koops, G.H.; Houwing, J.; Breebaart, I.; van der Horst, H.C.; Wessling, Matthias
2002-01-01
The ability to produce functional food ingredients from natural sources becomes increasingly attractive to the food industry. Antimicrobial (bioactive) ingredients, like peptides and proteins, can be isolated from hydrolysates with membrane filtration and/or chromatography. Electro-membrane
Control of Bean Rust using Antibiotics Produced by Bacillus and ...
African Journals Online (AJOL)
Antibiotic culture filtrates produced by Bacillus (CA5) and Streptomyces spp. were tested for translocation and persistence when applied on snap beans inoculated with rust (Uromyces appendiculatus) in greenhouse pot experiments. The antibiotics were applied on the first trifoliate leaves and translocation was assessed as ...
Water Filtration through Homogeneous Granulated Charge
Directory of Open Access Journals (Sweden)
A. M. Krautsou
2005-01-01
Full Text Available General relationship for calculation of water filtration through homogeneous granulated charge has been obtained. The obtained relationship has been compared with experimental data. Discrepancies between calculated and experimental values do not exceed 6 % throughout the entire investigated range.
In-Water Hull Cleaning & Filtration System
George, Dan
2015-04-01
Dan George R & D Mining Technology LinkedIn GRD Franmarine have received the following prestigious awards in 2014 for their research & development of an in-water hull cleaning and filtration system "The Envirocart: Golden Gecko Award for Environmental Excellence; WA Innovator of the Year - Growth Sector; Department of Fisheries - Excellence in Marine Biosecurity Award - Innovation Category; Lloyd's List Asia Awards - Environmental Award; The Australian Innovation Challenge - Environment, Agriculture and Food Category; and Australian Shipping and Maritime Industry Award - Environmental Transport Award. The Envirocart developed and patented by GRD Franmarine is a revolutionary new fully enclosed capture and containment in-water hull cleaning technology. The Envirocart enables soft Silicon based antifouling paints and coatings containing pesticides such as Copper Oxide to be cleaned in situ using a contactless cleaning method. This fully containerised system is now capable of being deployed to remote locations or directly onto a Dive Support Vessel and is rated to offshore specifications. This is the only known method of in-water hull cleaning that complies with the Department of Agriculture Fisheries and Forestry (DAFF) and Department of Fisheries WA (DoF) Guidelines. The primary underwater cleaning tool is a hydraulically powered hull cleaning unit fitted with rotating discs. The discs can be fitted with conventional brushes for glass or epoxy based coatings or a revolutionary new patented blade system which can remove marine biofouling without damaging the antifouling paint (silicone and copper oxide). Additionally there are a patented range of fully enclosed hand cleaning tools for difficult to access niche areas such as anodes and sea chests, providing an innovative total solution that enables in-water cleaning to be conducted in a manner that causes no biological risk to the environment. In full containment mode or when AIS are present, material is pumped
Impacts of extreme flooding on riverbank filtration water quality.
Ascott, M J; Lapworth, D J; Gooddy, D C; Sage, R C; Karapanos, I
2016-06-01
Riverbank filtration schemes form a significant component of public water treatment processes on a global level. Understanding the resilience and water quality recovery of these systems following severe flooding is critical for effective water resources management under potential future climate change. This paper assesses the impact of floodplain inundation on the water quality of a shallow aquifer riverbank filtration system and how water quality recovers following an extreme (1 in 17 year, duration >70 days, 7 day inundation) flood event. During the inundation event, riverbank filtrate water quality is dominated by rapid direct recharge and floodwater infiltration (high fraction of surface water, dissolved organic carbon (DOC) >140% baseline values, >1 log increase in micro-organic contaminants, microbial detects and turbidity, low specific electrical conductivity (SEC) 400% baseline). A rapid recovery is observed in water quality with most floodwater impacts only observed for 2-3 weeks after the flooding event and a return to normal groundwater conditions within 6 weeks (lower fraction of surface water, higher SEC, lower DOC, organic and microbial detects, DO). Recovery rates are constrained by the hydrogeological site setting, the abstraction regime and the water quality trends at site boundary conditions. In this case, increased abstraction rates and a high transmissivity aquifer facilitate rapid water quality recoveries, with longer term trends controlled by background river and groundwater qualities. Temporary reductions in abstraction rates appear to slow water quality recoveries. Flexible operating regimes such as the one implemented at this study site are likely to be required if shallow aquifer riverbank filtration systems are to be resilient to future inundation events. Development of a conceptual understanding of hydrochemical boundaries and site hydrogeology through monitoring is required to assess the suitability of a prospective riverbank filtration
Toosi, Mohammad Reza; Emami, Mohammad Reza Sarmasti; Hajian, Sudeh
2018-05-11
MCM-41 mesopore was prepared by hydrothermal method and used for synthesis of polyaniline/MCM-41 nanocomposite via in situ polymerization. The nanocomposite was blended with polysulfone to prepare mixed matrix membrane in different content of nanocomposite by phase inversion method. Structural and surface properties of the samples were characterized by SEM, XRD, FTIR, AFM, TGA, BET, and zeta potential measurements. Effect of the nanocomposite content on the hydrophilicity, porosity, and permeability of the membrane was determined. Membrane performance was evaluated for removal of lead ions in dynamic filtration and static adsorption. The membranes were found as effective adsorptive filters for removal of lead ions via interactions between active sites of nanocomposite in membrane structure and lead ions during filtration. Results of batch experiments proved adsorptive mechanism of membranes for removal of lead ions with the maximum adsorption capacity of 19.6 mg/g.
Energy Technology Data Exchange (ETDEWEB)
Selvakumar, S., E-mail: lathaselvam1963@gmail.com [Department of Mechanical Engineering, Nehru Institute of Technology, Coimbatore 641105, Tamil Nadu (India); Department of Mechanical Engineering, Anna University, Chennai 600025, Tamil Nadu (India); Dinaharan, I., E-mail: dinaweld2009@gmail.com [Department of Mechanical Engineering Science, University of Johannesburg, Auckland Park Kingsway Campus, Johannesburg 2006 (South Africa); Palanivel, R., E-mail: rpalanivelme@gmail.com [Department of Mechanical Engineering Science, University of Johannesburg, Auckland Park Kingsway Campus, Johannesburg 2006 (South Africa); Ganesh Babu, B., E-mail: profbgb@gmail.com [Department of Mechanical Engineering, Roever College of Engineering and Technology, Perambalur 621212, Tamil Nadu (India)
2017-03-15
Aluminum matrix composites (AMCs) reinforced with various ceramic particles suffer a loss in ductility. Hard metallic particles can be used as reinforcement to improve ductility. The present investigation focuses on using molybdenum (Mo) as potential reinforcement for Mo(0,6,12 and 18 vol.%)/6082Al AMCs produced using friction stir processing (FSP). Mo particles were successfully retained in the aluminum matrix in its elemental form without any interfacial reaction. A homogenous distribution of Mo particles in the composite was achieved. The distribution was independent upon the region within the stir zone. The grains in the composites were refined considerably due to dynamic recrystallization and pinning effect. The tensile test results showed that Mo particles improved the strength of the composite without compromising on ductility. The fracture surfaces of the composites were characterized with deeply developed dimples confirming appreciable ductility. - Highlights: •Molybdenum particles used as reinforcement for aluminum composites to improve ductility. •Molybdenum particles were retained in elemental form without interfacial reaction. •Homogeneous dispersion of molybdenum particles were observed in the composite. •Molybdenum particles improved tensile strength without major loss in ductility. •Deeply developed dimples on the fracture surfaces confirmed improved ductility.
International Nuclear Information System (INIS)
Selvakumar, S.; Dinaharan, I.; Palanivel, R.; Ganesh Babu, B.
2017-01-01
Aluminum matrix composites (AMCs) reinforced with various ceramic particles suffer a loss in ductility. Hard metallic particles can be used as reinforcement to improve ductility. The present investigation focuses on using molybdenum (Mo) as potential reinforcement for Mo(0,6,12 and 18 vol.%)/6082Al AMCs produced using friction stir processing (FSP). Mo particles were successfully retained in the aluminum matrix in its elemental form without any interfacial reaction. A homogenous distribution of Mo particles in the composite was achieved. The distribution was independent upon the region within the stir zone. The grains in the composites were refined considerably due to dynamic recrystallization and pinning effect. The tensile test results showed that Mo particles improved the strength of the composite without compromising on ductility. The fracture surfaces of the composites were characterized with deeply developed dimples confirming appreciable ductility. - Highlights: •Molybdenum particles used as reinforcement for aluminum composites to improve ductility. •Molybdenum particles were retained in elemental form without interfacial reaction. •Homogeneous dispersion of molybdenum particles were observed in the composite. •Molybdenum particles improved tensile strength without major loss in ductility. •Deeply developed dimples on the fracture surfaces confirmed improved ductility.
Pollution Impact and Alternative Treatment for Produced Water
Hedar, Yusran; Budiyono
2018-02-01
Oil and gas exploration and production are two of the activities that potentially cause pollution and environmental damage. The largest waste generated from this activity is produced water. Produced water contains hazardous pollutants of both organic and inorganic materials, so that the produced water of oil and gas production cannot be discharged directly to the environment. Uncontrolled discharge can lead to the environmental damage, killing the life of water and plants. The produced water needs to be handled and fulfill the quality standards before being discharged to the environment. Several studies to reduce the contaminants in the produced water were conducted by researchers. Among them were gravity based separation - flotation, separation technique based on filtration, and biological process treatment. Therefore, some of these methods can be used as an alternative waste handling of produced water.
The impact of metallic filter media on HEPA filtration
International Nuclear Information System (INIS)
Chadwick, Chris; Kaufman, Seth
2006-01-01
Traditional HEPA filter systems have limitations that often prevent them from solving many of the filtration problems in the nuclear industry; particularly in applications where long service or storage life, high levels of radioactivity, dangerous decomposition products, chemical aggression, organic solvents, elevated operating temperatures, fire resistance and resistance to moisture are issues. This paper addresses several of these matters of concern by considering the use of metallic filter media to solve HEPA filtration problems ranging from the long term storage of transuranic waste at the WIPP site, spent and damaged fuel assemblies, in glove box ventilation and tank venting to the venting of fumes at elevated temperatures from incinerators, vitrification processes and conversion and sintering furnaces as well as downstream of iodine absorbers in gas cooled reactors in the UK. The paper reviews the basic technology, development, performance characteristics and filtration efficiency, flow versus differential pressure, cleanability and costs of sintered metal fiber in comparison with traditional resin bonded glass fiber filter media and sintered metal powder filter media. Examples of typical filter element and system configurations and applications will be presented The paper will also address the economic case for installing self cleaning pre-filtration, using metallic media, to recover the small volumes of dust that would otherwise blind large volumes of final disposable HEPA filters, thus presenting a route to reduce ultimate disposal volumes and secondary waste streams. (authors)
Complexant Identification in Hanford Waste Simulant Sr/TRU Filtrate
International Nuclear Information System (INIS)
Bannochie, C.J.
2003-01-01
This project was designed to characterize the available multidentate ligand species and metal ion complexes of iron, strontium and manganese formed with the parent chelators, complexing agents and their fragment products. Complex identification was applied to AN-102 and AN-107 filtrate simulants for Hanford waste after an oxidation reaction with sodium permanganate to create a freshly precipitated manganese dioxide solid for adsorption of transuranic elements. Separation efficiency of different ligands was investigated based on the exchange capability of different ion exchange and ion exclusion analytical columns including Dionex IonPac AS-5A, AS-10, AS-11 and AS-6. The elution programs developed with different mobile phase concentrations were based on the change in the effective charge of the anionic species and therefore the retention on the stationary phase. In the present work, qualitative and quantitative assessments of multidentate ligands were investigated. Identification methods for the metal ion complexes responsible for solubilizing Fe, Mn and Sr were applied to aged and fresh simulant waste filtrates. Although concentration measurements of both fresh and 3-week aged filtrates showed that the degradation process occurs mainly due to the harsh chemical environment, it was found that the concentration of iron and manganese did not increase, within the error of the analytical measurements, after three weeks when compared with fresh filtrate
Tools for Schools: Filtration for Improved Air Quality. Technical Services Bulletin.
2001
This product bulletin addresses air pollution control in educational facilities to enhance educational performance, provides air quality recommendations for schools, and examines the filtration needs of various school areas. The types of air particles typically present are highlighted, and the use of proper filtration to control gases and vapors…
Directory of Open Access Journals (Sweden)
Fatih Kardas
2012-12-01
Full Text Available OBJECTIVE: The aim of our study is to discuss the efficacy of low-density lipoprotein-cholesterol (LDL-C apheresis procedure using the cascade filtration system for pediatric patients with homozygous familial hypercholesterolemia (FH, and to clarify the adverse effects and difficulties. METHODS: LDL apheresis using the cascade filtration system was performed in 3 pediatric patients with homozygous FH. In total, 120 apheresis sessions were performed for all patients. RESULTS: Cascade filtration therapy significantly reduced the mean LDL-C values from 418 ± 62 mg/dl to 145 ± 43 mg/dl (p<0.05. We determined an acute mean reduction in the plasma levels of total cholesterol (57.9%, LDL cholesterol (70.8%, and high-density lipoprotein (HDL cholesterol (40.7%. Treatments were well tolerated. The most frequent clinical adverse effects were hypotension in 3 sessions (2.5%, chills/feeling cold (1.7% in 2 sessions, and nausea and vomiting in 3 sessions (2.5%. CONCLUSION: Our experience with three patients using the cascade filtration system were, good clinical outcomes, laboratory findings, safety of usage, minor adverse effects and technical problems.
T. Ufer; M. Posner; H.-P. Wessels; S. Wagner; K. Kaminski; T. Brand; Werres S.
2008-01-01
In a four year project, three different filtration systems were tested under commercial nursery conditions to eliminate Phytophthora spp. from irrigation water. Five nurseries were involved in the project. Slow sand filtration systems were tested in three nurseries. In the fourth nursery, a filtration system with lava grains (Shieer® Bio filtration)...
Antibiotic effective against Saccharomyces produced by Aspergillus oryzae
Energy Technology Data Exchange (ETDEWEB)
Nakata, H.; Sakai, T.; Takeda, M.; Tsukahara, T.
1980-01-01
Production of an antibiotic effective against Saccharomyces cerevisiae was investigated in 85 strains of Aspergillus oryzae, isolated from commercial koji molds. The antibiotic was produced by 50 strains. A. oryzae was cultivated at 30 degrees for 15-20 days in koji extract. The crude preparation was obtained by precipitation from the culture filtrate with EtOH, MeOH, or Me/sub 2/CO.
Water Clarity Simulant for K East Basin Filtration Testing
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Andrew J.
2006-01-20
This document provides a simulant formulation intended to mimic the behavior of the suspended solids in the K East (KE) Basin fuel storage pool. The simulant will be used to evaluate alternative filtration apparatus to improve Basin water clarity and to possibly replace the existing sandfilter. The simulant was formulated based on the simulant objectives, the key identified parameters important to filtration, the composition and character of the KE Basin suspended sludge particles, and consideration of properties of surrogate materials.
Development of electromagnetic filtration in the feed water circuits
International Nuclear Information System (INIS)
Dolle, L.
1980-01-01
Electromagnetic filtration in the feed water circuit of the steam generators in nuclear power plants is efficient towards insoluble corrosion products. The principle of electromagnetic filtration is shortly recalled and the results of corresponding development work are summarized. The magnitude of water volumes to be treated on the two priviledged parts of the circuit are estimated. These parts are on the feed water tank level and on the blow-down of the steam generator. The practical applications are discussed [fr
Detergent zeolite filtration plant
Stanković Mirjana S.; Pezo Lato L.
2003-01-01
The IGPC Engineering Department designed basic projects for detergent zeolite filtration plant, using technology developed in the IGPC laboratories. Several projects were completed: technological, machine, electrical, automation. On the basis of these projects, a production plant with a capacity of 75,000 t/y was manufactured, at "Zeolite Mira", Mira (VE), Italy, in 1997, for increasing detergent zeolite production, from 50,000 to 100,000 t/y. The main goal was to increase the detergent zeoli...
[Why? How? What for? We must measure the glomerular filtration].
Treviño-Becerra, Alejandro
2010-01-01
The measurement of the glomerular filtration shows the degree of the functional qualities and the proficiency of the renal system. Despite new technologies, at present the best accepted technique for measuring the glomerular filtration in most countries is the clearance of creatinine in 24 hour urine. The clearance of creatinine has the advantage that it is confident, easy to reproduce, without technical limitations and low cost.
Blood flow vs. venous pressure effects on filtration coefficient in oleic acid-injured lung.
Anglade, D; Corboz, M; Menaouar, A; Parker, J C; Sanou, S; Bayat, S; Benchetrit, G; Grimbert, F A
1998-03-01
On the basis of changes in capillary filtration coefficient (Kfc) in 24 rabbit lungs, we determined whether elevations in pulmonary venous pressure (Ppv) or blood flow (BF) produced differences in filtration surface area in oleic acid-injured (OA) or control (Con) lungs. Lungs were cyclically ventilated and perfused under zone 3 conditions by using blood and 5% albumin with no pharmacological modulation of vascular tone. Pulmonary arterial, venous, and capillary pressures were measured by using arterial, venous, and double occlusion. Before and during each Kfc-measurement maneuver, microvascular/total vascular compliance was measured by using venous occlusion. Kfc was measured before and 30 min after injury, by using a Ppv elevation of 7 cmH2O or a BF elevation from 1 to 2 l . min-1 . 100 g-1 to obtain a similar double occlusion pressure. Pulmonary arterial pressure increased more with BF than with Ppv in both Con and OA lungs [29 +/- 2 vs. 19 +/- 0.7 (means +/- SE) cmH2O; P Kfc (200 +/- 40 vs. 83 +/- 14%, respectively; P < 0.01) and microvascular/total vascular compliance ratio (86 +/- 4 vs. 68 +/- 5%, respectively; P < 0.01) increased more with BF than with Ppv. In conclusion, for a given OA-induced increase in hydraulic conductivity, BF elevation increased filtration surface area more than did Ppv elevation. The steep pulmonary pressure profile induced by increased BF could result in the recruitment of injured capillaries and could also shift downstream the compression point of blind (zone 1) and open injured vessels (zone 2).
21 CFR 211.46 - Ventilation, air filtration, air heating and cooling.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Ventilation, air filtration, air heating and cooling. 211.46 Section 211.46 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... Buildings and Facilities § 211.46 Ventilation, air filtration, air heating and cooling. (a) Adequate...
Galiatsatos, P. G.; Tennyson, J.
2012-11-01
The most time consuming step within the framework of the UK R-matrix molecular codes is that of the diagonalization of the inner region Hamiltonian matrix (IRHM). Here we present the method that we follow to speed up this step. We use shared memory machines (SMM), distributed memory machines (DMM), the OpenMP directive based parallel language, the MPI function based parallel language, the sparse matrix diagonalizers ARPACK and PARPACK, a variation for real symmetric matrices of the official coordinate sparse matrix format and finally a parallel sparse matrix-vector product (PSMV). The efficient application of the previous techniques rely on two important facts: the sparsity of the matrix is large enough (more than 98%) and in order to get back converged results we need a small only part of the matrix spectrum.
The Fundamentals of Waste Water Sludge Characterization and Filtration
Energy Technology Data Exchange (ETDEWEB)
Scales, Peter J.; Dixon, David R.; Harbour, Peter J.; Stickland, Anthony D.
2003-07-01
The move to greater emphasis on the disposal of waste water sludges through routes such as incineration and the added cost of landfill emplacement puts high demands on dewatering technology for these sludges. A dear problem in this area is that waste water sludges are slow and difficult to dewater and traditional methods of laboratory measurement for prediction of filtration performance are inadequate. This is highly problematic for the design and operational optimisation of centrifuges, filters and settling devices in the waste water industry. The behaviour is assessed as being due to non-linear behaviour of these sludges which negates the use of classical approaches. These approaches utilise the linear portion of a t versus V{sup 2} plot (where t is the time to filtration and V is the specific filtrate volume) to extract a simple Darcian permeability. Without this parameter, a predictive capacity for dewatering using current theory is negated. (author)
On the possibility of separation of valuable components from chloride pulps by filtration
International Nuclear Information System (INIS)
Chub, A.V.; Zelenkov, B.N.; Zakharov, V.F.; Drobot, D.V.
1977-01-01
The possibility has been studied of extracting MCl 5 (M=Nb, Ta) from technical products (chloride pulps in TiCl 4 ) by filtration. It has been established that in a low temperature range (( 5 . With increasing temperature a mutual presence of niobium and tantalum chlorides decreases the total content of MCl 5 in the solution. It has also been found that the filtration rate is proportional to pressure; besides, ''the aged'' precipitates possess worse filtrating properties due to particle destruction. Materials of the fiber glass fabric type are a good base for applying the precipitate. At a layer thickness of the chloride (MCl 5 ) precipitate about 20 mm a sufficiently high filtration rate is ensured
The effect of filtration on radon daughter atmospheres: Laboratory and field experiments
International Nuclear Information System (INIS)
Jonassen, N.; Jensen, B.
1987-01-01
Airborne radon daughters may be removed from the air by internal filtration using mechanical or electrofilters. The effect of the filtration may be evaluated in absolute measure by the decrease in the potential alpha energy concentration (or equivalent equilibrium concentration) or relatively by the decrease in the equilibrium factor. The filtration, however, may also change the distribution of airborne radon daughter activity between the unattached and the aerosol-attached state in a way to increase the radiological dose corresponding to a given potential alpha energy concentration. The paper describes a series of laboratory and field experiments which indicate that it is possible by the use of household electrofilters with filtration rates of 2-3 h -1 to lower the radon daughter concentrations to about 20 -30 % and the average radiological dose to about 50-60 % of the value in unfiltered air
International Nuclear Information System (INIS)
Van Asch, R.; Verbeek, R.
2009-10-01
In the light of the currently running subsidy programme for particulate filters in the Netherlands, the Dutch ministry of spatial planning and environment (VROM) asked TNO to execute a desk study to evaluate the particulates filtration efficiency of retrofit particulate filters for light duty vehicles (passenger cars and vans). The typical retrofit particulate filters for light duty vehicles are also called 'open' or 'half-open' filters, because a part of the exhaust gas can pass through the particulate filter unfiltered. From design point they are very different from the majority of the factory installed particulate filters, which are also called wall-flow or 'closed' particulate filters. Due to these differences there is a large difference in filtration efficiency. Whereas the 'dosed' particulate filters show a filtration efficiency of larger than 90%, the filtration efficiency of 'open' particulate filters is generally lower (type approval minimum 30%), and strongly dependent on the conditions of use. The objective of the current project was to assess the average filtration efficiency of retrofit (open) particulate fillters on light duty vehicles in real world day to day driving, based on available literature data. Also, the reasons of a possible deviation with the type approval test results (minimum filtration efficiency of 30%) was investigated.
Filtration set for gaseous fluids
International Nuclear Information System (INIS)
Lebrun, B.; Couvrat-Desvergnes, A.
1988-01-01
This filtration set is made by a cylindrical vessel containing upstairs to downstairs, the gas inlet, a sealed floor for man inspection, a horizontal granular filter bed, a linen with a porosity inferior to the granulometry of the filter bed, a light support layer of material of larger granulometry, gas permeable tubes and an annular collector connecting the tubes to the outlet [fr
Energy Technology Data Exchange (ETDEWEB)
Pangilinan, Monica [Brown Univ., Providence, RI (United States)
2010-05-01
The top quark produced through the electroweak channel provides a direct measurement of the Vtb element in the CKM matrix which can be viewed as a transition rate of a top quark to a bottom quark. This production channel of top quark is also sensitive to different theories beyond the Standard Model such as heavy charged gauged bosons termed W'. This thesis measures the cross section of the electroweak produced top quark using a technique based on using the matrix elements of the processes under consideration. The technique is applied to 2.3 fb-1 of data from the D0 detector. From a comparison of the matrix element discriminants between data and the signal and background model using Bayesian statistics, we measure the cross section of the top quark produced through the electroweak mechanism σ(p$\\bar{p}$ → tb + X, tqb + X) = 4.30-1.20+0.98 pb. The measured result corresponds to a 4.9σ Gaussian-equivalent significance. By combining this analysis with other analyses based on the Bayesian Neural Network (BNN) and Boosted Decision Tree (BDT) method, the measured cross section is 3.94 ± 0.88 pb with a significance of 5.0σ, resulting in the discovery of electroweak produced top quarks. Using this measured cross section and constraining |Vtb| < 1, the 95% confidence level (C.L.) lower limit is |Vtb| > 0.78. Additionally, a search is made for the production of W' using the same samples from the electroweak produced top quark. An analysis based on the BDT method is used to separate the signal from expected backgrounds. No significant excess is found and 95% C.L. upper limits on the production cross section are set for W' with masses within 600-950 GeV. For four general models of W{prime} boson production using decay channel W' → t$\\bar{p}$, the lower mass limits are the following: M(W'L with SM couplings) > 840 GeV; M(W'R) > 880 GeV or 890 GeV if the
DEFF Research Database (Denmark)
Colombo, Stefano; Brisander, Magnus; Haglöf, Jakob
2015-01-01
Factors determining the pH-controlled dissolution kinetics of nilotinib formulations with the pH-titrable polymer hydroxypropyl methylcellulose phthalate, obtained by carbon dioxide-mediated precipitation, were mechanistically examined in acid and neutral environment. The matrix effect, modulating...... in the polymer matrix were mediated by hydrogen bonding between the drug and the phthalate groups on the polymer. Simultaneous Raman and UV-imaging studies of the effect of drug load on the swelling and dissolution of the polymer matrix revealed that high nilotinib load prevented matrix swelling on passage from...
Zhang, Qingmao; He, Jingjiang; Liu, Wenjin; Zhong, Minlin
2005-01-01
Different weight ratio of titanium, zirconium, WC and Fe-based alloy powders were mixed, and cladded onto a medium carbon steel substrate using a 3kW continuous wave CO2 laser, aiming at producing Ceramic particles- reinforced metal matrix composites (MMCs) layers. The microstructures of the layers are typical hypoeutectic, and the major phases are Ni3Si2, TiSi2, Fe3C, FeNi, MC, Fe7Mo3, Fe3B, γ(residual austenite) and M(martensite). The microstructure morphologies of MMCs layers are dendrites/cells. The MC-type reinforcements are in situ synthesis Carbides which main compositions consist of transition elements Zr, Ti, W. The MC-type particles distributed within dendrite and interdendritic regions with different volume fractions for single and overlapping clad layers. The MMCs layers are dense and free of cracks with a good metallurgical bonding between the layer and substrate. The addition ratio of WC in the mixtures has the remarkable effect on the microhardness of clad layers.
Directory of Open Access Journals (Sweden)
Carlos F. Liriano-Jorge
2014-01-01
Full Text Available Separation of photocatalyst nanoparticles is a problem impeding widespread application of photocatalytic oxidation. As sedimentation of photocatalyst particles is facilitated by their flocculation, the influence of common constituents of biologically pretreated wastewaters (NaCl, NaHCO3, and their combination with humic acid sodium salt on flocculation was tested by the pipet method. Results showed that the impact of these substances on TiO2 nanoparticle flocculation is rather complex and strongly affected by pH. When humic acid was present, TiO2 particles did not show efficient flocculation in the neutral and slightly basic pH range. As an alternative to photocatalyst separation by sedimentation, precoat vacuum filtration with powdered activated carbon (PAC over low-cost spunbond polypropylene fabrics was tested in the presence of two PAC types in aqueous NaCl and NaHCO3 solutions as well as in biologically treated greywater and in secondary municipal effluent. PAC concentrations of ≥2 g/L were required in order to achieve a retention of nearly 95% of the TiO2 nanoparticles on the fabric filter when TiO2 concentration was 1 g/L. Composition of the aqueous matrix and PAC type had a slight impact on precoat filtration. PAC precoat filtration represents a potential pretreatment for photocatalyst removal by micro- or ultrafiltration.
Apparatus for Crossflow Filtration Testing of High Level Waste Samples
International Nuclear Information System (INIS)
Nash, C.
1998-05-01
Remotely-operated experimental apparatuses for verifying crossflow filtration of high level nuclear waste have been constructed at the Savannah River Site (SRS). These units have been used to demonstrate filtration processes at the Savannah River Site, Oak Ridge National Laboratory, the Idaho National Engineering and Environmental Laboratory, and Pacific Northwest National Laboratory. The current work covers the design considerations for experimentation as well as providing results from testing at SRS
Cast Steel Filtration Trials Using Ceramic-Carbon Filters
Directory of Open Access Journals (Sweden)
Lipowska B.
2014-12-01
Full Text Available Trials of cast steel filtration using two types of newly-developed foam filters in which carbon was the phase binding ceramic particles have been conducted. In one of the filters the source of carbon was flake graphite and coal-tar pitch, while in the other one graphite was replaced by a cheaper carbon precursor. The newly-developed filters are fired at 1000°C, i.e. at a much lower temperature than the currently applied ZrO2-based filters. During filtration trials the filters were subjected to the attack of a flowing metal stream having a temperature of 1650°C for 30 seconds.
Graphite beds for coolant filtration at high temperature
International Nuclear Information System (INIS)
Heathcock, R.E.; Lacy, C.S.
1978-01-01
High temperature filtration will be provided for new Ontario Hydro CANDU heat transport systems. Filtration has been shown to effectively reduce the concentration of circulating corrosion products in our heat transport systems, hence, minimizing the processes of activity transport. This paper will present one option we have for this application; Deep Bed Granular Graphite Filters. The filter system is described by discussing pertinent aspects of its development programme. The compatibility of the filter and the heat transport coolant are demonstrated by results from loop tests, both out- and in-reactor, and by subsequent results from a large filter installation in the NPD NGS heat transport system. (author)
Diatomite releases silica during spirit filtration.
Gómez, J; Gil, M L A; de la Rosa-Fox, N; Alguacil, M
2014-09-15
The purpose of this study was to ascertain whether diatomite is an inert filter aid during spirit filtration. Surely, any compound with a negative effect on the spirit composition or the consumer's health could be dissolved. In this study different diatomites were treated with 36% vol. ethanol/water mixtures and the amounts and structures of the extracted compounds were determined. Furthermore, Brandy de Jerez was diatomite- and membrane-filtered at different temperatures and the silicon content was analysed. It was found that up to 0.36% by weight of diatomite dissolved in the aqueous ethanol and amorphous silica, in the form of hollow spherical microparticles, was the most abundant component. Silicon concentrations in Brandy de Jerez increased by up to 163.0% after contact with diatomite and these changes were more marked for calcined diatomite. In contrast, reductions of more than 30% in silicon concentrations were achieved after membrane filtration at low temperatures. Copyright © 2014 Elsevier Ltd. All rights reserved.
Iron behavior in the ozonation and filtration of groundwater
Energy Technology Data Exchange (ETDEWEB)
Sallanko, J.; Lakso, E.; Ropelinen, J. [University of Oulu, Oulu (Finland)
2006-08-15
In Finnish groundwater, the main substances that require treatment are iron and manganese. In addition to this, groundwaters are soft and acidic. Iron removal is usually relatively effective by oxidizing dissolved iron into an insoluble form, either by aeration or chemical oxidation and removing the formed precipitate by sand filtration. Sometimes, if the untreated water contains high amounts of organic matter, problems may arise for iron removal. In Finland, it is quite common that groundwater contains high levels of both iron and natural organic matter, mainly as humic substances. The groundwater of the Kukkala intake plant in Liminka has been found to be problematic, due to its high level of natural organic matter. This research studied the removal of iron from this water by means of oxidation with ozone and filtration. While the oxidation of iron by ozone was rapid, the precipitate particles formed were small, and thus could not be removed by sand and anthracite filtration, and the iron residue in the treated water was more than 2 mg L{sup -1}. And while the filtration was able to remove iron well without the feed of ozone, the iron residue in the treated water was only 0.30 mg L{sup -1}. In this case, iron was led to the filter in a bivalent dissolved form. So, the result of iron removal was the best when the sand/anthracite filter functioned largely as an adsorption filter.
Determination of the filtration velocities and mean velocity in ground waters using radiotracers
International Nuclear Information System (INIS)
Duran P, Oscar; Diaz V, Francisco; Heresi M, Nelida
1994-01-01
An experimental method to determine filtration, or, Darcy velocity and mean velocity in underground waters using radiotracers, is described. After selecting the most appropriate tracers, from 6 chemical compounds, to measure water velocity, a method to measure filtration velocity was developed. By fully labelling the water column with 2 radioisotopes, Br and tritium, almost identical values were obtained for the aquifer filtration velocity in the sounding S1. This value was 0.04 m/d. Field porosity was calculated at 11% and mean velocity at 0.37 m.d. With the filtration velocity value and knowing the hydraulic variation between the soundings S1 and S2 placed at 10 meters, field permeability was estimated at 2.4 x 10 m/s. (author)
International Nuclear Information System (INIS)
Kondo, Y.
1998-01-01
The effect of phosphate ion on the filtration characteristics of solids generated in a high level liquid waste was experimentally examined. Addition of phosphate ion into the simulated HLLW induced the formation of phosphate such as zirconium phosphate and phosphomolybdic acid. The filtration rate of zirconium phosphate abruptly dropped in the midst of filtration because of a gel-cake formation on the filter surface. The denitration of the simulated HLLW contained zirconium phosphate improved the filterability of this gelatinous solid. The filtration rates of denitrated HLLW decreased with increase of the phosphate ion concentration, since the solids formed by denitration had irregular particle size and configuration in the simulated HLLW with phosphate ion. To increase the filtration rate of denitrated HLLW, a solid suspension filtration tester was designed. The solid-suspension accelerated the filtration rate only in the simulated HLLW with more than 1500 ppm phosphate ion concentration. Under this condition, the simple agitation can easily suspend the constituent solids of filter cake in the solution and a much higher filtration rate can be obtained because the filter cake is continuously swept from the filter surface by rotation of propellers. (authors)
Separation of nanoparticles: Filtration and scavenging from waste incineration plants.
Förster, Henning; Thajudeen, Thaseem; Funk, Christine; Peukert, Wolfgang
2016-06-01
Increased amounts of nanoparticles are applied in products of everyday life and despite material recycling efforts, at the end of their life cycle they are fed into waste incineration plants. This raises the question on the fate of nanoparticles during incineration. In terms of environmental impact the key question is how well airborne nanoparticles are removed by separation processes on their way to the bag house filters and by the existing filtration process based on pulse-jet cleanable fibrous filter media. Therefore, we investigate the scavenging and the filtration of metal nanoparticles under typical conditions in waste incineration plants. The scavenging process is investigated by a population balance model while the nanoparticle filtration experiments are realized in a filter test rig. The results show that depending on the particle sizes, in some cases nearly 80% of the nanoparticles are scavenged by fly ash particles before they reach the bag house filter. For the filtration step dust cakes with a pressure drop of 500Pa or higher are found to be very effective in preventing nanoparticles from penetrating through the filter. Thus, regeneration of the filter must be undertaken with care in order to guarantee highly efficient collection of particles even in the lower nanometre size regime. Copyright © 2016 Elsevier Ltd. All rights reserved.
Pollution Impact and Alternative Treatment for Produced Water
Directory of Open Access Journals (Sweden)
Hedar Yusran
2018-01-01
Full Text Available Oil and gas exploration and production are two of the activities that potentially cause pollution and environmental damage. The largest waste generated from this activity is produced water. Produced water contains hazardous pollutants of both organic and inorganic materials, so that the produced water of oil and gas production cannot be discharged directly to the environment. Uncontrolled discharge can lead to the environmental damage, killing the life of water and plants. The produced water needs to be handled and fulfill the quality standards before being discharged to the environment. Several studies to reduce the contaminants in the produced water were conducted by researchers. Among them were gravity based separation - flotation, separation technique based on filtration, and biological process treatment. Therefore, some of these methods can be used as an alternative waste handling of produced water.
Efektifitas Riverbank Filtration Trhadap Parameter Fisik (TDS di Sungai Cihideung
Directory of Open Access Journals (Sweden)
Roh Santoso Budi Waspodo
2013-01-01
Full Text Available Water is a natural resource that is necessary for the livelihood of many people, even by all living things. Data Ministry of Public Works in 2006 mentions the availability of water in Indonesia amounted to 15,500 cubic meters per capita per year, far higher than the global availability averaged only 600 m3. If drawn, the amount of water covers 21% of Indonesia Pacific Ocean. However, the overflow Indonesia does not necessarily solve the problem of water crisis which is also predicted to fall on two major islands in 2015. The general objective of this research is to develop and implement technological innovations RBF (Riverbank Filtration to support the needs of irrigation water Watershed Cisadane, making RBF (Riverbank Filtration as a natural water treatment in Cisadane River area, and water quality data information through RBF (Riverbank Filtration Cisadane Watershed.
Sivan, Unnikrishnan; Jayakumar, K; Krishnan, Lissy K
2016-10-01
Commercially available skin substitutes lack essential non-immune cells for adequate tissue regeneration of non-healing wounds. A tissue-engineered, patient-specific, dermal substitute could be an attractive option for regenerating chronic wounds, for which adipose-derived mesenchymal stem cells (ADMSCs) could become an autologous source. However, ADMSCs are multipotent in nature and may differentiate into adipocytes, osteocytes and chondrocytes in vitro, and may develop into undesirable tissues upon transplantation. Therefore, ADMSCs committed to the fibroblast lineage could be a better option for in vitro or in vivo skin tissue engineering. The objective of this study was to standardize in vitro culture conditions for ADMSCs differentiation into dermal-like fibroblasts which can synthesize extracellular matrix (ECM) proteins. Biomimetic matrix composite, deposited on tissue culture polystyrene (TCPS), and differentiation medium (DM), supplemented with fibroblast-conditioned medium and growth factors, were used as a fibroblast-specific niche (FSN) for cell culture. For controls, ADMSCs were cultured on bare TCPS with either DM or basal medium (BM). Culture of ADMSCs on FSN upregulated the expression of differentiation markers such as fibroblast-specific protein-1 (FSP-1) and a panel of ECM molecules specific to the dermis, such as fibrillin-1, collagen I, collagen IV and elastin. Immunostaining showed the deposition of dermal-specific ECM, which was significantly higher in FSN compared to control. Fibroblasts derived from ADMSCs can synthesize elastin, which is an added advantage for successful skin tissue engineering as compared to fibroblasts from skin biopsy. To obtain rapid differentiation of ADMSCs to dermal-like fibroblasts for regenerative medicine, a matrix-directed differentiation strategy may be employed. Copyright © 2014 John Wiley & Sons, Ltd. Copyright © 2014 John Wiley & Sons, Ltd.
Comparative evaluation of iohexol and inulin clearance for glomerular filtration rate determinations
International Nuclear Information System (INIS)
Lindblad, H.G.; Berg, U.B.
1994-01-01
The authors have evaluated iohexol as a filtration marker in 150 children. The clearance of iohexol was compared with that of inulin or with a formula clearance. The single-sample clearance of iohexol showed a good correlation with the clearance of inulin. The clearance of iohexol correlated well with the formula clearance. The optimal blood sampling time for iohexol clearance determinations appears to be between 120 and 180 min after injection, at least in patient with relatively normal filtration rates. It is concluded that iohexol clearance is an accurate method of determining the glomerular filtration rate in clinical practice. 25 refs., 5 figs
Ridha, Syahrir; Ibrahim, Arif; Shahari, Radzi; Fonna, Syarizal
2018-05-01
The main objective of this work is to evaluate the effectiveness of graphene nanoplatelets (GNP) as filtration control materials in water based drilling fluids. Three (3) general samples of water based drilling fluids were prepared including basic potassium chloride (KCl) drilling fluids, nanosilica (NS) drilling fluids and GNP drilling fluids. Several concentrations of NS and GNP were dispersed in controlled formulations of water based drilling fluids. Standard API filtration tests were carried out for comparison purposes as well as High Temperature High Pressure (HTHP) filtration tests at 150 °F (∼66 °C), 250 °F (∼121 °C) and 350 °F (∼177 °C) at a fixed 500 (∼3.45MPa) psi to study the filtration trend as a function of temperature. Mud cake samples from several tests were selectively chosen and analyzed under Field Emission Scanning Electron Microscope (FESEM) for its morphology. Results from this work show that nanoparticle concentrations play a factor in filtration ability of colloid materials in water based drilling fluids when studied at elevated temperature. Low temperature filtration, however, shows only small differences in volume in all the drilling fluid samples. 0.1 ppb concentrations of GNP reduced the fluid loss of 350 °F by 4.6 mL as compared to the similar concentration of NS drilling fluids.
Zhu, Min; Cohen, Steven R; Hicok, Kevin C; Shanahan, Rob K; Strem, Brian M; Yu, Johnson C; Arm, Douglas M; Fraser, John K
2013-04-01
Successful long-term volume retention of an autologous fat graft is problematic. The presence of contaminating cells, tumescent fluid, and free lipid in the graft contributes to disparate outcomes. Better preparation methods for the fat graft before transplantation may significantly improve results. Subcutaneous fat from 22 donors was divided and processed using various graft preparation methods: (1) no manipulation control, (2) gravity separation, (3) Coleman centrifugation, and (4) simultaneous washing with filtration using a commercially available system (Puregraft; Cytori Therapeutics, Inc., San Diego, Calif.). Fat grafts from various preparation methods were examined for free lipid, aqueous liquid, viable tissue, and blood cell content. Adipose tissue viability was determined by measuring glycerol release after agonist induction of lipolysis. All test graft preparation methods exhibited significantly less aqueous fluid and blood cell content compared with the control. Grafts prepared by washing with filtration exhibited significantly reduced blood cell and free lipid content, with significantly greater adipose tissue viability than other methods. Washing with filtration within a closed system produces a fat graft with higher tissue viability and lower presence of contaminants compared with grafts prepared by alternate methods.
Digital Marketing concept and strategy for a Finnish Start-up, Case: Sofi Filtration
Buda, Constantin
2014-01-01
The case company is a Finnish start-up company that operates in the industrial water filtration business and who aims to increase its brand awareness and generate more sales leads. The aim of this study is to provide effective and inexpensive tools for Sofi Filtration to engage its target audience and grow its business by being acknowledged as an expert in industrial water filtration. The thesis is part of the International Business Management program offered by HAAGA-HELIA University of ...
Directory of Open Access Journals (Sweden)
Pradeep Kumar
2018-03-01
Full Text Available Riverbank filtration leads to purification of water. For India it can be a simple, economical and effective alternative. A few unanswered questions were: Can it work in Indian mountainous regions? Will it be of any advantage in the case of some of the polluted Indian surface waters? With the goal to evaluate use of riverbank filtration as a sustainable technology under widely varying conditions prevalent in India, the effectiveness of riverbank filtration has been examined over the last 10 years. In the case of cleaner surface waters, the wells deliver water free of turbidity and coliform even during monsoon irrespective of well configuration. In the case of polluted source waters, it results in an overall advantage in terms of improved raw water quality, reduced degree and cost of subsequent treatment and decreased levels of disinfection by-products. The study shows riverbank filtration to be an effective and sustainable option for plains as well as the mountainous region.
Centrifugal Filtration System for Severe Accident Source Term Treatment
Energy Technology Data Exchange (ETDEWEB)
Liu, Shu Chang; Yim, Man Sung [KAIST, Daejeon (Korea, Republic of)
2016-05-15
The objective of this paper is to present the conceptual design of a filtration system that can be used to process airborne severe accident source term. Reactor containment may lose its structural integrity due to over-pressurization during a severe accident. This can lead to uncontrolled radioactive releases to the environment. For preventing the dispersion of these uncontrolled radioactive releases to the environment, several ways to capture or mitigate these radioactive source term releases are under investigation at KAIST. Such technologies are based on concepts like a vortex-like air curtain, a chemical spray, and a suction arm. Treatment of the radioactive material captured by these systems would be required, before releasing to environment. For current filtration systems in the nuclear industry, IAEA lists sand, multi-venturi scrubber, high efficiency particulate arresting (HEPA), charcoal and combinations of the above in NS-G-1-10, 4.143. Most if not all of the requirements of the scenario for applying this technology near the containment of an NPP site and the environmental constraints were analyzed for use in the design of the centrifuge filtration system.
Simple method for the estimation of glomerular filtration rate
Energy Technology Data Exchange (ETDEWEB)
Groth, T [Group for Biomedical Informatics, Uppsala Univ. Data Center, Uppsala (Sweden); Tengstroem, B [District General Hospital, Skoevde (Sweden)
1977-02-01
A simple method is presented for indirect estimation of the glomerular filtration rate from two venous blood samples, drawn after a single injection of a small dose of (/sup 125/I)sodium iothalamate (10 ..mu..Ci). The method does not require exact dosage, as the first sample, taken after a few minutes (t=5 min) after injection, is used to normilize the value of the second sample, which should be taken in between 2 to 4 h after injection. The glomerular filtration rate, as measured by standard insulin clearance, may then be predicted from the logarithm of the normalized value and linear regression formulas with a standard error of estimate of the order of 1 to 2 ml/min/1.73 m/sup 2/. The slope-intercept method for direct estimation of glomerular filtration rate is also evaluated and found to significantly underestimate standard insulin clearance. The normalized 'single-point' method is concluded to be superior to the slope-intercept method and more sophisticated methods using curve fitting technique, with regard to predictive force and clinical applicability.
Chest CT using spectral filtration: radiation dose, image quality, and spectrum of clinical utility
Energy Technology Data Exchange (ETDEWEB)
Braun, Franziska M.; Johnson, Thorsten R.C.; Sommer, Wieland H.; Thierfelder, Kolja M.; Meinel, Felix G. [University Hospital Munich, Institute for Clinical Radiology, Munich (Germany)
2015-06-01
To determine the radiation dose, image quality, and clinical utility of non-enhanced chest CT with spectral filtration. We retrospectively analysed 25 non-contrast chest CT examinations acquired with spectral filtration (tin-filtered Sn100 kVp spectrum) compared to 25 examinations acquired without spectral filtration (120 kV). Radiation metrics were compared. Image noise was measured. Contrast-to-noise-ratio (CNR) and figure-of-merit (FOM) were calculated. Diagnostic confidence for the assessment of various thoracic pathologies was rated by two independent readers. Effective chest diameters were comparable between groups (P = 0.613). In spectral filtration CT, median CTDI{sub vol}, DLP, and size-specific dose estimate (SSDE) were reduced (0.46 vs. 4.3 mGy, 16 vs. 141 mGy*cm, and 0.65 vs. 5.9 mGy, all P < 0.001). Spectral filtration CT had higher image noise (21.3 vs. 13.2 HU, P < 0.001) and lower CNR (47.2 vs. 75.3, P < 0.001), but was more dose-efficient (FOM 10,659 vs. 2,231/mSv, P < 0.001). Diagnostic confidence for parenchymal lung disease and osseous pathologies was lower with spectral filtration CT, but no significant difference was found for pleural pathologies, pulmonary nodules, or pneumonia. Non-contrast chest CT using spectral filtration appears to be sufficient for the assessment of a considerable spectrum of thoracic pathologies, while providing superior dose efficiency, allowing for substantial radiation dose reduction. (orig.)
Ali, Gul Shad; El-Sayed, Ashraf S A; Patel, Jaimin S; Green, Kari B; Ali, Mohammad; Brennan, Mary; Norman, David
2016-01-15
Bacterial biological control agents (BCAs) are largely used as live products to control plant pathogens. However, due to variable environmental and ecological factors, live BCAs usually fail to produce desirable results against foliar pathogens. In this study, we investigated the potential of cell-free culture filtrates of 12 different bacterial BCAs isolated from flower beds for controlling foliar diseases caused by Alternaria spp. In vitro studies showed that culture filtrates from two isolates belonging to Bacillus subtilis and Bacillus amyloliquefaciens displayed strong efficacy and potencies against Alternaria spp. The antimicrobial activity of the culture filtrate of these two biological control agents was effective over a wider range of pH (3.0 to 9.0) and was not affected by autoclaving or proteolysis. Comparative liquid chromatography-mass spectrometry (LC-MS) analyses showed that a complex mixture of cyclic lipopeptides, primarily of the fengycin A and fengycin B families, was significantly higher in these two BCAs than inactive Bacillus spp. Interaction studies with mixtures of culture filtrates of these two species revealed additive activity, suggesting that they produce similar products, which was confirmed by LC-tandem MS analyses. In in planta pre- and postinoculation trials, foliar application of culture filtrates of B. subtilis reduced lesion sizes and lesion frequencies caused by Alternaria alternata by 68 to 81%. Taken together, our studies suggest that instead of live bacteria, culture filtrates of B. subtilis and B. amyloliquefaciens can be applied either individually or in combination for controlling foliar diseases caused by Alternaria species. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Abreu, P; Adye, T; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Andersson, P; Andreazza, A; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbi, M S; Barbiellini, Guido; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Bärring, O; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Bérat, C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bizouard, M A; Bloch, D; Blume, M; Bonesini, M; Bonivento, W; Booth, P S L; Borgland, A W; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cao, F; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chen, M; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cindro, V; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Dauncey, P D; Davenport, Martyn; Da Silva, W; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Djannati, A; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Durand, J D; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fenyuk, A; Ferrari, P; Ferrer, A; Fichet, S; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gerdyukov, L N; Gokieli, R; Golob, B; Gonçalves, P; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Green, C; Grefrath, A; Gris, P; Grosdidier, G; Grzelak, K; Günther, M; Guy, J; Hahn, F; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klapp, O; Klein, H; Kluit, P M; Knoblauch, D; Kokkinias, P; Koratzinos, M; Korcyl, K; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kronkvist, I J; Krstic, J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Libby, J; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Mahon, J R; Maio, A; Malmgren, T G M; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Medbo, J; Meroni, C; Meyer, S; Meyer, W T; Myagkov, A; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Nikolenko, M; Niss, P; Nomerotski, A; Normand, Ainsley; Nygren, A; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pain, R; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Podobnik, T; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Røhne, O M; Romero, A; Ronchese, P; Roos, L; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sannino, M; Schneider, H; Schwickerath, U; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Serbelloni, L; Shellard, R C; Sheridan, A; Siegrist, P; Silvestre, R; Simonetto, F; Sissakian, A N; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stavitski, I; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Tegenfeldt, F; Terranova, F; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Apeldoorn, G W; van Dam, P; Van Eldik, J; Van Lysebetten, A; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Weiser, C; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Wlodek, T; Yi, J; Yip, K; Yushchenko, O P; Zach, F; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zucchelli, G C; Zumerle, G
1997-01-01
The spin density matrix elements for the $\\rho^0$, K$^{*0}(892)$ and $\\phi$ produced in hadronic Z$^0$ decays are measured in the DELPHI detector. There is no evidence for spin alignment of the K$^{*0}(892)$ and $\\phi$ in the region $x_p \\leq 0.3$ ($x_p = p/p_{beam}$), where $\\rho_{00} = 0.33 \\pm 0.05$ and $\\rho_{00} = 0.30 \\pm 0.04$, respectively. In the fragmentation region, $x_p \\geq 0.4$, there is some indication for spin alignment of the $\\rho^0$ and K$^{*0}(892)$, since $\\rho_{00} = 0.43 \\pm 0.05$ and $\\rho_{00} = 0.46 \\pm 0.08$, respectively. These values are compared with those found in meson-induced hadronic reactions. For the $\\phi$, $\\rho_{00} = 0.30 \\pm 0.04$ for $x_p \\geq 0.4$ and $0.55 \\pm 0.10$ for $x_p \\geq 0.7$. The off-diagonal spin density matrix element $\\rho_{1-1}$ is consistent with zero in all cases.
Effect of hypothermic pulmonary artery flushing on capillary filtration coefficient.
Andrade, R S; Wangensteen, O D; Jo, J K; Tsai, M Y; Bolman, R M
2000-07-27
We previously demonstrated that surfactant dilution and inhibition occur immediately after pulmonary artery flushing with hypothermic modified Euro-Collins solution. Consequently, we speculated that increased capillary permeability contributed to these surfactant changes. To test this hypothesis, we evaluated the effects of hypothermic pulmonary artery flushing on the pulmonary capillary filtration coefficient (Kfc), and additionally performed a biochemical analysis of surfactant. We used a murine isolated, perfused lung model to measure the pulmonary capillary filtration coefficient and hemodynamic parameters, to determine the wet to dry weight ratio, and to evaluate surfactant by biochemical analysis of lung lavage fluid. We defined three study groups. In group I (controls), we harvested lungs without hypothermic pulmonary artery flushing, and measured Kfc immediately. In group II (in situ flush), we harvested lungs after hypothermic pulmonary artery flushing with modified Euro-Collins solution, and then measured Kfc. Experiments in groups I and II were designed to evaluate persistent changes in Kfc after pulmonary artery flushing. In group III (ex vivo flush), we flushed lungs ex vivo to evaluate transient changes in Kfc during hypothermic pulmonary artery flushing. Groups I and II did not differ significantly in capillary filtration coefficient and hemodynamics. Group II showed significant alterations on biochemical surfactant analysis and a significant increase in wet-to-dry weight ratio, when compared with group I. In group III, we observed a significant transient increase in capillary filtration coefficient during pulmonary artery flushing. Hypothermic pulmonary artery flushing transiently increases the capillary filtration coefficient, leads to an increase in the wet to dry weight ratio, and induces biochemical surfactant changes. These findings could be explained by the effects of hypothermic modified Euro-Collins solution on pulmonary capillary
High-frequency matrix converter with square wave input
Carr, Joseph Alexander; Balda, Juan Carlos
2015-03-31
A device for producing an alternating current output voltage from a high-frequency, square-wave input voltage comprising, high-frequency, square-wave input a matrix converter and a control system. The matrix converter comprises a plurality of electrical switches. The high-frequency input and the matrix converter are electrically connected to each other. The control system is connected to each switch of the matrix converter. The control system is electrically connected to the input of the matrix converter. The control system is configured to operate each electrical switch of the matrix converter converting a high-frequency, square-wave input voltage across the first input port of the matrix converter and the second input port of the matrix converter to an alternating current output voltage at the output of the matrix converter.
On some Filtration Procedure for Jump Markov Process Observed in White Gaussian Noise
Khas'minskii, Rafail Z.; Lazareva, Betty V.
1992-01-01
The importance of optimal filtration problem for Markov chain with two states observed in Gaussian white noise (GWN) for a lot of concrete technical problems is well known. The equation for a posterior probability $\\pi(t)$ of one of the states was obtained many years ago. The aim of this paper is to study a simple filtration method. It is shown that this simplified filtration is asymptotically efficient in some sense if the diffusion constant of the GWN goes to 0. Some advantages of this proc...
DEFF Research Database (Denmark)
Kumala, Lars; Riisgård, Hans Ulrik; Canfield, Donald Eugene
2017-01-01
the clearance method. Osculum dynamics, as expressed by temporal variation of the OSA, including osculum contraction and expansion, correlated with variability in the explant filtration rate, and no water pumping was observed during periods of osculum closure. A linear relationship between filtration rate (FR......Contraction-inflation behavior, including the closure and opening of the exhalant opening (osculum), is common among sponges. This behavior may temporally affect filtration activity, making it difficult to study and understand sponge feeding biology. To examine the interplay between osculum...... dynamics and filtration activity, small (18 mm3) single-osculum explants of the demosponge Halichondria panicea were studied. Time-lapse video stereo-microscope recordings of the osculum cross-sectional area (OSA) were made simultaneously with measurements of the filtration rate (∼15°C, ∼20 PSU) using...
Cu filtration for dose reduction in neonatal chest imaging
International Nuclear Information System (INIS)
Smans, K.; Struelens, L.; Smet, M.; Bosmans, H.; Vanhavere, F.
2010-01-01
As neonatal chest images are frequently acquired to investigate the life-threatening lung diseases in prematurely born children, their optimisation in terms of X-ray exposure is required. The aim of this study was to investigate whether such dose-optimisation studies could be performed using a Monte Carlo computer model. More specifically, a Monte Carlo computer model was used to investigate the influence of Cu filtration on image quality and dose in neonatal chest imaging. Monte Carlo simulations were performed with the MCNPX code and used with voxel models representing prematurely born babies (590 and 1910 g). Physical image quality was derived from simulated images in terms of the signal difference-to-noise ratio and signal-to-noise ratio (SNR). To verify the simulation results, measurements were performed using the Gammex 610 Neonatal Chest Phantom, which represents a 1-2 kg neonate. A figure of merit was used to assist in evaluating the optimum balance between the image quality and the patient dose. The results show that the Monte Carlo computer model to investigate dose and image quality works well and can be used in dose-optimisation studies for real clinical practices. Furthermore, working at a specific constant incident air kerma (K a,I ), additional filtration proved to increase SNR with 30%, whereas working at a specific constant detector dose, extra Cu filtration reduces the lung dose with 25%. Optimum balance between patient dose and image quality is found to be 60 kVp (using extra filtration). (authors)
Evaluation of Impact of Coagulant Type on Operation Parameters in Direct Filtration
Directory of Open Access Journals (Sweden)
Ali Torabian
2007-06-01
Full Text Available Numerous advantages have been reported on PAC (poly aluminum chloride used as a coagulant over other coagulants such as alum and ferric chloride used in conventional water treatment process with medium and high turbidity levels. These include lower amounts of PACL required specially in removing turbidity, larger floc grain formation, reduced floc sedimentation time, lower sludge production, and relaxation of the need for pH adjustment by lime, among others. The present study aims to evaluate the effects of different coagulants such as ferric chloride and PACL on direct filtration and to identify the most effective material based on both turbidity and particle removal efficiencies. A perfectly experimental pilot system, including raw water preparation, coagulation, flocculation, distribution measurement, and filtration units, was designed and used. Raw water turbidity level in the experimental pilot was below 10 NTU. The effects of various parameters such as coagulant type, filtration rate, and coagulant dosage on the performance of the filter were investigated. The results obtained from several filtration cycles under different conditions indicated that average effluent turbidity level, effluent particle numbers, effluent turbidity variation graph, and effluent particle graph were lower throughout the filtration cycle when PACL was used compared to when ferric chloride was used as the coagulant. Increasing filtration rate led to increased turbidity and particle number. Addition of 2 mg/l of PACL (poor coagulation and flocculation scenario was compared with addition of 5 mg/l of ferric chloride (strong coagulation and flocculation scenario. The results indicated that higher average values of turbidity removal but lower turbidity and particle removal efficiencies obtained in the case of the poor coagulation and flocculation scenario.
Removal and recovery of metal ions from process and waste streams using polymer filtration
International Nuclear Information System (INIS)
Jarvinen, G.D.; Smith, B.F.; Robison, T.W.; Kraus, K.M.; Thompson, J.A.
1999-01-01
Polymer Filtration (PF) is an innovative, selective metal removal technology. Chelating, water-soluble polymers are used to selectively bind the desired metal ions and ultrafiltration is used to concentrate the polymer-metal complex producing a permeate with low levels of the targeted metal ion. When applied to the treatment of industrial metal-bearing aqueous process streams, the permeate water can often be reused within the process and the metal ions reclaimed. This technology is applicable to many types of industrial aqueous streams with widely varying chemistries. Application of PF to aqueous streams from nuclear materials processing and electroplating operations will be described
Measurement of water filtration in skeletal muscle in man by an osmotic transient method
DEFF Research Database (Denmark)
Palm, T; Nielsen, S L; Lassen, N A
1983-01-01
Water filtration in the human forearm was determined with a new method using a hyperoncotic transient of albumin solution infused into the brachial artery. Baseline dilution of labelled albumin in deep forearm vein plasma in excess of the contribution from arterial blood and from infusate...... was assumed to originate from extravascular water filtered into the blood by the transient. The filtration coefficient (Fc) was determined as the ratio between filtered water and increase in colloid osmotic pressure in the blood samples, and gives the filtrative water permeability in the exchange areas...... muscles, but it is of the same order of magnitude as the capillary filtration coefficient (CFC) determined plethysmographically for the entire forearm by the venous stasis technique....
Nadell, Carey D; Ricaurte, Deirdre; Yan, Jing; Drescher, Knut; Bassler, Bonnie L
2017-01-13
Bacteria often live in biofilms, which are microbial communities surrounded by a secreted extracellular matrix. Here, we demonstrate that hydrodynamic flow and matrix organization interact to shape competitive dynamics in Pseudomonas aeruginosa biofilms. Irrespective of initial frequency, in competition with matrix mutants, wild-type cells always increase in relative abundance in planar microfluidic devices under simple flow regimes. By contrast, in microenvironments with complex, irregular flow profiles - which are common in natural environments - wild-type matrix-producing and isogenic non-producing strains can coexist. This result stems from local obstruction of flow by wild-type matrix producers, which generates regions of near-zero shear that allow matrix mutants to locally accumulate. Our findings connect the evolutionary stability of matrix production with the hydrodynamics and spatial structure of the surrounding environment, providing a potential explanation for the variation in biofilm matrix secretion observed among bacteria in natural environments.
International Nuclear Information System (INIS)
Chadwick, Chris
2012-01-01
The strategy of protecting the traditional glass fibre HEPA filtration train from it's blinding contamination and the recovery of dust by the means of self cleaning, pre-filtration is a proven means in the reduction of ultimate disposal volumes and has been used within the Fuel Production Industry. However, there is an increasing demand in nuclear applications requiring elevated operating temperatures, fire resistance, moisture resistance and chemical composition that the existing glass fibre HEPA filtration cannot accommodate, which can be remedied by the use of a metallic HEPA filter media. Previous research suggests that the then costs to the Department of Energy (DOE), based on a five year life cycle, was $29.5 million for the installation, testing, removal and disposal of glass fibre HEPA filtration trains. Within these costs, $300 was the value given to the filter and $4, 450 was given to the peripheral activity. Development of a low cost, cleanable, metallic, direct replacement of the traditional filter train will the clear solution. The Bergman et al work has suggested that a 1000 ft 3 /min, cleanable, stainless HEPA could be commercially available for $5, 000 each, whereas the industry has determined that the truer cost of such an item in isolation would be closer to $15, 000. This results in a conflict within the requirement between 'low cost' and 'stainless HEPA'. By proposing a system that combines metallic HEPA filtration with the ability to self clean without interrupting the process flow, the need for a tradition HEPA filtration train will be eliminated and this dramatically reduces the resources required for cleaning or disposal, thus presenting a route to reducing ultimate costs. The paper will examine the performance characteristics, filtration efficiency, flow verses differential pressure and cleanability of a self cleaning HEPA grade sintered metal filter element, together with data to prove the contention. (authors)
International Nuclear Information System (INIS)
Seo, Dae Cheol; Ahn, Bong Young; Cho, Seung Hyun; Siddique, A. K. M. Ariful Haque; Kim, Cheol Gi
2013-01-01
Many studies have been conducted on the filtration of microparticles using the acoustic radiation force of ultrasonic standing wave. The present work concerns a flow-through particle filtration method by utilizing frequency varying ultrasound. The periodical frequency sweep of the ultrasonic standing wave translocates particles across a microchannel, where particles in fluid flow are filtrated without barriers. The present filtration technique in a microfluidic channel was proposed conceptually in the 1990s. However, its experimental realization on actual particles in a microfluidic channel has not been carried out in a notable way. Several sizes of polystyrene microspheres (10 µm to 90 µm) and silicon carbide (SiC) particles (37 µm) suspended in water were applied as a test sample. For filtration of those particles, a Y-branched microfluidic channel with one inlet and two outlets was made out of steel and acrylic as a form of modulized device. Ultrasound of a few MHz in band frequency (1.75 MHz to 3.05 MHz) was transmitted into one side of the channel wall to generate a standing wave field in fluid flow. The periodical frequency sweep operation showed successful filtration performance, whereby particles in water flowed into one outlet and purified water flowed into the other outlet of the Y branch of the channel.
Nagoshi, Keishiro; Yamakoshi, Mariko; Sakamoto, Kenya; Takayama, Mitsuo
2018-04-01
Radical-driven dissociation (RDD) of hydrogen-deficient peptide ions [M - H + H]·+ has been examined using matrix-assisted laser dissociation/ionization in-source decay mass spectrometry (MALDI-ISD MS) with the hydrogen-abstracting matrices 4-nitro-1-naphthol (4,1-NNL) and 5-nitrosalicylic acid (5-NSA). The preferential fragment ions observed in the ISD spectra include N-terminal [a] + ions and C-terminal [x]+, [y + 2]+, and [w]+ ions which imply that β-carbon (Cβ)-centered radical peptide ions [M - Hβ + H]·+ are predominantly produced in MALDI conditions. RDD reactions from the peptide ions [M - Hβ + H]·+ successfully explains the fact that both [a]+ and [x]+ ions arising from cleavage at the Cα-C bond of the backbone of Gly-Xxx residues are missing from the ISD spectra. Furthermore, the formation of [a]+ ions originating from the cleavage of Cα-C bond of deuterated Ala(d3)-Xxx residues indicates that the [a]+ ions are produced from the peptide ions [M - Hβ + H]·+ generated by deuteron-abstraction from Ala(d3) residues. It is suggested that from the standpoint of hydrogen abstraction via direct interactions between the nitro group of matrix and hydrogen of peptides, the generation of the peptide radical ions [M - Hβ + H]·+ is more favorable than that of the α-carbon (Cα)-centered radical ions [M - Hα + H]·+ and the amide nitrogen-centered radical ions [M - HN + H]·+, while ab initio calculations indicate that the formation of [M - Hα + H]·+ is energetically most favorable. [Figure not available: see fulltext.
DQE of wireless digital detectors: Comparative performance with differing filtration schemes
International Nuclear Information System (INIS)
Samei, Ehsan; Murphy, Simon; Christianson, Olav
2013-01-01
Purpose: Wireless flat panel detectors are gaining increased usage in portable medical imaging. Two such detectors were evaluated and compared with a conventional flat-panel detector using the formalism of the International Electrotechnical Commission (IEC 62220-1) for measuring modulation transfer function (MTF), normalized noise power spectrum (NNPS), and detective quantum efficiency (DQE) using two different filtration schemes.Methods: Raw images were acquired for three image receptors (DRX-1C and DRX-1, Carestream Health; Inc., Pixium 4600, Trixell) using a radiographic system with a well-characterized output (Philips Super80 CP, Philips Healthcare). Free in-air exposures were measured using a calibrated radiation meter (Unfors Mult-O-Meter Type 407, Unfors Instruments AB). Additional aluminum filtration and a new alternative combined copper-aluminum filtration were used to conform the x ray output to IEC-specified beam quality definitions RQA5 and RQA9. Using the IEC 62220-1 formalism, each detector was evaluated at X N /2, X N , and 2X N , where the normal exposure level to the detector surface (X N ) was set to 8.73 μGy (1.0 mR). The prescribed edge test device was used to evaluate the MTF, while the NNPS was measured using uniform images. The DQE was then calculated from the MTF and NNPS and compared across detectors, exposures, and filtration schemes.Results: The three DR systems had largely comparable MTFs with DRX-1 demonstrating lower values above 1.0 cycles/mm. At each exposure, DRX-1C and Pixium detectors demonstrated better noise performance than that of DRX-1. Zero-frequency DQEs for DRX-1C, Pixium, and DRX-1 detectors were approximately 74%, 63%, and 38% for RQA5 and 50%, 42%, and 28% for RQA9, respectively.Conclusions: DRX-1C detector exhibited superior DQE performance compared to Pixium and DRX-1. In terms of filtration, the alternative filtration was found to provide comparable performance in terms of rank ordering of different detectors with
Rania Aydi-Ben Abdallah; Marwa Hassine; Hayfa Jabnoun-Khiareddine; Rabiaa Haouala; Mejda Daami-Remadi
2014-01-01
Culture filtrates, chloroform and ethyl acetate extracts of nine isolates of Aspergillus spp. (A. niger, A. terreus, A. flavus and Aspergillus sp.), isolated from soil and compost, were tested for antifungal activity against Pythium ultimum the causal agent of the potato Pythium leak. Culture filtrates showed a significant antifungal activity at the different tested concentrations. Total inhibition of the pathogen was induced by the filtrate of CH8 of Aspergillus sp., used at 10% ...
Energy Technology Data Exchange (ETDEWEB)
Han, Lijun [College of Science, China Agricultural University, Beijing (China); Sapozhnikova, Yelena [U.S. Dept. of Agriculture, Agricultural Research Service, Eastern Regional Research Center, 600 East Mermaid Lane, Wyndmoor, PA 19038 (United States); Lehotay, Steven J., E-mail: Steven.Lehotay@ars.usda.gov [U.S. Dept. of Agriculture, Agricultural Research Service, Eastern Regional Research Center, 600 East Mermaid Lane, Wyndmoor, PA 19038 (United States)
2014-05-01
Highlights: • The first report that combines in-vial filtration and dispersive-SPE for sample cleanup. • The unique application of ammonium formate for salting-out partitioning in QuEChERS. • Evaluations of a new zirconium-based and a non-friable GCB sorbent for d-SPE cleanup. • A new analytical method for 59 pesticides and environmental pollutants in shrimp. Abstract: A new method of sample preparation was developed and is reported for the first time. The approach combines in-vial filtration with dispersive solid-phase extraction (d-SPE) in a fast and convenient cleanup of QuEChERS (quick, easy, cheap, effective, rugged, and safe) extracts. The method was applied to simultaneous analysis of 42 diverse pesticides and 17 environmental contaminants, including polycyclic aromatic hydrocarbons, polychlorinated biphenyls (PCBs), and flame retardants, in shrimp as the sample matrix. Final extracts were analyzed by both low-pressure gas chromatography – triple quadrupole tandem mass spectrometry (LPGC-MS/MS), and high-performance liquid chromatography – triple quadrupole tandem mass spectrometry (HPLC-MS/MS) to provide a wide scope of analysis for targeted analytes. During method development, several different commercial sorbents for d-SPE were investigated and compared with respect to analyte recoveries. The method was validated at 10, 50, and 100 ng g⁻¹ spiking levels (10-fold lower for PCBs), and the results for nearly all analytes were between 70 and 115% recoveries with ≤17% relative standard deviations. The method was shown to be simple, fast, and effective for multi-application analysis of chemical residues in the representative food and environmental marker matrix.
Mohammadi, Maziar Shah; Ahmed, Ifty; Muja, Naser; Rudd, Christopher D; Bureau, Martin N; Nazhat, Showan N
2011-12-01
Incorporation of soluble bioactive glass fibres into biodegradable polymers is an interesting approach for bone repair and regeneration. However, the glass composition and its surface properties significantly affect the nature of the fibre-matrix interface and composite properties. Herein, the effect of Si and Fe on the surface properties of calcium containing phosphate based glasses (PGs) in the system (50P(2)O(5)-40CaO-(10-x)SiO(2)-xFe(2)O(3), where x = 0, 5 and 10 mol.%) were investigated. Contact angle measurements revealed a higher surface energy, and surface polarity as well as increased hydrophilicity for Si doped PG which may account for the presence of surface hydroxyl groups. Two PG formulations, 50P(2)O(5)-40CaO-10Fe(2)O(3) (Fe10) and 50P(2)O(5)-40CaO-5Fe(2)O(3)-5SiO(2) (Fe5Si5), were melt drawn into fibres and randomly incorporated into poly(lactic acid) (PLA) produced by melt processing. The ageing in deionised water (DW), mechanical property changes in phosphate buffered saline (PBS) and cytocompatibility properties of these composites were investigated. In contrast to Fe10 and as a consequence of the higher surface energy and polarity of Fe5Si5, its incorporation into PLA led to increased inorganic/organic interaction indicated by a reduction in the carbonyl group of the matrix. PLA chain scission was confirmed by a greater reduction in its molecular weight in PLA-Fe5Si5 composites. In DW, the dissolution rate of PLA-Fe5Si5 was significantly higher than that of PLA-Fe10. Dissolution of the glass fibres resulted in the formation of channels within the matrix. Initial flexural strength was significantly increased through PGF incorporation. After PBS ageing, the reduction in mechanical properties was greater for PLA-Fe5Si5 compared to PLA-Fe10. MC3T3-E1 preosteoblasts seeded onto PG discs, PLA and PLA-PGF composites were evaluated for up to 7 days indicating that the materials were generally cytocompatible. In addition, cell alignment along the PGF
Clay and plant materials such as wood are the raw materials used in manufacture of ceramic water filtration devices around the world. A step by step manufacturing procedure which includes initial mixing, molding and sintering is used. The manufactured ceramic filters have numerous pores which help i...
Formation of filtration fields close to near-surface radioactive waste storages
International Nuclear Information System (INIS)
Mart'yanov, V.V.
2008-01-01
Data on the formation of filtration fields in the location of near-surface radioactive waste storages for the conditions of uniformly isotropic properties of bearing strata are demonstrated. The possibility for changing parameters of mean-caused ground flow depending on water permeability of the storages and their dimensions in plan is noted. Comparison of different filtration fields permits to determine a state of its isolating properties. Assessment criteria of the storage engineering barriers integrity are given. Conditions for uniformly isotropic properties of bearing strata by three scenarios, when engineering barriers of the storage are waterproof, distracted or lost protective properties in full, have been determined. Changing filtration field, geochemical and radiochemical situations in bearing strata are noted to represent one of basic characteristics of the integrity of the storage [ru
Filtration of Oak Ridge National Laboratory simulated liquid low-level waste
International Nuclear Information System (INIS)
Fowler, V.L.; Hewitt, J.D.
1989-08-01
A method for disposal of Oak Ridge National Laboratory's (ORNL's) liquid low-level radioactive waste (LLLW) is being developed in which the material will be solidified in cement and stored in an aboveground engineered storage facility. The acceptability of the final waste form rests in part on the presence or absence of transuranic isotopes. Filtration methods to remove transuranic isotopes from the bulk liquid stored in the Melton Valley Storage Tanks (MVST) were investigated in this study. Initial batch studies using waste from MVST indicate that >99.9% of the transuranic isotopes can be removed from the bulk liquid by simple filtration. Bench-scale studies with a nonradioactive surrogate waste indicate that >99.5% of the suspended solids can be removed from the bulk liquid via inertial crossflow filtration. 4 refs., 3 figs., 11 tabs
Estimating filtration coefficients for straining from percolation and random walk theories
DEFF Research Database (Denmark)
Yuan, Hao; Shapiro, Alexander; You, Zhenjiang
2012-01-01
In this paper, laboratory challenge tests are carried out under unfavorable attachment conditions, so that size exclusion or straining is the only particle capture mechanism. The experimental results show that far above the percolation threshold the filtration coefficients are not proportional...... size exclusion theory or the model of parallel tubes with mixing chambers, where the filtration coefficients are proportional to the flux through smaller pores, and the predicted penetration depths are much lower. A special capture mechanism is proposed, which makes it possible to explain...... the experimentally observed power law dependencies of filtration coefficients and large penetration depths of particles. Such a capture mechanism is realized in a 2D pore network model with periodical boundaries with the random walk of particles on the percolation lattice. Geometries of infinite and finite clusters...
Filtration of engineered nanoparticles using porous membranes
Trzaskus, Krzystof
2016-01-01
The research presented in this thesis aims at providing a better understanding of the fundamental aspects responsible for nanoparticle removal and fouling development during filtration of engineered nanoparticles. The emphasis is put on the role of interparticle interactions in the feed solution,
Organic micropollutant removal during river bank filtration
Bertelkamp, C.
2015-01-01
This study investigated the factors influencing the main removal mechanisms (adsorption and biodegradation) for organic micropollutant (OMP) removal during river bank filtration (RBF) and the possibility of developing a predictive model of this process for OMP removal during RBF. Chapter 2 analysed
2012-06-29
... Filtration and Adsorption Units of Normal Atmosphere Cleanup Systems in Light-Water- Cooled Nuclear Power... Criteria for Air Filtration and Adsorption Units of Normal Atmosphere Cleanup Systems in Light-Water-Cooled... draft regulatory guide (DG), DG-1280, ``Design, Inspection, and Testing Criteria for Air Filtration and...
DEFF Research Database (Denmark)
Yuan, Hao; Sin, Gürkan
2011-01-01
Uncertainty and sensitivity analyses are carried out to investigate the predictive accuracy of the filtration models for describing non-Fickian transport and hyperexponential deposition. Five different modeling approaches, involving the elliptic equation with different types of distributed...... filtration coefficients and the CTRW equation expressed in Laplace space, are selected to simulate eight experiments. These experiments involve both porous media and colloid-medium interactions of different heterogeneity degrees. The uncertainty of elliptic equation predictions with distributed filtration...... coefficients is larger than that with a single filtration coefficient. The uncertainties of model predictions from the elliptic equation and CTRW equation in Laplace space are minimal for solute transport. Higher uncertainties of parameter estimation and model outputs are observed in the cases with the porous...
Fahrul Hassan, Mohd; Jusoh, Suhada; Zaini Yunos, Muhamad; Arifin, A. M. T.; Ismail, A. E.; Rasidi Ibrahim, M.; Zulafif Rahim, M.
2017-09-01
Portable water filter has grown significantly in recent years. The use of water bottles as a water drink stuff using hand pump water filtration unit has been suggested to replace water bottled during outdoor recreational activities and for emergency supplies. However, quality of water still the issue related to contaminated water due to the residual waste plants, bacteria, and so on. Based on these issues, the study was carried out to design a portable water filter that uses membrane filtration system by applying Design for Six Sigma. Design for Six Sigma methodology consists of five stages which is Define, Measure, Analyze, Design and Verify. There were several tools have been used in each stage in order to come out with a specific objective. In the Define stage, questionnaire approach was used to identify the needs of portable water filter in the future from potential users. Next, Quality Function Deployment (QFD) tool was used in the Measure stage to measure the users’ needs into engineering characteristics. Based on the information in the Measure stage, morphological chart and weighted decision matrix tools were used in the Analyze stage. This stage performed several activities including concept generation and selection. Once the selection of the final concept completed, detail drawing was made in the Design stage. Then, prototype was developed in the Verify stage to conduct proof-of-concept testing. The results that obtained from each stage have been reported in this paper. From this study, it can be concluded that the application of Design for Six Sigma in designing a future portable water filter that uses membrane filtration system is a good start in looking for a new alternative concept with a completed supporting document.
Polymer-treated woody biomass: a filtration medium for removing phosphate from water
Thomas L Eberhardt
2006-01-01
A two-stage treatment of refined aspen wood fiber with solutions of carboxymethyl cellulose (CMC) and ferrous chloride afforded a filtration medium that was effective in removing phosphate from test solutions. To assess the stability of the filtration medium, samples exposed to the test solutions were analyzed by FTIR spectroscopy. The resultant spectra indicated that...
Microwave-Irradiation-Assisted HVAC Filtration for Inactivation of Viral Aerosols (Postprint)
2012-02-01
Baggiani, A. and Senesi, S. (2004). Effect of Microwave Radiation on Bacillus subtilis Spores . J. Appl. Microbiol. 97: 1220–1227. Damit, B., Lee, C.N...AFRL-RX-TY-TP-2012-0020 MICROWAVE-IRRADIATION-ASSISTED HVAC FILTRATION FOR INACTIVATION OF VIRAL AEROSOLS POSTPRINT Myung-Heui Woo and...12-APR-2011 -- 11-DEC-2011 Microwave Irradiation-Assisted HVAC Filtration for Inactivation of Viral Aerosols (POSTPRINT) FA8650-06-C-5913 0602102F
Directory of Open Access Journals (Sweden)
Bílek Petr
2016-01-01
Full Text Available This paper deals with visualization and evaluation of flow during filtration of water seeded by artificial microscopic particles. Planar laser induced fluorescence (PLIF is a wide spread method for visualization and non-invasive characterization of flow. However the method uses fluorescent dyes or fluorescent particles in special cases. In this article the flow is seeded by non-fluorescent monodisperse polystyrene particles with the diameter smaller than one micrometer. The monodisperse sub-micron particles are very suitable for testing of textile filtration materials. Nevertheless non-fluorescent particles are not useful for PLIF method. A water filtration setup with an optical access to the place, were a tested filter is mounted, was built and used for the experiments. Concentration of particles in front of and behind the tested filter in a laser light sheet measured is and the local filtration efficiency expressed is. The article describes further progress in the measurement. It was carried out sensitivity analysis, parameterization and performance of the method during several simulations and experiments.
Longitudinal-transverse liquid filtration in an annular heat-liberating medium
International Nuclear Information System (INIS)
Akhramovich, A.P.; Kolos, V.P.; Sorokin, V.N.
1987-01-01
The authors interpret experimental flow visualization data and construct a flow model for coolant filtration and flow in a layered granular heat exchange material for implementation in a reactor cooling system. Breakaway flow zones close to the ends of a layer in longitudinal-transverse liquid filtration are observed. In a linear approximation the problem of determining the form of the ends of the layer for which there is no flow breakaway is solved. The model is tested against experimental data for water and a nitrogen tetroxide coolant
Chiral filtration-induced spin/valley polarization in silicene line defects
Ren, Chongdan; Zhou, Benhu; Sun, Minglei; Wang, Sake; Li, Yunfang; Tian, Hongyu; Lu, Weitao
2018-06-01
The spin/valley polarization in silicene with extended line defects is investigated according to the chiral filtration mechanism. It is shown that the inner-built quantum Hall pseudo-edge states with identical chirality can serve as a chiral filter with a weak magnetic field and that the transmission process is restrained/strengthened for chiral states with reversed/identical chirality. With two parallel line defects, which act as natural chiral filtration, the filter effect is greatly enhanced, and 100% spin/valley polarization can be achieved.
Simulation of impaction filtration of aerosol droplets in porous media
Ghazaryan, L.; Lopez Penha, D.J.; Geurts, Bernardus J.; Stolz, S.; Stolz, Steffen; Winkelmann, Christoph; Pereira, J.C.F; Sequeira, A.; Pereira, J.M.C.
2010-01-01
We report on the development of a method to simulate from first principles the particle filtration efficiency of filters that are composed of structured porous media. We assume that the ratio of particle density to the fluid density is high. We concentrate on the motion of the particles in a laminar flow and quantify the role of inertial effects on the filtration of an ensemble of particles. We adopt the Euler-Lagrange approach, distinguishing a flow field in which the motion of a large numbe...
The selection of a matrix for the recovery of uranium by wet high-intensity magnetic separation
International Nuclear Information System (INIS)
Svoboda, J.
1985-01-01
The proper choice of a suitable matrix for high-intensity magnetic separation is of the utmost importance, since the geometry and size of the matrix play decisive roles in the achievement of optimum separation conditions. In relatively simple filtration applications, the matrix must offer a high efficiency of collision with suspended particles, a high probability of retention of intercepted particles, and high loading capacity. Also, it must be easily cleaned. The results obtained by the use of theoretical models of magnetic separation fail to agree with the experimental results for basic parameters like the ratio of particle size to matrix size, the length of the matrix, and the magnetic properties of the matrix material. Preconceived ideas about the matrix often lead to the erroneous choice of a matrix, and hence to its unsatisfactory performance during magnetic separation. The potential value of high-intensity magnetic separation as applied to the recovery of uranium and gold from leach residues and in association with the development of a large-scale magnetic separator to be used for the same purpose led to the present investigation in which a wide spectrum of matrix shapes and sizes were tested. It was found that the optimum recovery and selectivity of separation are obtained at a ratio of particle size to matrix-element size ranging from 200 to 300. The use of these matrices also results in a low degree of mechanical entrapment, particularly of coarser particles, for which straining plays a significant role for fine matrices. It was also found that the magnetization of a matrix plays a minor role, contrary to the theoretical predictions. Furthermore, the effects of matrix height, matrix loading, and scalping of the pulp by paramagnetic matrices were evaluated for various types of matrices
International Nuclear Information System (INIS)
Carrasco, C.; Inzunza, G.; Camurri, C.; Rodríguez, C.; Radovic, L.; Soldera, F.; Suarez, S.
2014-01-01
The collection of used beverage cans is limited in countries where they are not fabricated; their low value does not justify the extra charge of exporting them for further processing. To address this increasingly serious problem, here we optimize the properties of an aluminum metal matrix composite (Al-MMC) obtained through direct fusion of beverage cans by using the slag generated in the melting process as reinforcement. This method consists of a modified rheocasting process followed by thixoforming. Our main operational variable is the shear rate applied to a semi-solid bath, subsequent to which a suitable heat treatment (T8) is proposed to improve the mechanical properties. The microstructure, the phases obtained and their effect on composite mechanical properties are analyzed. The composite material produced has, under the best conditions, a yield stress of 175 MPa and a tensile strength of 273 MPa. These results demonstrate that the proposed process does indeed transform the used beverage cans into promising composite materials, e.g., for structural applications
Energy Technology Data Exchange (ETDEWEB)
Carrasco, C., E-mail: ccarrascoc@udec.cl [Department of Materials Engineering, University of Concepción, Edmundo Larenas 270, Concepción (Chile); Inzunza, G.; Camurri, C.; Rodríguez, C. [Department of Materials Engineering, University of Concepción, Edmundo Larenas 270, Concepción (Chile); Radovic, L. [Department of Chemical Engineering, University of Concepción, Edmundo Larenas 129, Concepción (Chile); Department of Energy and Geo-Environmental Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Soldera, F.; Suarez, S. [Department of Materials Science, Saarland University, Campus D3.3, 66123 Saarbrücken (Germany)
2014-11-03
The collection of used beverage cans is limited in countries where they are not fabricated; their low value does not justify the extra charge of exporting them for further processing. To address this increasingly serious problem, here we optimize the properties of an aluminum metal matrix composite (Al-MMC) obtained through direct fusion of beverage cans by using the slag generated in the melting process as reinforcement. This method consists of a modified rheocasting process followed by thixoforming. Our main operational variable is the shear rate applied to a semi-solid bath, subsequent to which a suitable heat treatment (T8) is proposed to improve the mechanical properties. The microstructure, the phases obtained and their effect on composite mechanical properties are analyzed. The composite material produced has, under the best conditions, a yield stress of 175 MPa and a tensile strength of 273 MPa. These results demonstrate that the proposed process does indeed transform the used beverage cans into promising composite materials, e.g., for structural applications.
Methods of producing compounds from plant materials
Werpy, Todd A [West Richland, WA; Schmidt, Andrew J [Richland, WA; Frye, Jr., John G.; Zacher, Alan H. , Franz; James A. , Alnajjar; Mikhail S. , Neuenschwander; Gary G. , Alderson; Eric V. , Orth; Rick J. , Abbas; Charles A. , Beery; Kyle E. , Rammelsberg; Anne M. , Kim; Catherine, J [Decatur, IL
2010-01-26
The invention includes methods of processing plant material by adding water to form a mixture, heating the mixture, and separating a liquid component from a solid-comprising component. At least one of the liquid component and the solid-comprising component undergoes additional processing. Processing of the solid-comprising component produces oils, and processing of the liquid component produces one or more of glycerol, ethylene glycol, lactic acid and propylene glycol. The invention includes a process of forming glycerol, ethylene glycol, lactic acid and propylene glycol from plant matter by adding water, heating and filtering the plant matter. The filtrate containing starch, starch fragments, hemicellulose and fragments of hemicellulose is treated to form linear poly-alcohols which are then cleaved to produce one or more of glycerol, ethylene glycol, lactic acid and propylene glycol. The invention also includes a method of producing free and/or complexed sterols and stanols from plant material.
Methods of producing compounds from plant material
Energy Technology Data Exchange (ETDEWEB)
Werpy, Todd A.; Schmidt, Andrew J.; Frye, Jr., John G.; Zacher, Alan H.; Franz, James A.; Alnajjar, Mikhail S.; Neuenschwander, Gary G.; Alderson, Eric V.; Orth, Rick J.; Abbas, Charles A.; Beery, Kyle E.; Rammelsberg, Anne M.; Kim, Catherine J.
2006-01-03
The invention includes methods of processing plant material by adding water to form a mixture, heating the mixture, and separating a liquid component from a solid-comprising component. At least one of the liquid component and the solid-comprising component undergoes additional processing. Processing of the solid-comprising component produces oils, and processing of the liquid component produces one or more of glycerol, ethylene glycol, lactic acid and propylene glycol. The invention includes a process of forming glycerol, ethylene glycol, lactic acid and propylene glycol from plant matter by adding water, heating and filtering the plant matter. The filtrate containing starch, starch fragments, hemicellulose and fragments of hemicellulose is treated to form linear poly-alcohols which are then cleaved to produce one or more of glycerol, ethylene glycol, lactic acid and propylene glycol. The invention also includes a method of producing free and/or complexed sterols and stanols from plant material.
Vingerhoeds, Monique H; Nijenhuis-de Vries, Mariska A; Ruepert, Nienke; van der Laan, Harmen; Bredie, Wender L P; Kremer, Stefanie
2016-05-01
Membrane filtration of ground, surface, or sea water by reverse osmosis results in permeate, which is almost free from minerals. Minerals may be added afterwards, not only to comply with (legal) standards and to enhance chemical stability, but also to improve the taste of drinking water made from permeate. Both the nature and the concentrations of added minerals affect the taste of the water and in turn its acceptance by consumers. The aim of this study was to examine differences in taste between various remineralised drinking waters. Samples selected varied in mineral composition, i.e. tap water, permeate, and permeate with added minerals (40 or 120 mg Ca/L, added as CaCO3, and 4 or 24 mg Mg/L added as MgCl2), as well as commercially available bottled drinking waters, to span a relevant product space in which the remineralised samples could be compared. All samples were analysed with respect to their physical-chemical properties. Sensory profiling was done by descriptive analysis using a trained panel. Significant attributes included taste intensity, the tastes bitter, sweet, salt, metal, fresh and dry mouthfeel, bitter and metal aftertaste, and rough afterfeel. Total dissolved solids (TDS) was a major determinant of the taste perception of water. In general, lowering mineral content in drinking water in the range examined (from water from fresh towards bitter, dry, and rough sensations. In addition, perceived freshness of the waters correlated positively with calcium concentration. The greatest fresh taste was found for water with a TDS between 190 and 350 mg/L. Remineralisation of water after reverse osmosis can improve drinking quality significantly. Copyright © 2016 Elsevier Ltd. All rights reserved.
Investigation of Microgranular Adsorptive Filtration System
Cai, Zhenxiao
Over the past few decades, enormous advances have been made in the application of low-pressure membrane filtration to both drinking water and wastewater treatment. Nevertheless, the full potential of this technology has not been reached, due primarily to limitations imposed by membrane fouling. In drinking water treatment, much of the fouling is caused by soluble and particulate natural organic matter (NOM). Efforts to overcome the problem have focused on removal of NOM from the feed solution, usually by addition of conventional coagulants like alum and ferric chloride (FeCl3) or adsorbents like powdered activated carbon (PAC). While coagulants and adsorbents can remove a portion of the NOM, their performance with respect to fouling control has been inconsistent, often reducing fouling but sometimes having no effect or even exacerbating fouling. This research investigated microgranular adsorptive filtration (muGAF), a process that combines three existing technologies---granular media filtration, packed bed adsorption, and membrane filtration---in a novel way to reduce membrane fouling while simultaneously removing NOM from water. In this technology, a thin layer of micron-sized adsorbent particles is deposited on the membrane prior to delivering the feed to the system. The research reported here represents the first systematic study of muGAF, and the results demonstrate the promising potential of this process. A new, aluminum-oxide-based adsorbent---heated aluminum oxide particles (HAOPs)---was synthesized and shown to be very effective for NOM removal as well as fouling reduction in muGAF systems. muGAF has also been demonstrated to work well with powdered activated carbon (PAC) as the adsorbent, but not as well as when HAOPs are used; the process has also been successful when used with several different membrane types and configurations. Experiments using a wide range of operational parameters and several analytical tools lead to the conclusion that the fouling
Filtration behavior of organic substance through a compacted bentonite
International Nuclear Information System (INIS)
Kanaji, Mariko; Kuno, Yoshio; Yui, Mikazu
1999-07-01
Filtration behavior of organic substance through a compacted bentonite was investigated. Na-type bentonite containing 30wt% of quartz sand was compacted in a column and the dry density was adjusted to be 1.6 g/cm 3 . Polyacrylic acid solution (including three types of polyacrylic acid, average molecular weight 2,100, 15,000 and 450,000) was prepared and was passed through the compacted bentonite. Molecular weight distributions of polyacrylic acid in the effluent solution were analysed by GPC (Gel Permeation Chromatography). A batch type experiment was also carried out in order to examine a sorption behavior of these organic substances onto the surfaces of grains of the bentonite. The results indicated that the smaller size polyacrylic acid (molecular weight < 100,000) was passed through the compacted bentonite. On the other hand, the larger size polyacrylic acid (molecular weight ≥100,000) was mostly filtrated by the compacted bentonite. The batch type sorption tests clarified that the polyacrylic acid did not sorb onto the surfaces of minerals constituting the bentonite. Therefore it was suggested that the larger size molecules (≥100,000) of organic substances could be predominantly filtrated by the microstructure of the compacted bentonite. (author)
Public health protection through bank filtration - Kearney Nebraska case study
Esseks, E.; Bellamy, W.; Heinemann, T.; Stocker, K.
2003-04-01
The investigation of Kearney's bank filtration system provides further evidence of this technology's capability to assist in providing public health protection, as it relates to drinking water. The results of hydrogeologic and treatment studies demonstrate the capabilities of the Platte River aquifer materials, in this locale, to remove pathogens and their surrogates. Continual monitoring and evaluations will establish the system’s longevity and continued treatment efficacy. The City of Kearney is located in south central Nebraska. The City owns and operates a public water system that serves approximately 24,889 people. The water system includes 12 wells located on Killgore Island in the Platte River. In 1994, the Nebraska Department of Health and Human Services System (Department) determined that 3 wells in the wellfield serving the City of Kearney were ground water under the direct influence of surface water. This determination was based on results of microscopic particulate analysis (MPA). The City of Kearney undertook the natural bank filtration study to determine whether natural bank filtration was occurring at the site and if the filtration was sufficient to meet pathogen treatment requirements designed to protect public health. A preliminary study was undertaken from June through October 1995. This coincided with the City’s peak pumping time, which may be the time when the influence of the River is greatest on the wellfield wells. Hydrogeologic studies assisted in selecting wells that were at highest risk based on shortest travel times and greatest differential head. Data collected included particle counts, MPAs, turbidity, coliform, centrifugate pellet evaluation (CPE) volumes, pH, conductivity, and temperature. Following analysis of data collected during the preliminary 18-week study the Department granted conditional approval of 2-log credit for removal of Giardia lamblia and 1-log credit for removal of viruses through bank filtration, pending the
Polychoric/Tetrachoric Matrix or Pearson Matrix? A methodological study
Directory of Open Access Journals (Sweden)
Dominguez Lara, Sergio Alexis
2014-04-01
Full Text Available The use of product-moment correlation of Pearson is common in most studies in factor analysis in psychology, but it is known that this statistic is only applicable when the variables related are in interval scale and normally distributed, and when are used in ordinal data may to produce a distorted correlation matrix . Thus is a suitable option using polychoric/tetrachoric matrices in item-level factor analysis when the items are in level measurement nominal or ordinal. The aim of this study was to show the differences in the KMO, Bartlett`s Test and Determinant of the Matrix, percentage of variance explained and factor loadings in depression trait scale of Depression Inventory Trait - State and the Neuroticism dimension of the short form of the Eysenck Personality Questionnaire -Revised, regarding the use of matrices polychoric/tetrachoric matrices and Pearson. These instruments was analyzed with different extraction methods (Maximum Likelihood, Minimum Rank Factor Analysis, Unweighted Least Squares and Principal Components, keeping constant the rotation method Promin were analyzed. Were observed differences regarding sample adequacy measures, as well as with respect to the explained variance and the factor loadings, for solutions having as polychoric/tetrachoric matrix. So it can be concluded that the polychoric / tetrachoric matrix give better results than Pearson matrices when it comes to item-level factor analysis using different methods.
ALTERNATE HIGH EFFICIENCY PARTICULATE AIR (HEPA) FILTRATION SYSTEM
Energy Technology Data Exchange (ETDEWEB)
Bruce Bishop; Robert Goldsmith; Karsten Nielsen; Phillip Paquette
2002-08-16
In Phase IIA of this project, CeraMem has further developed and scaled up ceramic HEPA filters that are appropriate for use on filtration of vent gas from HLW tanks at DOE sites around the country. This work included procuring recrystallized SiC monoliths, developing membrane and cement materials, and defining a manufacturing process for the production of prototype full sizes HEPA filters. CeraMem has demonstrated that prototype full size filters can be manufactured by producing 9 full size filters that passed DOP aerosol testing at the Oak Ridge Filter Test Facility. One of these filters was supplied to the Savannah River Technical Center (SRTC) for process tests using simulated HLW tank waste. SRTC has reported that the filter was regenerable (with some increase in pressure drop) and that the filter retained its HEPA retention capability. CeraMem has also developed a Regenerable HEPA Filter System (RHFS) design and acceptance test plan that was reviewed by DOE personnel. The design and acceptance test plan form the basis of the system proposal for follow-on work in Phase IIB of this project.
ALTERNATE HIGH EFFICIENCY PARTICULATE AIR (HEPA) FILTRATION SYSTEM
International Nuclear Information System (INIS)
Bruce Bishop; Robert Goldsmith; Karsten Nielsen; Phillip Paquette
2002-01-01
In Phase IIA of this project, CeraMem has further developed and scaled up ceramic HEPA filters that are appropriate for use on filtration of vent gas from HLW tanks at DOE sites around the country. This work included procuring recrystallized SiC monoliths, developing membrane and cement materials, and defining a manufacturing process for the production of prototype full sizes HEPA filters. CeraMem has demonstrated that prototype full size filters can be manufactured by producing 9 full size filters that passed DOP aerosol testing at the Oak Ridge Filter Test Facility. One of these filters was supplied to the Savannah River Technical Center (SRTC) for process tests using simulated HLW tank waste. SRTC has reported that the filter was regenerable (with some increase in pressure drop) and that the filter retained its HEPA retention capability. CeraMem has also developed a Regenerable HEPA Filter System (RHFS) design and acceptance test plan that was reviewed by DOE personnel. The design and acceptance test plan form the basis of the system proposal for follow-on work in Phase IIB of this project
Organic iodide capture using a zeolite dry filtration
International Nuclear Information System (INIS)
Park, Sanggil; Sung, Joonyoung; Kim, Gi-ppeum; Lee, Jaeyoung
2017-01-01
An organic iodide, especially, methyl iodide (CH 3 I) would generated non-negligibly from a severe accident in a nuclear power plant. This CH 3 I will be dangerous for human when it was inhaled, it is highly toxic and causes a serious nerve disorder. Even it is a major contributor to a thyroid cancer. In order to prevent its environmental release, it is required to decontaminate using a filtration system. For the removal of CH 3 I from the release gases, wet-type is not ideal due to a high re-volatile characteristics of CH 3 I. It may become volatile after dissolving in a pool and forms CH 3 I again at the surface of water pool. Therefore, a dry-filtration should be installed to remove the CH 3 I. In this study, we preliminary investigate the characteristics of zeolite filtration methods for the removal of CH 3 I. We used both silver ion exchanged ZSM-5-zeolite (Ag+-ZSM-5) to study the effect of silver ion for the removal of iodine from CH 3 I. In summary, the CH 3 I capture tests using a silver ion exchanged zeolite was conducted in the coupled TGAGC test set-up. The mass change of the sample and concentration of CH 3 I were measured. The samples were investigated by the SEM/EDS to see its surface characteristics.
Biophysical analysis of water filtration phenomenon in the roots of halophytes
Kim, Kiwoong; Lee, Sang Joon
2015-11-01
The water management systems of plants, such as water collection and water filtration have been optimized through a long history. In this point of view, new bio-inspired technologies can be developed by mimicking the nature's strategies for the survival of the fittest. In this study, the biophysical characteristics of water filtration process in the roots of halophytes are experimentally investigated in the plant hydrodynamic point of view. To understand the functional features of the halophytes 3D morphological structure of their roots are analyzed using advanced bioimaging techniques. The surface properties of the roots of halophytes are also examined Based on the quantitatively analyzed information, water filtration phenomenon in the roots is examined. Sodium treated mangroves are soaked in sodium acting fluorescent dye solution to trace sodium ions in the roots. In addition, in vitroexperiment is carried out by using the roots. As a result, the outermost layer of the roots filters out continuously most of sodium ions. This study on developing halophytes would be helpful for understanding the water filtration mechanism of the roots of halophytes and developing a new bio inspired desalination system. This research was financially supported by the National Research Foundation (NRF) of Korea (Contract grant number: 2008-0061991).
Yan, Jing; Nadell, Carey D; Stone, Howard A; Wingreen, Ned S; Bassler, Bonnie L
2017-08-23
Biofilms, surface-attached communities of bacteria encased in an extracellular matrix, are a major mode of bacterial life. How the material properties of the matrix contribute to biofilm growth and robustness is largely unexplored, in particular in response to environmental perturbations such as changes in osmotic pressure. Here, using Vibrio cholerae as our model organism, we show that during active cell growth, matrix production enables biofilm-dwelling bacterial cells to establish an osmotic pressure difference between the biofilm and the external environment. This pressure difference promotes biofilm expansion on nutritious surfaces by physically swelling the colony, which enhances nutrient uptake, and enables matrix-producing cells to outcompete non-matrix-producing cheaters via physical exclusion. Osmotic pressure together with crosslinking of the matrix also controls the growth of submerged biofilms and their susceptibility to invasion by planktonic cells. As the basic physicochemical principles of matrix crosslinking and osmotic swelling are universal, our findings may have implications for other biofilm-forming bacterial species.Most bacteria live in biofilms, surface-attached communities encased in an extracellular matrix. Here, Yan et al. show that matrix production in Vibrio cholerae increases the osmotic pressure within the biofilm, promoting biofilm expansion and physical exclusion of non-matrix producing cheaters.
International Nuclear Information System (INIS)
Chen Zhenpeng; Qi Huiquan
1990-01-01
A comprehensive R-matrix analysis code has been developed. It is based on the multichannel and multilevel R-matrix theory and runs in VAX computer with FORTRAN-77. With this code many kinds of experimental data for one nuclear system can be fitted simultaneously. The comparisions between code RAC and code EDA of LANL are made. The data show both codes produced the same calculation results when one set of R-matrix parameters was used. The differential cross section of 10 B (n, α) 7 Li for E n = 0.4 MeV and the polarization of 16 O (n,n) 16 O for E n = 2.56 MeV are presented
Removal of heavy metals and radionuclides by seeded magnetic filtration
International Nuclear Information System (INIS)
Bibler, J.P.; Norrell, G.; Hemmings, R.L.; Bradbury, D.; Dunn, M.J.; Kalinauskas, G.L.
1991-01-01
Removal of traces of heavy metal or radionuclide contamination from solution at high flow rate presents a considerable technical challenge. Low flow methods of treatment such as particle gravity settling require expensive large volume equipment, whereas traditional methods of filtration can cause significant energy costs. Magnetic filtration can be used to provide a low cost method of solid-liquid separation at high flow rate, provided contaminants can be selectively bound to a magnetic solid particle. This paper describes the use of such selective magnetic particles made up of inorganic particles coupled with organic polymers
Resolution of the three dimensional structure of components of the glomerular filtration barrier
DEFF Research Database (Denmark)
Arkill, Kenton P; Qvortrup, Klaus; Starborg, Tobias
2014-01-01
The human glomerulus is the primary filtration unit of the kidney, and contains the Glomerular Filtration Barrier (GFB). The GFB had been thought to comprise 3 layers - the endothelium, the basement membrane and the podocyte foot processes. However, recent studies have suggested that at least two...
Filtration aids in uranium ore processing
International Nuclear Information System (INIS)
Ford, H.L.; Levine, N.M.; Risdon, A.R.
1975-01-01
A process of improving the filtration efficiency and separation of uranium ore pulps obtained by carbonate leaching of uranium ore which comprises treating said ore pulps with an aqueous solution of hydroxyalkyl guar selected from the group consisting of hydroxyethyl and hydroxypropyl guar in the amount of 0.1 and 2.0 pounds of hydroxyalkyl guar per ton of uranium ore
Enlargement of filtration with finance in view
Aksamit, Anna
2017-01-01
This volume presents classical results of the theory of enlargement of filtration. The focus is on the behavior of martingales with respect to the enlarged filtration and related objects. The study is conducted in various contexts including immersion, progressive enlargement with a random time and initial enlargement with a random variable. The aim of this book is to collect the main mathematical results (with proofs) previously spread among numerous papers, great part of which is only available in French. Many examples and applications to finance, in particular to credit risk modelling and the study of asymmetric information, are provided to illustrate the theory. A detailed summary of further connections and applications is given in bibliographic notes which enables to deepen study of the topic. This book fills a gap in the literature and serves as a guide for graduate students and researchers interested in the role of information in financial mathematics and in econometric science. A basic knowledge of...
Energy Technology Data Exchange (ETDEWEB)
Kusworo, T. D., E-mail: tdkusworo@che.undip.ac.id; Widayat,; Pradini, A. W.; Armeli, Y. P. [Department of Chemical Engineering, University of Diponegoro Prof. Soedarto, Tembalang, Semarang, 50239, Phone/Fax : (024) 7460058 (Indonesia)
2015-12-29
Membrane technology is an alternative of water treatment based on filtration that is being developed. Surface Modification using heat treatment has been investigated to improve the performance of ultra thin PES-Zeolite nanocomposite membrane for produced water treatment from Pertamina Balongan. Two types of membranes with surface modification and without modification were prepared to study the effect of surface modification on its permeation properties. Asymmetric ultra thin PES-Zeolite nanocomposite membrane for produced water treatment was casted using the dry/wet phase inversion technique from dope solutions containing polyethersulfone, N-methyl-2-pyrrolidone (NMP) as a solvent and zeolite as a filler. Experimental results showed that the heat treatment at near glass transition temperature was increase the rejection of COD, Turbidity and ion Ca{sup 2+}. The better adherence of zeolite particles in the polymer matrix combined with formation of charge transfer complexes (CTCs) and cross-linking might be the main factors to enhance the percent of rejection. Field emission scanning electron microscopy (FESEM) micrographs showed that the selective layer and the substructure of PES-zeolite membrane became denser and more compact after the heat treatment. The FESEM micrographs also showed that the heat treatment was increased the adherence of zeolite particle and polymer. Membranes treated at 180 °C for 15 seconds indicated increase the rejection and small decrease in flux for produced water treatment.
DEFF Research Database (Denmark)
Kowalski, Krysztof; Arturi, Kasia; Søgaard, Erik Gydesen
2014-01-01
The results from a new water treatment system for arsenic removal are presented. The technology is based on the employment of an electrolytic iron dissolution and efficient aeration procedure prior to sand filtration. The treatment was introduced and investigated in a pilot scale plant and full......, there was a relationship where the higher applied current from the iron generator resulted in a better quality of the produced water. The long period of use also helped to determine a proper iron dosage (the Fe/As ratio 68 mg/mg) and identify carbonate scale formation in the electrochemical process. The electrolytic...
DQE of wireless digital detectors: Comparative performance with differing filtration schemes
Energy Technology Data Exchange (ETDEWEB)
Samei, Ehsan [Carl E. Ravin Advanced Imaging Laboratories, Departments of Radiology, Biomedical Engineering, Physics, and Electrical and Computer Engineering, Medical Physics Graduate Program, Duke University Medical Center, Durham, North Carolina 27705 (United States); Murphy, Simon; Christianson, Olav [Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States)
2013-08-15
Purpose: Wireless flat panel detectors are gaining increased usage in portable medical imaging. Two such detectors were evaluated and compared with a conventional flat-panel detector using the formalism of the International Electrotechnical Commission (IEC 62220-1) for measuring modulation transfer function (MTF), normalized noise power spectrum (NNPS), and detective quantum efficiency (DQE) using two different filtration schemes.Methods: Raw images were acquired for three image receptors (DRX-1C and DRX-1, Carestream Health; Inc., Pixium 4600, Trixell) using a radiographic system with a well-characterized output (Philips Super80 CP, Philips Healthcare). Free in-air exposures were measured using a calibrated radiation meter (Unfors Mult-O-Meter Type 407, Unfors Instruments AB). Additional aluminum filtration and a new alternative combined copper-aluminum filtration were used to conform the x ray output to IEC-specified beam quality definitions RQA5 and RQA9. Using the IEC 62220-1 formalism, each detector was evaluated at X{sub N}/2, X{sub N}, and 2X{sub N}, where the normal exposure level to the detector surface (X{sub N}) was set to 8.73 μGy (1.0 mR). The prescribed edge test device was used to evaluate the MTF, while the NNPS was measured using uniform images. The DQE was then calculated from the MTF and NNPS and compared across detectors, exposures, and filtration schemes.Results: The three DR systems had largely comparable MTFs with DRX-1 demonstrating lower values above 1.0 cycles/mm. At each exposure, DRX-1C and Pixium detectors demonstrated better noise performance than that of DRX-1. Zero-frequency DQEs for DRX-1C, Pixium, and DRX-1 detectors were approximately 74%, 63%, and 38% for RQA5 and 50%, 42%, and 28% for RQA9, respectively.Conclusions: DRX-1C detector exhibited superior DQE performance compared to Pixium and DRX-1. In terms of filtration, the alternative filtration was found to provide comparable performance in terms of rank ordering of different
DUST FILTRATION BY PLANET-INDUCED GAP EDGES: IMPLICATIONS FOR TRANSITIONAL DISKS
Energy Technology Data Exchange (ETDEWEB)
Zhu Zhaohuan; Dong Ruobing [Department of Astrophysical Sciences, 4 Ivy Lane, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Nelson, Richard P. [Astronomy Unit, Queen Mary University of London, Mile End Road, London E1 4NS (United Kingdom); Espaillat, Catherine [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Hartmann, Lee, E-mail: zhzhu@astro.princeton.edu, E-mail: rdong@astro.princeton.edu, E-mail: lhartm@umich.edu, E-mail: r.p.nelson@qmul.ac.uk, E-mail: cespaillat@cfa.harvard.edu [Department of Astronomy, University of Michigan, 500 Church St., Ann Arbor, MI 48109 (United States)
2012-08-10
By carrying out two-dimensional two-fluid global simulations, we have studied the response of dust to gap formation by a single planet in the gaseous component of a protoplanetary disk-the so-called dust filtration mechanism. We have found that a gap opened by a giant planet at 20 AU in an {alpha} = 0.01, M-dot =10{sup -8} M{sub Sun} yr{sup -1} disk can effectively stop dust particles larger than 0.1 mm drifting inward, leaving a submillimeter (submm) dust cavity/hole. However, smaller particles are difficult to filter by a gap induced by a several M{sub J} planet due to (1) dust diffusion and (2) a high gas accretion velocity at the gap edge. Based on these simulations, an analytic model is derived to understand what size particles can be filtered by the planet-induced gap edge. We show that a dimensionless parameter T{sub s} /{alpha}, which is the ratio between the dimensionless dust stopping time and the disk viscosity parameter, is important for the dust filtration process. Finally, with our updated understanding of dust filtration, we have computed Monte Carlo radiative transfer models with variable dust size distributions to generate the spectral energy distributions of disks with gaps. By comparing with transitional disk observations (e.g., GM Aur), we have found that dust filtration alone has difficulties depleting small particles sufficiently to explain the near-IR deficit of moderate M-dot transitional disks, except under some extreme circumstances. The scenario of gap opening by multiple planets studied previously suffers the same difficulty. One possible solution is to invoke both dust filtration and dust growth in the inner disk. In this scenario, a planet-induced gap filters large dust particles in the disk, and the remaining small dust particles passing to the inner disk can grow efficiently without replenishment from fragmentation of large grains. Predictions for ALMA have also been made based on all these scenarios. We conclude that dust filtration
DUST FILTRATION BY PLANET-INDUCED GAP EDGES: IMPLICATIONS FOR TRANSITIONAL DISKS
International Nuclear Information System (INIS)
Zhu Zhaohuan; Dong Ruobing; Nelson, Richard P.; Espaillat, Catherine; Hartmann, Lee
2012-01-01
By carrying out two-dimensional two-fluid global simulations, we have studied the response of dust to gap formation by a single planet in the gaseous component of a protoplanetary disk—the so-called dust filtration mechanism. We have found that a gap opened by a giant planet at 20 AU in an α = 0.01, M-dot =10 -8 M ☉ yr -1 disk can effectively stop dust particles larger than 0.1 mm drifting inward, leaving a submillimeter (submm) dust cavity/hole. However, smaller particles are difficult to filter by a gap induced by a several M J planet due to (1) dust diffusion and (2) a high gas accretion velocity at the gap edge. Based on these simulations, an analytic model is derived to understand what size particles can be filtered by the planet-induced gap edge. We show that a dimensionless parameter T s /α, which is the ratio between the dimensionless dust stopping time and the disk viscosity parameter, is important for the dust filtration process. Finally, with our updated understanding of dust filtration, we have computed Monte Carlo radiative transfer models with variable dust size distributions to generate the spectral energy distributions of disks with gaps. By comparing with transitional disk observations (e.g., GM Aur), we have found that dust filtration alone has difficulties depleting small particles sufficiently to explain the near-IR deficit of moderate M-dot transitional disks, except under some extreme circumstances. The scenario of gap opening by multiple planets studied previously suffers the same difficulty. One possible solution is to invoke both dust filtration and dust growth in the inner disk. In this scenario, a planet-induced gap filters large dust particles in the disk, and the remaining small dust particles passing to the inner disk can grow efficiently without replenishment from fragmentation of large grains. Predictions for ALMA have also been made based on all these scenarios. We conclude that dust filtration with planet(s) in the disk is a
Directory of Open Access Journals (Sweden)
Sonia C. Ferreira
2014-12-01
Full Text Available Specimens of aluminum-based composites reinforced by silicon carbide nanoparticles (Al/SiCnp produced by powder metallurgy (PM were anodized under voltage control in tartaric-sulfuric acid (TSA. In this work, the influence of the amount of SiCnp on the film growth during anodizing was investigated. The current density versus time response and the morphology of the porous alumina film formed at the composite surface are compared to those concerning a commercial aluminum alloy (AA1050 anodized under the same conditions. The processing method of the aluminum alloys influences the efficiency of the anodizing process, leading to a lower thicknesses for the unreinforced Al-PM alloy regarding the AA1050. The current density versus time response is strongly dependent on the amount of SiCnp. The current peaks and the steady-state current density recorded at each voltage step increases with the SiCnp volume fraction due to the oxidation of the SiCnp. The formation mechanism of the anodic film on Al/SiCnp composites is different from that occurring in AA1050, partly due the heterogeneous distribution of the reinforcement particles in the metallic matrix, but also to the entrapment of SiCnp in the anodic film.
Ferreira, Sonia C.; Conde, Ana; Arenas, María A.; Rocha, Luis A.; Velhinho, Alexandre
2014-01-01
Specimens of aluminum-based composites reinforced by silicon carbide nanoparticles (Al/SiCnp) produced by powder metallurgy (PM) were anodized under voltage control in tartaric-sulfuric acid (TSA). In this work, the influence of the amount of SiCnp on the film growth during anodizing was investigated. The current density versus time response and the morphology of the porous alumina film formed at the composite surface are compared to those concerning a commercial aluminum alloy (AA1050) anodized under the same conditions. The processing method of the aluminum alloys influences the efficiency of the anodizing process, leading to a lower thicknesses for the unreinforced Al-PM alloy regarding the AA1050. The current density versus time response is strongly dependent on the amount of SiCnp. The current peaks and the steady-state current density recorded at each voltage step increases with the SiCnp volume fraction due to the oxidation of the SiCnp. The formation mechanism of the anodic film on Al/SiCnp composites is different from that occurring in AA1050, partly due the heterogeneous distribution of the reinforcement particles in the metallic matrix, but also to the entrapment of SiCnp in the anodic film. PMID:28788295
Ferreira, Sonia C; Conde, Ana; Arenas, María A; Rocha, Luis A; Velhinho, Alexandre
2014-12-19
Specimens of aluminum-based composites reinforced by silicon carbide nanoparticles (Al/SiC np ) produced by powder metallurgy (PM) were anodized under voltage control in tartaric-sulfuric acid (TSA). In this work, the influence of the amount of SiC np on the film growth during anodizing was investigated. The current density versus time response and the morphology of the porous alumina film formed at the composite surface are compared to those concerning a commercial aluminum alloy (AA1050) anodized under the same conditions. The processing method of the aluminum alloys influences the efficiency of the anodizing process, leading to a lower thicknesses for the unreinforced Al-PM alloy regarding the AA1050. The current density versus time response is strongly dependent on the amount of SiC np . The current peaks and the steady-state current density recorded at each voltage step increases with the SiC np volume fraction due to the oxidation of the SiC np . The formation mechanism of the anodic film on Al/SiC np composites is different from that occurring in AA1050, partly due the heterogeneous distribution of the reinforcement particles in the metallic matrix, but also to the entrapment of SiC np in the anodic film.
Preparation of Ag/HBP/PAN Nanofiber Web and Its Antimicrobial and Filtration Property
Directory of Open Access Journals (Sweden)
Li-Rong Yao
2016-01-01
Full Text Available To widen the application of nanofibers web in the field of medical health materials, a new Ag/amino-terminated hyperbranched polymer (HBP/polyacrylonitrile (PAN nanofiber web with excellent antimicrobial activity and filtration property was produced with Ag/HBP dispersion solution and PAN nanofiber. Ag/HBP dispersion solution was prepared with HBP as reducer and stabilizer, and Ag/HBP/PAN nanofiber was prepared by modifying electrospun PAN nanofiber with Ag/HBP aqueous solution. The characterization results showed that spherical Ag nanoparticles were prepared and they had a narrow distribution in HBP aqueous solution. The results of Ag/HBP/PAN nanofiber characterized with SEM and EDS showed that the content of silver nanoparticles on the surface of PAN nanofiber was on the increase when the treating temperature rose. The bacterial reduction rates of HBP-treated PAN nanofiber against S. aureus and E. coli were about 89%, while those of the Ag/HBP/PAN nanofiber against S. aureus and E. coli were 99.9% and 99.96%, respectively, due to the cooperative effects from the amino groups in HBP and Ag nanoparticles. Moreover, the small pores and high porosity in Ag/HBP/PAN nanofiber web resulted in high filtration efficiency (99.9% for removing smaller particles (0.1 μm~0.7 μm, which was much higher than that of the gauze mask.
Thermo-resistant filtration fabrics for hot gas extraction
International Nuclear Information System (INIS)
Wierzbowska, T.
1992-01-01
Types and technical and utilizing data of heat resistant filtrating fabrics initiated to production by 'Moratex' and provided for dust extraction of technical gas from various industrial processes have been discussed. (author). 8 refs, 2 tabs
Improved remote HEPA filtration development program
International Nuclear Information System (INIS)
Wilson, C.E. III.
1987-03-01
This paper presents a summary of the prototype development and hot cell mock-up testing program undertaken to adapt a commercial remote HEPA filter housing for use in the Process Facility Modification Project (PFMP). This program was initiated in response to the project design criteria and documentation that required the air from the hot cell environment to be exhausted through three stages of HEPA filtration. Due to the anticipated quantity of radioactive contamination captured by the first stage of filters, it was determined that the first stage would need to be located in a remotely operated and maintained shielded cell adjoining the primary hot cell areas. Commercially available remote filtration equipment was evaluated and candidate unit was identified, which could be developed into a suitable filter housing. A candidate unit was obtained from Flanders Filters, Inc. and a series of hot cell mock-up tests were identified in the 305 facility at the Hanford site. The results of these tests, and further interaction with the vendor, led to a prototype remote filter housing which satisfied most PFMP criteria and proved to be significantly superior to existing commercial units for remote operation/maintenance
Mathematics model of filtration efficiency of moisture separator for nuclear reactors
International Nuclear Information System (INIS)
Zhang Zhenzhong; Jiang Feng; Huang Yunfeng
2010-01-01
In order to study the filtration mechanism of the moisture separator for water droplet of 5∼10μm, this paper set up a physical model. For the mixed meshes, they can be classified into three types: standard meshes, bur meshes and middle meshes. For all fibers of the wire meshes and vertical fibers of standard mixed meshes, a Kuwabara flow field is used to track the particle to get the inertial impaction efficiency and then calculate the total filtration efficiency of the meshes. For other fibers, besides the Kuwabara flow field, an around-flat flow field is added to calculate the efficiency. Lastly, the total efficiency of the moisture separator according to the equation of the filtration efficiency for the filters in series is compared with the experimental data. The result shows that, under the standard condition,the calculation value is consistent with the experimental efficiency data. (authors)
Optimization of gravity-driven membrane (GDM) filtration process for seawater pretreatment.
Wu, Bing; Hochstrasser, Florian; Akhondi, Ebrahim; Ambauen, Noëmi; Tschirren, Lukas; Burkhardt, Michael; Fane, Anthony G; Pronk, Wouter
2016-04-15
Seawater pretreatment by gravity-driven membrane (GDM) filtration at 40 mbar has been investigated. In this system, a beneficial biofilm develops on the membrane that helps to stabilize flux. The effects of membrane type, prefiltration and system configuration on stable flux, biofilm layer properties and dissolved carbon removal were studied. The results show that the use of flat sheet PVDF membranes with pore sizes of 0.22 and 0.45 μm in GDM filtration achieved higher stabilized permeate fluxes (7.3-8.4 L/m(2)h) than that of flat sheet PES 100 kD membranes and hollow fibre PVDF 0.1 μm membranes. Pore constriction and cake filtration were identified as major membrane fouling mechanisms, but their relative contributions varied with filtration time for the various membranes. Compared to raw seawater, prefiltering of seawater with meshes at sizes of 10, 100 and 1000 μm decreased the permeate flux, which was attributed to removal of beneficial eukaryotic populations. Optical coherence tomography (OCT) showed that the porosity of the biofouling layer was more significantly related with permeate flux development rather than its thickness and roughness. To increase the contact time between the biofilm and the dissolved organics, a hybrid biofilm-submerged GDM reactor was evaluated, which displayed significantly higher permeate fluxes than the submerged GDM reactor. Although integrating the biofilm reactor with the membrane system displayed better permeate quality than the GDM filtration cells, it could not effectively reduce dissolved organic substances in the seawater. This may be attributed to the decomposition/degradation of solid organic substances in the feed and carbon fixation by the biofilm. Further studies of the dynamic carbon balance are required. Copyright © 2016 Elsevier Ltd. All rights reserved.
Zebra mussel filtration and its potential uses in industrial water treatment.
Elliott, Paul; Aldridge, David C; Moggridge, Geoff D
2008-03-01
The zebra mussel (Dreissena polymorpha) is a notorious freshwater biofouling pest, and populations of the species can alter aquatic environments through their substantial filtration capabilities. Despite the ecological importance of zebra mussel filtration, many predictions of their large-scale effects on ecosystems rely on extrapolations from filtration rates obtained in static laboratory experiments, not accounting for natural mussel densities, boundary layer effects, flow rates or elevated algal concentrations. This study used large-scale industrial flume trials to investigate the influence of these factors on zebra mussel filtration and proposes some novel industrial applications of these findings. The flume trials revealed some of the highest zebra mussel clearance rates found to date, up to 574+/-20mlh(-1)g(-1) of wet tissue mass. Under low algal concentrations, chlorophyll a removal by zebra mussels was not proportional to mussel density, indicating that field rates of zebra mussel grazing may be much lower than previous studies have predicted. Increasing ambient velocities up to 100mls(-1) ( approximately 4cms(-1)) led to increased clearance rates by zebra mussels, possibly due to the replenishment of locally depleted resources, but higher velocities of 300mls(-1) (12cms(-1)) did not lead to further significant increases in clearance rate. When additional algal cultures were dosed into the flumes, chlorophyll a removal increased approximately logarithmically with zebra mussel density and there were no differences in the clearance of three different species of alga: Ankyra judayi, Pandorina morum and Cyclotella meneghinia. Some novel industrial uses of these zebra mussel filtration studies are proposed, such as: (1) helping to inform models that predict the large-scale grazing effects of the mussels, (2) allowing estimates of zebra mussel densities in industrial pipelines, and (3) constructing large-scale biofilters for use in water clarification.
Assessment of glomerular filtration rate and effective renal plasma flow in cystic fibrosis
International Nuclear Information System (INIS)
Spino, M.; Chai, R.P.; Isles, A.F.; Balfe, J.W.; Brown, R.G.; Thiessen, J.J.; MacLeod, S.M.
1985-01-01
A study was conducted to examine renal function in 10 healthy control subjects and eight patients with cystic fibrosis in stable condition. Sequential bolus injections of /sup 99m/Tc-DTPA and 125 I-OIH were administered to assess glomerular filtration rate and effective renal plasma flow, respectively. Blood was subsequently collected for 3 hours, and urine for 24 hours. Renal clearances of both radioisotope markers were virtually identical in patients and controls. Inasmuch as neither glomerular filtration rate nor effective renal plasma flow was enhanced in patients with cystic fibrosis, increased clearance of drugs in these patients is unlikely to be the result of enhanced glomerular filtration or tubular secretion
Directory of Open Access Journals (Sweden)
Ting Chen
2014-06-01
Full Text Available At present, filtration surgery remains an important treatment of glaucoma, and filtering bleb fibrosis is the main cause for treatment failure. Filtering bleb fibrosis is a common fiber hyperplastic disease, and it relates to the activation and proliferation of fibroblasts and the excessive production of extracellular matrix(ECMsuch as collagen protein. The most frequently-used drugs for filtering bleb fibrosis in clinic are 5-fluoro-2,4(1h, 3hpyrimidinedione(5-Fuand mitomycin(MMC. Although they are effective in some degree, they also have some serious side effects which restrict their clinical use. Triptolide(TPLis a major active component of the medicinal plant, tripterygium wilfordii hook.f.(TWHF. TPL has multiple pharmacological activities including immunosuppressive, anti-inflammatory, anti-cancer and anti-fertility activity. Reviewing related literatures published in recent ten years, we confirmed that TPL seemed to possess a pharmacological activity in treating filtering bleb fibrosis. Since it has three major functions: 1. inhibit the activation and proliferation of fibroblasts and the excessive production of collagen protein; 2. alleviate the inflammatory reaction after surgical wound to suppress fibrous scar formation; 3.TPL has a protective effect on retinal ganglion cells(RGCs. We further find that TPL's anti-fibrosis activity mainly results from that it inhibits TGF-β/Smad,NF-κB and PI3K/AKT signal transduction pathway. This comprehensive analysis about the feasibility of Triptolide's role in treating filtering bleb fibrosis after the filtration surgery of glaucoma can help us develop new drugs for filtering bleb fibrosis and exploit TPL's clinical value on some level.
Influence of the surface structure on the filtration performance of UV-modified PES membranes
DEFF Research Database (Denmark)
Kæselev, Bozena Alicja; Kingshott, P.; Jonsson, Gunnar Eigil
2002-01-01
chemically characterised using X-ray photoelectron spectroscopy (XPS) and time of flight-static secondary ion mass spectrometry (TOF-static SIMS). The filtration performance of irradiated/non-modified and irradiated/modified membranes was examined in a crossflow cell, using a dextran solution. The filtration...... in relation to dextran when compared to membranes modified by AAG and AAP. This work suggests that the structure of the presence of grafted chains seems to be responsible for the observed changes to filtration performance of the modified membrane. Surface analysis supports the claim that the specific surface...
Nocturnal polyuria is related to absent circadian rhythm of glomerular filtration rate.
De Guchtenaere, A; Vande Walle, C; Van Sintjan, P; Raes, A; Donckerwolcke, R; Van Laecke, E; Hoebeke, P; Vande Walle, J
2007-12-01
Monosymptomatic nocturnal enuresis is frequently associated with nocturnal polyuria and low urinary osmolality during the night. Initial studies found decreased vasopressin levels associated with low urinary osmolality overnight. Together with the documented desmopressin response, this was suggestive of a primary role for vasopressin in the pathogenesis of enuresis in the absence of bladder dysfunction. Recent studies no longer confirm this primary role of vasopressin. Other pathogenetic factors such as disordered renal sodium handling, hypercalciuria, increased prostaglandins and/or osmotic excretion might have a role. So far, little attention has been given to abnormalities in the circadian rhythm of glomerular filtration rate. We evaluated the circadian rhythm of glomerular filtration rate and diuresis in children with desmopressin resistant monosymptomatic nocturnal enuresis and nocturnal polyuria. We evaluated 15 children (9 boys) 9 to 14 years old with monosymptomatic nocturnal enuresis and nocturnal polyuria resistant to desmopressin treatment. The control group consisted of 25 children (12 boys) 9 to 16 years old with monosymptomatic nocturnal enuresis without nocturnal polyuria. Compared to the control population, children with nocturnal polyuria lost their circadian rhythm not only for diuresis and sodium excretion but also for glomerular filtration rate. Patients with monosymptomatic nocturnal enuresis and nocturnal polyuria lack a normal circadian rhythm for diuresis and sodium excretion, and the circadian rhythm of glomerular filtration rate is absent. This absence of circadian rhythm of glomerular filtration rate and/or sodium handling cannot be explained by a primary role of vasopressin, but rather by a disorder in circadian rhythm of renal glomerular and/or tubular functions.
Semen Quality of Holstein and Buffalo Bulls after Filtration using Sephadex Column
International Nuclear Information System (INIS)
AbdelKhalek, A E; AboulEla, M B; Soheir, A Fawzy; Dandooush E
2008-01-01
To evaluate the effect of sephadex column filtration technique on semen quality of five Holstein bulls and five Egyptian buffalo bulls. Semen was collected biweekly from each eight weeks. Immediately after collection, semen was extended (37degree C) and filtered using sephadex column-filtration technique. Semen was evaluated for physical semen characteristics including, percentages of sperm motility, live sperm and sperm abnormality as well as sperm cell concentration pre-and post-filtration. Results show that among all physical semen characteristics, only ejaculate semen volume was significantly (P<0.001) higher in Holstein than buffalo bulls, but motility, livability, abnormality, sperm concentration and sperm with intact acrosome did not differ between both species. As a result of filtration, sperm motility and livability increased (P<0.05) by 16.4 and 11.8% in Holstein and by 16.9 and 10.1% in buffalo semen, respectively. Sperm abnormality and concentration reduced (P<0.05) by 2.6 and 3.3% in Holstein and by 2.4 and 3.5% in buffalo semen, respectively. Improvements of live sperm and the reduction in sperm concentration (proportional to the pre-filtration value) were better (P<0.05) in Holstein than buffalo semen (15.5% and %52.4 vs. 13.2 and -49.3%, respectively). Improvement of motility and abnormality did not differ in Holstein (25.4 and %57.8) and buffalo semen (26.6 and ,(%54.5respectively. The present results indicate that using sephadex column filter technique has beneficial effects on improving quality of spermatozoa in both species. (author)
Filtration in the Use of Individual Water Purification Devices
National Research Council Canada - National Science Library
Lundquist, Arthur; Clarke, Steven; Bettin, William
2006-01-01
.... Understanding the ability of filtration to reduce disease-causing microorganisms in water is important in protecting Soldiers, who are considering using this technology, from acute health threats...
Filtration engineering study to upgrade the ETF
International Nuclear Information System (INIS)
McDonald, F.N.N.
1995-01-01
Filtration technologies are evaluated which have potential to augment or upgrade the 200 Area Effluent Treatment Facility. The study was written in anticipation of treating future waste waters that have high fouling potentials. The Three ultrafilters judged to be capable of treating future waste waters are: hollow fiber, tubular, and centrifugal
Improvement of municipal wastewater pretreatment by direct membrane filtration.
Nascimento, Thiago A; Mejía, Fanny R; Fdz-Polanco, Fernando; Peña Miranda, Mar
2017-10-01
The high content of particulate matter in municipal wastewater hinders the conventional anaerobic treatments at psychrophilic temperatures. The hydrolysis of the particulate chemical oxygen demand (pCOD) could be the limiting step under these conditions. Therefore, new pretreatments or improved conventional pretreatments are needed in order to separate pCOD. In this work, direct membrane filtration of municipal wastewater, using an ultrafiltration membrane, was investigated. This intensive pretreatment, which aims to separate soluble chemical oxygen demand (sCOD) and to concentrate pCOD, together with anaerobic treatments of both streams at psychrophilic and mesophilic conditions respectively, could be an alternative to the conventional activated sludge process. The obtained results show a removal yield of 24.9% of the total solids (TS) and 45% of total chemical oxygen demand (tCOD), obtaining a permeate free of suspended solids. This physical removal implies the accumulation of solids inside the membrane tank, reaching the values of 45.4 and 4.4 g/L of TS in the sedimentation and filtration sections, respectively. The membrane operated with filtration, backwashing cycles and continuous gas sparging, with a permeate flux predominantly around 10 L/(m 2 h). The results show the viability of the technology to concentrate pCOD and so to improve energy recovery from municipal wastewater.
National Research Council Canada - National Science Library
Radsick, Timothy
2001-01-01
... or from inadequate oxide-based ones. A porous mullite/alumina matrix combined with alumina/mullite fiber reinforcement eliminates the need for an interface coating while producing a strong, tough and oxidation resistant composite...
Clinical dehydration and glomerular filtration rate in acute paediatric gastroenteritis.
Milani, Gregorio P; Fossali, Emilio F; Perri, Alessandra; Vettori, Arianna; Grillo, Paolo; Agostoni, Carlo
2013-08-01
To evaluate changes in glomerular filtration rate in acute gastroenteritis. The correlation between two clinical diagnostic scales and glomerular filtration rate has been investigated in 113 children with acute gastroenteritis in a paediatric emergency setting. A significant reduction of GFR was found in 10% children less than, and 5% children higher than, 2 years of age with acute gastroenteritis. The differences observed as for risk of renal hypoperfusion suggests to consider the age of children as an important determinant to consider the dehydration status in acute gastroenteritis. ©2013 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.
DEFF Research Database (Denmark)
Demissie, A; Ravn, P; Olobo, J
1999-01-01
We examined the immune responses of patients with active pulmonary tuberculosis (TB) and their healthy household contacts to short-term culture filtrate (ST-CF) of Mycobacterium tuberculosis or molecular mass fractions derived from it. Our goal was to identify fractions strongly recognized...... antigens and immune responses were determined. Household contacts produced significantly higher levels of gamma interferon (IFN-gamma) than the TB patients in response to antigens present in ST-CF and the 10 narrow-molecular-mass fractions. A similar difference in leukocyte proliferative responses...... to the antigens between the two groups was also found. In general, while all fractions stimulated immune responses, the highest activity was seen with the low-molecular-mass fractions, which include well-defined TB antigens such as ESAT-6. Leukocytes from contacts of TB patients with severe disease produced...
Exopolysaccharides produced by lactic acid bacteria
Caggianiello, Graziano; Kleerebezem, Michiel; Spano, Giuseppe
2016-01-01
A wide range of lactic acid bacteria (LAB) is able to produce capsular or extracellular polysaccharides, with various chemical compositions and properties. Polysaccharides produced by LAB alter the rheological properties of the matrix in which they are dispersed, leading to typically viscous and
Efficiency criterion for teleportation via channel matrix, measurement matrix and collapsed matrix
Directory of Open Access Journals (Sweden)
Xin-Wei Zha
Full Text Available In this paper, three kinds of coefficient matrixes (channel matrix, measurement matrix, collapsed matrix associated with the pure state for teleportation are presented, the general relation among channel matrix, measurement matrix and collapsed matrix is obtained. In addition, a criterion for judging whether a state can be teleported successfully is given, depending on the relation between the number of parameter of an unknown state and the rank of the collapsed matrix. Keywords: Channel matrix, Measurement matrix, Collapsed matrix, Teleportation
Bench-scale cross flow filtration of Tank S-107 sludge slurries and Tank C-107 supernatant
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1996-10-01
Hanford tank waste filtration experiments were conducted using a bench-scale cross flow filter on 8 wt%, 1.5 wt%, and 0.05 wt% Tank S- 107 sludge slurries and on Tank C-107 supernatant. For comparison, two simulants each with solids loadings of 8 wt% and 0.05 wt% were also tested. The purpose of the tests was to determine the efficacy of cross flow filtration on slurries of various solids loadings. -In addition, filtrate flux dependency on axial velocity and transmembrane pressure was sought so that conditions for future experiments might be better selected. The data gathered are compared to the simulants and three cross flow filtration models. A two- parameter central composite design which tested. transmembrane pressure from 5 to 40 psig and axial Velocity from 3 to 9 ft/s was used for all feeds. The cross flow filter effectively removed solids from the liquid, as 19 of 20 filtrate samples had particle concentrations below the resolution limit of the photon correlation spectrometer used in the Hanford Radiocolloid Laboratory. Radiochemical analysis indicate that all filtrate samples were below Class A waste classification standards for 9OSr and transuranics
Application of Combined Cake Filtration-Complete Blocking Model to Ultrafiltration of Skim Milk
Directory of Open Access Journals (Sweden)
Mansoor Kazemimoghadam
2017-10-01
Full Text Available Membrane ultrafiltration (UF is widely used in dairy industries like milk concentration and dehydration processes. The limiting factor of UF systems is fouling which is defined as the precipitation of solutes in the form of a cake layer on the surface of the membrane. In this study, the combined cake filtration-complete blocking model was compared to cake filtration mechanism for flux data through ultrafiltration of skim milk at constant flow rate. The resistance data also was modeled using cake filtration model and standard blocking model. The effect of different trans-membrane pressures and temperatures on flux decline was then investigated. Based on the results obtained here, the combined complete blocking-cake formation model was in excellent agreement with experimental data. The cake filtration model also provided good data fits and can be applied to solutions whose solutes tend to accumulate on the surface of the membrane in the form of a cake layer. With increasing pressure, the differences between the model and experimental data increased.
Matrix inversion tomosynthesis improvements in longitudinal x-ray slice imaging
International Nuclear Information System (INIS)
Dobbines, J.T. III.
1990-01-01
This patent describes a tomosynthesis apparatus. It comprises: an x-ray tomography machine for producing a plurality of x-ray projection images of a subject including an x-ray source, and detection means; and processing means, connected to receive the plurality of projection images, for: shifting and reconstructing the projection x-ray images to obtain a tomosynthesis matrix of images T; acquiring a blurring matrix F having components which represent out-of-focus and in-focus components of the matrix T; obtaining a matrix P representing only in-focus components of the imaged subject by solving a matrix equation including the matrix T and the matrix F; correcting the matrix P for low spatial frequency components; and displaying images indicative of contents of the matrix P
Potential study of bed filtration characteristics in impressed boreholes by radon tracer technique
International Nuclear Information System (INIS)
Litvinov, A.A.; Pinkenzon, D.B.; Makarov, M.S.; Vinarskij, M.S.
1977-01-01
Potential study of bed filtration characteristics in impressed boreholes by radon tracer method is shown. Effects recorded by radon tracer result from gamma radiation of short-living radon decay daughter products. During filtration of tracer through punched holes, cement stone, and rocks the products are deposited and cause a local effect for 2-3 hours. There is a shortage of short-living products in filtrated radon liquid and for some time (which is necessary for production of notable quantity of new decay products) it is practically not a gamma emitter. It is shown that the feature of effect formation governs the technique for well logging as well as interpretation of the results obtained
Water quality and treatment of river bank filtrate
De Vet, W.W.J.M.; Van Genuchten, C.C.A.; Van Loosdrecht, M.C.M.; Van Dijk, J.C.
2010-01-01
In drinking water production, river bank filtration has the advantages of dampening peak concentrations of many dissolved components, substantially removing many micropollutants and removing, virtually completely, the pathogens and suspended solids. The production aquifer is not only fed by the
Water quality and treatment of river bank filtrate
De Vet, W.W.J.M.; Van Genuchten, C.C.A.; Van Loosdrecht, M.C.M.; Van Dijk, J.C.
2009-01-01
In drinking water production, river bank filtration has the advantages of dampening peak concentrations of many dissolved components, substantially removing many micropollutants and removing, virtually completely, the pathogens and suspended solids. The production aquifer is not only fed by the
Scaling and particulate fouling in membrane filtration systems
Boerlage, S.F.E.
2001-01-01
Membrane filtration technologies have emerged as cost competitive and viable techniques in drinking and industrial water production. Despite advancements in membrane manufacturing and technology, membrane scaling and fouling remain major problems and may limit future growth in the industry. Scaling
International Nuclear Information System (INIS)
Fang, Qun; Zhu, Ming; Yu, Siruo; Sui, Gang; Yang, Xiaoping
2016-01-01
Highlights: • Biodegradable filtration membranes were prepared. • Polar groups in the membrane surface helped capture fine particles. • Loading filtration efficiency can reach 99.99% in the case of small pressure drop. • Filtration membrane showed antimicrobial activity to Escherichia coli. - Abstract: A biodegradable and multifunctional air filtration membrane was prepared by electrospinning of soy protein isolate (SPI)/polyvinyl alcohol (PVA) system in this paper. The optimized SPI/PVA proportion in the spinning solution was determined according to the analyses of microstructure, surface chemical characteristic and mechanical property of the hybrid nanofiber membranes. Under the preferred preparation condition, two kinds of polymer materials displayed a good compatibility in the hybrid nanofibers, and a large number of polar groups existed in the membrane surface. The loading filtration efficiency of the nanofiber membrane with optimal material ratio and areal density can reach 99.99% after test of 30 min for fine particles smaller than 2.5 μm in the case of small pressure drop. Besides, this kind of filtration membrane showed an antimicrobial activity to Escherichia coli in the study. The SPI/PVA hybrid nanofiber membrane with proper material composition and microstructure can be used as a new type of high performance eco-friendly filtration materials.
Energy Technology Data Exchange (ETDEWEB)
Fang, Qun; Zhu, Ming; Yu, Siruo; Sui, Gang, E-mail: suigang@mail.buct.edu.cn; Yang, Xiaoping
2016-12-15
Highlights: • Biodegradable filtration membranes were prepared. • Polar groups in the membrane surface helped capture fine particles. • Loading filtration efficiency can reach 99.99% in the case of small pressure drop. • Filtration membrane showed antimicrobial activity to Escherichia coli. - Abstract: A biodegradable and multifunctional air filtration membrane was prepared by electrospinning of soy protein isolate (SPI)/polyvinyl alcohol (PVA) system in this paper. The optimized SPI/PVA proportion in the spinning solution was determined according to the analyses of microstructure, surface chemical characteristic and mechanical property of the hybrid nanofiber membranes. Under the preferred preparation condition, two kinds of polymer materials displayed a good compatibility in the hybrid nanofibers, and a large number of polar groups existed in the membrane surface. The loading filtration efficiency of the nanofiber membrane with optimal material ratio and areal density can reach 99.99% after test of 30 min for fine particles smaller than 2.5 μm in the case of small pressure drop. Besides, this kind of filtration membrane showed an antimicrobial activity to Escherichia coli in the study. The SPI/PVA hybrid nanofiber membrane with proper material composition and microstructure can be used as a new type of high performance eco-friendly filtration materials.
First order deformations of the Fourier matrix
Energy Technology Data Exchange (ETDEWEB)
Banica, Teodor, E-mail: teo.banica@gmail.com [Department of Mathematics, Cergy-Pontoise University, 95000 Cergy-Pontoise (France)
2014-01-15
The N × N complex Hadamard matrices form a real algebraic manifold C{sub N}. The singularity at a point H ∈ C{sub N} is described by a filtration of cones T{sub H}{sup ×}C{sub N}⊂T{sub H}{sup ∘}C{sub N}⊂T{sub H}C{sub N}⊂T{sup ~}{sub H}C{sub N}, coming from the trivial, affine, smooth, and first order deformations. We study here these cones in the case where H = F{sub N} is the Fourier matrix, (w{sup ij}) with w = e{sup 2πi/N}, our main result being a simple description of T{sup ~}{sub H}C{sub N}. As a consequence, the rationality conjecture dim{sub R}(T{sup ~}{sub H}C{sub N})=dim{sub Q}(T{sup ~}{sub H}C{sub N}∩M{sub N}(Q)) holds at H = F{sub N}.
Energy Technology Data Exchange (ETDEWEB)
Buczkowski, M; Wawszczak, D; Starosta, W [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)
1997-10-01
The characteristics of track filtration membranes has been performed. The investigation of radiation resistance has been carried out for different types of polymer foil used as a membrane material. Biomedical applications of track filtration membranes have been presented and discussed. 10 refs, 10 figs.
DEFF Research Database (Denmark)
Purice, Andreea; Schou, Jørgen; Pryds, Nini
2007-01-01
Thin films of the protein, lysozyme, have been deposited by the matrix-assisted pulsed laser evaporation (MAPLE) technique. Frozen targets of 0.3-1.0 wt.% lysozyme dissolved in ultrapure water were irradiated by laser light at 355 mn with a fluence of 2 J/cm(2). The surface quality of the thin....... The concentration of lysozyme in the ice matrix apparently does not play any significant role for the morphology of the film. The morphology obtained with MAPLE has been compared with results for direct laser irradiation of a pressed lysozyme sample (i.e. pulsed laser deposition (PLD)). (C) 2007 Elsevier B.V. All...
Non-stationary open-flow filtration of ground waters at the Pripyat'-Dnieper inter river
International Nuclear Information System (INIS)
Tarapon, A.G.
1989-01-01
Consideration is given to filtration of ground waters into rivers and to effect of drainage devices. Investigations were conducted with use of modelling of planned and profile filtration of ground waters at the electric models. Efficiency of engineering protection facilities suggested, was studied to prevent contamination of water intakes. Modelling shown, that contamination washing out process was in a cycle character with 1 year period. Use of drainage canal with the water level 0.8 m lower than in the river, is an effective way to prevent filtration of ground waters into the Pripyat' and the Dnieper from the upper open-flow aquiver
Evaluation of dissolved air flotation and membrane filtration for drinking water treatment
International Nuclear Information System (INIS)
Van Benschoten, J.; Martin, C.; Schaefer, J.; Xu, L.; Franceschini, S.
2002-01-01
Laboratory and pilot-scale testing was conducted to evaluate the use of dissolved air flotation (DAF) followed by membrane filtration (MF) for drinking water treatment. At the laboratory scale, four water samples of varying water quality were tested. Pilot- scale DAF and MF plants located at the City of Buffalo Water Treatment facility utilized Lake Erie as a raw water source to evaluate this combination of treatment processes. A polyaluminum coagulant was used throughout the study. Study results demonstrated beneficial effects of coagulant addition in extending MF run time. Pilot testing showed additional benefits to using DAF as a pretreatment step to MF. In all testing, MF produced excellent water quality. Particulate matter appeared more important than concentration or type of dissolved organic matter in membrane fouling. (author)
Tseng, Boo Shan; Reichhardt, Courtney; Merrihew, Gennifer E; Araujo-Hernandez, Sophia A; Harrison, Joe J; MacCoss, Michael J; Parsek, Matthew R
2018-04-10
Pseudomonas aeruginosa produces an extracellular biofilm matrix that consists of nucleic acids, exopolysaccharides, lipid vesicles, and proteins. In general, the protein component of the biofilm matrix is poorly defined and understudied relative to the other major matrix constituents. While matrix proteins have been suggested to provide many functions to the biofilm, only proteins that play a structural role have been characterized thus far. Here we identify proteins enriched in the matrix of P. aeruginosa biofilms. We then focused on a candidate matrix protein, the serine protease inhibitor ecotin (PA2755). This protein is able to inhibit neutrophil elastase, a bactericidal enzyme produced by the host immune system during P. aeruginosa biofilm infections. We show that ecotin binds to the key biofilm matrix exopolysaccharide Psl and that it can inhibit neutrophil elastase when associated with Psl. Finally, we show that ecotin protects both planktonic and biofilm P. aeruginosa cells from neutrophil elastase-mediated killing. This may represent a novel mechanism of protection for biofilms to increase their tolerance against the innate immune response. IMPORTANCE Proteins associated with the extracellular matrix of bacterial aggregates called biofilms have long been suggested to provide many important functions to the community. To date, however, only proteins that provide structural roles have been described, and few matrix-associated proteins have been identified. We developed a method to identify matrix proteins and characterized one. We show that this protein, when associated with the biofilm matrix, can inhibit a bactericidal enzyme produced by the immune system during infection and protect biofilm cells from death induced by the enzyme. This may represent a novel mechanism of protection for biofilms, further increasing their tolerance against the immune response. Together, our results are the first to show a nonstructural function for a confirmed matrix
Transport of micropollutants in a riverbank filtration system
van Driezum, Inge; Oudega, Thomas; Reiner, Philipp; Zessner, Matthias; Farnleitner, Andreas; Blaschke, Paul
2014-05-01
Groundwater locations at alluvial backwaters are essential for public water supply. Riverbank filtration (RBF) systems are widely used as a means of obtaining public water supplies. Riverbank filtration is an effective way to remove micropollutants from the receiving surface water. The efficiency of the RBF system strongly depends on the residence time of the water in the aquifer and on the soil properties (Ray, 2011). In order to understand all bio- and geochemical processes within the hyporheic zone (e.g. the region were mixing of surface water and groundwater occurs), exchange rates and flow patterns need to be quantified. The main study area covers the porous groundwater aquifer study site (PGWA) - an urban floodplain extending on the left bank of the River Danube downstream of the City of Vienna. It is one of the main groundwater bodies in Austria. Groundwater quality in the PGWA is influenced by a combination of anthropogenic activities, industry, wastewater treatment plants, heavy precipitation events and floodings. The upper layer of the DPA is impermeable, preventing pollution originating from the surface. The upper layer consists of silt. The underlying confined aquifer consists of sand and gravel layers. Hydraulic conductivities range from 5 x 10-2 m/s up to 5 x 10-5 m/s. Underneath the aquifer are alternating sand an clay/silt layers. Samples are taken from two transects in the DPA. These transects consist of four piezometers in the first few meters of the groundwater aquifer. Several other piezometers are placed downstream from the river-groundwater interface. The behaviour of the micropollutants in the hyporheic zone can therefore be studied intensively. The transport behaviour of several micropollutants is modeled using carbamazepine (CBZ) and acesulfame (ACE) as natural tracers. Furthermore, temperature and electrical conductivity data was used for modeling. The micropollutants are measured using an in house developed online SPE-HPLC-MS/MS method
Renal filtration function in patients with gout
Directory of Open Access Journals (Sweden)
N. N. Kushnarenko
2016-01-01
Full Text Available Aim. To study circadian blood pressure (BP profile in patients with gout depending on the presence of arterial hypertension (HT and their relationship to the renal filtration function.Material and methods. Patients with gout (n=87 were included into the study. All the patients underwent ambulatory BP monitoring (ABPM with the assessment of circadian BP profile, determination of uric acid serum levels, glomerular filtration rate (GFR was evaluated by CKD-EPI method. Depending on GFR level, all the patients were divided into 2 groups - with renal dysfunction or without one.Results. ABPM revealed circadian BP dysregulation in 55% of gout patients both with HT and without HT. Chronic kidney disease (CKD was revealed in 72.4% of male patients, with the prevalence in patients with HT (76.6 vs 61%; p<0.001. Correlations between uric acid levels and some ABPM indicators and GFR were determined.Conclusion. Obtained data suggest the contribution of hyperuricemia in disorders of systemic and renal hemodynamics, leading to the early development of CKD.
YSZ-Reinforced Alumina Multi-Channel Capillary Membranes for Micro-Filtration
Directory of Open Access Journals (Sweden)
Bo Wang
2015-12-01
Full Text Available The combined phase-inversion and sintering method not only produces ceramic hollow fibre membranes with much lower fabrication costs than conventional methods, but these membranes can also be designed to have greatly reduced transport resistances for filtration processes. The bottleneck of this technique is the weak mechanical property of the fibres, due to the small dimensions and the brittle nature of the ceramic materials. In this study, yttrium stabilised zirconia (YSZ reinforced alumina seven-channel capillary microfiltration membranes were prepared with a pore size of ~230 nm and their mechanical property and permeation characteristics were studied. It is found that the addition of YSZ can effectively enhance the mechanical property of the membrane and also increase pure water permeation flux. The Al2O3-YSZ seven-channel capillary membranes could reach a fracture load of 23.4 N and a bending extension of 0.54 mm when being tested with a 6 cm span, to meet the requirements for most industrial microfiltration applications.
YSZ-Reinforced Alumina Multi-Channel Capillary Membranes for Micro-Filtration.
Wang, Bo; Lee, Melanie; Li, Kang
2015-12-30
The combined phase-inversion and sintering method not only produces ceramic hollow fibre membranes with much lower fabrication costs than conventional methods, but these membranes can also be designed to have greatly reduced transport resistances for filtration processes. The bottleneck of this technique is the weak mechanical property of the fibres, due to the small dimensions and the brittle nature of the ceramic materials. In this study, yttrium stabilised zirconia (YSZ) reinforced alumina seven-channel capillary microfiltration membranes were prepared with a pore size of ~230 nm and their mechanical property and permeation characteristics were studied. It is found that the addition of YSZ can effectively enhance the mechanical property of the membrane and also increase pure water permeation flux. The Al₂O₃-YSZ seven-channel capillary membranes could reach a fracture load of 23.4 N and a bending extension of 0.54 mm when being tested with a 6 cm span, to meet the requirements for most industrial microfiltration applications.
Batch cooling crystallization and pressure filtration of sulphathiazole
DEFF Research Database (Denmark)
Häkkinen, Antti; Pöllänen, Kati; Karjalainen, Milja
2005-01-01
Currently there is a great interest in new process analytical approaches to increase the process understanding of pharmaceutical unit operations. In the present study, the influence of the solvent composition on the material properties and, further, on the filtration characteristics, of different...
International Nuclear Information System (INIS)
Kondo, Y.; Kubota, M.
1997-01-01
The filtration characteristics of solids generated in a simulated high level liquid waste (HLLW) were experimentally examined, when the simulated HLLW was processed according to the ordinary way of actual HLLW treatment process. The filtration characteristics of solids depended on the particle size. The phosphomolybdic acid, which was very fine particle with about 0.1 μm diameter, made slurry a 'difficult-to-filter' slurry, if the phosphomolybdic acid content (wt%) to the whole solids in a slurry exceeded 50wt%. On the contrary, the zirconium compounds (zirconium molybdate and zirconium telluride) had positive effect on filtration characteristics because of their relatively large particle size of about 3 to 5 μm. When the zirconium compounds content was above 50 wt%, slurry became a 'easy-to-filter' slurry. A centrifugal sedimentation was discussed as a solid/liquid separation technique for very fine particles such as phosphomolybdic acid. The theoretical feed flow rate corresponded to 0.1 μm diameter particles was about 20 1/h at the centrifugal acceleration of about 8000 G. (author)
Silver Matrix Composites - Structure and Properties
Directory of Open Access Journals (Sweden)
Wieczorek J.
2016-03-01
Full Text Available Phase compositions of composite materials determine their performance as well as physical and mechanical properties. Depending on the type of applied matrix and the kind, amount and morphology of the matrix reinforcement, it is possible to shape the material properties so that they meet specific operational requirements. In the paper, results of investigations on silver alloy matrix composites reinforced with ceramic particles are presented. The investigations enabled evaluation of hardness, tribological and mechanical properties as well as the structure of produced materials. The matrix of composite material was an alloy of silver and aluminium, magnesium and silicon. As the reinforcing phase, 20-60 μm ceramic particles (SiC, SiO2, Al2O3 and Cs were applied. The volume fraction of the reinforcing phase in the composites was 10%. The composites were produced using the liquid phase (casting technology, followed by plastic work (the KOBO method. The mechanical and tribological properties were analysed for plastic work-subjected composites. The mechanical properties were assessed based on a static tensile and hardness tests. The tribological properties were investigated under dry sliding conditions. The analysis of results led to determination of effects of the composite production technology on their performance. Moreover, a relationship between the type of reinforcing phase and the mechanical and tribological properties was established.
Filtration influence in a constant potential X-ray machine peak voltage measurements
Energy Technology Data Exchange (ETDEWEB)
Santos, L.R.; Vivolo, V.; Xavier, M.; Potiens, M.P.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Navarro, M.V.T., E-mail: dossantos.lucasrodrigues@gmail.com [Instituto Federal de Educacao, Ciencia e Tecnologia da Bahia (IFBA), Salvador (Brazil)
2017-09-01
This work shows the peak voltage measurements for several beam filtrations used in diagnostic radiology, using two types of non-invasive detectors; a voltage meter and a high-resolution spectrometer. The technique chosen for the voltage peak measurements with the spectrometer was the endpoint. The results were compared to the measured ones and showed good similarity to the nominal values. However the voltage meter detector used in this work presented errors for heavier filtrations. (author)
Characterization of soluble microbial products and their fouling impacts in membrane bioreactors
Jiang, Tao; Kennedy, Maria Dolores; Schepper, Veerle D.; Nam, Seongnam; Nopens, Ingmar; Vanrolleghem, Peter A.; Amy, Gary L.
2010-01-01
Membrane bioreactor (MBR) fouling is not only influenced by the soluble microbial products (SMP) concentration but by their characteristics. Experiments of separate producing biomass associated products (BAP) and utilization associated products (UAP) allowed the separation of BAP and UAP effects from sludge water (SW). Thus, filtration of individual SMP components and further characterization becomes possible. Unstirred cell filtration was used to study fouling mechanisms and liquid chromatography-organic carbon detection (LC-OCD) and fluorescence excitation-emission matrix (EEM) were used to characterize the foulant. Generally, the SMP exhibiting characteristics of higher molecular weight, greater hydrophilicity and a more reduced state showed a higher retention percentage. However, the higher retention does not always yield higher fouling effects. The UAP filtration showed the highest specific cake resistance and pore blocking resistance attributed to their higher percentage of low molecular weight molecules, although their retention percentage was lower than the SW and BAP filtration. The UAP produced in the cell proliferation phase appeared to have the highest fouling potential. © 2010 American Chemical Society.
Characterization of soluble microbial products and their fouling impacts in membrane bioreactors
Jiang, Tao
2010-09-01
Membrane bioreactor (MBR) fouling is not only influenced by the soluble microbial products (SMP) concentration but by their characteristics. Experiments of separate producing biomass associated products (BAP) and utilization associated products (UAP) allowed the separation of BAP and UAP effects from sludge water (SW). Thus, filtration of individual SMP components and further characterization becomes possible. Unstirred cell filtration was used to study fouling mechanisms and liquid chromatography-organic carbon detection (LC-OCD) and fluorescence excitation-emission matrix (EEM) were used to characterize the foulant. Generally, the SMP exhibiting characteristics of higher molecular weight, greater hydrophilicity and a more reduced state showed a higher retention percentage. However, the higher retention does not always yield higher fouling effects. The UAP filtration showed the highest specific cake resistance and pore blocking resistance attributed to their higher percentage of low molecular weight molecules, although their retention percentage was lower than the SW and BAP filtration. The UAP produced in the cell proliferation phase appeared to have the highest fouling potential. © 2010 American Chemical Society.
Modeling Non-Fickian Transport and Hyperexponential Deposition for Deep Bed Filtration
DEFF Research Database (Denmark)
Yuan, Hao; Shapiro, Alexander
2010-01-01
An integral model of the deep bed filtration process has been developed. It incorporates pore and particle size distributions, as well as the particle residence time distribution in the framework of the continuous time random walk theory. Numerical modeling is carried out to study the factors...... influencing breakthrough curves and deposition profiles for the deep bed filtration systems. Results are compared with a large set of experimental observations. Our findings show that highly dispersed breakthrough curves, e.g. those with early arrivals and large ending tails, correspond to large dispersion...
Energy Technology Data Exchange (ETDEWEB)
Gougeon, R
1994-09-26
In most previous studies of aerosol filtration, attention is focused on the maximum penetrating particle size region where the predominant mechanisms for collection are brownian diffusion and interception. In contrary the inertial regime remains poorly understood. Therefore, the aim of this study was to improve understanding of the behaviour of fibrous filters with liquid aerosols ar high frontal velocities both in the stationary and nonstationary filtration. Stationary filtration is first investigated. Experiments are done with special filters called `formettes` which have well defined structural characteristics. Precise results obtained with those filters allow us to select two relations quoted in the literature in order to describe the diffusion and the interception and to determine an empirical correlation describing the inertial impaction. Then this correlation with an industrial filter. In the second part, the evolution of the performances of fibrous filters loaded with liquid aerosols is studied experimentally and theoretically. We show that, in the inertial regime the filter efficiency first decreases and then increases rapidly with the loading rate. This increase is particularly important at high frontal velocities and with big particles. Macroscopic observations of high loaded filters show that the liquid is located in the fibre`s intersections to form big flat surfaces. A tentative of describing the evolution of the filter efficiency in modifying our stationary filtration model in order to take into account those liquid surfaces in the filter gives encouraging results. (authors). 92 refs., 93 figs., 11 tabs., 4 appends.
Chuang, Hsiao-Chi; Ho, Kin-Fai; Lin, Lian-Yu; Chang, Ta-Yuan; Hong, Gui-Bing; Ma, Chi-Ming; Liu, I-Jung; Chuang, Kai-Jen
2017-09-01
The association of short-term air pollution filtration with cardiovascular health has been documented. However, the effect of long-term indoor air conditioner filtration on the association between air pollution and cardiovascular health is still unclear. We recruited 200 homemakers from Taipei and randomly assigned 100 of them to air filtration or control intervention; six home visits were conducted per year from 2013 to 2014. The participants under air filtration intervention during 2013 were reassigned to control intervention in 2014. The air pollution measurements consisted of particulate matter less than or equal to 2.5μm in diameter (PM 2.5 ) and total volatile organic compounds (VOCs); blood pressure was monitored for each participant during each visit. The following morning, blood samples were collected after air pollution monitoring. The blood samples were used to analyze biological markers, including high sensitivity-C-reactive protein (hs-CRP), 8-hydroxy-2'-deoxyguanosine (8-OHdG) and fibrinogen. Household information, including cleaning, cooking, and air conditioning, was collected by a questionnaire. Mixed-effects models were used to investigate the associations among air pollution measurements, blood pressure and biological markers. The results showed that increased levels of PM 2.5 and total VOCs were associated with increased hs-CRP, 8-OHdG and blood pressure. The health variables were higher among participants in the control intervention phase than among those in the air filtration intervention phase. We concluded that air pollution exposure was associated with systemic inflammation, oxidative stress and elevated blood pressure. The long-term filtration of air pollution with an air conditioner filter was associated with cardiovascular health of adults. Copyright © 2017 Elsevier Ltd. All rights reserved.
Agui, Juan H.; Vijayakumar, R.; Perry, Jay L.; Frederick, Kenneth R.; Mccormick, Robert M.
2017-01-01
Human deep space exploration missions will require advances in long-life, low maintenance airborne particulate matter filtration technology. As one of the National Aeronautics and Space Administrations (NASA) developments in this area, a prototype of a new regenerable, multi-stage particulate matter filtration technology was tested in an International Space Station (ISS) module simulation facility. As previously reported, the key features of the filter system include inertial and media filtration with regeneration and in-place media replacement techniques. The testing facility can simulate aspects of the cabin environment aboard the ISS and contains flight-like cabin ventilation system components. The filtration technology test article was installed at the inlet of the central ventilation system duct and instrumented to provide performance data under nominal flow conditions. In-place regeneration operations were also evaluated. The real-time data included pressure drop across the filter stages, process air flow rate, ambient pressure, humidity and temperature. In addition, two video cameras positioned at the filtration technology test articles inlet and outlet were used to capture the mechanical performance of the filter media indexing operation under varying air flow rates. Recent test results are presented and future design recommendations are discussed.
Varanasi, Rao; Mesawich, Michael; Connor, Patrick; Johnson, Lawrence
2017-03-01
Two versions of a specific 2nm rated filter containing filtration medium and all other components produced from high density polyethylene (HDPE), one subjected to standard cleaning, the other to specialized ultra-cleaning, were evaluated in terms of their cleanliness characteristics, and also defectivity of wafers processed with photoresist filtered through each. With respect to inherent cleanliness, the ultraclean version exhibited a 70% reduction in total metal extractables and 90% reduction in organics extractables compared to the standard clean version. In terms of particulate cleanliness, the ultraclean version achieved stability of effluent particles 30nm and larger in about half the time required by the standard clean version, also exhibiting effluent levels at stability almost 90% lower. In evaluating defectivity of blanket wafers processed with photoresist filtered through either version, initial defect density while using the ultraclean version was about half that observed when the standard clean version was in service, with defectivity also falling more rapidly during subsequent usage of the ultraclean version compared to the standard clean version. Similar behavior was observed for patterned wafers, where the enhanced defect reduction was primarily of bridging defects. The filter evaluation and actual process-oriented results demonstrate the extreme value in using filtration designed possessing the optimal intrinsic characteristics, but with further improvements possible through enhanced cleaning processes
El-Shenawy, Z; Mansour, M A; El-Behrawi, S
1978-01-01
The highly pathogenic isolate stimulated the emergence of the squash seedlings first, caused, however, the highest death rate of the seedlings finally. Fusarium isolates and their culture filtrates inhibited the respiratory rate of squash plants significantly. However, F. oxysporum isolates inhibited respiration more than F. solani isolates. Seasonal changes of respiration decline show that the respiratory rate decreased with plant growth in the case of infested soil and of plants injected with culture filtrates. However, spraying Fusarium culture filtrates on the foliage gave opposite results when the plants grew older. Fusarium solani isolates decreased nitrogen content of squash stems and leaves, while F. oxysporum isolates gave reverse results. Injecting Fusarium culture filtrate into the plant decreased nitrogen content of both stems and leaves, while spraying the foliage with the filtrates increased nitrogen content more than that of the control. Phosphorus content of the stems of squash plants, sown in infested soil, was less than in the control when the plants were treated with F. solani and higher when they were treated with F. oxysporum isolates. On the other hand, the phosphorus content of squash leaves was higher than in the control. In the case of injected plants, however, the phosphorus content in stems and leaves was equal to that of the control or less, and with sprayed plants it was higher than in the control. Infesting the soil with Fusarium isolates and spraying the foliage with their culture filtrates increased potassium content of squash stems and leaves, while injecting the filtrates into the plants decreased potassium content of both stems and leaves.
Directory of Open Access Journals (Sweden)
Asłanowicz M.
2007-01-01
Full Text Available Filtration guarantees castings characterised by high quality and free from any non-metallic inclusions, which are formed at the stage of melting and pouring of liquid metal. This article discusses the problem of the effectiveness of filtration process taking as an example heat-resistant cast steel poured into ceramic moulds. In investigations, foamed zircon filters made by FerroTerm Sp. z o.o. The effectiveness of filtration was described and examined using the results of metallographic examinations, including macro- and micro-structure examinations of metal and of cast metal/ceramic filter interface, and measurements of the content of non-metallic inclusions. The methods of investigations were presented, the obtained results were described, and relevant conclusions were drawn, all of them unmistakably indicating a very beneficial effect that filtration has on molten metal quality. Łódź, Poland, were used.
Graphite matrix materials for nuclear waste isolation
International Nuclear Information System (INIS)
Morgan, W.C.
1981-06-01
At low temperatures, graphites are chemically inert to all but the strongest oxidizing agents. The raw materials from which artificial graphites are produced are plentiful and inexpensive. Morover, the physical properties of artificial graphites can be varied over a very wide range by the choice of raw materials and manufacturing processes. Manufacturing processes are reviewed herein, with primary emphasis on those processes which might be used to produce a graphite matrix for the waste forms. The approach, recommended herein, involves the low-temperature compaction of a finely ground powder produced from graphitized petroleum coke. The resultant compacts should have fairly good strength, low permeability to both liquids and gases, and anisotropic physical properties. In particular, the anisotropy of the thermal expansion coefficients and the thermal conductivity should be advantageous for this application. With two possible exceptions, the graphite matrix appears to be superior to the metal alloy matrices which have been recommended in prior studies. The two possible exceptions are the requirements on strength and permeability; both requirements will be strongly influenced by the containment design, including the choice of materials and the waste form, of the multibarrier package. Various methods for increasing the strength, and for decreasing the permeability of the matrix, are reviewed and discussed in the sections in Incorporation of Other Materials and Elimination of Porosity. However, it would be premature to recommend a particular process until the overall multi-barrier design is better defined. It is recommended that increased emphasis be placed on further development of the low-temperature compacted graphite matrix concept
Sorption of polycyclic aromatic hydrocarbons (PAH) during the filtration of water samples
International Nuclear Information System (INIS)
Herbert, M.; Schueth, C.; Pyka, W.
1992-01-01
Filtration experiments were preformed for three selected polycyclic aromatic hydrocarbons (PAH-Fluorene, Fluoranthene and Benz(b)-fluoranthene) dissolved in water by varying filter materials, filter-pore sizes and filter equipment. The rate of recovery of PAH depended on the materials and methods applied. Organic filter materials showed a by far stronger sorption than inorganic materials. The losses for organic filters increased up to 100% with decreasing pore-size. The percentage loss was observed to increase with increasing octanol-water distribution coefficient (K OW ). Saturation tests revealed that the amount of water, necessary to saturate the filtration apparatus with and without filter-paper, also increased with the K OW . For BBF several liters would be necessary for saturation. It can be concluded, that the filtration of water samples, analysed for PAH, can lead to considerable errors in the analytical results, particularly for those PAH with log K OW larger than 5. (orig.)
Filtration of droplets in the nose of the rabbit
Energy Technology Data Exchange (ETDEWEB)
Davies, C N
1946-01-01
Optical measurement was done on oil cloud sedimentation before and after passing through nose and out tracheal cannula. The filtering unit which also provides most resistance to flow is maximal turbinates. Nasal cavity is more complex than in man or some other animals, so filtration may be different. Calculation of particle inertia and filter channel width shows that particles > 7 ..mu..m would impact on curves or projections. Particles less than 1.5 ..mu..m should penetrate freely, but low molecular weight gases would be caught by diffusion. The higher the flow, the better the filtration (inertial settling). Broadly summarizing, at ordinary flow rates and nasal resistances, essentially all drops > 7 ..mu..m will be removed. About 50% of 3-..mu.. drops will be removed. < 1.5-..mu..m drops will penetrate.
Ozone and membrane filtration based strategies for the treatment of cork processing wastewaters
Energy Technology Data Exchange (ETDEWEB)
Benitez, F. Javier [Departamento de Ingenieria Quimica, Universidad de Extremadura, 06071 Badajoz (Spain)], E-mail: javben@unex.es; Acero, Juan L.; Leal, Ana I.; Real, Francisco J. [Departamento de Ingenieria Quimica, Universidad de Extremadura, 06071 Badajoz (Spain)
2008-03-21
The degradation of the pollutant organic matter present in the cork processing wastewater was studied by combining chemical treatments, which used ozone and some Advanced Oxidation Processes, and membrane filtration procedures. Two schemes were conducted: firstly, a single ozonation stage followed by an UF stage; and secondly, a membrane filtration stage, using different MF and UF membranes, followed by a chemical oxidation stage, where ozone, UV radiation, and the AOPs constituted by ozone plus UV radiation and ozone plus hydrogen peroxide, were used. The membrane filtration stages were carried out in tangential filtration laboratory equipment, and the membranes used were two MF membranes with pores sizes of 0.65 and 0.1 {mu}m, and three UF membranes with molecular weights cut-off of 300, 10, and 5 kDa. The effectiveness of the different stages (conversions in the chemical procedures and rejection coefficients in the membrane processes) were evaluated in terms of several parameters which measure the global pollutant content of the wastewater: COD, absorbance at 254 nm, tannins content, color, and ellagic acid. In the ozonation/UF combined process the following removals were achieved: 100% for ellagic acid and color, 90% for absorbance at 254 nm, more than 80% for tannins, and 42-57% for COD reduction. In the filtration/chemical oxidation combined process, 100% elimination of ellagic acid, more than 90% elimination in color, absorbance at 254 nm and tannins, and removal higher than 80% in COD were reached, which indicates a greater purification power of this combination.
Fibre-matrix bond strength studies of glass, ceramic, and metal matrix composites
Grande, D. H.; Mandell, J. F.; Hong, K. C. C.
1988-01-01
An indentation test technique for compressively loading the ends of individual fibers to produce debonding has been applied to metal, glass, and glass-ceramic matrix composites; bond strength values at debond initiation are calculated using a finite-element model. Results are correlated with composite longitudinal and interlaminar shear behavior for carbon and Nicalon fiber-reinforced glasses and glass-ceramics including the effects of matrix modifications, processing conditions, and high-temperature oxidation embrittlement. The data indicate that significant bonding to improve off-axis and shear properties can be tolerated before the longitudinal behavior becomes brittle. Residual stress and other mechanical bonding effects are important, but improved analyses and multiaxial interfacial failure criteria are needed to adequately interpret bond strength data in terms of composite performance.
Novel Particulate Air-Filtration Media: Market Survey
2013-02-01
larger and more efficient filter designs similar to those being considered for future integrated respirator/helmet systems. To avoid eliminating ...including nonwoven, woven, and electret and combinations of media. Some of the manufacturers identified themselves as specializing in biofiltration or...Three Millipore products were identified. The 0.2 µm hydrophobic Aervent PTFE membrane62 is used for the sterile filtration of gases . Aerex
Dodson, Jennifer L; Jerry-Fluker, Judith V; Ng, Derek K; Moxey-Mims, Marva; Schwartz, George J; Dharnidharka, Vikas R; Warady, Bradley A; Furth, Susan L
2011-10-01
Urological disorders are the most common cause of pediatric chronic kidney disease. We determined the characteristics of children with urological disorders and assessed the agreement between the newly developed bedside glomerular filtration rate estimating formula with measured glomerular filtration rate in 586 patients in the Chronic Kidney Disease in Children study. The Chronic Kidney Disease in Children study is a prospective, observational cohort of children recruited from 48 sites in the United States and Canada. Eligibility requirements include age 1 to 16 years and estimated glomerular filtration rate by original Schwartz formula 30 to 90 ml/min/1.73 m(2). Baseline demographics, clinical variables and glomerular filtration rate were assessed. Bland-Altman analysis was conducted to assess agreement between estimated and measured glomerular filtration rates. Of the 586 participants with at least 1 glomerular filtration rate measurement 348 (59%) had an underlying urological diagnosis (obstructive uropathy in 118, aplastic/hypoplastic/dysplastic kidneys in 104, reflux in 87 and other condition in 39). Among these patients median age was 9 years, duration of chronic kidney disease was 7 years and age at first visit with a urologist was less than 1 year. Of the patients 67% were male, 67% were white and 21% had a low birth weight. Median height was in the 24th percentile. Median glomerular filtration rate as measured by iohexol plasma disappearance was 44.8 ml/min/1.73 m(2). Median glomerular filtration rate as estimated by the Chronic Kidney Disease in Children bedside equation was 44.3 ml/min/1.73 m(2) (bias = -0.5, 95% CI -1.7 to 0.7, p = 0.44). Underlying urological causes of chronic kidney disease were present in 59% of study participants. These children were diagnosed early in life, and many had low birth weight and growth delay. There is good agreement between the newly developed Chronic Kidney Disease in Children estimating equations and measured
Effect of Twisting and Stretching on Magneto Resistance and Spin Filtration in CNTs
Directory of Open Access Journals (Sweden)
Anil Kumar Singh
2017-08-01
Full Text Available Spin-dependent quantum transport properties in twisted carbon nanotube and stretched carbon nanotube are calculated using density functional theory (DFT and non-equilibrium green’s function (NEGF formulation. Twisting and stretching have no effect on spin transport in CNTs at low bias voltages. However, at high bias voltages the effects are significant. Stretching restricts any spin-up current in antiparallel configuration (APC, which results in higher magneto resistance (MR. Twisting allows spin-up current almost equivalent to the pristine CNT case, resulting in lower MR. High spin filtration is observed in PC and APC for pristine, stretched and twisted structures at all applied voltages. In APC, at low voltages spin filtration in stretched CNT is higher than in pristine and twisted ones, with pristine giving a higher spin filtration than twisted CNT.
Initial testing of electrospun nanofibre filters in water filtration ...
African Journals Online (AJOL)
2009-11-17
Nov 17, 2009 ... for water filtration applications, but that further improvements are necessary before these membranes can be ... power supply, and a grounded collector. .... nanofibres so that the pore size increases and bacteria leak through ...
Photogeneration of heptacene in a polymer matrix.
Mondal, Rajib; Shah, Bipin K; Neckers, Douglas C
2006-08-02
Heptacene (1) was generated by the photodecarbonylation of 7,16-dihydro-7,16-ethanoheptacene-19,20-dione (2) in a polymer matrix using a UV-LED lamp (395 +/- 25 nm). Compound 1 showed a long wavelength absorption band extending from 600 to 825 nm (lambdamax approximately 760 nm) and was found to be stable up to 4 h in the polymer matrix. However, irradiation of a solution of 2 in toluene produced only oxygen adducts.
Diatomite releases silica during spirit filtration
Gómez Benítez, Juan; Gil Montero, María Luisa Almoraima; De la Rosa Fox, Nicolas; Alguacil, Marcos
2014-01-01
The purpose of this study was to ascertain whether diatomite is an inert filter aid during spirit filtration. Surely, any compound with a negative effect on the spirit composition or the consumer’s health could be dissolved. In this study different diatomites were treated with 36% vol. ethanol/water mixtures and the amounts and structures of the extracted compounds were determined. Furthermore, Brandy de Jerez was diatomite- and membrane-filtered at different temperatures and the silicon cont...
Directory of Open Access Journals (Sweden)
Young Chon Choi
2006-06-01
Full Text Available Objectives : This study was conducted to carry out Purification of Melittin and other peptide components from Bee Venom using gel filtration chromatography and propionic acid/urea polyacrylamide gel electrophoresis Methods : Melittin and other peptide components were separated from bee venom by using gel filtration chromatography on Sephadex G-50 column in 0.05M ammonium acetate buffer. Results : Melittin and other peptide components were separated from bee venom by using gel filtration chromatography on Sephadex G-50 column in 0.05M ammonium acetate buffer. The fractions obtained from gel filtration chromatography was analyzed by using SDS-PAGE and propionic acid/urea polyacrylamide gel electrophoresis. The melittin obtained from the gel filtration contained residual amount of phospholipase A2 and a protein with molecular weight of 6,000. The contaminating proteins were removed by the second gel filtration chromatography. Conclusion : Gel filtration chromatography and propionic acid/urea polyacrylamide gel electrophoresis are useful to separate peptide components including melittin from bee venom.
A stochastic model for filtration of particulate suspensions with incomplete pore plugging
DEFF Research Database (Denmark)
Shapiro, Alexander; Santos, A; Bedrikovetsky, P. G.
2007-01-01
. A closed system of governing stochastic equations determines the evolution of size distributions for suspended particles and pores. Its averaging results in the closed system of hydrodynamic equations accounting for permeability and porosity reduction due to plugging. The problem of deep bed filtration...... of a single particle size suspension through a single pore size medium where a pore can be completely plugged by two particles allows for an exact analytical solution. The phenomenological deep bed filtration model follows from the analytical solution....
Simultaneous multielement analysis of zirconium alloys by chlorination separation of matrix/ICP-AES
International Nuclear Information System (INIS)
Kato, Kaneharu
1990-01-01
An analytical method combined chlorination separation of matrix with ICP-AES has been developed for reactor grade Zr alloys (Zircaloy-2). A sample (1 g) is taken into a Pt boat and chlorinated with HCl gas of 100 ml/min in a glass reaction tube at ca. 330degC. Matrix Zr of the sample is volatilized and separated as ZrCl 4 . The analytic elements remaining quantitatively as chlorination residue are dissolved in a mixture of mineral acids (6 M HCl 3 ml+conc. HNO 3 0.5 ml+conc. H 2 SO 4 0.2 ml) and diluted to 20 ml with distilled water after filtration. ICP-AES was used for simultaneous multielement determination using a calibration curve method. The present method has the following advantages: simple sample preparation procedure; applicability to any form of samples to determine multielements; simple ICP-AES calibration procedure. This method was successfully applied to the determination of Fe, Ni, Cu, Co, Mn and Pb in the Zr alloys of JAERI CRM's and NBS SRM's. (author)
Removal of waterborne microorganisms by filtration using clay-polymer complexes.
Undabeytia, Tomas; Posada, Rosa; Nir, Shlomo; Galindo, Irene; Laiz, Leonila; Saiz-Jimenez, Cesareo; Morillo, Esmeralda
2014-08-30
Clay-polymer composites were designed for use in filtration processes for disinfection during the course of water purification. The composites were formed by sorption of polymers based on starch modified with quaternary ammonium ethers onto the negatively charged clay mineral bentonite. The performance of the clay-polymer complexes in removal of bacteria was strongly dependent on the conformation adopted by the polycation on the clay surface, the charge density of the polycation itself and the ratio between the concentrations of clay and polymer used during the sorption process. The antimicrobial effect exerted by the clay-polymer system was due to the cationic monomers adsorbed on the clay surface, which resulted in a positive surface potential of the complexes and charge reversal. Clay-polymer complexes were more toxic to bacteria than the polymers alone. Filtration employing our optimal clay-polymer composite yielded 100% removal of bacteria after the passage of 3L, whereas an equivalent filter with granular activated carbon (GAC) hardly yielded removal of bacteria after 0.5L. Regeneration of clay-polymer complexes saturated with bacteria was demonstrated. Modeling of the filtration processes permitted to optimize the design of filters and estimation of experimental conditions for purifying large water volumes in short periods. Copyright © 2014 Elsevier B.V. All rights reserved.
Evaluation of multistage filtration to reduce sand filter exhaust activity
International Nuclear Information System (INIS)
Zippler, D.B.
1975-01-01
Air from the Savannah River Plant Fuel Reprocessing facilities is filtered through deep bed sand filters consisting of 8 1 / 2 feet of gravel and sand. These filters have performed satisfactorily for the past 18 years in maintaining radioactive release levels to a minimum. The apparent filter efficiency has been determined for many years by measurements of the quantity of radioactivity in the air stream before and after the filter. Such tests have indicated efficiencies of 99.9 percent or better. Even with sand filter efficiency approaching a single stage HEPA filter, new emphasis on further reduction in release of plutonium activity to the environment prompted a study to determine what value backup HEPA filtration could provide. To evaluate the specific effect additional HEPA filtration would have on the removal of Pu from the existing sand filter exhaust stream, a test was conducted by passing a sidestream of sand-filtered air through a standard 24 x 24 x 11 1 / 2 in. HEPA filter. Isokinetic air samples were withdrawn upstream and downstream of the HEPA filter and counted for alpha activity. Efficiency calculations indicated that backup HEPA filtration could be expected to provide an additional 99 percent removal of the Pu activity from the present sand-filter exhaust. (U.S.)
Lanthanides(3)/ actinides (3) separation by nano-filtration-complexation in aqueous medium
International Nuclear Information System (INIS)
Chitry, F.; Pellet-Rostaing, S.; Gozzi, C.; Lemaire, M.; Guy, A.; Foos, J.
2000-01-01
Lanthanides(III)/actinides(III) separation is a major research subject in matter of treatment of high activity liquid effluents. Liquid-liquid extraction actually gives the best results for this separation. In order to demonstrate that nano-filtration (NF) is a valuable alternative to liquid-liquid extraction, we tried to separate different lanthanides(III) with a nano-filtration process combined with a selective complexation step. At first DTPA (diethylene-triamine-pentaacetic acid) combined with a Sepa MG-17 (Osmonics) gave a 95% retention of Gd 3+ and a 50% retention of La 3+ . Then new hydrosoluble and more selective ligands derived from DTPA were synthesized. One of them combined with a Sepa MG-17 membrane allowed a 87% retention of Gd 3+ and a 5% retention of La 3+ . The same nano-filtration-complexation system was experimented with an equimolar aqueous solution of Gd 3+ , Pr 3+ and La 3+ . Other experiments in the field of actinides(III)/lanthanides(III) separation were also performed. (authors)
Aspergillus niger produced a proteinaceous hemolysin, nigerlysinTM when incubated on sheep's blood agar at both 23° C and 37°C. Nigerlysin was purified from tryptic soy broth culture filtrate. Purified nigerlysin has a molecular weight of approximately 72 kDa, with an...
Riverbed Clogging and Sustainability of Riverbank Filtration
Directory of Open Access Journals (Sweden)
Thomas Grischek
2016-12-01
Full Text Available Clogging refers to a reduction of riverbed hydraulic conductivity. Due to difficulties in determining the thickness of the clogging layer, the leakage coefficient (L is introduced and used to quantify the recoverable portion of bank filtrate. L was determined at several riverbank filtration (RBF sites in field tests and using an analytical solution. Results were compared with data from similar experiments in the early 1970s and 1991–1993. In the 1980s, severe river water pollution in conjunction with high water abstraction led to partly unsaturated conditions beneath the riverbed. A leakage coefficient L of 5 × 10−7 s−1 was determined. After water quality improvement, L increased to 1–1.5 × 10−6 s−1. An alternative, cost and time efficient method is presented to estimate accurate leakage coefficients. The analytical solution is based on groundwater level monitoring data from observation wells next to the river, which can later feed into numerical models. The analytical approach was able to reflect long-term changes as well as seasonal variations. Recommendations for its application are given based on experience.
Experience with high-temperature filtration of incinerator flue gases
International Nuclear Information System (INIS)
Carpentier, S.; de Tassigny, C.
1990-01-01
It is always preferable to filter incinerator flue gases as close as possible to their origin, i.e. in a high-temperature zone, and means must be provided to destroy the other organic parts of the flyash resulting from these gases by in-filter combustion. The filter also traps a mineral part of the flyash, which eventually causes clogging and requires replacement or regeneration. Such filtration systems are available and can be operated on an industrial scale. They include candles made of micro-expanded refractory alloys supporting filtering media, porous ceramic candles and other devices. Research and subsequent pilot facility testing have enabled development of alumina fiber filter cartridges that offer more advantages than other equipment employed to date. Specifically, these advantages are: ultralight weight, which enables construction of systems that are relatively unaffected by creep and high-temperature deformations; excellent refractory qualities, which permit a use above 1000 degrees C; insensitivity to thermal shocks and in-situ carbon fines combustion capability; anti-acid quality of the material, which enables high-temperature filtration of acidic flue gases (chlorine and hydrochloric acid, SO x , etc.); low initial pressure drop of the cartridges; dimensional stability of the cartridges, which can be machined to a given tolerance with specific contours after casting and drying. This paper reports the results obtained during the last filtration system test campaign. Details are given for operating conditions, grain sizes and real-time monitoring of various parameters
Focal adhesions and cell-matrix interactions
DEFF Research Database (Denmark)
Woods, A; Couchman, J R
1988-01-01
Focal adhesions are areas of cell surfaces where specializations of cytoskeletal, membrane and extracellular components combine to produce stable cell-matrix interactions. The morphology of these adhesions and the components identified in them are discussed together with possible mechanisms...
International Nuclear Information System (INIS)
Cunha, R.S.; Goulart, A.S.; Flores, M.R.; Saibt, M.
2017-01-01
Gaseous rejects generated in the production of FDG- 18 F are produced mainly during the irradiation of the enriched water (H2O 18 ) within the niobium / target body at the cyclotron accelerator and during the process of FDG- 18 F synthesis in the synthesizer modules within the cell hot. In order to reduce the levels of gaseous effluents emitted, activated carbon filters are used in the exhaust system. These have the ability to adsorb the 18 F gaseous molecules generated in the synthesis. This work aims to quantify the efficiency of the activated carbon filters in relation to the dose rate before and after the passage of the gases through the filtration system. To quantify the values in the exhaust system, two radiation detectors were used, in the equivalent dose rate mode in μSv/h. To evaluate the values obtained, graphs of the levels before and after the filtration system were generated. These graphs were compared to each other, relating the values found. The generated graphs showed a high efficiency in the filtration of gaseous effluents. Several dose rate peaks are presented in the exhaust system during FDG- 18 F synthesis, however after the passage of the gases through the filters these peaks become values very close to the Background values
Clinical use of estimated glomerular filtration rate for evaluation of kidney function
DEFF Research Database (Denmark)
Broberg, Bo; Lindhardt, Morten; Rossing, Peter
2013-01-01
is a significant predictor for cardiovascular disease and may along with classical cardiovascular risk factors add useful information to risk estimation. Several cautions need to be taken into account, e.g. rapid changes in kidney function, dialysis, high age, obesity, underweight and diverging and unanticipated......Estimating glomerular filtration rate by the Modification of Diet in Renal Disease or Chronic Kidney Disease Epidemiology Collaboration formulas gives a reasonable estimate of kidney function for e.g. classification of chronic kidney disease. Additionally the estimated glomerular filtration rate...
Molecular events in matrix protein metabolism in the aging kidney
Sataranatarajan, Kavithalakshmi; Feliers, Denis; Mariappan, Meenalakshmi M.; Lee, Hak Joo; Lee, Myung Ja; Day, Robert T.; Yalamanchili, Hima Bindu; Choudhury, Goutam G.; Barnes, Jeffrey L.; Van Remmen, Holly; Richardson, Arlan; Kasinath, Balakuntalam S.
2018-01-01
Summary We explored molecular events associated with aging-induced matrix changes in the kidney. C57BL6 mice were studied in youth, middle age, and old age. Albuminuria and serum cystatin C level (an index of glomerular filtration) increased with aging. Renal hypertrophy was evident in middle-aged and old mice and was associated with glomerulomegaly and increase in mesangial fraction occupied by extracellular matrix. Content of collagen types I and III and fibronectin was increased with aging; increment in their mRNA varied with the phase of aging. The content of ZEB1 and ZEB2, collagen type I transcription inhibitors, and their binding to the collagen type Iα2 promoter by ChIP assay also showed age-phase-specific changes. Lack of increase in mRNA and data from polysome assay suggested decreased degradation as a potential mechanism for kidney collagen type I accumulation in the middle-aged mice. These changes occurred with increment in TGFβ mRNA and protein and activation of its SMAD3 pathway; SMAD3 binding to the collagen type Iα2 promoter was also increased. TGFβ-regulated microRNAs (miRs) exhibited selective regulation. The renal cortical content of miR-21 and miR-200c, but not miR-192, miR-200a, or miR-200b, was increased with aging. Increased miR-21 and miR-200c contents were associated with reduced expression of their targets, Sprouty-1 and ZEB2, respectively. These data show that aging is associated with complex molecular events in the kidney that are already evident in the middle age and progress to old age. Agephase-specific regulation of matrix protein synthesis occurs and involves matrix protein-specific transcriptional and post-transcriptional mechanisms. PMID:23020145
Inverse Problem of Air Filtration of Nanoparticles: Optimal Quality Factors of Fibrous Filters
Directory of Open Access Journals (Sweden)
Dahua Shou
2015-01-01
Full Text Available Application of nanofibers has become an emerging approach to enhance filtration efficiency, but questions arise about the decrease in Quality factor (QF for certain particles due to the rapidly increasing pressure drop. In this paper, we theoretically investigate the QF of dual-layer filters for filtration of monodisperse and polydisperse nanoparticles. The inverse problem of air filtration, as defined in this work, consists in determining the optimal construction of the two-layer fibrous filter with the maximum QF. In comparison to a single-layer substrate, improved QF values for dual-layer filters are found when a second layer with proper structural parameters is added. The influences of solidity, fiber diameter, filter thickness, face velocity, and particle size on the optimization of QF are studied. The maximum QF values for realistic polydisperse particles with a lognormal size distribution are also found. Furthermore, we propose a modified QF (MQF accounting for the effects of energy cost and flow velocity, which are significant in certain operations. The optimal MQF of the dual-layer filter is found to be over twice that of the first layer. This work provides a quick tool for designing and optimizing fibrous structures with better performance for the air filtration of specific nanoparticles.
Novel water filtration of saline water in the outermost layer of mangrove roots.
Kim, Kiwoong; Seo, Eunseok; Chang, Suk-Kyu; Park, Tae Jung; Lee, Sang Joon
2016-02-05
The scarcity of fresh water is a global challenge faced at present. Several desalination methods have been suggested to secure fresh water from sea water. However, conventional methods suffer from technical limitations, such as high power consumption, expensive operating costs, and limited system durability. In this study, we examined the feasibility of using halophytes as a novel technology of desalinating high-concentration saline water for long periods. This study investigated the biophysical characteristics of sea water filtration in the roots of the mangrove Rhizophora stylosa from a plant hydrodynamic point of view. R. stylosa can grow even in saline water, and the salt level in its roots is regulated within a certain threshold value through filtration. The root possesses a hierarchical, triple layered pore structure in the epidermis, and most Na(+) ions are filtered at the first sublayer of the outermost layer. The high blockage of Na(+) ions is attributed to the high surface zeta potential of the first layer. The second layer, which is composed of macroporous structures, also facilitates Na(+) ion filtration. This study provides insights into the mechanism underlying water filtration through halophyte roots and serves as a basis for the development of a novel bio-inspired desalination method.
Polymer matrix electroluminescent materials and devices
Marrocco, III, Matthew L.; Motamedi, Farshad J [Claremont, CA; Abdelrazzaq, Feras Bashir [Covina, CA; Abdelrazzaq, legal representative, Bashir Twfiq
2012-06-26
Photoluminescent and electroluminescent compositions are provided which comprise a matrix comprising aromatic repeat units covalently coordinated to a phosphorescent or luminescent metal ion or metal ion complexes. Methods for producing such compositions, and the electroluminescent devices formed therefrom, are also disclosed.
Aerosol filtration with metallic fibrous filters
International Nuclear Information System (INIS)
Klein, M.; Goossens, W.R.A.
1983-01-01
The filtration efficiency of stainless steel fibrous filters (BEKIPOR porous mats and sintered webs) is determined using submicronic monodisperse polystyrene aerosols. Lasers spectrometers are used for the aerosol measurements. The parameters varied are the fiber diameter, the number of layers, the aerosol diameter and the superficial velocity. Two selected types of filters are tested with polydisperse methylene blue aerosols to determine the effect of bed loading on the filter performance and to test washing techniques for the regeneration of the filter
Strategy BMT Al-Ittihad Using Matrix IE, Matrix SWOT 8K, Matrix SPACE and Matrix TWOS
Directory of Open Access Journals (Sweden)
Nofrizal Nofrizal
2018-03-01
Full Text Available This research aims to formulate and select BMT Al-Ittihad Rumbai strategy to face the changing of business environment both from internal environment such as organization resources, finance, member and external business such as competitor, economy, politics and others. This research method used Analysis of EFAS, IFAS, IE Matrix, SWOT-8K Matrix, SPACE Matrix and TWOS Matrix. our hope from this research it can assist BMT Al-Ittihad in formulating and selecting strategies for the sustainability of BMT Al-Ittihad in the future. The sample in this research is using purposive sampling technique that is the manager and leader of BMT Al-IttihadRumbaiPekanbaru. The result of this research shows that the position of BMT Al-Ittihad using IE Matrix, SWOT-8K Matrix and SPACE Matrix is in growth position, stabilization and aggressive. The choice of strategy after using TWOS Matrix is market penetration, market development, vertical integration, horizontal integration, and stabilization (careful.
Lent, P.L.E.M. van; Figdor, C.G.; Barrera Rico, P.; Ginkel, K. van; Sloetjes, A.W.; Berg, W.B. van den; Torensma, R.
2003-01-01
OBJECTIVE: To determine whether matrix metalloproteinase (MMP)-producing inflammatory macrophages in the synovium of rheumatoid arthritis (RA) patients express the novel dendritic cell (DC)-specific C-type lectin DC-SIGN and whether this expression is associated with the presence of naive T cells
Fukuda, Makoto; Yoshimura, Kengo; Namekawa, Koki; Sakai, Kiyotaka
2017-06-01
The objective of the present study is to evaluate the effect of filtration coefficient and internal filtration on dialysis fluid flow and mass transfer coefficient in dialyzers using dimensionless mass transfer correlation equations. Aqueous solution of vitamin B 12 clearances were obtained for REXEED-15L as a low flux dialyzer, and APS-15EA and APS-15UA as high flux dialyzers. All the other design specifications were identical for these dialyzers except for filtration coefficient. The overall mass transfer coefficient was calculated, moreover, the exponents of Reynolds number (Re) and film mass transfer coefficient of the dialysis-side fluid (k D ) for each flow rate were derived from the Wilson plot and dimensionless correlation equation. The exponents of Re were 0.4 for the low flux dialyzer whereas 0.5 for the high flux dialyzers. Dialysis fluid of the low flux dialyzer was close to laminar flow because of its low filtration coefficient. On the other hand, dialysis fluid of the high flux dialyzers was assumed to be orthogonal flow. Higher filtration coefficient was associated with higher k D influenced by mass transfer rate through diffusion and internal filtration. Higher filtration coefficient of dialyzers and internal filtration affect orthogonal flow of dialysis fluid.
You, Young-Hyun; Yoon, Hyeokjun; Kang, Sang-Mo; Woo, Ju-Ri; Choo, Yeon-Sik; Lee, In-Jung; Shin, Jae-Ho; Kim, Jong-Guk
2013-07-01
Fourteen endophytic fungi with different colony morphologies were isolated from the roots of Calystegia soldanella. Endophytic fungi isolated from C. soldanella were identified by internal transcribed spacer (ITS) region. To verify plant growth promotion (PGP), culture filtrates of isolated endophytic fungi were treated in Waito-c rice (WR) and C. soldanella seedlings. Culture filtrates of Cs-8-1 fungal strain had advanced PGP activity. The presence of physiologically bioactive gibberellins (GA) GA(1) (1.213 ng ml(-1)), GA(3) (1.292 ng ml(-1)), GA(4) (3.6 ng ml(-1)), GA(7) (1.328 ng ml(-1)), other inactive GA(9) (0.796 ng ml(-1)) and GA(12) (0.417 ng ml(-1)), GA(20) (0.302 ng ml(-1)), GA(24) (1.351 ng ml(-1)), GA(34) (0.076 ng ml(-1)), and GA(53) (0.051 ng ml(-1)) in culture filtrates of Cs-8-1 fungal strain was detected. The Cs-8-1 fungal strain was confirmed as a producer of GAs. Molecular analysis of sequences showed high similarity of 99% to Cadophora malorum. Consequentially, the Cs-8-1 fungal strain was identified as a new C. malorum producing GAs. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Chu, Huaqiang; Dong, Bingzhi; Zhang, Yalei; Zhou, Xuefei
2012-01-01
A bio-diatomite dynamic membrane (BDDM) reactor for surface water treatment under a water head of 30, 40, 50, 60 and 70 cm, respectively, was investigated, which was very effective for pollutants removal. The water head exerted strong influences on filtration flux of BDDM during the precoating process, as well as on the formation of BDDM and turbidity variations. A high filtration flux (approximately 200-300 L/m2 h) could be achieved in the long filtration times of BDDM with a stable effluent turbidity of approximately 0.11-0.25 NTU. The BDDM could remove particles larger than 25 μm completely. The adopted sintered diatomite mainly consisted of macro pores, which were beneficial for improving the filtration flux of BDDM. During the backwash stage, the BDDM could be removed completely by the air backwash.
International Nuclear Information System (INIS)
Seifert, N.; Gibson, N.D.; Risley, J.S.
1995-01-01
In continuation of our previous work, charge transfer processes occurring in protons on rare-gas-atom collisions have been investigated. Diagonal and real off-diagonal coherence elements of the density matrix for H(n=3) atoms produced in 20--100-keV electron-capture collisions with Kr atoms are experimentally determined by analyzing the Balmer-α light from the decay of H atoms from the (n=3) state to the (n=2) state. The intensity and polarization of the emitted light are measured as functions of an axially symmetric electric field in the collision region. These data are fitted to a numerical model of the H atom in an electric field in order to extract density-matrix elements. The results are compared to previous studies of H + on He and Ar. The collisionally produced dipole moment of the H(n=3) atom decreases for increasing atomic number of the rare-gas target atoms, which indicates that the final phase of the collision process is not essential for the formation of the dipole moment. This physical picture is further supported by our alignment data. Absolute cross sections for charge transfer to the 3s, 3p, and 3d levels are presented as well
Development of an Indexing Media Filtration System for Long Duration Space Missions
Agui, Juan H.; Vijayakumar, R.
2013-01-01
The effective maintenance of air quality aboard spacecraft cabins will be vital to future human exploration missions. A key component will be the air cleaning filtration system which will need to remove a broad size range of particles derived from multiple biological and material sources. In addition, during surface missions any extraterrestrial planetary dust, including dust generated by near-by ISRU equipment, which is tracked into the habitat will also need to be managed by the filtration system inside the pressurized habitat compartments. An indexing media filter system is being developed to meet the demand for long-duration missions that will result in dramatic increases in filter service life and loading capacity, and will require minimal crew involvement. The filtration system consists of three stages: an inertial impactor stage, an indexing media stage, and a high-efficiency filter stage, packaged in a stacked modular cartridge configuration. Each stage will target a specific range of particle sizes that optimize the filtration and regeneration performance of the system. An 1/8th scale and full-scale prototype of the filter system have been fabricated and have been tested in the laboratory and reduced gravity environments that simulate conditions on spacecrafts, landers and habitats. Results from recent laboratory and reduce-gravity flight tests data will be presented. The features of the new filter system may also benefit other closed systems, such as submarines, and remote location terrestrial installations where servicing and replacement of filter units is not practical.
The use of an air filtration system in podiatry clinics.
McLarnon, Nichola; Burrow, Gordon; Maclaren, William; Aidoo, Kofi; Hepher, Mike
2003-06-01
A small-scale study was conducted to ascertain the efficiency and effectiveness of an air filtration system for use in podiatry/chiropody clinics (Electromedia Model 35F (A), Clean Air Ltd, Scotland, UK). Three clinics were identified, enabling comparison of data between podiatry clinics in the West of Scotland. The sampling was conducted using a portable Surface Air Sampler (Cherwell Laboratories, Bicester, UK). Samples were taken on two days at three different times before and after installation of the filtration units. The global results of the study indicate the filter has a statistically significant effect on microbial counts, with an average percentage decrease of 65%. This study is the first time, to the authors' knowledge, such a system has been tested within podiatric practice.
Directory of Open Access Journals (Sweden)
José Pancrácio Ribeiro
Full Text Available Abstract Tailings recovery has been a constant challenge for most engineers. Along more than five years, GAUSTEC joined major players in the mining Industry to scavenge Iron from tailings produced by flotation making use of WHIMS (Wet High Intensity Magnetic Separation. In the early 1980s, in USA, the US 4,192,738 patent was granted with promising results. Despite this, thirty years have passed with no significant application worldwide. One main reason is reported: the market missed a really high feed capacity WHIMS in order to avoid the huge number of the WHIMS that were available at that time (such projects would typically require more than 20 WHIMS to scavenge iron from tailings produced by flotation plants. Such a huge asset to scavenge low grade iron tailings would not payback. The Mega sized WHIMS launched by GAUSTEC in 2014, the GHX-1400, improved by the Super-WHIMS Technology (18.000 Gauss and BigFlow Magnetic Matrixes (Gaps smaller than 1.5 mm, faced this challenge. Specially designed ancillary equipment described here also played a decisive role in the scene.
Reinehr, Christian Oliveira; Treichel, Helen; Tres, Marcus Vinicius; Steffens, Juliana; Brião, Vandré Barbosa; Colla, Luciane Maria
2017-06-01
In this study, we developed a simplified method for producing, separating, and concentrating lipases derived from solid-state fermentation of agro-industrial residues by filamentous fungi. First, we used Aspergillus niger to produce lipases with hydrolytic activity. We analyzed the separation and concentration of enzymes using membrane separation processes. The sequential use of microfiltration and ultrafiltration processes made it possible to obtain concentrates with enzymatic activities much higher than those in the initial extract. The permeate flux was higher than 60 L/m 2 h during microfiltration using 20- and 0.45-µm membranes and during ultrafiltration using 100- and 50-kDa membranes, where fouling was reversible during the filtration steps, thereby indicating that the fouling may be removed by cleaning processes. These results demonstrate the feasibility of lipase production using A. niger by solid-state fermentation of agro-industrial residues, followed by successive tangential filtration with membranes, which simplify the separation and concentration steps that are typically required in downstream processes.
Directory of Open Access Journals (Sweden)
Débora Pestana
2009-02-01
Full Text Available The golden mussel (Limnoperna fortunei, Mollusca: Bivalvia is an invasive species that has been causing considerable environmental and economic problems in South America. In the present study, filtration rates of L. fortunei were determined in the laboratory under different temperatures (10, 15, 20, 25, 28, and 30 ºC and two types of food (Algamac-2000® and the chlorophycean alga Scenedesmus sp.. There was a statistically significant relationship between time and filtration rates in the experiment using Scenedesmus sp., regardless of temperature. However, this pattern was absent in the experiment using Algamac, suggesting that the relationship between filtration rates and temperature might depend on the size of the filtered particles. In addition, there was no correlation between filtration rates and either shell size or condition index (the relationship between the weight and the length of a mussel. The filtration rate measured in the present study (724.94 ml/h was one of the highest rates recorded among invasive bivalves to date. Given that the colonies of the golden mussel could reach hundreds of thousands of individuals per square meter, such filtration levels could severely impact the freshwater environments in its introduced range.
Measurement of glomerular filtration rate by impulse synthesis: Clinical validation and optimization
International Nuclear Information System (INIS)
Palagi, B.; Verga, P.; Broggi, A.; Picozzi, R.; Villa, F.; Guzzini, F.; Cozzi, C.; Tomasi, A.
1988-01-01
Impulse synthesis is a technique which relies upon the logic of continuous infusion but extracts the clearance value from single-injection data by shifting and adding them until an asymptotic value is attained. This study has been aimed at validating and optimizing clinically the measurement of glomerular filtration rate by impulse synthesis. A single intravenous injection of 51 Cr-EDTA has been made in 32 patients and plasma activity monitored over the next 6 h. Glomerular filtration rate computed by a single-exponential fit method (GFR-SEF) has been shown to be significantly (p [de
Water filtration of the forearm in short- and long-term diabetes mellitus
DEFF Research Database (Denmark)
Poulsen, H L; Nielsen, S L
1976-01-01
of the forearm. Increased water filtration in connective tissue in long-term diabetics is in accordance with earlier findings of a lowered subcutaneous interstitial fluid albumin concentration in long-term diabetics, this being explained by an increase in net water outflux from the microcirculation.......Blood flow and capillary filtration coefficient (CFC) were measured by strain-gauge plethysmography on the upper and lower third of the forearm in 9 normal subjects and 29 well regulated patients with diabetes mellitus of varying duration (less than 10 years, 10 to 20 years, and more than 20 years...
Purification of adenoviral vectors by combined anion exchange and gel filtration chromatography.
Eglon, Marc N; Duffy, Aoife M; O'Brien, Timothy; Strappe, Padraig M
2009-11-01
Adenoviral vectors are used extensively in human gene therapy trials and in vaccine development. Large-scale GMP production requires a downstream purification process, and liquid chromatography is emerging as the most powerful mode of purification, enabling the production of vectors at a clinically relevant scale and quality. The present study describes the development of a two-step high-performance liquid chromatography (HPLC) process combining anion exchange (AIEX) and gel filtration (GF) in comparison with the caesium chloride density gradient method. HEK-293 cells were cultured in ten-layer CellStacks() and infected with 10 pfu/cell of adenoviral vector expressing green fluorescent protein (Ad5-GFP). Cell-bound virus was harvested and benzonase added to digest DNA, crude lysate was clarified by centrifugation and filtration prior to HPLC. Chromatography fractions were added to HEK-293 cells and GFP expression measured using a fluorescent plate reader. Using AIEX then GF resulted in an adenoviral vector with purity comparable to Ad5-GFP purified by CsCl, whereas the reverse process (GF-AIEX) showed a reduced purity by electrophoresis and required further buffer exchange of the product. The optimal process (AIEX-GF) resulted in a vector yield of 2.3 x 10(7) pfu/cm(2) of cell culture harvested compared to 3.3 x 10(7) pfu/cm(2) for CsCl. The process recovery for the HPLC process was 36% compared to 27.5% for CsCl and total virion to infectious particle ratios of 18 and 11, respectively, were measured. We present a simple two-step chromatography process that is capable of producing high-quality adenovirus at a titre suitable for scale-up and clinical translation.
Di Luccia, Blanda; Riccio, Antonio; Vanacore, Adele; Baccigalupi, Loredana; Molinaro, Antonio; Ricca, Ezio
2015-10-21
The ability to produce an extracellular matrix and form multicellular communities is an adaptive behavior shared by many bacteria. In Bacillus subtilis, the model system for spore-forming bacteria, matrix production is one of the possible differentiation pathways that a cell can follow when vegetative growth is no longer feasible. While in B. subtilis the genetic system controlling matrix production has been studied in detail, it is still unclear whether other spore formers utilize similar mechanisms. We report that SF214, a pigmented strain of Bacillus pumilus isolated from the marine environment, can produce an extracellular matrix relying on orthologs of many of the genes known to be important for matrix synthesis in B. subtilis. We also report a characterization of the carbohydrates forming the extracellular matrix of strain SF214. The isolation and characterization of mutants altered in matrix synthesis, pigmentation, and spore formation suggest that in strain SF214 the three processes are strictly interconnected and regulated by a common molecular mechanism.
International Nuclear Information System (INIS)
Ling, Tsz Yan; Wang Jing; Pui, David Y. H.
2011-01-01
Membrane filtration has been demonstrated to be effective for the removal of liquid-borne nanoparticles (NPs). Such technique can be applied to purify and disinfect drinking water as well as remove NPs in highly pure chemicals used in the industries. This study aims to study the filtration process of a model membrane filter, the Nuclepore filter. Experiments were carried out using standard filtration tools and the nanoparticle tracking analysis (NTA) technique was used to measure particle (50–500 nm) concentration upstream and downstream of the filter to determine the filtration efficiency. The NTA technique has been calibrated using 150-nm polystyrene latex particles to determine its accuracy of particle concentration measurement. Measurements were found reliable within a certain concentration limit (about 10 8 –10 10 particles/cm 3 ), which is dependent on the camera settings during the measurement. Experimental results are comparable with previously published data obtained using the aerosolization method, validating the capability of the NTA technique. The capillary tube model modified from that developed for aerosol filtration was found to be useful to represent the experimental results, when a sticking coefficient of 0.15 is incorporated. This suggests that only 15% of the particle collisions with the filter results in successful attachment. The small sticking coefficient found can be explained by the unfavorable surface interactions between the particles and the filter medium.
Aluminium - Cobalt-Pillared Clay for Dye Filtration Membrane
Darmawan, A.; Widiarsih
2018-04-01
The manufacture of membrane support from cobalt aluminium pillared clay has been conducted. This research was conducted by mixing a clay suspension with pillared solution prepared from the mixture of Co(NO3)2.6H2O and AlCl3.6H2O. The molar ratio between Al and Co was 75:25 and the ratio of [OH-]/[metal] was 2. The clay suspension was stirred for 24 hours at room temperature, filtered and dried. The dried clay was then calcined at 200°C, 300°C and 400°C with a ramp rate of 2°C/min. Aluminium-cobalt-pillared clay was then characterized by XRD and GSA and moulded become a membrane support for subsequent tests on dye filtration. The XRD analysis showed that basal spacing (d 001) value of aluminium cobalt was 19.49 Å, which was higher than the natural clay of 15.08Å however, the basal spacing decreased with increasing calcination temperature. The result of the GSA analysis showed that the pore diameter of the aluminium cobalt pillared clay membrane was almost the same as that of natural clay that were 34.5Å and 34.2Å, respectively. Nevertheless, the pillared clay has a more uniform pore size distribution. The results of methylene blue filtration measurements demonstrated that the membrane filter support could well which shown by a clear filtrate at all concentrations tested. The value of rejection and flux decreased with the increasing concentration of methylene blue. The values of dye rejection and water flux reached 99.89% and 5. 80 x 10-6 kg min-1, respectively but they decreased with increasing concentration of methylene blue. The results of this study indicates that the aluminium-pillared clay cobalt could be used as membrane materials especially for ultrafiltration.
Aluminum matrix composites reinforced with alumina nanoparticles
Casati, Riccardo
2016-01-01
This book describes the latest efforts to develop aluminum nanocomposites with enhanced damping and mechanical properties and good workability. The nanocomposites exhibited high strength, improved damping behavior and good ductility, making them suitable for use as wires. Since the production of metal matrix nanocomposites by conventional melting processes is considered extremely problematic (because of the poor wettability of the nanoparticles), different powder metallurgy routes were investigated, including high-energy ball milling and unconventional compaction methods. Special attention was paid to the structural characterization at the micro- and nanoscale, as uniform nanoparticle dispersion in metal matrix is of prime importance. The aluminum nanocomposites displayed an ultrafine microstructure reinforced with alumina nanoparticles produced in situ or added ex situ. The physical, mechanical and functional characteristics of the materials produced were evaluated using different mechanical tests and micros...
Filtrations on Springer fiber cohomology and Kostka polynomials
Bellamy, Gwyn; Schedler, Travis
2018-03-01
We prove a conjecture which expresses the bigraded Poisson-de Rham homology of the nilpotent cone of a semisimple Lie algebra in terms of the generalized (one-variable) Kostka polynomials, via a formula suggested by Lusztig. This allows us to construct a canonical family of filtrations on the flag variety cohomology, and hence on irreducible representations of the Weyl group, whose Hilbert series are given by the generalized Kostka polynomials. We deduce consequences for the cohomology of all Springer fibers. In particular, this computes the grading on the zeroth Poisson homology of all classical finite W-algebras, as well as the filtration on the zeroth Hochschild homology of all quantum finite W-algebras, and we generalize to all homology degrees. As a consequence, we deduce a conjecture of Proudfoot on symplectic duality, relating in type A the Poisson homology of Slodowy slices to the intersection cohomology of nilpotent orbit closures. In the last section, we give an analogue of our main theorem in the setting of mirabolic D-modules.
Energy Technology Data Exchange (ETDEWEB)
David B. Burnett
2004-09-29
Produced water is a major waste generated at the oil and natural gas wells in the state of Texas. This water could be a possible source of new fresh water to meet the growing demands of the state after treatment and purification. Treatment of brine generated in oil fields or produced water with an ultrafiltration membranes were the subject of this thesis. The characterization of ultrafiltration membranes for oil and suspended solids removal of produced water, coupled with the reverse osmosis (RO) desalination of brine were studied on lab size membrane testing equipment and a field size testing unit to test whether a viable membrane system could be used to treat produced water. Oil and suspended solids were evaluated using turbidity and oil in water measurements taken periodically. The research considered the effect of pressure and flow rate on membrane performance of produced water treatment of three commercially available membranes for oily water. The study also analyzed the flux through the membrane and any effect it had on membrane performance. The research showed that an ultrafiltration membrane provided turbidity removal of over 99% and oil removal of 78% for the produced water samples. The results indicated that the ultrafiltration membranes would be asset as one of the first steps in purifying the water. Further results on selected RO membranes showed that salt rejection of greater than 97% could be achieved with satisfactory flux and at reasonable operating cost.
Filtration of Carbon Particulate Emissions from a Plasma Pyrolysis Assembly
Agui, Juan H.; Green, Robert; Vijayakumar, R.; Berger, Gordon; Greenwood, Zach; Abney, Morgan; Peterson, Elspeth
2016-01-01
NASA is investigating plasma pyrolysis as a candidate technology that will enable the recovery of hydrogen from the methane produced by the ISS Sabatier Reactor. The Plasma Pyrolysis Assembly (PPA) is the current prototype of this technology which converts the methane product from the Carbon Dioxide Reduction Assembly (CRA) to acetylene and hydrogen with 90% or greater conversion efficiency. A small amount of solid carbon particulates are generated as a side product and must be filtered before the acetylene is removed and the hydrogen-rich gas stream is recycled back to the CRA. We discuss developmental work on several options for filtering out the carbon particulate emissions from the PPA exit gas stream. The filtration technologies and concepts investigated range from fibrous media to monolithic ceramic and sintered metal media. This paper describes the different developed filter prototypes and characterizes their performance from integrated testing at the Environmental Chamber (E-Chamber) at MSFC. In addition, characterization data on the generated carbon particulates, that help to define filter requirements, are also presented.
Thorsten Ufer; Heinrich Beltz; Thomas Brand; Katrin Kaminski; Ralf Lüttmann; Martin Posner; Stefan Wagner; Sabine Werres; Hans-Peter Wessels
2006-01-01
In a 3-year project the elimination of Phytophthora spp. from the recirculation water with different kinds of filtration systems will be tested under commercial conditions in container nurseries. First results indicate that the filtration systems eliminate Phytophthora spp. from the water.
Water filtration using plant xylem.
Directory of Open Access Journals (Sweden)
Michael S H Boutilier
Full Text Available Effective point-of-use devices for providing safe drinking water are urgently needed to reduce the global burden of waterborne disease. Here we show that plant xylem from the sapwood of coniferous trees--a readily available, inexpensive, biodegradable, and disposable material--can remove bacteria from water by simple pressure-driven filtration. Approximately 3 cm(3 of sapwood can filter water at the rate of several liters per day, sufficient to meet the clean drinking water needs of one person. The results demonstrate the potential of plant xylem to address the need for pathogen-free drinking water in developing countries and resource-limited settings.
SU-F-I-76: Fluoroscopic X-Ray Beam Profiles for Spectra Incorporating Copper Filtration
Energy Technology Data Exchange (ETDEWEB)
Wunderle, K [Cleveland Clinic Foundation, Cleveland, OH (United States); Wayne State University School of Medicine, Detroit, MI (United States); Godley, A; Shen, Z; Dong, F [Cleveland Clinic Foundation, Cleveland, OH (United States); Rakowski, J [Wayne State University School of Medicine, Detroit, MI (United States)
2016-06-15
Purpose: The purpose of this investigation is to characterize and quantify X-ray beam profiles for fluoroscopic x-ray beam spectra incorporating spectral (copper) filtration. Methods: A PTW (Freiburg, Germany) type 60016 silicon diode detector and PTW MP3 water tank were used to measure X-ray beam profiles for 60, 80, 100 and 120 kVp x-ray beams at five different copper filtration thicknesses ranging from 0–0.9 mm at 22 and 42 cm fields of view and depths of 1, 5, and 10 cm in both the anode-cathode axis (inplane) and cross-plane directions. All measurements were acquired on a Siemens (Erlangen, Germany) Artis ZeeGo fluoroscope inverted from the typical orientation providing an x-ray beam originating from above the water surface with the water level set at 60 cm from the focal spot. Results: X-ray beam profiles for beam spectra without copper filtration compared well to previously published data by Fetterly et al. [Med Phys, 28, 205 (2001)]. Our data collection benefited from the geometric orientation of the fluoroscope, providing a beam perpendicular to the tank water surface, rather than through a thin side wall as did the previously mentioned study. Profiles for beams with copper filtration were obtained which have not been previously investigated and published. Beam profiles in the anode-cathode axis near the surface and at lower x-ray energy exhibited substantial heel effect, which became less pronounced at greater depth. At higher energy with copper filtration in the beam, the dose falloff out-of-field became less pronounced, as would be anticipated given higher scatter photon energy. Conclusion: The x-ray beam profile data for the fluoroscopic x-ray beams incorporating copper filtration are intended for use as reference data for estimating doses to organs or soft tissue, including fetal dose, involving similar beam qualities or for comparison with mathematical models.
Matrix isolation sublimation: An apparatus for producing cryogenic beams of atoms and molecules
Energy Technology Data Exchange (ETDEWEB)
Sacramento, R. L.; Alves, B. X.; Silva, B. A.; Wolff, W.; Cesar, C. L. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); Oliveira, A. N. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); INMETRO, Av. Nossa Senhora das Graças, 50 25250-020 Duque de Caxias, RJ (Brazil); Li, M. S. [Instituto de Física de São Carlos, Universidade de São Paulo, Ave. Trabalhador São Carlense, 400, 13565-590 São Carlos, SP (Brazil)
2015-07-15
We describe the apparatus to generate cryogenic beams of atoms and molecules based on matrix isolation sublimation. Isolation matrices of Ne and H{sub 2} are hosts for atomic and molecular species which are sublimated into vacuum at cryogenic temperatures. The resulting cryogenic beams are used for high-resolution laser spectroscopy. The technique also aims at loading atomic and molecular traps.
Huangfu, Xiaoliu; Ma, Chengxue; Ma, Jun; He, Qiang; Yang, Chun; Zhou, Jian; Jiang, Jin; Wang, Yaan
2017-12-01
Thallium (Tl) has drawn wide concern due to its high toxicity even at extremely low concentrations, as well as its tendency for significant accumulation in the human body and other organisms. The need to develop effective strategies for trace Tl removal from drinking water is urgent. In this study, the removal of trace Tl (0.5 μg L -1 ) by conventional quartz sand filtration enhanced by nanosized manganese dioxide (nMnO 2 ) has been investigated using typical surface water obtained from northeast China. The results indicate that nMnO 2 enhanced quartz sand filtration could remove trace Tl(I) and Tl(III) efficiently through the adsorption of Tl onto nMnO 2 added to a water matrix and onto nMnO 2 attached on quartz sand surfaces. Tl(III)-HA complexes might be responsible for higher residual Tl(III) in the effluent compared to residual Tl(I). Competitive Ca 2+ cations inhibit Tl removal to a certain extent because the Ca 2+ ions will occupy the Tl adsorption site on nMnO 2 . Moreover, high concentrations of HA (10 mgTOC L -1 ), which notably complexes with and dissolves nMnO 2 (more than 78%), resulted in higher residual Tl(I) and Tl(III). Tl(III)-HA complexes might also enhance Tl(III) penetration to a certain extent. Additionally, a higher pH level could enhance the removal of trace Tl from surface water. Finally, a slight increase of residual Tl was observed after backwash, followed by the reduction of the Tl concentration in the effluent to a "steady" state again. The knowledge obtained here may provide a potential strategy for drinking water treatment plants threatened by trace Tl. Copyright © 2017. Published by Elsevier Ltd.
Energy Technology Data Exchange (ETDEWEB)
Shimskey, Rick W.; Billing, Justin M.; Buck, Edgar C.; Casella, Amanda J.; Crum, Jarrod V.; Daniel, Richard C.; Draper, Kathryn E.; Edwards, Matthew K.; Hallen, Richard T.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Swoboda, Robert G.
2009-03-02
A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan (Barnes and Voke 2006). The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Hanford Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Under test plan TP RPP WTP 467 (Fiskum et al. 2007), eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. Under this test plan, a waste testing program was implemented that included: • Homogenizing the archive samples by group as defined in the test plan. • Characterizing the homogenized sample groups. • Performing parametric leaching testing on each group for compounds of interest. • Performing bench-top filtration/leaching tests in the hot cell for each group to simulate filtration and leaching activities if they occurred in the UFP2 vessel of the WTP Pretreatment Facility. This report focuses on a filtration/leaching test performed using two of the eight waste composite samples. The sample groups examined in this report were the plutonium-uranium extraction (PUREX) cladding waste sludge (Group 3, or CWP) and reduction-oxidation (REDOX) cladding waste sludge (Group 4, or CWR). Both the Group 3 and 4 waste composites were anticipated to be high in gibbsite, thus requiring caustic leaching. WTP RPT 167 (Snow et al. 2008) describes the homogenization, characterization, and parametric leaching activities before benchtop filtration/leaching testing of these two waste groups. Characterization and initial parametric data in that report were used to plan a single filtration/leaching test using a blend of both wastes. The test focused on filtration testing of the waste and caustic leaching for aluminum, in the form
Final hazard classification for N basin water filtration and sediment relocation operations
International Nuclear Information System (INIS)
Pisarcik, D.J.; Kretzschmar, S.P.
1996-02-01
This document provides an auditable safety analysis and hazard classification for the filtration of basin water and the relocation of 105-N basin solids to the North Cask Pit within the basin complex. This report assesses the operation of the Water Filtration System and the Remotely Operated Sediment Extraction Equipment (ROSEE). These activities have an activity hazard classification of radiological. Inventories of potentially releasable nonradioactive hazardous materials are far below the reportable quantities of 40 CFR 302. No controls are required to maintain the releasable inventories of these materials below the reportable quantities. Descriptive material is included to provide a general understanding of the water filtration and sediment relocation processes. All equipment will be operated as described in work instructions and/or applicable procedures. Special controls associated with these activities are as follows: (1) A leak inspection of the ROSEE system shall be performed at least once every 5-hour period of sediment relocation operation. (2) A berm must be in place around the North Cask Pit to redirect a potential abovewater ROSEE system leak back to the basin
Semi-continuous protein fractionating using affinity cross-flow filtration
Borneman, Zandrie; Zhang, W.; van den Boomgaard, Anthonie; Smolders, C.A.
2002-01-01
Protein purification by means of downstream processing is increasingly important. At the University of Twente a semi-continuous process is developed for the isolation of BSA out of crude protein mixtures. For this purpose an automated Affinity Cross-Flow Filtration, ACFF, process is developed. This
Directory of Open Access Journals (Sweden)
J. Bažan
2009-10-01
Full Text Available Composition and morphology of filter ceramics were investigated during filtration of steel deoxidised by aluminium. Filtration was realized with use of filters based on oxidic ceramics Cr2O3, TiO2, SiO2, ZrO2, Al2O3, 3Al2O3•2SiO2 and MgO•Al2O3. It was established that change of interphase (coating occurs during filtration of steel on the surface of capillaries of ceramics, where content of basic oxidic component decreases. Loss of oxidic component in the coating is replaced by increase of oxides of manganese and iron and it is great extent inversely proportional to the value of Gibbs’ energy of oxide, which forms this initial basis of ceramics.
International Nuclear Information System (INIS)
Dolle, L.
1976-01-01
A effective limitation to the deposition of radioactive corrosion products in the core of a reactor at power operation, is to be obtained by filtering the water of the primary circuit at a flow rate upper than 1% of the coolant flow rate. However, in view of accounting for more important release of corrosion products during the reactor start-up and also for some possible variations in the efficiency of the system, it is better that the flow rate to be treated by the cleaning circuit is stated at 5%. Filtration must be effected at the temperature of the primary circuit and preferably on each loop. To this end, the feasibility of electromagnetic filtration or filtration through a deep bed of granulated graphite has been studied. The on-loop tests effected on each filter gave efficiencies and yields respectively upper than 90% and 99% for magnetite and ferrite particles in suspension in water at 250 deg C. Such results confirm the interest lying in high temperature filtration and lead to envisage its application to reactors [fr
Organo-clay/anthracite filtration for oil removal
International Nuclear Information System (INIS)
Moazed, H.; Viragahavan, T.
1999-01-01
An advantage of organo-clay compared to other sorbents is that it can selectively remove organic pollutants from contaminated waters. An investigation was conducted to determine the potential of an organo-clay/anthracite mixture as a filter media for the removal of oil from synthetic and real oily waters. Also included in the study were column filtration studies using synthetic and real waste waters to determine the sorptive capacity of the material. In general, oil removal efficiencies in a 300 mm organo-clay/anthracite bed decreased with an increase in flow rates. Results of eight hour studies indicated that the depth of an organo-clay/anthracite bed has a direct effect on oil removal efficiency. The Thomas equation provides a reasonable fit of the data based on breakthrough studies. The model can be used to determine the parameters needed to design full-scale filtration columns. The uptake of oil by an organo-clay/anthracite mixture is well described by an equation including time such as the Weber or Moris model. The maximum solid-phase concentration of the solute values obtained from the Thomas equation were comparable to the values found by a mass balance approach. 12 refs., 8 figs., 4 tabs
Laser cladding of wear resistant metal matrix composite coatings
International Nuclear Information System (INIS)
Yakovlev, A.; Bertrand, Ph.; Smurov, I.
2004-01-01
A number of coatings with wear-resistant properties as well as with a low friction coefficient are produced by laser cladding. The structure of these coatings is determined by required performance and realized as metal matrix composite (MMC), where solid lubricant serves as a ductile matrix (e.g. CuSn), reinforced by appropriate ceramic phase (e.g. WC/Co). One of the engineered coating with functionally graded material (FGM) structure has a dry friction coefficient 0.12. Coatings were produced by coaxial injection of powder blend into the zone of laser beam action. Metallographic and tribological examinations were carried out confirming the advanced performance of engineered coatings
Air filtration media from electrospun waste high-impact polystyrene fiber membrane
Zulfi, Akmal; Miftahul Munir, Muhammad; Hapidin, Dian Ahmad; Rajak, Abdul; Edikresnha, Dhewa; Iskandar, Ferry; Khairurrijal, Khairurrijal
2018-03-01
Nanofiber membranes were synthesized from waste high-impact polystyrene (HIPS) using electrospinning method and then applied as air filtration media. The waste HIPS precursor solution with the concentration of 20 wt.% was prepared by dissolving waste HIPS into the mixture of d-limonene and DMF solvents. Beaded or fine nanofibers could be achieved by adjusting the ratio of solvents mixture (d-limonene and DMF). Using the ratios of solvents (d-limonene: DMF) of 3:1, 1:1, and 1:3, it was obtained beaded HIPS nanofibers with the average diameter of 272 nm, beaded HIPS nanofibers with the average diameter of 937, and fine HIPS nanofibers with the average diameter of 621 nm, respectively. From the FTIR spectral analysis, it was found that the FTIR peaks of the HIPS nanofiber membranes are the same as those of the cleaned waste HIPS and there are no FTIR peaks of DMF and d-limonene solvents. These findings implied that the electrospinning process allows the recycling of waste HIPS into HIPS nanofibers without any trapped solvent phases or apparent degradation of the original material. From the contact angle measurement, it was confirmed that the HIPS nanofiber membranes are hydrophobic and the presence of the beads in the HIPS nanofiber membranes varies their contact angles. From the air-filtration test, it was shown that the fiber morphology (beaded or fine nanofibers) considerably affects the filtration performance of the membranes. The presence of beads increased the distance between the fibers so that the pressure drop decreased. Moreover, the basis weight of the membrane greatly affected the filtration efficiency. The HIPS nanofiber membrane with the basis weight of 12.22 g m‑2 had the efficiency greater than 99.999%, which was equivalent to that of the HEPA filter.
Estimated glomerular filtration rate in patients with type 2 diabetes mellitus
Directory of Open Access Journals (Sweden)
Paula Caitano Fontela
2014-12-01
Full Text Available Objective: to estimate the glomerular filtration using the Cockcroft-Gault (CG, Modification of Diet in Renal Disease (MDRD, and Chronic Kidney Disease Epidemiology Collaboration (CKD-EPI equations, and serum creatinine in the screening of reduced renal function in patients with type two diabetes (T2DM enrolled in the Family Health Strategy (ESF, Brazilian federal health-care program. Methods: a cross-sectional descriptive and analytical study was conducted. The protocol consisted of sociodemographics, physical examination and biochemical tests. Renal function was analyzed through serum creatinine and glomerular filtration rate (GFR estimated according to the CG, MDRD and CKD-EPI equations, available on the websites of the Brazilian Nephrology Society (SBN and the (NKF. Results: 146 patients aged 60.9±8.9 years were evaluated; 64.4% were women. The prevalence of serum creatinine >1.2 mg/dL was 18.5% and GFR <60 mL/min/1.73m2 totaled 25.3, 36.3 and 34.2% when evaluated by the equations CG, MDRD and CKD-EPI, respectively. Diabetic patients with reduced renal function were older, had long-term T2DM diagnosis, higher systolic blood pressure and higher levels of fasting glucose, compared to diabetics with normal renal function. Creatinine showed strong negative correlation with the glomerular filtration rate estimated using CG, MDRD and CKD-EPI (-0.64, -0.87, -0.89 equations, respectively. Conclusion: the prevalence of individuals with reduced renal function based on serum creatinine was lower, reinforcing the need to follow the recommendations of the SBN and the National Kidney Disease Education Program (NKDEP in estimating the value of the glomerular filtration rate as a complement to the results of serum creatinine to better assess the renal function of patients.
Regularities of filtration of sunflower oil with the use of vibroacoustic exposure
Directory of Open Access Journals (Sweden)
S. A. Bredikhin
2017-01-01
Full Text Available The residue in sunflower oil is a dispersed phase consisting of particulate products grinding sunflower seeds in the form of particles of the pulp, oil cake, meal, residual quantities of metals, pesticides. In the recycling process they are in the oil in suspension and negatively affect its quality. For research an experimental setup was developed allowing to change the angle of inclination of the filter element. The regularities of filtration were determined without preliminary purification of sunflower oil by centrifugation and after centrifugation. It is established, the contamination of centrifuged oil in the initial period is 14.6 times lower. After 10 minutes of treatment, it decreases by 62%, after 20 minutes – by 79.4%. With a 30-minute treatment, particles of 0.005-0.1 mm in size are removed to 90%, which is approximated to the refined oil in terms of contamination. The influence of vibration-acoustic action on sunflower oil during its filtration is shown. At the last stage of production, the peroxide index is reduced to 2-3 moles of active oxygen, and after 3 months of storage – from 11.8 to 7.7, which according to GOST corresponds to the highest-grade oil. The regularities of the filtration without pre-treatment of sunflower oil by centrifugation and after centrifugation. Shows the effect of vibroacoustic exposure on sunflower oil when filtering. The obtained data on the change of qualitative parameters of sunflower oil during its filtration in the field of vibroacoustic impact.
Good Filtrations and the Steinberg Square
DEFF Research Database (Denmark)
Kildetoft, Tobias
that tensoring the Steinberg module with a simple module of restricted highest weight gives a module with a good filtration. This result was first proved by Andersen when the characteristic is large enough. In this dissertation, generalizations of those results, which are joint work with Daniel Nakano......, the socle completely determines how a Steinberg square decomposes. The dissertation also investigates the socle of the Steinberg square for a finite group of Lie type, again providing formulas which describe how to find the multiplicity of a simple module in the socle, given information about...
Effect of flood-induced chemical load on filtrate quality at bank filtration sites
Ray, C.; Soong, T.W.; Lian, Y.Q.; Roadcap, G.S.
2002-01-01
Riparian municipal wells, that are located on riverbanks, are specifically designed to capture a portion of the river water through induced infiltration. Runoff from agricultural watersheds is found to carry enormous amounts of pesticides and nitrate. While the risk of contamination for a vast majority of sites with small-capacity vertical wells is low, potential exists for medium to large capacity collector wells to capture a fraction of the surface water contaminants during flood. Prior monitoring and current modeling results indicate that a small-capacity (peak pumpage 0.0315 m3/s) vertical bank filtration well may not be affected by river water nitrate and atrazine even during flood periods. For a medium capacity (0.0875-0.175 m3/s) hypothetical collector well at the same site, potential exists for a portion of the river water nitrate and atrazine to enter the well during flood periods. Various combinations of hydraulic conductivity of the riverbed or bank material were used. For nitrate, it was assumed either no denitrification occurred during the period of simulation or a half-life of 2 years. Equilibrium controlled sorption (organic carbon partition coefficient of 52 ml/g) and a half-life of between 7.5 and 15 weeks were considered for atrazine. Combinations of these parameters were used in various simulations. Peak concentrations of atrazine or nitrate in pumped water could vary from less than 1% to as high as 90% of that in the river. It was found that a combination of river stage, pumping rates, hydraulic properties of the riverbed and bank, and soil/pesticide properties could affect contaminant entry from river water to any of these wells. If the hydraulic conductivity of the bed and bank material were low, atrazine would not reach the pumping well with or without sorption and degradation. However, for moderately low permeable bank and bed materials, some atrazine from river water could enter a hypothetical collector well while pumping at 0.0875 m3/s. It
Mathematical Modeling of Multiphase Filtration in Porous Media with a Chemically Active Skeleton
Khramchenkov, M. G.; Khramchenkov, É. M.
2018-01-01
The authors propose a mathematical model of two-phase filtration that occurs under the conditions of dissolution of a porous medium. The model can be used for joint description of complex chemical-hydrogeomechanical processes that are of frequent occurrence in the oil-and-gas producing and nature conservation practice. As an example, consideration is given to the acidizing of the bottom zone of the injection well of an oil reservoir. Enclosing rocks are represented by carbonates. The phases of the process are an aqueous solution of hydrochloric acid and oil. A software product for computational experiments is developed. For the numerical experiments, use is made of the data on the wells of an actual oil field. Good agreement is obtained between the field data and the calculated data. Numerical experiments with different configurations of the permeability of an oil stratum are conducted.
Matrix method for acoustic levitation simulation.
Andrade, Marco A B; Perez, Nicolas; Buiochi, Flavio; Adamowski, Julio C
2011-08-01
A matrix method is presented for simulating acoustic levitators. A typical acoustic levitator consists of an ultrasonic transducer and a reflector. The matrix method is used to determine the potential for acoustic radiation force that acts on a small sphere in the standing wave field produced by the levitator. The method is based on the Rayleigh integral and it takes into account the multiple reflections that occur between the transducer and the reflector. The potential for acoustic radiation force obtained by the matrix method is validated by comparing the matrix method results with those obtained by the finite element method when using an axisymmetric model of a single-axis acoustic levitator. After validation, the method is applied in the simulation of a noncontact manipulation system consisting of two 37.9-kHz Langevin-type transducers and a plane reflector. The manipulation system allows control of the horizontal position of a small levitated sphere from -6 mm to 6 mm, which is done by changing the phase difference between the two transducers. The horizontal position of the sphere predicted by the matrix method agrees with the horizontal positions measured experimentally with a charge-coupled device camera. The main advantage of the matrix method is that it allows simulation of non-symmetric acoustic levitators without requiring much computational effort.
Nonnegative Matrix Factorizations Performing Object Detection and Localization
Directory of Open Access Journals (Sweden)
G. Casalino
2012-01-01
Full Text Available We study the problem of detecting and localizing objects in still, gray-scale images making use of the part-based representation provided by nonnegative matrix factorizations. Nonnegative matrix factorization represents an emerging example of subspace methods, which is able to extract interpretable parts from a set of template image objects and then to additively use them for describing individual objects. In this paper, we present a prototype system based on some nonnegative factorization algorithms, which differ in the additional properties added to the nonnegative representation of data, in order to investigate if any additional constraint produces better results in general object detection via nonnegative matrix factorizations.
Filtrated K-theory for real rank zero C*-algebras
DEFF Research Database (Denmark)
Arklint, Sara Esther; Restorff, Gunnar; Ruiz, Efren
2012-01-01
The smallest primitive ideal spaces for which there exist counterexamples to the classification of non-simple, purely infinite, nuclear, separable C*-algebras using filtrated K-theory, are four-point spaces. In this article, we therefore restrict to real rank zero C*-algebras with four-point prim...
Enforced Sparse Non-Negative Matrix Factorization
2016-01-23
proposals quotas opec legislation revenue england ico iraq vote passenger yen producer iranian surplus Figure 4. Example NMF with and without sparsity...preprint arXiv:1007.0380, 2010. [22] A. Cichocki and P. Anh-Huy, “Fast local algorithms for large scale nonnegative matrix and tensor factorizations
International Nuclear Information System (INIS)
Gouvion Saint Cyr, D. de; Wisniewski, C.; Schrive, L.; Farhi, E.; Rivasseau, C.
2014-01-01
Bio-remediation technologies often offer efficiency, cost and environmental impact benefits against physico-chemical technologies. Concerning the remediation of radionuclide-containing water, a few bio-based technologies have been proposed but none is currently operational in highly radioactive environments. A new radio-tolerant micro-alga, isolated from a nuclear facility, possesses properties that offer new decontamination prospects for the nuclear industry or for the clean-up of environmental water. A pilot-scale treatment unit based on this alga is currently under development for the decontamination of radioactive water. It includes separation and/or concentration steps relying on membrane filtration. This work aims at verifying the feasibility of micro-filtration as separation step for the targeted algae separation. Recommendations about the choice of operating conditions limiting and/or controlling the membrane fouling are provided with the objective to enhance the separation efficiency. Lab-scale dead-end filtration tests were implemented and the key factors involved in the separation performances were investigated. Membrane characteristics, biomass composition, and hydrodynamic conditions were considered. Organic membranes provided adequate filtration performance. Membrane fouling was essentially induced by a rapid reversible algae deposit and to a lesser extent by irreversible pore blockage caused by smaller particles and dissolved organic matter. To cancel the reversible fouling, hydrodynamic actions such as stirring and back-flush efficiently prevented algae deposit, allowing higher filtration productivity. This study demonstrates the feasibility of membrane separation for micro-algae harvesting at laboratory-scale and specifies the suitable working conditions. (authors)
Entanglement in Gaussian matrix-product states
International Nuclear Information System (INIS)
Adesso, Gerardo; Ericsson, Marie
2006-01-01
Gaussian matrix-product states are obtained as the outputs of projection operations from an ancillary space of M infinitely entangled bonds connecting neighboring sites, applied at each of N sites of a harmonic chain. Replacing the projections by associated Gaussian states, the building blocks, we show that the entanglement range in translationally invariant Gaussian matrix-product states depends on how entangled the building blocks are. In particular, infinite entanglement in the building blocks produces fully symmetric Gaussian states with maximum entanglement range. From their peculiar properties of entanglement sharing, a basic difference with spin chains is revealed: Gaussian matrix-product states can possess unlimited, long-range entanglement even with minimum number of ancillary bonds (M=1). Finally we discuss how these states can be experimentally engineered from N copies of a three-mode building block and N two-mode finitely squeezed states
Amorphous metal matrix composite ribbons
International Nuclear Information System (INIS)
Barczy, P.; Szigeti, F.
1998-01-01
Composite ribbons with amorphous matrix and ceramic (SiC, WC, MoB) particles were produced by modified planar melt flow casting methods. Weldability, abrasive wear and wood sanding examinations were carried out in order to find optimal material and technology for elevated wear resistance and sanding durability. The correlation between structure and composite properties is discussed. (author)
Contaminated fluid filtration plant using pneumatically renewable granulated material
International Nuclear Information System (INIS)
Lucas, J.-C.; Messirejean, Pierre.
1980-01-01
This invention concerns a plant for the filtration of a contaminated fluid flow using a granulated material capable of absorbing or adsorbing the contaminants. This plant includes a filtration box within which there is at least one appreciably vertical filtering bed filled with the material and crossed by the fluid flow, loading and discharge compartments respectively located at the top and bottom of the box, each in communication with the filtering bed and an air-actuated transfer system for loading and discharging this bed through these compartments. Facilities of this kind are used mainly in the nuclear and chemical engineering industries to rid their waste of radio-iodines, generally constituted by elementary iodine and methyl iodide, or of toxic gases that contaminate them. The granulated material, whose job it is to trap these contaminants by adsorption or absorption, is generally composed of active carbon or zeolites whose utilisation time is limited [fr
Carbon Nanotube Membranes: Synthesis, Properties, and Future Filtration Applications
Directory of Open Access Journals (Sweden)
Md. Harun-Or Rashid
2017-05-01
Full Text Available Over the course of the past decade, there has been growing interest in the development of different types of membranes composed of carbon nanotubes (CNTs, including buckypapers and composite materials, for an ever-widening range of filtration applications. This article provides an overview of how different types of CNT membranes are prepared and the results obtained from investigations into their suitability for different applications. The latter involve the removal of small particles from air samples, the filtration of aqueous solutions containing organic compounds and/or bacteria, and the separation of individual liquids present in mixtures. A growing number of reports have demonstrated that the incorporation of CNTs into composite membranes confers an improved resistance to fouling caused by biomacromolecules and bacteria. These results are discussed, along with evidence that demonstrates it is possible to further reduce fouling by taking advantage of the inherent conductivity of composite membranes containing CNTs, as well as by using different types of electrochemical stimuli.
Formation of siliceous sediments in brandy after diatomite filtration.
Gómez, J; Gil, M L A; de la Rosa-Fox, N; Alguacil, M
2015-03-01
Brandy is quite a stable spirit but sometimes light sediment appears. This sediment was separated and analysed by IR and SEM-EDX. It was revealed that the sediment is composed mostly of silica and residual organic matter. Silica was present as an amorphous phase and as microparticles. In an attempt to reproduce the formation of the sediment, a diatomite extract was prepared with an ethanol/water mixture (36% vol.) and a calcined diatomite similar to that used in brandy filtration. This extract was added to unfiltered brandy in different amounts. After 1 month, the Si concentration decreased in all samples and sediments with similar compositions and features to those found in the unstable brandy appeared. The amounts of sediment obtained were directly related to the decrease in Si concentration in solution. Consequently, it can be concluded that siliceous sediment in brandy originates from Si released during diatomite filtration. Copyright © 2014 Elsevier Ltd. All rights reserved.
Pizano, Camila; Mangan, Scott A; Graham, James H; Kitajima, Kaoru
2017-09-01
Plant-soil interactions have been shown to determine plant community composition in a wide range of environments. However, how plants distinctly interact with beneficial and detrimental organisms across mosaic landscapes containing fragmented habitats is still poorly understood. We experimentally tested feedback responses between plants and soil microbial communities from adjacent habitats across a disturbance gradient within a human-modified tropical montane landscape. In a greenhouse experiment, two components of soil microbial communities were amplified; arbuscular mycorrhizal fungi (AMF) and a filtrate excluding AMF spores from the soils of pastures (high disturbance), coffee plantations (intermediate disturbance), and forest fragments (low disturbance), using potted seedlings of 11 plant species common in these habitats (pasture grass, coffee, and nine native species). We then examined their effects on growth of these same 11 host species with reciprocal habitat inoculation. Most plant species received a similar benefit from AMF, but differed in their response to the filtrates from the three habitats. Soil filtrate from pastures had a net negative effect on plant growth, while filtrates from coffee plantations and forests had a net positive effect on plant growth. Pasture grass, coffee, and five pioneer tree species performed better with the filtrate from "away" (where these species rarely occur) compared to "home" (where these species typically occur) habitat soils, while four shade-tolerant tree species grew similarly with filtrates from different habitats. These results suggest that pastures accumulate species-specific soil enemies, while coffee plantations and forests accumulate beneficial soil microbes that benefit pioneer native plants and coffee, respectively. Thus, compared to AMF, soil filtrates exerted stronger habitat and host-specific effects on plants, being more important mediators of plant-soil feedbacks across contrasting habitats. © 2017 by
Osteoblast Differentiation and Bone Matrix Formation In Vivo and In Vitro.
Blair, Harry C; Larrouture, Quitterie C; Li, Yanan; Lin, Hang; Beer-Stoltz, Donna; Liu, Li; Tuan, Rocky S; Robinson, Lisa J; Schlesinger, Paul H; Nelson, Deborah J
2017-06-01
We review the characteristics of osteoblast differentiation and bone matrix synthesis. Bone in air breathing vertebrates is a specialized tissue that developmentally replaces simpler solid tissues, usually cartilage. Bone is a living organ bounded by a layer of osteoblasts that, because of transport and compartmentalization requirements, produce bone matrix exclusively as an organized tight epithelium. With matrix growth, osteoblasts are reorganized and incorporated into the matrix as living cells, osteocytes, which communicate with each other and surface epithelium by cell processes within canaliculi in the matrix. The osteoblasts secrete the organic matrix, which are dense collagen layers that alternate parallel and orthogonal to the axis of stress loading. Into this matrix is deposited extremely dense hydroxyapatite-based mineral driven by both active and passive transport and pH control. As the matrix matures, hydroxyapatite microcrystals are organized into a sophisticated composite in the collagen layer by nucleation in the protein lattice. Recent studies on differentiating osteoblast precursors revealed a sophisticated proton export network driving mineralization, a gene expression program organized with the compartmentalization of the osteoblast epithelium that produces the mature bone matrix composite, despite varying serum calcium and phosphate. Key issues not well defined include how new osteoblasts are incorporated in the epithelial layer, replacing those incorporated in the accumulating matrix. Development of bone in vitro is the subject of numerous projects using various matrices and mesenchymal stem cell-derived preparations in bioreactors. These preparations reflect the structure of bone to variable extents, and include cells at many different stages of differentiation. Major challenges are production of bone matrix approaching the in vivo density and support for trabecular bone formation. In vitro differentiation is limited by the organization and
Use of nano filtration membrane technology for ceramic industry wastewater treatment
Energy Technology Data Exchange (ETDEWEB)
Moliner-Salvador, R.; Deratani, A.; Palmeri, J.; Sanchez, E.
2012-07-01
A study has been undertaken of an advanced wastewater treatment approach using polymer nano filtration membranes, in an attempt to obtain water of sufficient quality to allow it to be reused in the same production process or, alternatively, to be discharged without any problems. The study has initially focused on the removal of organic matter (reduction of COD) and the most representative ions present in the wastewater, such as Na{sup +}, Mg{sup 2}+, Cl{sup -}, and SO{sub 4}{sup 2}. In a first part of the study, with a view to optimising the experimental phase, a simulation has been performed of the nano filtration process using the Nano Flux software. Among other things, the simulation allows the most suitable membranes to be selected as a function of the permeate flow rate and desired level of retention in the substances to be removed. The subsequent experimentation was carried out in a laboratory tangential filtration system that works with flat membranes. It was found that retention values of about 90% were obtained for the studied substances, with a good permeate flow rate, using low operating pressures. These results demonstrate the feasibility of the studied technology and its potential as a treatment for improving ceramic industry wastewater quality.
Directory of Open Access Journals (Sweden)
Esther Lorente
2018-03-01
Full Text Available The aim of this study is to explore an innovative downstream route for microalgae processing to reduce cost production. Experiments have been carried out on cell disruption and fractionation stages to recover lipids, sugars, and proteins. Steam explosion and dynamic membrane filtration were used as unit operations. The species tested were Nannochloropsis gaditana, Chlorella sorokiniana, and Dunaliella tertiolecta with different cell wall characteristics. Acid-catalysed steam explosion permitted cell disruption, as well as the hydrolysis of carbohydrates and partial hydrolysis of proteins. This permitted a better access to non-polar solvents for lipid extraction. Dynamic filtration was used to moderate the impact of fouling. Filtration enabled two streams: A permeate containing water and monosaccharides and a low-volume retentate containing the lipids and proteins. The necessary volume of solvent to extract the lipids is thus much lower. An estimation of operational costs of both steam explosion and membrane filtration was performed. The results show that the steam explosion operation cost varies between 0.005 $/kg and 0.014 $/kg of microalgae dry sample, depending on the cost of fuel. Membrane filtration cost in fractionation was estimated at 0.12 $/kg of microalgae dry sample.
International Nuclear Information System (INIS)
Eakin, D.E.
1996-03-01
Process waste streams from the Hanford Waste Vitrification Plant (HWVP) may require treatment for cesium, strontium, and transuranic (TRU) element removal in order to meet criteria for incorporation in grout. The approach planned for cesium and strontium removal is ion exchange using a zeolite exchanger followed by filtration. Filtration using a pneumatic hydropulse filter is planned to remove TRU elements which are associated with process solids and to also remove zeolite bearing the cesium and strontium. The solids removed during filtration are recycled to the melter feed system to be incorporated into the HWVP glass product. Fluor Daniel, Inc., the architect-engineering firm for HWVP, recommended a Pneumatic Hydropulse (PHP) filter manufactured by Mott Metallurgical Corporation for use in the HWVP. The primary waste streams considered for application of zeolite contact and filtration are melter off-gas condensate from the submerged bed scrubber (SBS), and equipment decontamination solutions from the Decontamination Waste Treatment Tank (DWTT). Other waste streams could be treated depending on TRU element and radionuclide content. Laboratory and pilot-scale filtration tests were conducted to provide a preliminary assessment of the adequacy of the recommended filter for application to HWVP waste treatment
Use of ultra-filtration in organic-rich groundwater for the physical separation of thorium
International Nuclear Information System (INIS)
Singhal, R.K.; Basu, H.; Pimple, M.V.; Manisha, V.; Bassan, M.K.T.; Reddy, A.V.R.
2014-01-01
During this work, size fractionation technique 'ultra filtration' is used in physical speciation of thorium in organic rich groundwater. Laboratory simulated experiments were carried out to study the physical speciation of thorium in aquatic environment having elevated level of dissolved humus material classified as dissolved organic carbon (DOC). Samples were collected from organic rich environment having DOC in the range of 50-60 μg mL -1 . Th(IV) ions are extremely particle reactive having K d value of the order of 105-6, hence to avoid adsorption on suspended particulate matter, spiking of the solution with Th(NO 3 )4 was carried out in ground water samples after filtering through 450 nm pore size using suction filtration. Particles in dissolved state (colloids) ranging between 220 nm were separated using suction filtration assembly having a membrane with a pore diameter of 220 nm. Thereafter, solution was sequentially passed through the ultra-filtration membranes having pore diameters of 14 nm [300 k NMWL (nominal molecular weight limit)], 3.1 nm (50 k NMWL), 2.2 nm (30 k NMWL), 1.6 nm (10 k NMWL) and 1.1 nm (0.5 k NMWL) by using 'Stirred Ultra-filtration Cells', operating in concentration mode. Thorium has only one stable oxidation state i.e. IV, under all redox conditions in natural waters and therefore, its speciation is dominated by its interaction with various fractions of DOC. Experimental results show 50-60 % of the spiked Th is in association with fraction enriched with particles of 10 k NMWL (1.6 nm) followed by fraction enriched with particle of 0.5 k NMWL and <220 nm. (author)