Molecular genetic features of polyploidization and aneuploidization reveal unique patterns for genome duplication in diploid Malus.

Science.gov (United States)

Considine, Michael J; Wan, Yizhen; D'Antuono, Mario F; Zhou, Qian; Han, Mingyu; Gao, Hua; Wang, Man

2012-01-01

Polyploidization results in genome duplication and is an important step in evolution and speciation. The Malus genome confirmed that this genus was derived through auto-polyploidization, yet the genetic and meiotic mechanisms for polyploidization, particularly for aneuploidization, are unclear in this genus or other woody perennials. In fact the contribution of aneuploidization remains poorly understood throughout Plantae. We add to this knowledge by characterization of eupolyploidization and aneuploidization in 27,542 F₁ seedlings from seven diploid Malus populations using cytology and microsatellite markers. We provide the first evidence that aneuploidy exceeds eupolyploidy in the diploid crosses, suggesting aneuploidization is a leading cause of genome duplication. Gametes from diploid Malus had a unique combinational pattern; ova preserved euploidy exclusively, while spermatozoa presented both euploidy and aneuploidy. All non-reduced gametes were genetically heterozygous, indicating first-division restitution was the exclusive mode for Malus eupolyploidization and aneuploidization. Chromosome segregation pattern among aneuploids was non-uniform, however, certain chromosomes were associated for aneuploidization. This study is the first to provide molecular evidence for the contribution of heterozygous non-reduced gametes to fitness in polyploids and aneuploids. Aneuploidization can increase, while eupolyploidization may decrease genetic diversity in their newly established populations. Auto-triploidization is important for speciation in the extant Malus. The features of Malus polyploidization confer genetic stability and diversity, and present heterozygosity, heterosis and adaptability for evolutionary selection. A protocol using co-dominant markers was proposed for accelerating apple triploid breeding program. A path was postulated for evolution of numerically odd basic chromosomes. The model for Malus derivation was considerably revised. Impacts of

Natural membranes of Hevea brasiliensis latex as delivery system for Casearia sylvestris leaf components

Directory of Open Access Journals (Sweden)

Flávio A. Carvalho

Full Text Available ABSTRACT Natural latex from Hevea brasiliensis (Wild. ex A.Juss Müll.Arg., Euphorbiaceae, showed angiogenic action and Casearia sylvestris Sw., Salicaceae, leaf derivatives presented anti-inflammatory and wound healing activities. Therefore, an association of these effects was interesting for wound healing applications. The aims of this study were the development of membranes of natural latex incorporated with C. sylvestris leaf derivatives (ethanolic extract, diterpene concentrated fraction and casearin J, their chemical and physical characterization, and the evaluation of in vitro skin permeation and retention of C. sylvestris bioactive secondary metabolites (diterpenes and phenolic compounds. The membranes were developed mixing hydroethanolic solutions of C. sylvestris derivatives with latex and drying them in a desiccator. They were characterized by infrared spectroscopy, scanning electron microscopy, water vapor permeability and mechanical resistance assays, demonstrating that all membranes were permeable, resistant and homogeneous in surfaces. The permeation and retention assays demonstrated dermal penetration of phenolic compounds for ethanolic extract membrane and of casearin-like clerodane diterpenes for all membranes, indicating that these membranes have great potential for therapeutical application as a topical system for C. sylvestris components releasing.

Catalytic Properties and Immobilization Studies of Catalase from Malva sylvestris L.

OpenAIRE

Arabaci, G.; Usluoglu, A.

2013-01-01

Catalase was partially purified from Malva sylvestris L. and immobilized onto chitosan. Then, its catalytic properties were investigated. (NH4)2SO4 precipitation and dialysis were performed in the extracted enzyme. Further purification was performed with sephadex G-200 column. Kinetic studies of the purified enzyme activity were measured and characterized. The inhibitory effects of KCN, NaN3, CuSO4, and EDTA on M. sylvestris L. catalase activity were observed except NaCl. Furthermore, M. sylv...

Catalytic Properties and Immobilization Studies of Catalase from Malva sylvestris L.

Directory of Open Access Journals (Sweden)

G. Arabaci

2013-01-01

Full Text Available Catalase was partially purified from Malva sylvestris L. and immobilized onto chitosan. Then, its catalytic properties were investigated. (NH42SO4 precipitation and dialysis were performed in the extracted enzyme. Further purification was performed with sephadex G-200 column. Kinetic studies of the purified enzyme activity were measured and characterized. The inhibitory effects of KCN, NaN3, CuSO4, and EDTA on M. sylvestris L. catalase activity were observed except NaCl. Furthermore, M. sylvestris L. catalase was immobilized covalently with glutaraldehyde onto chitosan particles. The pH and temperature optima as well as the changes in the kinetics (Km, Vmax of the immobilized and free M. sylvestris L. catalase were determined. The Km value for immobilized catalase (23.4 mM was higher than that of free enzyme (17.6 mM. Optimum temperature was observed higher than that of the free enzyme. The optimum pH was the same for both free and immobilized catalases (pH 7.50. Immobilized catalase showed higher storage and thermal stabilities than free catalases. Free catalase lost all its activity within 60 days whereas immobilized catalase lost 45% of its activity during the same incubation period at 4°C. The remaining immobilized catalase activity was about 70% after 8 cycles of batch operations.

A phytochemical study of lignans in whole plants and cell suspension cultures of Anthriscus sylvestris

NARCIS (Netherlands)

Koulman, A; Kubbinga, M.E.; Batterman, S; Woerdenbag, H.J.; Pras, N.; Woolley, J.G.; Quax, Wim

2003-01-01

In the roots of Anthriscus sylvestris 12 different lignans were detected. Arctigenin, dimethylmatairesinol, dimethylthujaplicatin, podophyllotoxin, 7-hydroxyyatein and 7-hydroxyanhydropodorhizol have not been previously reported to be present in A. sylvestris. In the cell suspension cultures, which

Differential dependence of apple ( Malus domestica Borkh.) cultivars ...

African Journals Online (AJOL)

Golden Delicious' and 'Topred' apple (Malus domestica Borkh.) peel on the xanthophyll cycle for photoprotection was studied under laboratory conditions. Mature fruit peel was either treated with 1 mm dithiothreitol (DTT) to inhibit the ...

Volatile components from Anthriscus sylvestris (L.) Hoffm

NARCIS (Netherlands)

Bos, R.; Koulman, A; Woerdenbag, H.J.; Quax, Wim; Pras, N.

2002-01-01

The volatile components of fresh leaves and roots from Anthriscus sylvestris (L.) Hoffm., obtained through hydrodistillation, were analysed by GC and GC-MS. This was compared to dichloromethane extracts of both fresh and dried leaf and root material. The monoterpene fraction (69-70%) dominated,

Larvicidal efficacies and chemical composition of essential oils of Pinus sylvestris and Syzygium aromaticum against mosquitoes.

Science.gov (United States)

Fayemiwo, Kehinde Adenike; Adeleke, Monsuru Adebayo; Okoro, Ovie Princewill; Awojide, Shola Hezekiah; Awoniyi, Ilias Olufemi

2014-01-01

To assess the chemical composition and mosquito larvicidal potentials of essential oils of locally sourced Pinus sylvestris (P. sylvestris) and Syzygium aromaticum (S. aromaticum) against Aedes aegypti (A. aegypti) and Culex quinquefasciatus (C. quinquefasciatus). The chemical composition of the essential oils of both plants was determined using GC-MS while the larvicidal bioassay was carried out using different concentrations of the oils against the larvae of A. aegypti and C. quinquefasciatus in accordance with the standard protocol. The results as determined by GC-MS showed that oil of S. aromaticum has eugenol (80.5%) as its principal constituent while P. sylvestris has 3-Cyclohexene-1-methanol, .alpha., .alpha.4-trimethyl (27.1%) as its dominant constituent. Both oils achieved over 85% larval mortality within 24 h. The larvae of A. aegypti were more susceptible to the oils [LC50 (S. aromaticum)=92.56 mg/L, LC50(P. sylvestris)=100.39 mg/L] than C. quinquefasciatus [LC50(S. aromaticum)=124.42 mg/L; LC50(P. sylvestris)=128.00 mg/L]. S. aromaticum oil was more toxic to the mosquito larvae than oil of P. sylvestris but the difference in lethal concentrations was insignificant (P>0.05). The results justify the larvicidal potentials of both essential oils and the need to incorporate them in vector management and control. Copyright © 2014 Asian Pacific Tropical Biomedical Magazine. Published by Elsevier B.V. All rights reserved.

Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study

OpenAIRE

Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

2018-01-01

RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an...

A genome-wide expression profile of salt-responsive genes in the apple rootstock Malus zumi.

Science.gov (United States)

Li, Qingtian; Liu, Jia; Tan, Dunxian; Allan, Andrew C; Jiang, Yuzhuang; Xu, Xuefeng; Han, Zhenhai; Kong, Jin

2013-10-18

In some areas of cultivation, a lack of salt tolerance severely affects plant productivity. Apple, Malus x domestica Borkh., is sensitive to salt, and, as a perennial woody plant the mechanism of salt stress adaption will be different from that of annual herbal model plants, such as Arabidopsis. Malus zumi is a salt tolerant apple rootstock, which survives high salinity (up to 0.6% NaCl). To examine the mechanism underlying this tolerance, a genome-wide expression analysis was performed, using a cDNA library constructed from salt-treated seedlings of Malus zumi. A total of 15,000 cDNA clones were selected for microarray analysis. In total a group of 576 cDNAs, of which expression changed more than four-fold, were sequenced and 18 genes were selected to verify their expression pattern under salt stress by semi-quantitative RT-PCR. Our genome-wide expression analysis resulted in the isolation of 50 novel Malus genes and the elucidation of a new apple-specific mechanism of salt tolerance, including the stabilization of photosynthesis under stress, involvement of phenolic compounds, and sorbitol in ROS scavenging and osmoprotection. The promoter regions of 111 genes were analyzed by PlantCARE, suggesting an intensive cross-talking of abiotic stress in Malus zumi. An interaction network of salt responsive genes was constructed and molecular regulatory pathways of apple were deduced. Our research will contribute to gene function analysis and further the understanding of salt-tolerance mechanisms in fruit trees.

In vitro regeneration of wild chervil (Anthriscus sylvestris L.)

NARCIS (Netherlands)

Hendrawati, Oktavia; Hille, Jacques; Woerdenbag, Herman J.; Quax, Wim J.; Kayser, Oliver; Finer, J.

Anthriscus sylvestris (L.) Hoffm. (Apiaceae) is a common wild plant that accumulates the lignan deoxypodophyllotoxin. Deoxypodophyllotoxin can be hydroxylated at the C-7 position in recombinant organisms yielding podophyllotoxin, which is used as a semi-synthetic precursor for the anticancer drugs,

Folk uses and pharmacological properties of Casearia sylvestris: a medicinal review

Directory of Open Access Journals (Sweden)

Paulo Michel P. Ferreira

2011-12-01

Full Text Available Folk uses and scientific investigations have highlighted the importance of Casearia sylvestris extracts and their relevant bioactive potential. The aim of this work was to review the pharmacological properties of C. sylvestris, emphasizing its anti-ulcer, anti-inflammatory, anti-ophidian and antitumor potentialities. Ethanolic extracts and essential oil of their leaves have antiulcerogenic activity and reduce gastric volume without altering the stomach pH, which corroborates their consumption on gastrointestinal disorders. Leaf water extracts show phospholipase A2 inhibitory activity that prevents damage effects on the muscular tissue after toxin inoculation. This antiphospholipasic action is probably related to the use as an anti-inflammatory, proposing a pharmacological blockage similar to that obtained with non-steroidal anti-inflammatory drugs on arachidonic acid and cyclooxygenase pathways. Bioguided-assay fractionations lead to the identification of secondary metabolites, especially the clerodane diterpenes casearins (A-X and casearvestrins (A-C, compounds with a remarkable cytotoxic and antitumor action. Therefore, the C. sylvestris shrub holds a known worldwide pharmacological arsenal by its extensive folk utilization, exciting searches for new molecules and a better comprehension about biological properties.Usos populares e pesquisas científicas têm destacado a importância dos extratos da planta Casearia sylvestris e seu grande potencial bioativo. Neste trabalho, objetiva-se revisar as propriedades farmacológicas de C. sylvestris, enfatizando sua potencialidade antiulcerogênica, antiinflamatória, antiofídica e antitumoral. O extrato etanólico e o óleo essencial das folhas possuem atividade antiulcerogênica promissora, diminuindo o volume gástrico sem alterar o pH estomacal, corroborando sua aplicação contra dores gastrointestinais. Já os extratos aquosos das folhas têm atividade inibitória contra fosfolipase A2 presente

Recovery patterns, histological observations and genetic integrity in Malus shoot tips cryopreserved using droplet vitrification and encapsulation-dehydration procedures

Science.gov (United States)

A droplet-vitrification procedure is described for cryopreservation of Malus shoot tips. Survival patterns, recovery types, histological observations, and genetic integrity were compared for Malus shoot tips cryopreserved using this droplet-vitrification procedure and an encapsulation-dehydration pr...

An interesting chemical polymorphism in Pinus sylvestris L.

Directory of Open Access Journals (Sweden)

Jerzy Szweykowski

2014-01-01

Full Text Available Intra- and interpopulational polymorphism in the production of phenolic compounds is described in Polish populations of Pinus sylvestris L. Two mutually exclusive forms of pine trees are present in changing proportions in all populations studied. This allows three groups of populations to be distinguished. The character of this differentiation is discussed.

Experimental data of biomaterial derived from Malva sylvestris and charcoal tablet powder for Hg2+ removal from aqueous solutions

Directory of Open Access Journals (Sweden)

Alireza Rahbar

2016-09-01

Full Text Available In this experimental data article, a novel biomaterial was provided from Malva sylvestris and characterized its properties using various instrumental techniques. The operating parameters consisted of pH and adsorbent dose on Hg2+ adsorption from aqueous solution using M. sylvestris powder (MSP were compared with charcoal tablet powder (CTP, a medicinal drug. The data acquired showed that M. sylvestris is a viable and very promising alternative adsorbent for Hg2+ removal from aqueous solutions. The experimental data suggest that the MSP is a potential adsorbent to use in medicine for treatment of poisoning with heavy metals; however, the application in animal models is a necessary step before the eventual application of MSP in situations involving humans. Keywords: Adsorption, Biomaterial, Hg2+ ion, Malva sylvestris, Charcoal tablet

Delta 13C predicts water deficit sensitivity in Malus sieversii (Ledeb.) M. Roem. from a xerophytic site in Kazakhstan

Science.gov (United States)

Modern apples [Malus x domestica (Borkh.)] are thought to have originated in western China from the progenitor species, Malus sieversii (Ledeb.) M. Roem. Due to many generations of selection for traits associated with high fruit quality, our current breeding germplasm has become dangerously narrow....

[Pathways and rates of Pinus sylvestris L. and Picea species recolonization into Scandinavia in Holocene].

Science.gov (United States)

Sannikov, S N; Sannikova, N S

2015-01-01

The results are presented of comparative analysis of pathways, rates, and timing of recolonization into Scandinavia, in Holocene, of Pinus sylvestris populations and those of Picea abies and P. obovata. The dispersion rate, starting from 12 thou years before present (BP), is calculated using palynological data from scientific literature on radiometric dating. It is found out that P sylvestris spread into Central Scandinavia from the Alps via the Danish Isthmus about 8.2 thou years BP with the speed of 500-1250 km per 1 thou years. A hypothesis is put forward suggesting that such a fast speed is due to pine seeds hydrochory, which is much faster than anemochory according to our researches. From the northern part of the East European Plain, P. sylvestris spread into Fennoscandia with lower speed (520 km per 1 thou years). Populations of Picea species dispersed from the same regions with speed (131-164 km per 1 thou years) 3-10 times lower than that of P. sylvestris. Therefore, invasion of Picea abies from the Alps into Scandinavia via the Danish Isthmus did not have time to happen before the formation of the Kattegat Strait. By circumferential pathway, through Karelia, both species of Picea reached the northern parts of Scandinavia only 3.5 thou years BP, its central parts - 2 thou years BP, and its southern parts - 1.5 thou years BP, i.e., later than P. sylvestris by 4, 6.2, and 8.5 thou years respectively. Probably, this may be explained by the fact that in pines the time to seeding is twofold shorter, while their sprouts were more tolerant to climatic extremums in periglacial habitats in middle Holocene.

Intracellular localization of Na + /H + antiporter from Malus zumi ...

African Journals Online (AJOL)

In this study, we examined the intracellular localization of the product of Na+/H+ antiporter gene (MzNHX1) cloned from Malus zumi. Analysis using yeast cells expressing a fusion protein of MzNHX1 and green fluorescent protein confirmed the localization of MzNHX1 on the tonoplast.

Drought resistance of Pinus sylvestris seedlings conferred by plastic root architecture rather than ectomycorrhizal colonisation

OpenAIRE

Moser , Barbara; Kipfer , Tabea; Richter , Sarah; Egli , Simon; Wohlgemuth , Thomas

2015-01-01

International audience; Abstract ContextIncreased summer drought is considered as a threat to the regeneration of Pinus sylvestris in the Central Alps. To a certain degree, seedlings are able to mitigate negative effects of drought by altering root/shoot ratios. But, seedlings may also enhance access to water and nutrients by cooperation with ectomycorrhizal fungi. AimsWe tested the importance of both mechanisms for drought resistance of P. sylvestris seedlings during early establishment and ...

Perspective of use of Pinus sylvestris L. as biological indicator of areas with low level radioactive pollution

International Nuclear Information System (INIS)

Dragan, G.I.; Dragan, N.V.; Levon, F.M.

2006-01-01

Research indicates data about distinct of Pinus sylvestris as biological indicator. Especially important is discovered distinctiveness of reactions of Pinus sylvestris to low level radioactive pollution. To identify radioactive pollution in habitats using biological indicators it is recommended the following complex of markers of functions of vegetative and reproductive systems of Pinus sylvestris: specific changes in architectonic of tree crowns; increase in number of annual cycles of growth to two or three and duration of active vegetation drastic change in morphogenesis of vegetative shoots in secondary (summer) shoots; formation of intermediate structures (combined buds and shoots) with mosaic development of some metamers with regular or affected structure; stimulation of buds (general increase of points of growth and appearance of additional ways of their formation); specific changes in gistogenesis of needles; hollow tar channels filled with sclerenhyma or parenchyma ect.; interruption of morphogenesis of male reproductive shoots; increase in the number of abnormal pollen grains to 70%; abnormal branching of pollen channels. All affects in vegetative system of Pinus sylvestris take place at the age of up to 12-14 (20) years. (authors)

Foliar fungi of Scots pine (Pinus sylvestris)

OpenAIRE

Millberg, Hanna

2015-01-01

Scots pine (Pinus sylvestris) is an ecologically and economically important tree species in Fennoscandia. Scots pine needles host a variety of fungi, some with the potential to profoundly influence their host. These fungi can have beneficial or detrimental effects with important implications for both forest health and primary production. In this thesis, the foliar fungi of Scots pine needles were investigated with the aim of exploring spatial and temporal patterns, and development with needle...

The Polarization of Light and Malus' Law Using Smartphones

Science.gov (United States)

Monteiro, Martín; Stari, Cecilia; Cabeza, Cecilia; Marti, Arturo C.

2017-01-01

Originally an empirical law, nowadays Malus' law is seen as a key experiment to demonstrate the transverse nature of electromagnetic waves, as well as the intrinsic connection between optics and electromagnetism. In this work, a simple and inexpensive setup is proposed to quantitatively verify the nature of polarized light. A flat computer screen…

Evaluation of genetic diversity of Portuguese Pinus sylvestris L.

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 92; Online resources. Evaluation of genetic diversity of Portuguese Pinus sylvestris L. populations based on molecular data and inferences about the future use of this germplasm. J. Cipriano A. Carvalho C. Fernandes M. J. Gaspar J. Pires J. Bento L. Roxo J. Louzada J. Lima- ...

ECOLOGIC FEATURES OF WOOD ANATOMY OF Casearia sylvestris SW (SALICACEAE IN THREE BRAZILIAN ECOSYSTEMS

Directory of Open Access Journals (Sweden)

Graciene da Silva Mota

2017-12-01

Full Text Available Casearia sylvestris SW (Salicaceae is a highly adaptive perennial species that is found throughout Latin America and widely spread in Brazil. This work analyzed the ecological features of wood anatomy of C. sylvestris occurring in three ecosystem types: Cerrado, Gallery Forest (Northern of Minas Gerais and Mata Atlântica (Southern of Minas Gerais. Qualitative features were similar among plants in the three ecosystems, differing only in the distribution of pith flecks and neighboring tyloses that were more frequent in Cerrado and Gallery Forest. The quantitative results showed significant differences for several parameters, as well as variation between individuals of vegetation types of Northern and Southern of Minas Gerais. The correlation matrix of variables including quantitative anatomical characteristics, soil characteristics, height and diameter of the plants showed that plants were grouped by ecosystem type. Casearia sylvestris might adopt different survival strategies regarding safety and efficiency of water transport by wood anatomy ecological adaptation. The adaptive anatomical features to drought were mostly an decrease of vessel frequency and an increase of ray width and frequency.

Alelopatia de Joanesia princeps Vell. e Casearia sylvestris Sw. sobre espécies cultivadas

Directory of Open Access Journals (Sweden)

Rafael Aguiar Capobiango

Full Text Available Metabólitos secundários produzidos em algumas plantas podem provocar alterações no desenvolvimento de outras plantas ou até mesmo de outros organismos. O objetivo do trabalho foi avaliar o efeito alelopático de extratos aquosos de folhas de Joanesia princeps e Casearia sylvestris na germinação e no desenvolvimento inicial de plântulas de Brassica oleracea cv. capitata, Lactuca sativa cv. grand rapids e Lycopersicum esculentum. Foram testadas seis concentrações de cada extrato (10, 30, 50, 70, 90 e 100% além do controle água destilada. Os extratos aquosos de J. princeps e C. sylvestris reduziram e, ou inibiram significativamente o percentual de geminação das sementes, o crescimento inicial da parte aérea e do sistema radicular de todas as espécies cultivadas e causaram severas anormalidades nas plântulas. Os resultados indicam a existência de potencial alelopático de J. princeps e C. sylvestris.

Anti-trypanosomal effect of Malva sylvestris (Malvaceae) extract on a ...

African Journals Online (AJOL)

Methods: Sleeping sickness was induced by the intraperitoneal injection of ... count in the blood and CSF of mice with Trypanosoma brucei brucei-induced sleeping sickness compared ... The whole plant of Malva sylvestris was collected ... The animals were anesthetized by ... significantly (p < 0.01) improved the weight of.

Xylem and Leaf Functional Adjustments to Drought in Pinus sylvestris and Quercus pyrenaica at Their Elevational Boundary.

Science.gov (United States)

Fernández-de-Uña, Laura; Rossi, Sergio; Aranda, Ismael; Fonti, Patrick; González-González, Borja D; Cañellas, Isabel; Gea-Izquierdo, Guillermo

2017-01-01

Climatic scenarios for the Mediterranean region forecast increasing frequency and intensity of drought events. Consequently, a reduction in Pinus sylvestris L. distribution range is projected within the region, with this species being outcompeted at lower elevations by more drought-tolerant taxa such as Quercus pyrenaica Willd. The functional response of these species to the projected shifts in water availability will partially determine their performance and, thus, their competitive success under these changing climatic conditions. We studied how the cambial and leaf phenology and xylem anatomy of these two species responded to a 3-year rainfall exclusion experiment set at their elevational boundary in Central Spain. Additionally, P. sylvestris leaf gas exchange, water potential and carbon isotope content response to the treatment were measured. Likewise, we assessed inter-annual variability in the studied functional traits under control and rainfall exclusion conditions. Prolonged exposure to drier conditions did not affect the onset of xylogenesis in either of the studied species, whereas xylem formation ceased 1-3 weeks earlier in P. sylvestris . The rainfall exclusion had, however, no effect on leaf phenology on either species, which suggests that cambial phenology is more sensitive to drought than leaf phenology. P. sylvestris formed fewer, but larger tracheids under dry conditions and reduced the proportion of latewood in the tree ring. On the other hand, Q. pyrenaica did not suffer earlywood hydraulic diameter changes under rainfall exclusion, but experienced a cumulative reduction in latewood width, which could ultimately challenge its hydraulic performance. The phenological and anatomical response of the studied species to drought is consistent with a shift in resource allocation under drought stress from xylem to other sinks. Additionally, the tighter stomatal control and higher intrinsic water use efficiency observed in drought-stressed P. sylvestris

Xylem and Leaf Functional Adjustments to Drought in Pinus sylvestris and Quercus pyrenaica at Their Elevational Boundary

Directory of Open Access Journals (Sweden)

Laura Fernández-de-Uña

2017-07-01

Full Text Available Climatic scenarios for the Mediterranean region forecast increasing frequency and intensity of drought events. Consequently, a reduction in Pinus sylvestris L. distribution range is projected within the region, with this species being outcompeted at lower elevations by more drought-tolerant taxa such as Quercus pyrenaica Willd. The functional response of these species to the projected shifts in water availability will partially determine their performance and, thus, their competitive success under these changing climatic conditions. We studied how the cambial and leaf phenology and xylem anatomy of these two species responded to a 3-year rainfall exclusion experiment set at their elevational boundary in Central Spain. Additionally, P. sylvestris leaf gas exchange, water potential and carbon isotope content response to the treatment were measured. Likewise, we assessed inter-annual variability in the studied functional traits under control and rainfall exclusion conditions. Prolonged exposure to drier conditions did not affect the onset of xylogenesis in either of the studied species, whereas xylem formation ceased 1–3 weeks earlier in P. sylvestris. The rainfall exclusion had, however, no effect on leaf phenology on either species, which suggests that cambial phenology is more sensitive to drought than leaf phenology. P. sylvestris formed fewer, but larger tracheids under dry conditions and reduced the proportion of latewood in the tree ring. On the other hand, Q. pyrenaica did not suffer earlywood hydraulic diameter changes under rainfall exclusion, but experienced a cumulative reduction in latewood width, which could ultimately challenge its hydraulic performance. The phenological and anatomical response of the studied species to drought is consistent with a shift in resource allocation under drought stress from xylem to other sinks. Additionally, the tighter stomatal control and higher intrinsic water use efficiency observed in drought

Antioxidant, antimicrobial activity and mineral composition of low-temperature fractioning products of Malus domestica Borkh (common Antonovka

Directory of Open Access Journals (Sweden)

Elena Kuznetsova

2017-01-01

Full Text Available The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has been performed. We obtained by fractionation the biologically active products that are the dehydrated concentrate of juice and the powder of pomace fibers. Use of low temperature minimizes biological value losses during processing. These fractions of fruit Malus domestica Borkh (Common Antonovka are experimentally studied. It is found that the fractions have high antioxidant activity and include bioflavonoids and organic and phenol carboxylic acids. Analysis of chromatograms showed availability of the identical compounds in the products of low-temperature fractionation. Sodium and potassium are part of the cells of biological systems as highly mobile ionic forms. Therefore, these elements prevail in the concentrated juice. Iron, manganese, copper, and zinc are biogenic trace elements or components of enzyme systems and are evenly distributed as in plant cell walls as well in protoplasm. It follows from the results of the study of the mineral composition that the products of the low-temperature fractioning can be used for a functional food as a result of its high content of magnesium and iron. The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has antimicrobial activity against the standard strains of spoilage: Bacillus subtilis VKM-B-501, Micrococcus luteus VKM-As-2230, Aspergillus flavus VKM-F-1024, Penicillium expansion VKM-F-275, Mucor mucedo VKM- F-1257, Rhizopus stolonifer VKM- F-2005. Experimental data show that the products of low-temperature fractioning of Malus domestica Borkh (Common Antonovka inhibit microorganism's growth. The detected composition of Malus domestica Borkh (Common Antonovka fractions allows using these products as natural additives in food technology to maintain and increase period of storage and also for preventive nutrition.

Identificação de diterpenos clerodânicos em diferentes órgãos de Casearia sylvestris Swartz

Directory of Open Access Journals (Sweden)

Elisângela Simões de Carvalho

2010-06-01

Full Text Available

Casearia sylvestris Swartz (Salicaceae é uma espécie vegetal arbórea ou arbustiva, disseminada pelo território brasileiro e bastante utilizada em nossa medicina popular. Diversos diterpenos clerodânicos bioativos típicos do gênero Casearia foram isolados desta espécie (ex. casearinas e casearvestrinas. O objetivo principal deste trabalho foi avaliar a presença de diterpenos clerodânicos em diferentes órgãos de C. sylvestris, utilizando técnicas analíticas cromatográficas e espectroscópicas. Os extratos dos diferentes órgãos foram analisados por cromatografia em camada delgada, cromatografia líquida de alta eficiência com detector de arranjo de diodos e ressonância magnética nuclear de 1H. Nas análises cromatográficas foram utilizados diterpenos clerodânicos isolados de C. sylvestris como padrões, incluindo rel-19S-acetóxi- 18R- butanoilóxi-18,19- epóxi -6S -hidróxi -2R- (2 metilbutanoilóxi -5S,8R, 9R, 10S -cleroda-3,13(16,14-trieno, isolado do caule pela primeira vez. Foram obtidos perfis fitoquímicos dos órgãos avaliados. Os resultados indicaram a presença de diterpenos clerodânicos em toda planta, prevalecendo em maior número nas folhas. Além disso, os resultados também indicam que em caules, flores e raízes há predomínio de diterpenos clerodânicos com padrão diênico diferente daqueles obtidos de folhas de C. sylvestris. Palavras-chave: Casearia sylvestris. Diterpenos clerodânicos. Salicaceae. Flacourtiaceae. Cromatografia. ABSTRACT Identification of clerodane diterpenes in different organs of Casearia sylvestris Swartz Casearia sylvestris Swartz (Salicaceae is a tree or shrub distributed widely in Brazil, where it is used in popular medicine. Several bioactive clerodane diterpenes typical of Casearia have been isolated from this species (e.g. casearins and casearvestrins. The main objective of this study was to identify clerodane diterpenes in various organs of C. sylvestris

Cytotoxic Deoxypodophyllotoxin Can Be Extracted in High Purity from Anthriscus sylvestris Roots by Supercritical Carbon Dioxide.

Science.gov (United States)

Seegers, Christel L C; Tepper, Pieter G; Setroikromo, Rita; Quax, Wim J

2018-05-01

Deoxypodophyllotoxin is present in the roots of Anthriscus sylvestris . This compound is cytotoxic on its own, but it can also be converted into podophyllotoxin, which is in high demand as a precursor for the important anticancer drugs etoposide and teniposide. In this study, deoxypodophyllotoxin is extracted from A. sylvestris roots by supercritical carbon dioxide extraction. The process is simple and scalable. The supercritical carbon dioxide method extracts 75 - 80% of the total deoxypodophyllotoxin content, which is comparable to a single extraction by traditional Soxhlet. However, less polar components are extracted. The activity of the supercritical carbon dioxide extract containing deoxypodophyllotoxin was assessed by demonstrating that the extract arrests A549 and HeLa cells in the G 2 /M phase of the cell cycle. We conclude that biologically active deoxypodophyllotoxin can be extracted from A. sylvestris by supercritical carbon dioxide extraction. The method is solvent free and more sustainable compared to traditional methods. Georg Thieme Verlag KG Stuttgart · New York.

Crop-to-wild gene flow and its fitness consequences for a wild fruit tree: Towards a comprehensive conservation strategy of the wild apple in Europe.

Science.gov (United States)

Feurtey, Alice; Cornille, Amandine; Shykoff, Jacqui A; Snirc, Alodie; Giraud, Tatiana

2017-02-01

Crop-to-wild gene flow can reduce the fitness and genetic integrity of wild species. Malus sylvestris , the European crab-apple fruit tree in particular, is threatened by the disappearance of its habitat and by gene flow from its domesticated relative , Malus domestica . With the aims of evaluating threats for M. sylvestris and of formulating recommendations for its conservation, we studied here, using microsatellite markers and growth experiments: (i) hybridization rates in seeds and trees from a French forest and in seeds used for replanting crab apples in agrosystems and in forests, (ii) the impact of the level of M. domestica ancestry on individual tree fitness and (iii) pollen dispersal abilities in relation to crop-to-wild gene flow. We found substantial contemporary crop-to-wild gene flow in crab-apple tree populations and superior fitness of hybrids compared to wild seeds and seedlings. Using paternity analyses, we showed that pollen dispersal could occur up to 4 km and decreased with tree density. The seed network furnishing the wild apple reintroduction agroforestry programmes was found to suffer from poor genetic diversity, introgressions and species misidentification. Overall, our findings indicate supported threats for the European wild apple steering us to provide precise recommendations for its conservation.

Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study.

Science.gov (United States)

Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

2018-01-31

RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an integrated approach of pathway- and gene- set enrichment analysis, Mapman visualization tool, gene ontology analysis and inferred protein-protein interaction network. Our meta-analysis revealed that the bacterial infection enhanced specifically genes involved in sugar alcohol metabolism. Brassinosteroids were upregulated by fungal pathogens while ethylene was highly affected by Erwinia amylovora. Gibberellins and jasmonates were strongly repressed by fungal and viral infections. The protein-protein interaction network highlighted the role of WRKYs in responses to the studied pathogens. In summary, our meta-analysis provides a better understanding of the Malus X domestica transcriptome responses to different biotic stress conditions; we anticipate that these insights will assist in the development of genetic resistance and acute therapeutic strategies. This work would be an example for next meta-analysis works aiming at identifying specific common molecular features linked with biotic stress responses in other specialty crops.

Evaluation of seed production of scots pine ( Pinus sylvestris L ...

African Journals Online (AJOL)

This research was carried out to investigate seed production in a 13 years-old scots pine (Pinus sylvestris L.) clonal seed orchard, including 30 clones. Eight of cone and seed traits as number of fertile and infertile scales, cone volume, cone number, filled and empty seed number, seed efficiency and 1000 seed weight were ...

Genetic variability in apple fruit polyphenol composition in Malus × domestica and Malus sieversii germplasm grown in New Zealand.

Science.gov (United States)

Volz, Richard K; McGhie, Tony K

2011-11-09

Variations in the concentrations of flavan-3-ol, oligomeric procyanidin, chlorogenic acid, dihydrochalcone, flavonol, and anthocyanin polyphenol groups and total polyphenols were examined in the fruit peel and cortical flesh of 93 (80 Malus × domestica and 13 Malus sieversii) apple genotypes in at least 1 year between 2003 and 2005 grown at one site in New Zealand (NZ). Differences among genotypes accounted for 46-97% of the total variation in the concentrations of total polyphenols and each of the individual phenol groups in the flesh and peel in both species, whereas effects of year and genotype × year were minimal, except for peel flavonols in M. × domestica and flesh flavonols in both species. In these cases, differences among genotypes accounted for less than 30% of the total variation, which was less than the variation found for the interaction between genotype and year. Total polyphenol concentrations among genotypes were spread over a 7- and 9-fold range in the flesh and a 4- and 3-fold range in the peel of M. sieversii and M. × domestica, respectively, with the spread in concentrations of individual polyphenol groups in each tissue and within each species varying from a 2-fold to over a 500-fold range. Higher concentrations were generally found in M. sieversii. In M. × domestica, cultivars and breeding selections originating in NZ had lower average flesh and peel total polyphenols and chlorogenic acid than older cultivars previously imported into NZ from overseas countries.

Characterisation of bacteria from Pinus sylvestris-Suillus luteus mycorrhizas and their effects on root-fungus interactions and plant growth.

Science.gov (United States)

Bending, Gary D; Poole, Elizabeth J; Whipps, John M; Read, David J

2002-03-01

Bacteria from Pinus sylvestris-Suillus luteus mycorrhizas were isolated, characterised, and their effects on P. sylvestris-S. luteus interactions and plant growth investigated in vitro. The isolates formed five distinct phenotypic and physiological groups. Two of the groups, accounting for 34 of the 55 isolates, consisted of Bacillus spp., with three subgroups represented. The other groups contained Burkholderia spp., Serratia spp. and Pseudomonas spp. Representatives from each bacterial group were used in microcosm experiments to investigate bacterial effects on P. sylvestris-S. luteus interactions. Most Bacillus isolates stimulated growth of S. luteus along the P. sylvestris root, while isolates of Pseudomonas and Serratia inhibited root colonisation by the fungus. Burkholderia and Serratia isolates inhibited ectomycorrhiza formation by 97 and 41% respectively, while a single Bacillus isolate doubled the formation of first order ectomycorrhizal roots. There were no clear relationships between effects of the bacteria on root colonisation by the fungus after 4 weeks, and chitinase production or subsequent ectomycorrhiza formation. However, isolates that inhibited ectomycorrhiza formation appeared to associate preferentially with ectomycorrhizal roots. Several isolates enhanced plant growth substantially, although these effects were unrelated to either root colonisation by the fungus or ectomycorrhiza formation.

A Comparative Study on Turpentine Oils of Oleoresins of Pinus sylvestris L. from Three Districts of Denizli

Directory of Open Access Journals (Sweden)

İbrahim Tümen

2010-10-01

Full Text Available Oleoresin samples collected from Pinus sylvestris L. trees from Acıpayam, Çal and Çamlıbel, three different locations in Denizli-Turkey. The constituents of the turpentine oil, obtained by hydrodistillation of oleoresin of Pinus sylvestris L., were identified by GC-MS. Fifty four constituents were detected from the turpentine oil, which constituted about between 96.2% and 98.2% of the total amount. Major constituents of the oil were a-pinene, b-pinene, camphene, longifolene, D3-carene, limonene and b-caryophyllene

Efeitos benéficos e maléficos da malva sylvestris

Directory of Open Access Journals (Sweden)

Ana Carolina Locatelli Ecker

2016-04-01

Full Text Available Objetivo. Revisar os efeitos benéficos e maléficos da Malva sylvestris para a saúde humana. Materiais e métodos. Foi realizada uma busca na base de dados BIREME, em setembro de 2014, por meio das pala­vras chaves malva AND sylvestris. Foram incluídos os artigos na língua inglesa e portuguesa sem limite de tempo. Foram excluídos os estudos repetidos e aqueles que não abordavam o tema. Resultados. Atra­vés da busca realizada, foram encontrados 56 artigos, destes, foram excluídos dois repetidos, um por encontrar-se no idioma chinês e, 41 por estarem fora do tema (benefícios para animais e solo, proprie­dades químicas da erva, pesquisa em campo de determinadas regiões do mundo abrangendo índices de utilização de muitas espécies de plantas para fins medicinais. Assim, foram, incluídos 12 artigos. Com grande importância terapêutica, a erva tem sido utilizada na área da saúde em geral para inflamações internas e externas, fins quimio-preventivos e antissépticos. Também alivia secreções como catarros, congestionamento das vias respiratórias e age como calmante no sistema neurológico. Segundo pes­quisas, o chá de malva apresenta resultados mais vantajosos do que tratamentos medicamentosos e é uma das mais utilizadas como auto-medicação. Conclusão. A Malva sylvestris é utilizada para muitos fins benéficos para o ser humano desde tempos remotos, mas sua comprovação científica tem ocorrido atualmente, evidenciando a veracidade de suas vantagens na saúde e no tratamento de patologias.

Modeling and performance of Bonus-Malus Systems: Stationarity versus age-correction

DEFF Research Database (Denmark)

Asmussen, Søren

In a bonus-malus system in car insurance, the bonus class of a customer is updated from a year to the next as a function of the current class and the number of claims in the year (assumed Poisson). Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of t...

Genetic diversity of Casearia sylvestris populations in remnants of the Atlantic Forest.

Science.gov (United States)

Araujo, F L; Siqueira, M V B M; Grando, C; Viana, J P G; Pinheiro, J B; Alves-Pereira, A; Campos, J B; Brancalion, P H S; Zucchi, M I

2017-01-23

Guaçatonga (Casearia sylvestris) is a native plant of the Atlantic Forest, with high medicinal potential and relevance for reforestation programs. The aim of this study was to characterize, with microsatellite markers, two populations of C. sylvestris from remaining areas of the Atlantic Forest in the State of São Paulo. High allelic variation was found in both populations (N A = 101 and 117; A R = 12.5 and 14.4), although with high endogamy coefficients (f = 0.640 and 0.363). Estimates of genetic structure suggested the presence of considerable genetic divergence between the populations (F ST = 0.103); however, there was no spatial genetic structure within the populations. Genetic divergence may have occurred due to decreased gene flow between the fragmented populations as the result of deforestation. The results of this study demonstrate the importance of genetic diversity and its characterization in native plants within remaining forest areas for the management and restoration of such areas.

Salinity-Induced Callus Browning and Re-Differentiation, Root Formation by Plantlets and Anatomical Structures of Plantlet Leaves in Two Malus Species

International Nuclear Information System (INIS)

Gou, W.; Zheng, P.; Zheng, P.; Wang, K.; Zhang, L.; Akram, N. A.

2016-01-01

Apple (Malus domestica L.) is widely grown in northern China. However, soil salinization has become one of the most severe factors limiting apple productivity in some regions including the Loess Plateau. In our study, the regeneration system of both rootstock Rehd (Malus robusta Rehd) and scion Fuji (Malus domestica Borkh. cv. Fuji) was established In vitro. The two Malus species were cultured on the MS medium containing 0 or 150 mM NaCl to examine salt-induced effects on callus browning and re-differentiation, root formation of plantlets and anatomical structures of plantlet leaves at 15 days old callus and plantlet stages. Salt stress caused a marked increase in callus browning rate, while a decrease in re-differentiation rate, rooting rate, root number and length in both species. Additionally, anatomical structures of plantlet leave showed salt-induced damage such as reduced palisade tissue and intracellular chloroplast, incomplete development of xylem and severe damage of the phloem tissue. Salt stress also caused a few adaptive structural features in leaves including increased thickness of upper and lower epidermis, elevated proportion of spongy tissue and formation of lignified vessels. The responses of the two Malus species did not differ significantly at the differentiation stage. However, they were more sensitive to salinity at the callus stage than those at the plantlet stage in each species. Therefore, callus stage has been found to be more suitable for evaluating responses of the two apple species to salt stress. The Fuji and Rehd could be treated as a good scion/rootstock combination of apple to adapt to soil salinity based on their similar degree of salt stress-tolerance. (author)

Antimicrobial potential of Casearia sylvestris against oral bacteria

Directory of Open Access Journals (Sweden)

Amanda Henriques CAVALHEIRO

Full Text Available Abstract Aim The aim of this study was to obtain Casearia sylvestris leave extracts by different extractive methods, including the obtention of essential oil, in order to compare their antimicrobial activities to conventional mouthwash chlorhexidine against oral bacteria. Material and method For this evaluation, extracts from the leaves were obtained by different methods of extraction (infusion, decoction, maceration and percolation using different solvent systems: water 100%, ethanol 100%, methanol 100%, water: ethanol 3:7; water: ethanol 7:3; water: methanol 7:3 and water: methanol 3:7. The essential oil, which corresponds to a volatile fraction, was obtained by hydrodistillation using Clevenger modified apparatus. The microdilution broth method was used to determine the values of minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC for the following microorganisms: Streptococcus mutans ATCC 25175, S. mitis ATCC 49456, S. sanguinis ATCC 10556, S. salivarius ATCC 25975, Lactobacillus casei ATCC 11578 and Enterococcus faecalis ATCC4082. Chlorhexidine gluconate was used as a positive control. Result All extracts evaluated in the used protocol displayed MIC values higher than 400 µg/mL and few showed bactericidal activity. The antimicrobial activity of essential oil was higher than the activity of the extracts, and the best minimum inhibitory concentration and minimum bactericidal concentration values were obtained against L. casei (MIC of 0.023 µg/mL and MBC of 0.046 µg/mL and S. mutans (MIC of 25 µg/mL and MBC of 50 µg/mL, respectively. Conclusion The essential oil of Casearia sylvestris has significant antimicrobial activity against oral microorganisms.

Pre-clinical efficacy assessment of Malva sylvestris on chronic skin inflammation.

Science.gov (United States)

Prudente, Arthur S; Sponchiado, Graziela; Mendes, Daniel A G B; Soley, Bruna S; Cabrini, Daniela A; Otuki, Michel F

2017-09-01

In the search for improved quality of life, the treatment of skin diseases like psoriasis (hyperproliferative disease) is valid, since it causes huge social discomfort to the patient. In this context, earlier studies showed that Malva sylvestris L. has anti-inflammatory activity demonstrated by acute animal models of skin inflammation, becoming a promising target for further studies. The present investigation aimed to verify the effect of hydroalcoholic extract of M. sylvestris (HEMS) on the chronic inflammatory and hyperproliferative response caused by multiple applications of 12-O-tetradecanoylphorbol-13-acetate (TPA) on mouse ears. Topical application of HEMS reduced oedema, leukocyte migration (mono- and polymorphonuclear cells) and keratinocyte hyperproliferation, confirmed by histology and proliferating cell nuclear antigen (PCNA) immunostaining. It was found that the anti-inflammatory effects of the extract did not involve the glucocorticoid system, and its incubation with HaCaT keratinocytes caused low toxicity and reduced cell proliferation by apoptosis. Thus, HEMS proved to be effective as an anti-psoriatic therapy, with the ability to prevent keratinocyte hyperproliferation and with low toxicity by topical application. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

[Responses of Pinus sylvestris var. mongolica radial growth to climate warming in Great Xing' an Mountins: a case study in Mangui].

Science.gov (United States)

Zhang, Xing-Liang; He, Xing-Yuan; Chen, Zhen-Ju; Cui, Ming-Xing; Li, Na

2011-12-01

Based on the theory and methodology of dendrochronology, the tree ring width chronology of Pinus sylvestris var. mongolica in Mangui of Great Xing' an Mountains was developed, and the relationships between the standardized tree ring width chronology and local climate factors (temperature and precipitation) as well as the effects of climate factors on the P. sylvestris var. mongolica radial growth were analyzed. In this region, the mean monthly temperature in April-August of current year was the main factor limiting the radial growth, and the increasing mean monthly temperature from April to August had negative effects to the radial growth. The simulation of the variations of the radial growth by the mean monthly temperature change in April-August showed that the radial growth of P. sylvestris var. mongolica would present a declining trend accompanied with the warmer and drier regional climate condition.

Genetic processes in Scots pine (Pinus sylvestris L.) in the Chernobyl exclusion zone

International Nuclear Information System (INIS)

Kuchma, Oleksandra

2010-01-01

As immobile organisms, plants have to tolerate unfavorable environmental conditions and make use of different adaptive mechanisms to survive and reproduce successfully under stress. It is often difficult to detect the organism s or population s response to stress factors due to slow changes of environmental conditions or delayed reactions of plants. From this point of view, the investigation of reactions under extreme environmental change offer unique opportunities to study adaptation mechanisms. Areas with a strong anthropogenic impact on the environment represent ideal places for research on adaptation or selection processes. For many decades, ionizing radiation is well known as a strong damaging and stress factor. Radiation exposure causes heavy damages of the DNA. This leads to a decrease in fitness in the present generation and inheritable mutations which reveal their effects in later generations. On the other hand, radiation exposure activates adaptation processes to ensure survival. The investigation of the influence of radiation at different levels of life organization from the DNA level to the population level can help to elucidate response mechanisms to changing environments. After the accident in 1986 at the Chernobyl Nuclear Power Plant, the surrounding territories were contaminated with high amounts of radioactive material. The exclusion zone became a natural laboratory for the investigation of effects of radiation on the biocenosis. Pinus sylvestris is one of the most wildly used species in radiation research due to its very high sensitivity to radiation exposure and dominance in forest ecosystems of the exclusion zone. Nuclear microsatellites (SSRs) and AFLP markers were investigated in order to study mutation rates and selection processes under the influence of radiation in the Scots pine (Pinus sylvestris) of different age and irradiation conditions collected in the Chernobyl exclusion zone and control areas. The results of this study show that a

Allelopathic effect of aqueous extracts of Eucalyptus globulus Labill. and of Casearia sylvestris Sw. on cropsEfeito alelopático de extratos aquosos de Eucalyptus globulus Labill. e de Casearia sylvestris Sw. sobre espécies cultivadas

Directory of Open Access Journals (Sweden)

Grasielle Soares Gusman

2011-10-01

Full Text Available Allelopathy is characterized by the harmful or benefic effects caused by secondary metabolites, that are produced by plants, microorganisms or fungi and are released in the environment, on the development of natural biological systems or implemented ones. This study aimed to evaluate the allelopathic effects of aqueous extracts of eucalypt (Eucalyptus globulus Labill. and wild coffee (Casearia sylvestris Sw. on the germination and initial development of mustard (Brassica campestris L., cabbage (Brassica oleracea L. cv. capitata, broccoli (Brassica oleracea L. cv. italica, kale (Brassica pekinensis L., lettuce (Lactuca sativa L. cv. grand rapids, tomato (Lycopersicum esculentum Miller, turnip (Brassica rapa L., rucola (Eruca sativa L. and radish (Raphanus sativus L.. Six concentrations of each aqueous extract were tested (10, 30, 50, 70, 90 and 100% and compared to control (distilled water, with five replicates of each concentration, being ten seeds of each crop distributed in each replicate. The aqueous extracts of E. globulus and C. sylvestris reduced significantly the percentage of seed germination, the index of germination speed and the initial growth of the above ground part and roots of all cultivated species, being the reduction of these parameters higher with the increment of the aqueous extracts concentration, which led to thicker and atrophied roots with a higher number of absorbent hairs. Therefore, the results indicate an existence of allelopathic potential of E. globulus and C. sylvestris.A alelopatia caracteriza-se pelos efeitos danosos ou benéficos que metabólitos secundários produzidos por plantas, microrganismos ou fungos liberados no ambiente exercem sobre o desenvolvimento de sistemas biológicos naturais ou implantados. O objetivo do trabalho foi avaliar o efeito alelopático de extratos aquosos de eucalipto (Eucalyptus globulus Labill. e guaçatonga (Casearia sylvestris Sw. na germinação e no crescimento inicial de

13C discriminations of Pinus sylvestris vs. Pinus ponderosa at a dry site in Brandenburg (eastern Germany): 100-year growth comparison.

Science.gov (United States)

Wagner, Ralf; Insinna, Patrick A; Götz, Bernhard; Junge, Sebastian; Boettger, Tatjana

2007-06-01

The carbon isotope composition (delta(13)C, per thousand) and discrimination (Delta, per thousand) of old grown North American Pinus ponderosa Dougl. Ex P. et C. Laws. and European Pinus sylvestris L. were determined using trees grown under almost identical growing conditions in a mixed stand in Bralitz, Northeast Germany. Single-tree delta(13)C analyses of tree-ring cellulose of both species were carried out at a yearly resolution for the period 1901-2001 and the results compared with growth (basal area increment). Annual mean delta(13)C values for P. ponderosa ranged from-21.6 per thousand to-25.2 per thousand and for P. sylvestris from-21.4 per thousand to-24.4 per thousand. Accordingly, (13)C discrimination (Delta) showed higher values for P. ponderosa throughout the investigation period. Five characteristic periods of Delta were identified for both the tree species, reflecting positive and negative influences of environmental factors. Good growing conditions such as after-thinning events had a positive effect on Delta, reflecting higher values, while poor conditions like aridity and air pollution had a negative influence, reflecting lower values. The dynamics of Delta were likewise reflected in the growth (basal area increment, BAI). Higher (13)C discrimination values of P. ponderosa led to higher BAIs of P. ponderosa in comparison with P. sylvestris. Correlation function analyses confirmed that P. sylvestris was more dependent on precipitation than P. ponderosa, which showed a closer relationship with temperature. The results confirm that under predominantly dry growing conditions, P. ponderosa showed better growth performance than P. sylvestris, indicating better common intrinsic water-use efficiency and, therefore, higher rates of net photosynthesis at a given transpiration. In view of the prospect of climate change, the results are very significant for assessing both trees' physiological properties and, hence, their potential for coping with future growing

Boron toxicity causes multiple effects on Malus domestica pollen tube growth

Directory of Open Access Journals (Sweden)

Kefeng eFang

2016-02-01

Full Text Available Boron is an essential micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this stress is not known. This study aimed to evaluate the effect of boron stress on Malus domestica pollen tube growth and its possible regulatory pathway. Our results show that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron stress could decrease [Ca2+]c and induce the disappearance of the [Ca2+]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron stress. Immuno-localization and fluorescence labeling, together with Fourier-transform infrared analysis (FTIR, suggested that boron stress influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca2+]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

Boron Toxicity Causes Multiple Effects on Malus domestica Pollen Tube Growth.

Science.gov (United States)

Fang, Kefeng; Zhang, Weiwei; Xing, Yu; Zhang, Qing; Yang, Liu; Cao, Qingqin; Qin, Ling

2016-01-01

Boron is an important micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this toxicity is not known. This study aimed to evaluate the effect of boron toxicity on Malus domestica pollen tube growth and its possible regulatory pathway. Our results showed that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron toxicity could decrease [Ca(2+)]c and induce the disappearance of the [Ca(2+)]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron toxicity. Immuno-localization and fluorescence labeling, together with fourier-transform infrared analysis, suggested that boron toxicity influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins, and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca(2+)]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

Biogeochemical assessment of environmental risk by the example of Pinus sylvestris L.

Directory of Open Access Journals (Sweden)

Rybakov Dmitry Sergeevich

2016-06-01

Full Text Available The possibility of using annual rings of Pinus sylvestris L. to assess chemical pollution in the Republic of Karelia is discussed. With the help of principal component factor analysis the relationship between the contents of chemical elements and dendrological parameters – the width of annual rings and wood density - was revealed. The main factors contributing to the pollution of the northern part of the Republic of Karelia by the emission from iron-ore enterprise JSC «Karelsky Okatysh» are frequent ecologically significant wind directions, the distance from the source and the total mass of the emission. The value of radial growth (the average width of annual rings for five-years of Pinus sylvestris L. is connected negatively with the content of Cu, Cd, Ni and Fe. As an element of nutrition, Mn is positively correlated with the density of wood wherein it is an antagonist of Fe and partially of Cr in northern areas . Several peaks of Pb content coincide with the most intense tests of atomic weapons. Sharp maximums of Pb can also be due to a cross-border pollution and emission from regional sources.

Influence of ammonia and ozone on growth and drought sensitivity of Pinus sylvestris

NARCIS (Netherlands)

Dueck, Th.A.; Zuin, A.; Elderson, J.

1998-01-01

Four-year-old Pinus sylvestris trees were exposed to ammonia (16, 55, 110 ppb for 24 h d-1)and ozone (0, 45 and 68 ppb, 9 h d-1) in a factorial design in open-top chambers for 15 months. Treatment effects on tree growth and architecture were assessed during two growing seasons; effects on

Characteristics of blooming, floral nectaries and nectar of Malus sargentii Rehd.

Directory of Open Access Journals (Sweden)

Elżbieta Weryszko-Chmielewska

2012-12-01

Full Text Available In the years 2007-2008, the flowering biology of Malus sargentii, an ornamental apple tree native to Japan, was studied in the conditions of Lublin (Poland. The daily rate of flower opening, flowering duration and flower visitation by insects were determined. The amount of nectar produced per flower and sugar content in the nectar were investigated. The size of nectaries and the micromorphology of their surface were examined using light and scanning electron microscopy. It was found that the greatest amount of flowers opened between 11.00 and 13.00. During this time, the largest number of insects was observed in the flowers. Bees (90% were predominant among the insects, with a much smaller number of bumblebees (6% and butterflies (4%. The flower life span was 5 days. Over this period, the flower produced, on the average, 0.71 mg of nectar with an average sugar content of 32%. The nectaries of Malus sargentii are orange-yellow coloured and they represent the hypanthial type. Due to the protrusion of the nectariferous tissue, they are classified as automorphic nectaries. The surface of the epidermal cells of the nectary was distinguished by distinct cuticle folds. A small number of stomata were located only in the basal part of the nectary. At the beginning of flowering, all stomata were closed, but secretion traces were observed near well-developed outer cuticular ledges.

The effect of bonus/malus systems on the sales of new vehicles; Wirkung von Bonus-Malus-Systemen beim Neuwagenkauf

Energy Technology Data Exchange (ETDEWEB)

Haan, P. de

2008-07-01

This presentation made at the Swiss 2008 research conference on traffic by Peter de Haan from the Institute for Environmental Decisions at the Swiss Federal Institute of Technology ETH in Zurich takes a look at the effects of bonus/malus systems on the sales of new vehicles. The author notes that in spite of technological progress made, increasing car size, weight and mileage along with increased motor power has eaten up two-thirds of energy-efficiency progress made. The effect of the long lifetime of modern vehicles is commented on. The results of a survey made are presented and discussed, as are the results of simulations. Further aspects discussed include effects on the motor trade and road safety and the indirect effects of bonuses. Finally, trends in the area are noted.

Effects of environmental conditions on onset of xylem growth in Pinus sylvestris under drought.

Science.gov (United States)

Swidrak, Irene; Gruber, Andreas; Kofler, Werner; Oberhuber, Walter

2011-05-01

We determined the influence of environmental factors (air and soil temperature, precipitation, photoperiod) on onset of xylem growth in Scots pine (Pinus sylvestris L.) within a dry inner Alpine valley (750 m a.s.l., Tyrol, Austria) by repeatedly sampling micro-cores throughout 2007-10 at two sites (xeric and dry-mesic) at the start of the growing season. Temperature sums were calculated in degree-days (DD) ≥5 °C from 1 January and 20 March, i.e., spring equinox, to account for photoperiodic control of release from winter dormancy. Threshold temperatures at which xylogenesis had a 0.5 probability of being active were calculated by logistic regression. Onset of xylem growth, which was not significantly different between the xeric and dry-mesic sites, ranged from mid-April in 2007 to early May in 2008. Among most study years, statistically significant differences (Pdrought stress forces P. sylvestris to draw upon water reserves in the stem for enlargement of first tracheids after cambial resumption in spring. © The Author 2011. Published by Oxford University Press. All rights reserved.

Pinus sylvestris L. subsp. nevadensis (Christ Heywood in southern Spain: An endangered endemic Mediterranean forest

Directory of Open Access Journals (Sweden)

Olmedo-Cobo Antonio José

2017-01-01

Full Text Available Pinus sylvestris subsp. nevadensis is the most endangered pine in Spain. This taxon takes refuge in only two massifs of the Betic Cordillera -Sierra Nevada and Sierra de Baza-, where its forests represent the southernmost limit of the species global distribution, surviving under conditions of geographic, demographic and ecological marginality in the upper treeline boundary that makes them very vulnerable to any environmental change or external aggression. This research establishes for the first time, and for the entire Betic Cordillera, the locations and ecological patterns of these pine forests, their plant dynamic and floristic composition, and provides an updated map of the current and potential distribution area of this subspecies. The methodological process for this research has consisted of an integrated phytosociological and biogeographical analysis of vegetation and the resulting landscape, through fieldwork covering in as much detail as possible the distribution area of P. sylvestris in the Betic Cordillera, and a review of the bibliographic background. Taking into account the results, P. sylvestris subsp. nevadensis forests survive at present under hostile Mediterranean conditions due to the special physical characteristics of the microenvironments in which they have taken refuge, mainly the cool, relatively moist climate of their ecological niches and the relatively impermeable soils that forests occupy. However, there are significant ecological obstacles for the future preservation of this pine in southern Spain, and therefore it is necessary for the creation of programmes to protect these threatened endemic and post-glacial relict forests through continued monitoring of their evolution and further research studying the processes that make this ecosystem as a whole so unique and valuable.

Optimal Claiming Strategies in Bonus Malus Systems and Implied Markov Chains

Directory of Open Access Journals (Sweden)

Arthur Charpentier

2017-11-01

Full Text Available In this paper, we investigate the impact of the accident reporting strategy of drivers, within a Bonus-Malus system. We exhibit the induced modification of the corresponding class level transition matrix and derive the optimal reporting strategy for rational drivers. The hunger for bonuses induces optimal thresholds under which, drivers do not claim their losses. Mathematical properties of the induced level class process are studied. A convergent numerical algorithm is provided for computing such thresholds and realistic numerical applications are discussed.

Physiological responses of Pinus sylvestris var. mongolica seedlings to the interaction between Suillus luteus and Trichoderma virens.

Science.gov (United States)

Yin, D; Deng, X; Chet, Ilan; Song, R

2014-09-01

The effects of the interaction between Suillus luteus (L.) Roussel and Trichoderma virens (J.H. Mill., Giddens & A.A. Foster) Arx on Pinus sylvestris var. mongolica Litv. were studied using plant physiology, mycorrhizal science, forest pathology, and biochemistry. Seedling growth and physiological parameters were determined, including the colonization rate of mycorrhizal fungi, biomass, root activity, photosynthetic pigment content, soluble protein content, antioxidant enzyme activities, rhizosphere soil enzyme activities, and protective enzyme activities. In addition, an optimal resistance system involving T. virens, mycorrhizal fungus (S. luteus), and P. sylvestris var. mongolica seedlings was constructed. Synergies between S. luteus and T. virens were observed, and most of the parameters of P. sylvestris var. mongolica seedlings inoculated with S. luteus 30 days + T. virens were higher than other treatments. After three months, when compared the control, the S. luteus 30 days + T. virens treatment gave increases in height (42.3 %); collar diameter (66.7 %); fresh weight (54 %); dry weight (50 %); soluble protein content (69.86 %); root activity (150 %); chlorophyll a (77.6 %); chlorophyll b (70.5 %); carotenoids (144 %); CAT activity (876.9 %); POD activity (268.3 %); SOD activity (66.18 %); β-1,3-glucanase activity (125.8 %); chitinase activity (40 %); rhizosphere soil catalase activity (97.8 %); and phosphatase activity (266.7 %). These results indicate that there may be a stimulating factor between S. luteus and T. virens when they are inoculated together (S. luteus 30 days + T. virens).

Removal of Cd(II) and Pb(II) ions, from aqueous solutions, by adsorption onto sawdust of Pinus sylvestris

International Nuclear Information System (INIS)

Taty-Costodes, V. Christian; Fauduet, Henri; Porte, Catherine; Delacroix, Alain

2003-01-01

Fixation of heavy metal ions (Cd(II) and Pb(II)) onto sawdust of Pinus sylvestris is presented in this paper. Batch experiments were conducted to study the main parameters such as adsorbent concentration, initial adsorbate concentration, contact time, kinetic, pH solution, and stirring velocity on the sorption of Cd(II) and Pb(II) by sawdust of P. sylvestris. Kinetic aspects are studied in order to develop a model which can describe the process of adsorption on sawdust. The equilibrium of a solution between liquid and solid phases is described by Langmuir model. Scanning electronic microscopy (SEM) coupled with energy dispersive X-ray analysis (EDAX) and X-ray photoelectron spectroscopy (XPS) shows that the process is controlled by a porous diffusion with ion-exchange. The capacity of the metal ions to bind onto the biomass was 96% for Cd(II), and 98% for Pb(II). The sorption followed a pseudo-second-order kinetics. The adsorption of these heavy metals ions increased with the pH and reached a maximum at a 5.5 value. From these results, it can be concluded that the sawdust of P. sylvestris could be a good adsorbent for the metal ions coming from aqueous solutions. Moreover, this material could also be used for purification of water before rejection into the natural environment

Living on the edge: contrasted wood-formation dynamics in Fagus sylvatica and Pinus sylvestris under Mediterranean conditions

Directory of Open Access Journals (Sweden)

Edurne eMartinez Del Castillo

2016-03-01

Full Text Available Wood formation in European beech (Fagus sylvatica L. and Scots pine (Pinus sylvestris L. was intra-annually monitored to examine plastic responses of the xylem phenology according to altitude in one of the southernmost areas of their distribution range, i.e. in the Moncayo Natural Park, Spain. The monitoring was done from 2011 to 2013 at 1180 and 1580 m a.s.l., corresponding to the lower and upper limits of European beech forest in this region. Microcores containing phloem, cambium and xylem were collected biweekly from twenty-four trees from the beginning of March to the end of November to assess the different phases of wood formation. The samples were prepared for light microscopy to observe the following phenological phases: onset and end of cell production, onset and end of secondary wall formation in xylem cells and onset of cell maturation. The temporal dynamics of wood formation widely differed among years, altitudes and tree species. For Fagus sylvatica, the onset of cambial activity varied between the first week of May and the third week of June. Cambial activity then slowed down and stopped in summer, resulting in a length of growing season of 48–75 days. In contrast, the growing season for Pinus sylvestris started earlier and cambium remained active in autumn, leading to a period of activity varying from 139-170 days. The intra-annual wood-formation pattern is site and species-specific. Comparison with other studies shows a clear latitudinal trend in the duration of wood formation, positive for Fagus sylvatica and negative for Pinus sylvestris.

Development of a dense SNP-based linkage map of an apple rootstock progeny using the Malus Infinium whole genome genotyping array.

Science.gov (United States)

Antanaviciute, Laima; Fernández-Fernández, Felicidad; Jansen, Johannes; Banchi, Elisa; Evans, Katherine M; Viola, Roberto; Velasco, Riccardo; Dunwell, Jim M; Troggio, Michela; Sargent, Daniel J

2012-05-25

A whole-genome genotyping array has previously been developed for Malus using SNP data from 28 Malus genotypes. This array offers the prospect of high throughput genotyping and linkage map development for any given Malus progeny. To test the applicability of the array for mapping in diverse Malus genotypes, we applied the array to the construction of a SNP-based linkage map of an apple rootstock progeny. Of the 7,867 Malus SNP markers on the array, 1,823 (23.2%) were heterozygous in one of the two parents of the progeny, 1,007 (12.8%) were heterozygous in both parental genotypes, whilst just 2.8% of the 921 Pyrus SNPs were heterozygous. A linkage map spanning 1,282.2 cM was produced comprising 2,272 SNP markers, 306 SSR markers and the S-locus. The length of the M432 linkage map was increased by 52.7 cM with the addition of the SNP markers, whilst marker density increased from 3.8 cM/marker to 0.5 cM/marker. Just three regions in excess of 10 cM remain where no markers were mapped. We compared the positions of the mapped SNP markers on the M432 map with their predicted positions on the 'Golden Delicious' genome sequence. A total of 311 markers (13.7% of all mapped markers) mapped to positions that conflicted with their predicted positions on the 'Golden Delicious' pseudo-chromosomes, indicating the presence of paralogous genomic regions or mis-assignments of genome sequence contigs during the assembly and anchoring of the genome sequence. We incorporated data for the 2,272 SNP markers onto the map of the M432 progeny and have presented the most complete and saturated map of the full 17 linkage groups of M. pumila to date. The data were generated rapidly in a high-throughput semi-automated pipeline, permitting significant savings in time and cost over linkage map construction using microsatellites. The application of the array will permit linkage maps to be developed for QTL analyses in a cost-effective manner, and the identification of SNPs that have been

Competition for nitrogen between Pinus sylvestris and ectomycorrhizal fungi generates potential for negative feedback under elevated CO2

NARCIS (Netherlands)

Alberton, O.; Kuyper, T.W.; Gorissen, A.

2007-01-01

We investigated fungal species-specific responses of ectomycorrhizal (ECM) Scots pine (Pinus sylvestris) seedlings on growth and nutrient acquisition together with mycelial development under ambient and elevated CO2. Each seedling was associated with one of the following ECM species: Hebeloma

Improved recruitment and early growth of Scots pine (Pinus sylvestris L.) seedlings after fire and soil scarification.

NARCIS (Netherlands)

Hille, M.G.; Ouden, den J.

2004-01-01

The success of seedling recruitment of Scots pine (Pinus sylvestris L.) is strongly dependent on soil surface properties, such as humus depth and moisture content. In an undisturbed forest floor, seedlings are seldom able to become established due to the high incidence of desiccation in the organic

The utility of Pinus sylvestris L. in dendrochemical investigations: Pollution impact of lead mining and smelting in Darley Dale, Derbyshire, UK

International Nuclear Information System (INIS)

Lageard, J.G.A.; Howell, J.A.; Rothwell, J.J.; Drew, I.B.

2008-01-01

This research investigates atmospheric pollution from an isolated and increasingly productive lead-smelting site by examining the dendrochemistry of Pinus sylvestris growing in the local environment and at control sites. Tree increment cores and soil in the rooting environment were analysed for lead content. Inter-site comparisons of lead-in-soil suggest that contamination of the soil may be a less important pathway for lead inclusion within wood than pathways via bark or needles. Levels of lead-in-wood (up to 38 mg kg -1 ) are at the upper end of those previously reported. There is evidence of radial translocation of lead towards the heartwood and variability in intra-site dendrochemical records. Mean site lead-in-wood records can however be related to a well-documented pollution chronology and also suggest the importance of local topography in the dispersal and deposition of particulate lead. This study demonstrates that P. sylvestris can be used to estimate the scale and timing of past pollution episodes in similar environmental contexts to those investigated at Darley Dale, where precisely dated pollution chronologies are lacking. - Mean site dendrochemical records for Pinus sylvestris can be used to estimate the general scale and timing of atmospheric pollution episodes

WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations.

Science.gov (United States)

Riccio, Gennaro; Maisto, Maria; Bottone, Sara; Badolati, Nadia; Rossi, Giovanni Battista; Tenore, Gian Carlo; Stornaiuolo, Mariano; Novellino, Ettore

2017-11-18

Inhibitors of the Wingless-related Integration site (WNT)/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP). This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i) test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. 'Annurca' and Malus domestica cv 'Limoncella'; (ii) identify the mechanisms underpinning their activities and; (iii) evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations

Directory of Open Access Journals (Sweden)

Gennaro Riccio

2017-11-01

Full Text Available Inhibitors of the Wingless-related Integration site (WNT/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP. This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. ‘Annurca’ and Malus domestica cv ‘Limoncella’; (ii identify the mechanisms underpinning their activities and; (iii evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

Comparative Drought Responses of Quercus ilex L. and Pinus sylvestris L. in a Montane Forest Undergoing a Vegetation Shift

Directory of Open Access Journals (Sweden)

David Aguadé

2015-07-01

Full Text Available Different functional and structural strategies to cope with water shortage exist both within and across plant communities. The current trend towards increasing drought in many regions could drive some species to their physiological limits of drought tolerance, potentially leading to mortality episodes and vegetation shifts. In this paper, we study the drought responses of Quercus ilex and Pinus sylvestris in a montane Mediterranean forest where the former species is replacing the latter in association with recent episodes of drought-induced mortality. Our aim was to compare the physiological responses to variations in soil water content (SWC and vapor pressure deficit (VPD of the two species when living together in a mixed stand or separately in pure stands, where the canopies of both species are completely exposed to high radiation and VPD. P. sylvestris showed typical isohydric behavior, with greater losses of stomatal conductance with declining SWC and greater reductions of stored non-structural carbohydrates during drought, consistent with carbon starvation being an important factor in the mortality of this species. On the other hand, Q. ilex trees showed a more anisohydric behavior, experiencing more negative water potentials and higher levels of xylem embolism under extreme drought, presumably putting them at higher risk of hydraulic failure. In addition, our results show relatively small changes in the physiological responses of Q. ilex in mixed vs. pure stands, suggesting that the current replacement of P. sylvestris by Q. ilex will continue.

LAM-1 and FAT Genes Control Development of the Leaf Blade in Nicotiana sylvestris.

Science.gov (United States)

McHale, NA

1993-01-01

Leaf primordia of the lam-1 mutant of Nicotiana sylvestris grow normally in length but remain bladeless throughout development. The blade initiation site is established at the normal time and position in lam-1 primordia. Anticlinal divisions proceed normally in the outer L1 and L2 layers, but the inner L3 cells fail to establish the periclinal divisions that normally generate the middle mesophyll core. The lam-1 mutation also blocks formation of blade mesophyll from distal L2 cells. This suggests that LAM-1 controls a common step in initiation of blade tissue from the L2 and L3 lineage of the primordium. Another recessive mutation (fat) was isolated in N. sylvestris that induces abnormal periclinal divisions in the mesophyll during blade initiation and expansion. This generates a blade approximately twice its normal thickness by doubling the number of mesophyll cell layers from four to approximately eight. Presumably, the fat mutation defines a negative regulator involved in repression of periclinal divisions in the blade. The lam-1 fat double mutant shows radial proliferation of mesophyll cells at the blade initiation site. This produces a highly disorganized, club-shaped blade that appears to represent an additive effect of the lam-1 and fat mutations on blade founder cells. PMID:12271096

Characterization of resistance gene analogues (RGAs) in apple (Malus × domestica Borkh.) and their evolutionary history of the Rosaceae family.

Science.gov (United States)

Perazzolli, Michele; Malacarne, Giulia; Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

2014-01-01

The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

Characterization of resistance gene analogues (RGAs in apple (Malus × domestica Borkh. and their evolutionary history of the Rosaceae family.

Directory of Open Access Journals (Sweden)

Michele Perazzolli

Full Text Available The family of resistance gene analogues (RGAs with a nucleotide-binding site (NBS domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh. cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80% of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15, and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

Characterization of Resistance Gene Analogues (RGAs) in Apple (Malus × domestica Borkh.) and Their Evolutionary History of the Rosaceae Family

Science.gov (United States)

Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

2014-01-01

The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar ‘Golden Delicious’. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera. PMID:24505246

Evaluation of the present genetic conservation efforts in Pinus sylvestris, Picea abies, Quercus spp., Fagus sylvatica, and Pinus pinaster

NARCIS (Netherlands)

Kramer, K.

2015-01-01

Information on genetic diversity and gene conservation activities were combined with climatic data to evaluate the present genetic conservation efforts in Pinus sylvestris, Picea abies, Quercus spp., Fagus sylvatica, and Pinus pinaster. Combinations of climatic variables explained much of the

The Occurrence of the Cicada Cicadatra persica on Apple Trees, Malus domestica, in Erneh, Syria

Science.gov (United States)

Dardar, Marah A.; Belal, Hamzeh M.R.; Basheer, Abedlnabi M.

2013-01-01

An infestation of Cicadatra persica KirKaldy (Hemiptera: Cicadidae) on apple trees, Malus domestica Borkhausen (Rosales: Rosaceae), was reported for the first time in the apple fruit orchards of Erneh, Syria. Nymphs, adults, exuvia, and exit holes in the soil were observed. The species was identified as C. persica based on morphological characters. Some biological observations and an acoustic analysis of the male's songs were also achieved. PMID:23909877

[Physiological characteristics of Pinus densiflora var. zhangwuensis and Pinus sylvestris var. mongolica seedlings on sandy lands under salt-alkali stresses].

Science.gov (United States)

Meng, Peng; Li, Yu-Ling; Zhang, Bai-xi

2013-02-01

For the popularization of Pinus densiflora var. zhangwuensis, a new afforestation tree species on the desertified and salinized-alkalized lands in Northern China, and to evaluate the salinity-alkalinity tolerance of the tree species and to better understand the tolerance mechanisms, a pot experiment with 4-year old P. densiflora var. zhangwuensis and P. sylvestris var. mongolica was conducted to study their seedlings growth and physiological and biochemical indices under the effects of three types salt (NaCl, Na2CO3, and NaHCO3 ) stresses and of alkali (NaOH) stress. Under the salt-alkali stresses, the injury level of P. densiflora var. zhangwuensis was lower, and the root tolerance index was higher. The leaf catalase (CAT) activity increased significantly by 22. 6 times at the most, as compared with the control; the leaf malondialdehyde (MDA) content had no significant increase; the leaf chlorophyll (Chl) content had a smaller decrement; and the leaf water content (LWC) increased slightly. P. sylvestris var. mongolica responded differently to the salt-alkali stresses. Its leaf CAT activity had less change, MDA content increased significantly, Chl content had significant decrease, and LWC decreased slightly. It was suggested that P. densi-flora var. zhangwuensis had a greater salinity-alkalinity tolerance than P. sylvestris var. mongolica. The higher iron concentration in P. densiflora var. zhangwuensis needles enhanced the CAT activity and Chl content, whereas the higher concentrations of zinc and copper were associated with the stronger salinity-alkalinity tolerance.

Flavonoid Accumulation Plays an Important Role in the Rust Resistance of Malus Plant Leaves

Directory of Open Access Journals (Sweden)

Yanfen Lu

2017-07-01

Full Text Available Cedar-apple rust (Gymnosporangium yamadai Miyabe is a fungal disease that causes substantial injury to apple trees and results in fruit with reduced size and quality and a lower commercial value. The molecular mechanisms underlying the primary and secondary metabolic effects of rust spots on the leaves of Malus apple cultivars are poorly understood. Using HPLC, we found that the contents of flavonoid compounds, especially anthocyanin and catechin, were significantly increased in rust-infected symptomatic tissue (RIT. The expression levels of structural genes and MYB transcription factors related to flavonoid biosynthesis were one- to seven-fold higher in the RIT. Among these genes, CHS, DFR, ANS, FLS and MYB10 showed more than a 10-fold increase, suggesting that these genes were expressed at significantly higher levels in the RIT. Hormone concentration assays showed that the levels of abscisic acid (ABA, ethylene (ETH, jasmonate (JA and salicylic acid (SA were higher in the RIT and were consistent with the expression levels of McNCED, McACS, McLOX and McNPR1, respectively. Our study explored the complicated crosstalk of the signal transduction pathways of ABA, ETH, JA and SA; the primary metabolism of glucose, sucrose, fructose and sorbitol; and the secondary metabolism of flavonoids involved in the rust resistance of Malus crabapple leaves.

Object-based semi-automatic approach for forest structure characterization using lidar data in heterogeneous Pinus sylvestris stands

Science.gov (United States)

C. Pascual; A. Garcia-Abril; L.G. Garcia-Montero; S. Martin-Fernandez; W.B. Cohen

2008-01-01

In this paper, we present a two-stage approach for characterizing the structure of Pinus sylvestris L. stands in forests of central Spain. The first stage was to delimit forest stands using eCognition and a digital canopy height model (DCHM) derived from lidar data. The polygons were then clustered into forest structure types based on the DCHM data...

McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple

OpenAIRE

Tian, Ji; Zhang, Jie; Han, Zhen-yun; Song, Ting-ting; Li, Jin-yan; Wang, Ya-ru; Yao, Yun-cong

2017-01-01

The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to th...

Uji Aktivitas Ekstrak Etanol Kulit Buah Apel ( Pyrus malus, L Terhadap

Directory of Open Access Journals (Sweden)

Suparmia, Khusnul Khotimah Amal Fadho

2013-08-01

Full Text Available Apple (Pyrus malus, L is a fruit having much uses for health containing phytochemical and flavonoid substances. One of the substances contained in apple rind is quercetin. Quercetin capable to reduce vascular permeability (Mochizuki et al., 2004. The recent study has an aim to know activity of ethanol extract on apple rind to the reducing of vascular permeability thus it can used as therapies for plasma leakage in curing Dengue Blood Fever. The vascular permeability test it was done an induction method using acetate acid. Testing done on white male mice of the BALB/c strain where the mice were divided into 5 groups. The first and second groups were control groups that are a positive control were given 0.2 mg/20 g standard quersetin suspension and the negative one was given 0.5% Na CMC suspension. The third, fourth and fifth groups were treatment groups where each testing animals were given ethanol extract suspension of apple rind by dosages 0.2, 0.4, and 0.8 mg/20 g of Body Weight mice per oral. Taking data was done by measuring pigment intensities from abdominal cavity liquid had been washed with acetate saline. From percentages of vascular permeability reducing each group then analyzed using statistic analyses those were the one-way anova. If there was found any significant difference then it was continued a Tukey test and bivariate-correlation. From results in the study it was known that percentages of vascular permeability reduces of ethanol extract that were made from apple rind having dosages 0.2, 0.4, and 0.8 mg in sequences as big as 42.15%, 63.28% and 84.19%.Keywords: Pyrus malus, L, kuersetin, vascular permeability

Contrasting Pollination Efficiency and Effectiveness among Flower Visitors of Malva Sylvestris, Borago Officinalis and Onobrychis Viciifolia

OpenAIRE

Gorenflo, Anna; Diekötter, Tim; van Kleunen, Mark; Wolters, Volkmar; Jauker, Frank

2017-01-01

Biotic pollination is an important factor for ecosystem functioning and provides a substantial ecosystem service to human food security. Not all flower visitors are pollinators, however, and pollinators differ in their pollination performances. In this study, we determined the efficiencies of flower visitors to the plant species Malva sylvestris, Borago officinalis and Onobrychis viciifolia by analysing stigmatic pollen deposition. We further calculated pollinator effectiveness by scaling up ...

Chemopreventive activity of compounds extracted from Casearia sylvestris (Salicaceae) Sw against DNA damage induced by particulate matter emitted by sugarcane burning near Araraquara, Brazil

Energy Technology Data Exchange (ETDEWEB)

Prieto, A.M. [UNESP — Univ. Estadual Paulista, College of Pharmaceutical Sciences, Department of Clinical Analysis, Rua Expedicionários do Brasil, 1621, Araraquara (Brazil); Santos, A.G. [UNESP — Univ. Estadual Paulista, College of Pharmaceutical Sciences, Department of Natural Principles and Toxicology, Rodovia Araraquara-Jau, km 01, Araraquara (Brazil); Csipak, A.R.; Caliri, C.M.; Silva, I.C. [UNESP — Univ. Estadual Paulista, College of Pharmaceutical Sciences, Department of Clinical Analysis, Rua Expedicionários do Brasil, 1621, Araraquara (Brazil); Arbex, M.A. [UNIFESP — Federal University of São Paulo, Paulista College of Medicine, Department of Internal Medicine, Rua Pedro de Toledo, 720, São Paulo (Brazil); Silva, F.S.; Marchi, M.R.R. [UNESP — Univ. Estadual Paulista, Chemistry Institute, Department of Analytical Chemistry, Rua Francisco Degni, S/N, Araraquara (Brazil); Cavalheiro, A.J.; Silva, D.H.S.; Bolzani, V.S. [UNESP — Univ. Estadual Paulista, Chemistry Institute, Department of Organic Chemistry, Rua Francisco Degni, S/N, Araraquara (Brazil); Soares, C.P., E-mail: soarescp@hotmail.com [UNESP — Univ. Estadual Paulista, College of Pharmaceutical Sciences, Department of Clinical Analysis, Rua Expedicionários do Brasil, 1621, Araraquara (Brazil)

2012-12-15

Ethanolic extract of Casearia sylvestris is thought to be antimutagenic. In this study, we attempted to determine whether this extract and casearin X (a clerodane diterpene from C. sylvestris) are protective against the harmful effects of airborne pollutants from sugarcane burning. To that end, we used the Tradescantia micronucleus test in meiotic pollen cells of Tradescantia pallida, the micronucleus test in mouse bone marrow cells, and the comet assay in mouse blood cells. The mutagenic compound was total suspended particulate (TSP) from air. For the Tradescantia micronucleus test, T. pallida cuttings were treated with the extract at 0.13, 0.25, or 0.50 mg/ml. Subsequently, TSP was added at 0.3 mg/ml, and tetrads from the inflorescences were examined for micronuclei. For the micronucleus test in mouse bone marrow cells and the comet assay in mouse blood cells, Balb/c mice were treated for 15 days with the extract—3.9, 7.5, or 15.0 mg/kg body weight (BW)—or with casearin X—0.3, 0.25, or 1.2 mg/kg BW—after which they received TSP (3.75 mg/kg BW). In T. pallida and mouse bone marrow cells, the extract was antimutagenic at all concentrations tested. In mouse blood cells, the extract was antigenotoxic at all concentrations, whereas casearin X was not antimutagenic but was antigenotoxic at all concentrations. We conclude that C. sylvestris ethanolic extract and casearin X protect DNA from damage induced by airborne pollutants from sugarcane burning. -- Highlights: ► We assessed DNA protection of C. sylvestris ethanolic extract. ► We assessed DNA protection of casearin X. ► We used Tradescantia pallida micronucleus test as screening. ► We used comet assay and micronucleus test in mice. ► The compounds protected DNA against sugar cane burning pollutants.

McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple.

Science.gov (United States)

Tian, Ji; Zhang, Jie; Han, Zhen-Yun; Song, Ting-Ting; Li, Jin-Yan; Wang, Ya-Ru; Yao, Yun-Cong

2017-03-03

The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to their promoters, but to be only partially responsible for regulating PAs biosynthetic genes. In contrast, McMYB12b showed preferential binding to the promoters of PAs biosynthetic genes. Overexpression of McMYB12a and McMYB12b in tobacco (Nicotiana tabacum) altered the expression of flavonoid biosynthetic genes and promoted the accumulation of PAs and anthocyanins in tobacco petals. Conversely, transient silencing their expression in crabapple plants, using a conserved gene region, resulted in reduced PAs and anthocyanin production a green leaf phenotype. Meanwhile, transient overexpression of the two genes and silenced McMYB12s in apple (Malus domestica) fruit had a similar effect as overexpression in tobacco and silenced in crabapple. This study reveals a new mechanism for the coordinated regulation of PAs and anthocyanin accumulation in crabapple leaves, which depends on an auto-regulatory balance involving McMYB12a and McMYB12b expression.

Exogenous melatonin improves Malus resistance to Marssonina apple blotch.

Science.gov (United States)

Yin, Lihua; Wang, Ping; Li, Mingjun; Ke, Xiwang; Li, Cuiying; Liang, Dong; Wu, Shan; Ma, Xinli; Li, Chao; Zou, Yangjun; Ma, Fengwang

2013-05-01

We examined whether exogenously applied melatonin could improve resistance to Marssonina apple blotch (Diplocarpon mali) by apple [Malus prunifolia (Willd.) Borkh. cv. Donghongguo]. This serious disease leads to premature defoliation in the main regions of apple production. When plants were pretreated with melatonin, resistance was increased in the leaves. We investigated the potential roles for melatonin in modulating levels of hydrogen peroxide (H2O2), as well the activities of antioxidant enzymes and pathogenesis-related proteins during these plant-pathogen interactions. Pretreatment enabled plants to maintain intracellular H2O2 concentrations at steady-state levels and enhance the activities of plant defence-related enzymes, possibly improving disease resistance. Because melatonin is safe and beneficial to animals and humans, exogenous pretreatment might represent a promising cultivation strategy to protect plants against this pathogen infection. © 2012 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.

Static and dynamic bending has minor effects on xylem hydraulics of conifer branches (Picea abies, Pinus sylvestris).

Science.gov (United States)

Mayr, Stefan; Bertel, Clara; Dämon, Birgit; Beikircher, Barbara

2014-09-01

The xylem hydraulic efficiency and safety is usually measured on mechanically unstressed samples, although trees may be exposed to combined hydraulic and mechanical stress in the field. We analysed changes in hydraulic conductivity and vulnerability to drought-induced embolism during static bending of Picea abies and Pinus sylvestris branches as well as the effect of dynamic bending on the vulnerability. We hypothesized this mechanical stress to substantially impair xylem hydraulics. Intense static bending caused an only small decrease in hydraulic conductance (-19.5 ± 2.4% in P. abies) but no shift in vulnerability thresholds. Dynamic bending caused a 0.4 and 0.8 MPa decrease of the water potential at 50 and 88% loss of conductivity in P. sylvestris, but did not affect vulnerability thresholds in P. abies. With respect to applied extreme bending radii, effects on plant hydraulics were surprisingly small and are thus probably of minor eco-physiological importance. More importantly, results indicate that available xylem hydraulic analyses (of conifers) sufficiently reflect plant hydraulics under field conditions. © 2014 The Authors. Plant, Cell & Environment published by John Wiley & Sons Ltd.

Toxicity study about a medicinal plant Casearia sylvestris: A contribution to the Brazilian Unified Health System (SUS).

Science.gov (United States)

Ameni, A Z; Latorre, O A; Torres, L M B; Górniak, S L

2015-12-04

Casearia sylvestris S.w (Salicaceae) is catalogued by the Brazilian Unified Health System as a plant of interest for the Brazilian population with the purpose of treating inflammatory disorders, such as pain and gastrointestinal disorders based on the folk use and some literature about efficacy; however, no toxicological studies concerned the safety of extract fluid of this plant have been reported. The present study was carried out to evaluate the acute and subchronic toxicity of the hydroethanolic extract fluid (FE) obtained from leaves of C. sylvestris in Wistar rats. In the acute toxicity test three female Wistar rats were treated with a single dose of FE (2000 mg/kg) administered by oral gavage and observed for 14 days in order to identify signs of toxicity or death. In subchronic toxicity study animals received, by daily gavage three doses 60, 120 and 240 mg/kg of the FE of the plant for 28 and 90 days. The animals were observed daily for clinical signs and mortality. Body weight and food consumption were measured weekly and at the end of treatment were analysed hematological, biochemical and histopathological parameters. Also was analysed the cellularity of bone marrow and spleen. Moreover, phytochemical analysis by HPLC-PDA-ESI(+)/MS and CG/MS/EI was carried out to qualify the constituents of the extract. The results of acute study indicated that the LD50 is higher than 2000 mg/kg and at 28 and 90 day oral toxicity showed that there were no toxic effects detected in any of the parameters evaluated: body weight and relative organ weight, general behavioral changes, haematological and biochemical parameters and histopathological examination. The analysis by HPLC-PDA-ESI(+)/MS and CG/MS/EI identified the flavonoids rutin, quercetin and luteolin and also chlorogenic on the extract. Based on this study the hydroethanolic fluid extract of C. sylvestris could be safe even when used over a long period for therapeutic uses proposed by the Brazilian Unified Health

Tree-ring analysis of crown competition and climatic sensitivity in Pinus strobus and P. sylvestris stands in the Elbe River Sandstone Mountains

Czech Academy of Sciences Publication Activity Database

Mácová, Marcela

2001-01-01

Roč. 19, č. 1 (2001), s. 103-113 ISSN 1125-7865 R&D Projects: GA AV ČR IAA6005801 Institutional research plan: CEZ:AV0Z6005908 Keywords : dendroclimatology * Pinus strobus * Pinus sylvestris Subject RIV: EF - Botanics

Characterization of aroma-active compounds in dry flower of Malva sylvestris L. by GC-MS-O analysis and OAV calculations.

Science.gov (United States)

Usami, Atsushi; Kashima, Yusei; Marumoto, Shinsuke; Miyazawa, Mitsuo

2013-01-01

In this study, the aroma-active compounds in the dried flower of Malva sylvestris L. were extracted by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS), and gas chromatography-olfactometry (GC-O) and aroma extraction dilution analysis (AEDA). A light yellow oil with a sweet odor was obtained with a percentage yield of 0.039% (w/w), and 143 volatile compounds (89.86%) were identified by GC-MS. The main compounds were hexadecanoic acid (10.1%), pentacosane (4.8%) and 6,10,14-trimethyl-2-pentadecanone (4.1%). The essential oil consisted mainly of hydrocarbons (25.40%) followed by, alcohols (18.78%), acids (16.66%), ethers (5.01%) ketones (7.28%), esters(12.43%), aldehydes (2.30%) and others (2.00%). Of these compounds, 20 were determined by GC-O and AEDA, to be odor-active (FD (flavor dilution) factor ≥ 1). β-Damascenone (FD = 9, sweet), phenylacetaldehyde (FD = 8, floral, honey-like) and (E)-β-ocimene (FD = 8, spicy) were the most intense aroma-active compounds in M. sylvestris. In order to determine the relative contribution of each of the compounds to the aroma of M. sylvestris, odor activity values (OAVs) were used. β-Damascenone had the highest odor activity values (OAV) (50,700), followed by (E)-β-ionone (15,444) and decanal (3,510). In particular, β-damascenone had a high FD factors, and therefore, this compound was considered to be the main aroma-active components of the essential oil. On the basis of AEDA, OAVs, and sensory evaluation results, β-damascenone is estimated to be the main aroma-active compound of the essential oil.

Pinus halepensis, Pinus pinaster, Pinus pinea and Pinus sylvestris Essential Oils Chemotypes and Monoterpene Hydrocarbon Enantiomers, before and after Inoculation with the Pinewood Nematode Bursaphelenchus xylophilus.

Science.gov (United States)

Rodrigues, Ana M; Mendes, Marta D; Lima, Ana S; Barbosa, Pedro M; Ascensão, Lia; Barroso, José G; Pedro, Luis G; Mota, Manuel M; Figueiredo, A Cristina

2017-01-01

Pinewood nematode (PWN), Bursaphelenchus xylophilus, is the causal agent of pine wilt disease, a serious threat to global forest populations of conifers, especially Pinus spp. A time-course study of the essential oils (EOs) of 2-year-old Pinus halepensis, Pinus pinaster, Pinus pinea and Pinus sylvestris following inoculation with the PWN was performed. The constitutive and nematode inoculation induced EOs components were analyzed at both the wounding or inoculation areas and at the whole plant level. The enantiomeric ratio of optically active main EOs components was also evaluated. External symptoms of infection were observed only in P. pinaster and P. sylvestris 21 and 15 days after inoculation, respectively. The EO composition analysis of uninoculated and unwounded plants revealed the occurrence of chemotypes for P. pinaster, P. halepensis and P. sylvestris, whereas P. pinea showed a homogenous EO composition. When whole plants were evaluated for EO and monoterpene hydrocarbon enantiomeric chemical composition, no relevant qualitative and quantitative differences were found. Instead, EO analysis of inoculated and uninoculated wounded areas revealed an increase of sesquiterpenes and diterpenic compounds, especially in P. pinea and P. halepensis, comparatively to healthy whole plants EOs. © 2017 Wiley-VHCA AG, Zurich, Switzerland.

Seasonal Variations in the Deoxypodophyllotoxin Content and Yield of Anthriscus sylvestris L. (Hoffm.) Grown in the Field and under Controlled Conditions

NARCIS (Netherlands)

Hendrawati, Oktavia; Woerdenbag, Herman J.; Hille, Jacques; Quax, Wim J.; Kayser, Oliver

2011-01-01

Deoxypodophyllotoxin (DPT) is the main lignan in Anthriscus sylvestris. For this study two sets of experiments with 16 plants and seeds, collected from a wide geographical range, were carried out. The DPT content in roots was significantly lower (p <0.05) when the plants were cultivated in a

Optimizing dehydration of apples Malus Domestica with fructo-oligosaccharide incorporation

Directory of Open Access Journals (Sweden)

Mariana Buranelo Egea

2012-10-01

Full Text Available The objective of the present study was to study the effect of the variables of the osmotic dehydration process on sliced Fuji apples (Malus domestica using a 2 x 3² factorial design. The variables studied in the apple slices were the pretreatment (blanching or acidification, the temperatures (30, 45 and 60ºC and the FOS concentration (40%, 50% and 60% m/v of the osmotic solution. There was no difference among the pretreatments for the water activity and titratable acidity. The slices pre-treated by the acidification presented less enzymatic browning (greatest luminosity L* value combined with a greater soluble solid contents (thus, this treatment was selected. Treatments T4 (45ºC and 40% m/v and T7 (60ºC and 40%m/v, using the acidification presented responses within the recommended standards and FOS were validated by the repetition.

Genome-wide analysis of the GH3 family in apple (Malus × domestica).

Science.gov (United States)

Yuan, Huazhao; Zhao, Kai; Lei, Hengjiu; Shen, Xinjie; Liu, Yun; Liao, Xiong; Li, Tianhong

2013-05-02

Auxin plays important roles in hormone crosstalk and the plant's stress response. The auxin-responsive Gretchen Hagen3 (GH3) gene family maintains hormonal homeostasis by conjugating excess indole-3-acetic acid (IAA), salicylic acid (SA), and jasmonic acids (JAs) to amino acids during hormone- and stress-related signaling pathways. With the sequencing of the apple (Malus × domestica) genome completed, it is possible to carry out genomic studies on GH3 genes to indentify candidates with roles in abiotic/biotic stress responses. Malus sieversii Roem., an apple rootstock with strong drought tolerance and the ancestral species of cultivated apple species, was used as the experimental material. Following genome-wide computational and experimental identification of MdGH3 genes, we showed that MdGH3s were differentially expressed in the leaves and roots of M. sieversii and that some of these genes were significantly induced after various phytohormone and abiotic stress treatments. Given the role of GH3 in the negative feedback regulation of free IAA concentration, we examined whether phytohormones and abiotic stresses could alter the endogenous auxin level. By analyzing the GUS activity of DR5::GUS-transformed Arabidopsis seedlings, we showed that ABA, SA, salt, and cold treatments suppressed the auxin response. These findings suggest that other phytohormones and abiotic stress factors might alter endogenous auxin levels. Previous studies showed that GH3 genes regulate hormonal homeostasis. Our study indicated that some GH3 genes were significantly induced in M. sieversii after various phytohormone and abiotic stress treatments, and that ABA, SA, salt, and cold treatments reduce the endogenous level of axuin. Taken together, this study provides evidence that GH3 genes play important roles in the crosstalk between auxin, other phytohormones, and the abiotic stress response by maintaining auxin homeostasis.

A hybrid swarm population of Pinus densiflora x P. sylvestris hybrids inferred from sequence analysis of chloroplast DNA and morphological characters

Science.gov (United States)

To confirm a hybrid swarm population of Pinus densiflora × P. sylvestris in Jilin, China and to study whether shoot apex morphology of 4-year old seedlings can be correlated with the sequence of a chloroplast DNA simple sequence repeat marker (cpDNA SSR), needles and seeds from P. densiflora, P. syl...

Evolution of the population structure of Venturia inaequalis, the apple scab fungus, associated with the domestication of its host.

Science.gov (United States)

Gladieux, Pierre; Zhang, Xiu-Guo; Róldan-Ruiz, Isabel; Caffier, Valérie; Leroy, Thibault; Devaux, Martine; Van Glabeke, Sabine; Coart, Els; Le Cam, Bruno

2010-02-01

Evaluating the impact of plant domestication on the population structure of the associated pathogens provides an opportunity to increase our understanding of how and why diseases emerge. Here, we investigated the evolution of the population structure of the apple scab fungus Venturia inaequalis in response to the domestication of its host. Inferences were drawn from multilocus microsatellite data obtained from samples collected on (i) the Central Asian Malus sieversii, the main progenitor of apple, (ii) the European crabapple, Malus sylvestris, a secondary progenitor of apple, and (iii) the cultivated apple, Malus x domestica, in orchards from Europe and Central Asia. Using clustering methods, we identified three distinct populations: (i) a large European population on domesticated and wild apples, (ii) a large Central Asian population on domesticated and wild apples in urban and agricultural areas, and (iii) a more geographically restricted population in M. sieversii forests growing in the eastern mountains of Kazakhstan. Unique allele richness and divergence time estimates supported a host-tracking co-evolutionary scenario in which this latter population represents a relict of the ancestral populations from which current populations found in human-managed habitats were derived. Our analyses indicated that the domestication of apple induced a significant change in the genetic differentiation of populations of V. inaequalis in its centre of origin, but had little impact on its population dynamics and mating system. We discuss how the structure of the apple-based agrosystem may have restricted changes in the population structure of the fungus in response to the domestication of its host.

Isoenzymatic variability in progeny of Pinus mugo Turra x Pinus sylvestris L. hybrids from Bór na Czerwonem, in experimental culture

Directory of Open Access Journals (Sweden)

Maria A. Bobowicz

2014-01-01

Full Text Available The article describes the genetic structure of 12-year old seedlings. They were grown in an experimental culture representing the progeny of natural hybrids of Pinus mugo Turra and Pinus sylvestris L. from the peatbog Bór na Czerwonem. The studies were carried out on seedlings, employing electrophoresis of enzymatic proteins from winter buds. Parallel isoenzymatic analyses were also conducted for trees of P. mugo Turra from Tatra Mountains and for P. sylvestris L. trees from Białowieża in order to determine similarities of the hybrids to the 'pure' species, thought to represent parental forms, and for natural hybrids from Bór na Czerwonem. The obtained electrophoretic patterns made the determination of genetic structure of the population possible, namely of the observed heterozygosity, expected heterozygosity, Wright's fixation index and coefficients of similarity according to Nei and Hedrick. Genetic distances between the populations were also estimated. The variability of 11 enzymatic loci demonstrated the highest level of variability in the population of hybrids. Coefficients of genetic differentiation (GST and of gene flow, (Nm suggested a close relationship of the hybrids to P. mugo which may indicate an introgressive type of the hybrid swarm, from which the studied trees originated. The analysis of genetic similarity coefficients, according to Nei and Hedrick, demonstrated also an extensive similarity of the two hybrid groups to P. mugo. However, upon analysis of individual enzymatic loci, some of them highly resembled P. mugo while others were similar to P. sylvestris. The closest genetic similarity was demonstrated for the group of hybrids from the peatbog and the respective of hybrides group from culture. The variable gene expression as well as asymmetric inheritance of isoenzymes provided additional evidence of the introgressive character of the studied trees from the hybrid population.

Carbon stable isotope-climate association in tree rings of Pinus pinaster and Pinus sylvestris in Mediterranean environments

International Nuclear Information System (INIS)

Bogino, Stella M; Bravo, Felipe

2014-01-01

Carbon isotope ratios, recorded as "1"3C/"1"2C variations in tree rings of woody species, are the result of physiological changes related to environmental conditions. The objective of this work was to analyze the association among carbon thirteen variability (δ"1"3C), climate variables and tree-ring growth of Pinus pinaster and Pinus sylvestris in central Spain. Pulverized woody material from the period 1975-1999 from four trees for each pine species was analyzed. To detect common patterns in δ"1"3C within each species and between δ"1"3C and growth indices, a principal component analysis (PCA) was performed. δ"1"3C of trees and the residual tree-ring chronologies were used at the PCA. Multilevel mixed linear models were applied between intrinsic water use efficiency (iWUE) and climate variables. Our results show an inverse significant correlation between δ"1"3C and tree-ring growth of both species. Winter and spring air moisture was negatively correlated with iWUE of Pinus pinaster. July maximum temperature was positively correlated with iWUE of Pinus sylvestris. As δ"1"3C is significantly related to climate and growth and it may be recommended as a valuable tool for tree growth dynamic analysis to withstand increasingly stressful climate conditions

Growth response of drought-stressed Pinus sylvestris seedlings to single- and multi-species inoculation with ectomycorrhizal fungi.

Directory of Open Access Journals (Sweden)

Tabea Kipfer

Full Text Available Many trees species form symbiotic associations with ectomycorrhizal (ECM fungi, which improve nutrient and water acquisition of their host. Until now it is unclear whether the species richness of ECM fungi is beneficial for tree seedling performance, be it during moist conditions or drought. We performed a pot experiment using Pinus sylvestris seedlings inoculated with four selected ECM fungi (Cenococcum geophilum, Paxillus involutus, Rhizopogon roseolus and Suillus granulatus to investigate (i whether these four ECM fungi, in monoculture or in species mixtures, affect growth of P. sylvestris seedlings, and (ii whether this effect can be attributed to species number per se or to species identity. Two different watering regimes (moist vs. dry were applied to examine the context-dependency of the results. Additionally, we assessed the activity of eight extracellular enzymes in the root tips. Shoot growth was enhanced in the presence of S. granulatus, but not by any other ECM fungal species. The positive effect of S. granulatus on shoot growth was more pronounced under moist (threefold increase than under dry conditions (twofold increase, indicating that the investigated ECM fungi did not provide additional support during drought stress. The activity of secreted extracellular enzymes was higher in S. granulatus than in any other species. In conclusion, our findings suggest that ECM fungal species composition may affect seedling performance in terms of aboveground biomass.

Growth response of drought-stressed Pinus sylvestris seedlings to single- and multi-species inoculation with ectomycorrhizal fungi.

Science.gov (United States)

Kipfer, Tabea; Wohlgemuth, Thomas; van der Heijden, Marcel G A; Ghazoul, Jaboury; Egli, Simon

2012-01-01

Many trees species form symbiotic associations with ectomycorrhizal (ECM) fungi, which improve nutrient and water acquisition of their host. Until now it is unclear whether the species richness of ECM fungi is beneficial for tree seedling performance, be it during moist conditions or drought. We performed a pot experiment using Pinus sylvestris seedlings inoculated with four selected ECM fungi (Cenococcum geophilum, Paxillus involutus, Rhizopogon roseolus and Suillus granulatus) to investigate (i) whether these four ECM fungi, in monoculture or in species mixtures, affect growth of P. sylvestris seedlings, and (ii) whether this effect can be attributed to species number per se or to species identity. Two different watering regimes (moist vs. dry) were applied to examine the context-dependency of the results. Additionally, we assessed the activity of eight extracellular enzymes in the root tips. Shoot growth was enhanced in the presence of S. granulatus, but not by any other ECM fungal species. The positive effect of S. granulatus on shoot growth was more pronounced under moist (threefold increase) than under dry conditions (twofold increase), indicating that the investigated ECM fungi did not provide additional support during drought stress. The activity of secreted extracellular enzymes was higher in S. granulatus than in any other species. In conclusion, our findings suggest that ECM fungal species composition may affect seedling performance in terms of aboveground biomass.

The utility of Pinus sylvestris L. in dendrochemical investigations: pollution impact of lead mining and smelting in Darley Dale, Derbyshire, UK.

Science.gov (United States)

Lageard, J G A; Howell, J A; Rothwell, J J; Drew, I B

2008-05-01

This research investigates atmospheric pollution from an isolated and increasingly productive lead-smelting site by examining the dendrochemistry of Pinus sylvestris growing in the local environment and at control sites. Tree increment cores and soil in the rooting environment were analysed for lead content. Inter-site comparisons of lead-in-soil suggest that contamination of the soil may be a less important pathway for lead inclusion within wood than pathways via bark or needles. Levels of lead-in-wood (up to 38mgkg(-1)) are at the upper end of those previously reported. There is evidence of radial translocation of lead towards the heartwood and variability in intra-site dendrochemical records. Mean site lead-in-wood records can however be related to a well-documented pollution chronology and also suggest the importance of local topography in the dispersal and deposition of particulate lead. This study demonstrates that P. sylvestris can be used to estimate the scale and timing of past pollution episodes in similar environmental contexts to those investigated at Darley Dale, where precisely dated pollution chronologies are lacking.

Identification and cloning of an NADPH-dependent hydroxycinnamoyl-CoA double bond reductase involved in dihydrochalcone formation in Malus×domestica Borkh.

Science.gov (United States)

Ibdah, Mwafaq; Berim, Anna; Martens, Stefan; Valderrama, Andrea Lorena Herrera; Palmieri, Luisa; Lewinsohn, Efraim; Gang, David R

2014-11-01

The apple tree (Malus sp.) is an agriculturally and economically important source of food and beverages. Many of the health beneficial properties of apples are due to (poly)phenolic metabolites that they contain, including various dihydrochalcones. Although many of the genes and enzymes involved in polyphenol biosynthesis are known in many plant species, the specific reactions that lead to the biosynthesis of the dihydrochalcone precursor, p-dihydrocoumaroyl-CoA (3), are unknown. To identify genes involved in the synthesis of these metabolites, existing genome databases of the Rosaceae were screened for apple genes with significant sequence similarity to Arabidopsis alkenal double bond reductases. Herein described are the isolation and characterization of a Malus hydroxycinnamoyl-CoA double bond reductase, which catalyzed the NADPH-dependent reduction of p-coumaroyl-CoA and feruloyl-CoA to p-dihydrocoumaroyl-CoA and dihydroferuloyl-CoA, respectively. Its apparent Km values for p-coumaroyl-CoA, feruloyl-CoA and NADPH were 96.6, 92.9 and 101.3μM, respectively. The Malus double bond reductase preferred feruloyl-CoA to p-coumaroyl-CoA as a substrate by a factor of 2.1 when comparing catalytic efficiencies in vitro. Expression analysis of the hydroxycinnamoyl-CoA double bond reductase gene revealed that its transcript levels showed significant variation in tissues of different developmental stages, but was expressed when expected for involvement in dihydrochalcone formation. Thus, the hydroxycinnamoyl-CoA double bond reductase appears to be responsible for the reduction of the α,β-unsaturated double bond of p-coumaroyl-CoA, the first step of dihydrochalcone biosynthesis in apple tissues, and may be involved in the production of these compounds. Copyright © 2014 Elsevier Ltd. All rights reserved.

Two QTL characterized for soft scald and soggy breakdown in apple (Malus × domestica) through pedigree-based analysis of a large population of interconnected families

NARCIS (Netherlands)

Howard, Nicholas P.; Weg, van de Eric; Tillman, John; Tong, Cindy B.S.; Silverstein, Kevin A.T.; Luby, James J.

2018-01-01

Soft scald and soggy breakdown are important postharvest physiological disorders of apple (Malus × domestica). ‘Honeycrisp’ and some of its offspring are particularly susceptible to developing these disorders. The purpose of this study was to identify molecular markers associated with high

Correlating gene expression to physiological parameters and environmental conditons during cold acclimation of Pinus sylvestris, identification of molecular markers using cDNA microarrays

NARCIS (Netherlands)

Joosen, R.V.L.; Lammers, M.; Balk, P.A.; Bronnum, P.; Konings, M.C.J.M.; Perks, M.; Stattin, E.; Wordragen, van M.F.; Geest, van der A.H.M.

2006-01-01

Scots pine (Pinus sylvestris L.) seedlings were grown under different conditions (three field locations, two seasons and two climate room regimes), and then analyzed for freezing tolerance of shoots and roots and for transcript abundance in apical buds based on a cDNA microarray containing about

Using multilevel systematic sampling to study apple fruit (Malus domestica Borkh.) quality and its variability at the orchard scale

DEFF Research Database (Denmark)

Martínez Vega, Mabel V.; Wulfsohn, Dvoralai; Clemmensen, Line Katrine Harder

2013-01-01

sample of ‘Granny Smith’ (Malus x domestica cv. ‘Granny Smith’) apples obtained from a 17 ha orchard based on a final sample of 74 fruit. Estimates of fruit marketable yield and fruit size distribution agreed well with packing house records. The estimated marketable yield was 356.6 ± 89.2 t compared...... recommended sample sizes to accurately describe the distribution of various quality variables of apples at the orchard scale....

A comparison of estimation methods for fitting Weibull, Johnson's SB and beta functions to Pinus pinaster, Pinus radiata and Pinus sylvestris stands in northwest Spain

Energy Technology Data Exchange (ETDEWEB)

Gorgoseo, J. J.; Rojo, A.; Camara-Obregon, A.; Dieguez-Aranda, U.

2012-07-01

The purpose of this study was to compare the accuracy of the Weibull, Johnson's SB and beta distributions, fitted with some of the most usual methods and with different fixed values for the location parameters, for describing diameter distributions in even-aged stands of Pinus pinaster, Pinus radiata and Pinus sylvestris in northwest Spain. A total of 155 permanent plots in Pinus sylvestris stands throughout Galicia, 183 plots in Pinus pinaster stands throughout Galicia and Asturias and 325 plots in Pinus radiata stands in both regions were measured to describe the diameter distributions. Parameters of the Weibull function were estimated by Moments and Maximum Likelihood approaches, those of Johnson's SB function by Conditional Maximum Likelihood and by Knoebel and Burkhart's method, and those of the beta function with the method based on the moments of the distribution. The beta and the Johnson's SB functions were slightly superior to Weibull function for Pinus pinaster stands; the Johnson's SB and beta functions were more accurate in the best fits for Pinus radiata stands, and the best results of the Weibull and the Johnson's SB functions were slightly superior to beta function for Pinus sylvestris stands. However, the three functions are suitable for this stands with an appropriate value of the location parameter and estimation of parameters method. (Author) 44 refs.

Maize Lc transcription factor enhances biosynthesis of anthocyanins, distinct proanthocyanidins and phenylpropanoids in apple (Malus domestica Borkh.).

Science.gov (United States)

Li, Houhua; Flachowsky, Henryk; Fischer, Thilo C; Hanke, Magda-Viola; Forkmann, Gert; Treutter, Dieter; Schwab, Wilfried; Hoffmann, Thomas; Szankowski, Iris

2007-10-01

Flavonoids are a large family of polyphenolic compounds with manifold functions in plants. Present in a wide range of vegetables and fruits, flavonoids form an integral part of the human diet and confer multiple health benefits. Here, we report on metabolic engineering of the flavonoid biosynthetic pathways in apple (Malus domestica Borkh.) by overexpression of the maize (Zea mays L.) leaf colour (Lc) regulatory gene. The Lc gene was transferred into the M. domestica cultivar Holsteiner Cox via Agrobacterium tumefaciens-mediated transformation which resulted in enhanced anthocyanin accumulation in regenerated shoots. Five independent Lc lines were investigated for integration of Lc into the plant genome by Southern blot and PCR analyses. The Lc-transgenic lines contained one or two Lc gene copies and showed increased mRNA levels for phenylalanine ammonia-lyase (PAL), chalcone synthase (CHS), flavanone 3 beta-hydroxylase (FHT), dihydroflavonol 4-reductase (DFR), leucoanthocyanidin reductases (LAR), anthocyanidin synthase (ANS) and anthocyanidin reductase (ANR). HPLC-DAD and LC-MS analyses revealed higher levels of the anthocyanin idaein (12-fold), the flavan 3-ol epicatechin (14-fold), and especially the isomeric catechin (41-fold), and some distinct dimeric proanthocyanidins (7 to 134-fold) in leaf tissues of Lc-transgenic lines. The levels of phenylpropanoids and their derivatives were only slightly increased. Thus, Lc overexpression in Malus domestica resulted in enhanced biosynthesis of specific flavonoid classes, which play important roles in both phytopathology and human health.

Yeast biodiversity from Vitis vinifera L., subsp. sylvestris (Gmelin Hegi to face up the oenological consequences of climate change

Directory of Open Access Journals (Sweden)

Puig-Pujol Anna

2016-01-01

Full Text Available The impact of climate change in the viticulture is affecting the quality of grapes and their wines. As consequence, climatic variations are producing a mismatch between technological and phenolic maturity and are affecting the microbiota's ecology, biodiversity and their metabolism in vineyard, grape, must and wine. However, there are natural resources that can help to mitigate the effects of global warming. It has been noticed that grapes from female plants of wild vines (Vitis vinifera subsp. sylvestris have very appropriate characteristics to face up this problem: later maturing, high acidity, high polyphenol content,…A molecular study of 819 strains isolated at the end of spontaneous fermentations of grapes of Vitis vinifera subsp. sylvestris grapevines from 30 locations in northern of Spain revealed 8 different genera and 18 different species. 71,5% of the yeasts were classified as non-Saccharomycesand 28,5% were identified as Saccharomyces cerevisiae. This latter specie was characterized at strain level, classifying 30 different groups, 6 of which as the majority from 2 up to 4 different locations. These findings demonstrate a wide diversity of yeast microbiota in wild grapes that will allow a yeast selection for the wine industry in a scenario of climate change.

A comparison of epicuticular wax of Pinus sylvestris needles from three sites in Ireland

International Nuclear Information System (INIS)

Donnelly, A.; Dowding, P.

1994-01-01

Three forest stands of Pinus sylvestris were chosen for comparison in Ireland. Needles from three year classes were collected. Cuticular transpiration curves showed that the rate of water loss from 1-year-old needles was faster than either 2-year-old or current-year needles at all sites. The amount of epicuticular wax extracted was similar to that reported in the literature. Needle wettability increased with needle age. Amorphous wax coverage was estimated using scanning electron microscopy (SEM) and was found to increase with needle age. Algal cells were noted on needles of all ages at one site and appeared to affect transpiration and microroughness. The presence of fungal hyphae was also noted. (orig.)

Anti-Inflammatory Effect of Malva sylvestris, Sida cordifolia, and Pelargonium graveolens Is Related to Inhibition of Prostanoid Production.

Science.gov (United States)

Martins, Cleverson Antonio Ferreira; Campos, Michel Leandro; Irioda, Ana Carolina; Stremel, Dile Pontarolo; Trindade, Angela Cristina Leal Badaró; Pontarolo, Roberto

2017-11-03

The ability of plant extracts and preparations to reduce inflammation has been proven by different means in experimental models. Since inflammation enhances the release of specific mediators, inhibition of their production can be used to investigate the anti-inflammatory effect of plants widely used in folk medicine for this purpose. The study was performed for leaves and flowers of Malva sylvestris , and leaves of Sida cordifolia and Pelargonium graveolens . These are three plant species known in Brazil as Malva. The anti-inflammatory activity of extracts and fractions (hexane, chloroform, ethyl acetate, and residual) was evaluated by quantitation of prostaglandins (PG) PGE₂, PGD₂, PGF 2α , and thromboxane B₂ (the stable nonenzymatic product of TXA₂) concentration in the supernatant of lipopolysaccharide (LPS)- induced RAW 264.7 cells. Inhibition of anti-inflammatory mediator release was observed for plants mainly in the crude extract, ethyl acetate fraction, and residual fraction. The results suggest superior activity of S. cordifolia , leading to significantly lower values of all mediators after treatment with its residual fraction, even at the lower concentration tested (10 μg/mL). M. sylvestris and P. graveolens showed similar results, such as the reduction of all mediators after treatment, with leaf crude extracts (50 μg/mL). These results suggest that the three species known as Malva have anti-inflammatory properties, S. cordifolia being the most potent.

Warming Effects on Pinus sylvestris in the Cold–Dry Siberian Forest–Steppe: Positive or Negative Balance of Trade?

Directory of Open Access Journals (Sweden)

Tatiana A. Shestakova

2017-12-01

Full Text Available Understanding climate change impacts on drought-prone forests is a critical issue. We investigated ring-width and stable isotopes (Δ13C and δ18O in two Pinus sylvestris stands of the cold–dry Siberian forest–steppe growing under contrasting climatic trends over the last 75 years. Despite regional warming, there was increasing precipitation during the growing period at the southern site (MIN but increasing water deficit (WD at the northern site (BER. Intrinsic water use efficiency (WUEi increased similarly (ca. 22% in response to warming and rising atmospheric CO2. However, the steady increase in WUEi was accompanied by divergent growth patterns since 1980: increasing basal area increment (BAI in MIN (slope = 0.102 cm2 year−2 and decreasing BAI in BER (slope = −0.129 cm2 year−2. This suggests that increased precipitation, mediated by CO2 effects, promoted growth in MIN, whereas intensified drought stress led to decreased carbon gain and productivity in BER. When compared to warm–dry stands of eastern Spain, the WUEi dependence on WD was three-fold greater in Siberia. Conversely, BAI was more affected by the relative impact of water stress within each region. These results indicate contrasting future trajectories of P. sylvestris forests, which challenge forecasting growth and carbon sequestration in cold–dry areas.

Antifungal activities of the essential oil and its fractions rich in sesquiterpenes from leaves of Casearia sylvestris Sw.

Science.gov (United States)

Pereira, Flaviane G; Marquete, Ronaldo; Domingos, Levy T; Rocha, Marco E N; Ferreira-Pereira, Antonio; Mansur, Elisabeth; Moreira, Davyson L

2017-01-01

Casearia genus (Salicaceae) is found in sub-tropical and tropical regions of the world and comprises about 160-200 species. It is a medicinal plant used in South America, also known as "guaçatonga", "erva-de-tiú", "cafezinho-do-mato". In Brazil, there are about 48 species and 12 are registered in the State of Rio de Janeiro, including Casearia sylvestris Sw. There are many studies related to the chemical profile and cytotoxic activities of extracts from these plants, although few studies about the antifungal potential of the essential oil have been reported. In this work, we have studied the antifungal properties of the essential oil of C. sylvestris leaves, as well as of their fractions, against four yeasts (Saccharomyces cerevisae, Candida albicans, C. glabrata and C. krusei) for the first time. The chemical analysis of the essential oil revealed a very diversified (n = 21 compounds) volatile fraction composed mainly of non-oxygenated sesquiterpenes (72.1%). These sesquiterpenes included α-humulene (17.8%) and α-copaene (8.5%) and the oxygenated sesquiterpene spathulenol (11.8%) were also identified. Monoterpenes were not identified. The fractions are mainly composed of oxygenated sesquiterpenes, and the most active fraction is rich in the sesquiterpene 14-hydroxy -9-epi-β-caryophyllene. This fraction was the most effective in inhibiting the growth of three yeast strains.

Individual traits as determinants of time to death under extreme drought in Pinus sylvestris L.

Science.gov (United States)

Garcia-Forner, Núria; Sala, Anna; Biel, Carme; Savé, Robert; Martínez-Vilalta, Jordi

2016-10-01

Plants exhibit a variety of drought responses involving multiple interacting traits and processes, which makes predictions of drought survival challenging. Careful evaluation of responses within species, where individuals share broadly similar drought resistance strategies, can provide insight into the relative importance of different traits and processes. We subjected Pinus sylvestris L. saplings to extreme drought (no watering) leading to death in a greenhouse to (i) determine the relative effect of predisposing factors and responses to drought on survival time, (ii) identify and rank the importance of key predictors of time to death and (iii) compare individual characteristics of dead and surviving trees sampled concurrently. Time until death varied over 3 months among individual trees (from 29 to 147 days). Survival time was best predicted (higher explained variance and impact on the median survival time) by variables related to carbon uptake and carbon/water economy before and during drought. Trees with higher concentrations of monosaccharides before the beginning of the drought treatment and with higher assimilation rates prior to and during the treatment survived longer (median survival time increased 25-70 days), even at the expense of higher water loss. Dead trees exhibited less than half the amount of nonstructural carbohydrates (NSCs) in branches, stem and relative to surviving trees sampled concurrently. Overall, our results indicate that the maintenance of carbon assimilation to prevent acute depletion of NSC content above some critical level appears to be the main factor explaining survival time of P. sylvestris trees under extreme drought. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Pemanfaatan buah apel (Malus sylvestris Mill. lewat matang sebagai substrat nata de apple

Directory of Open Access Journals (Sweden)

Achmad Gazali

2017-08-01

Full Text Available Malang and Batu are territories for the apel production in Indonesia. overripe and rejected apples become trash only. So, it’s needed to make a solution for raising value. The reseach was conducted in Mei-Juli 2016, having an object to utilize the overripe apel for making substrates of nata de apple. Apples were gotten from malang apple shop. Samples were washed and mixed with water until 50%:50% of ratio (cider A, after that, filtering cider with a gause. Cider was deluted by watering again until achieving 75%:25% (cider B and 87,5%:12,5% (cider C of ratio. All ciders were heated to avoid a bacteria contaminant. 100ml each of cider is put into specific bottles and added with 10-20 ml of Gluconobacter xylinus. The ciders were incubated at room temperature. The result of this study showed that the growth of nata de apple on cider A (1.27 ± 0,9cm is thicker than B (1.27 ± 0,9cm and nata on cider B was thicker than C (0.13 ± 0,1 cm. The nata weight was 66.7gr for A, 43gr for B and 4.2gr for C. The residual liquid fermentation test showed that the total acid 0.4 mg/ml for A, 0.3 mg/ml for B and 0.1 mg/ml for C. The sugar reduction degree was 17,15 mg/ml of 32.4 mg/ml for A, 8 mg/ml of 26.4 mg/ml for B, and no sugar reduction of 6.3 mg/ml for C. It could be concluded that the cider A resulting the best subrate of nata de apple..

Mitochondrial respiratory pathways modulate nitrate sensing and nitrogen-dependent regulation of plant architecture in Nicotiana sylvestris.

Science.gov (United States)

Pellny, Till K; Van Aken, Olivier; Dutilleul, Christelle; Wolff, Tonja; Groten, Karin; Bor, Melike; De Paepe, Rosine; Reyss, Agnès; Van Breusegem, Frank; Noctor, Graham; Foyer, Christine H

2008-06-01

Mitochondrial electron transport pathways exert effects on carbon-nitrogen (C/N) relationships. To examine whether mitochondria-N interactions also influence plant growth and development, we explored the responses of roots and shoots to external N supply in wild-type (WT) Nicotiana sylvestris and the cytoplasmic male sterile II (CMSII) mutant, which has a N-rich phenotype. Root architecture in N. sylvestris seedlings showed classic responses to nitrate and sucrose availability. In contrast, CMSII showed an altered 'nitrate-sensing' phenotype with decreased sensitivity to C and N metabolites. The WT growth phenotype was restored in CMSII seedling roots by high nitrate plus sugars and in shoots by gibberellic acid (GA). Genome-wide cDNA-amplified fragment length polymorphism (AFLP) analysis of leaves from mature plants revealed that only a small subset of transcripts was altered in CMSII. Tissue abscisic acid content was similar in CMSII and WT roots and shoots, and growth responses to zeatin were comparable. However, the abundance of key transcripts associated with GA synthesis was modified both by the availability of N and by the CMSII mutation. The CMSII mutant maintained a much higher shoot/root ratio at low N than WT, whereas no difference was observed at high N. Shoot/root ratios were strikingly correlated with root amines/nitrate ratios, values of <1 being characteristic of high N status. We propose a model in which the amine/nitrate ratio interacts with GA signalling and respiratory pathways to regulate the partitioning of biomass between shoots and roots.

Selectivity of Pinus sylvestris extract and essential oil to estrogen-insensitive breast cancer cells Pinus sylvestris against cancer cells.

Science.gov (United States)

Hoai, Nguyen Thi; Duc, Ho Viet; Thao, Do Thi; Orav, Anne; Raal, Ain

2015-10-01

So far, the anticancer action of pine tree extracts has mainly been shown for the species distributed widely around the Asian countries. Therefore, this study was performed to examine the potential cytotoxicity of Scots pine (Pinus sylvestris L.) native also to the European region and growing widely in Estonia. The cytotoxic activity of methanol extract and essential oil of Scots pine needles was determined by sulforhodamine B assay in different human cancer cell lines. This needle extract was found to suppress the viability of several human cancer cell lines showing some selectivity to estrogen receptor negative breast cancer cells, MDA-MB-231(half maximal inhibitory concentration [IC50] 35 μg/ml) in comparison with estrogen receptor-positive breast cancer cells, MCF-7 (IC50 86 μg/ml). It is the strongest cytotoxic effect at all measured, thus far for the needles and leaves extracts derived from various pine species, and is also the first study comparing the anticancer effects of pine tree extracts on molecularly different human breast cancer cells. The essential oil showed the stronger cytotoxic effect to both negative and positive breast cancer cell lines (both IC50 29 μg/ml) than pine extract (IC50 42 and 80 μg/ml, respectively). The data from this report indicate that Scots pine needles extract and essential oil exhibits some potential as chemopreventive or chemotherapeutic agent for mammary tumors unresponsive to endocrine treatment.

Modeling and Performance of Bonus-Malus Systems: Stationarity versus Age-Correction

Directory of Open Access Journals (Sweden)

Søren Asmussen

2014-03-01

Full Text Available In a bonus-malus system in car insurance, the bonus class of a customer is updated from one year to the next as a function of the current class and the number of claims in the year (assumed Poisson. Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of the literature measures performance of the system in terms of the stationary characteristics of this Markov chain. However, the rate of convergence to stationarity may be slow in comparison to the typical sojourn time of a customer in the portfolio. We suggest an age-correction to the stationary distribution and present an extensive numerical study of its effects. An important feature of the modeling is a Bayesian view, where the Poisson rate according to which claims are generated for a customer is the outcome of a random variable specific to the customer.

[Interspecific polymorphism of the glucosyltransferase domain of the sucrose synthase gene in the genus Malus and related species of Rosaceae].

Science.gov (United States)

Boris, K V; Kochieva, E Z; Kudryavtsev, A M

2014-12-01

The sequences that encode the main functional glucosyltransferase domain of sucrose synthase genes have been identified for the first time in 14 species of the genus Malus and related species of the family Rosaceae, and their polymorphism was investigated. Single nucleotide substitutions leading to amino acid substitutions in the protein sequence, including the conservative transmembrane motif sequence common to all sucrose synthase genes of higher plants, were detected in the studied sequences.

Changes in climate-growth relationships and IADF formation over time of pine species (Pinus halepensis, P. pinaster and P. sylvestris in Mediterranean environments

Directory of Open Access Journals (Sweden)

Jorge Olivar

2015-04-01

Full Text Available Background: The Mediterranean basin has experienced an increase in the mean annual temperature, a decrease in the mean annual precipitation, and an increase in the frequency of severe drought periods during the second half of the 20th century. However, winter and spring precipitation has increased and summer precipitation has decreased in the western Mediterranean region. Aim of the study: The objectives of the present study were: i to compare changes in climate-growth relationships over time for Pinus halepensis, P. pinaster and P. sylvestris in Spain ii to quantify the presence of intra-annual density fluctuations (IADFs on the three species, and iii to define the associated climatic variables. Area of study: 26 sampling sites (8 P. halepensis sites, 8 P. pinaster sites and 10 P. sylvestris sites were selected in their distribution area in Spain. Main results: Precipitation is the main factor influencing growth and IADF occurrence in the three species. Wet periods during previous winter and spring induced higher growth rates on P. halepensis and P. pinaster, while P. sylvestris was mostly influenced by summer precipitation. However, the influence of these climatic variables on the growth of these species changed over the studied period. The increase of winter and spring precipitation combined with increasingly harsh summer climatic conditions in the second half of the 20th century may have enhanced the importance of precipitation at the beginning of the growing season on the growth of species subject to higher summer drought stress (P. halepensis and P. pinaster and increased IADF occurrence. Research highlights: Besides reflecting changes in the environmental conditions during the growing season, the inclusion of IADF detection in chronologies adds new information to ring-width chronologies, thereby improving its quality.

Population genetic relationships between Casearia sylvestris (Salicaceae) varieties occurring sympatrically and allopatrically in different ecosystems in south-east Brazil.

Science.gov (United States)

Cavallari, Marcelo Mattos; Gimenes, Marcos Aparecido; Billot, Claire; Torres, Roseli Buzanelli; Zucchi, Maria Imaculada; Cavalheiro, Alberto Jose; Bouvet, Jean-Marc

2010-10-01

Species delimitation can be problematic, and recently diverged taxa are sometimes viewed as the extremes of a species' continuum in response to environmental conditions. Using population genetic approaches, this study assessed the relationship between two Casearia sylvestris (Salicaceae) varieties, which occur sympatrically and allopatrically in the landscape of south-east Brazil, where intermediate types are also found. In total, 376 individuals from nine populations in four different ecosystems were sampled, and nine microsatellite markers were used to assess the relative effects of the ecosystems and varieties on the distribution of genetic diversity among populations of this species. As a by-product of this study, several PCR products with more than two alleles were observed. The possibility that extra bands represent non-specific amplification or PCR artefacts was discarded by sequencing a sample of these bands. We suggest that (partial) genome duplication in C. sylvestris most probably explains this phenomenon, which may be a key factor in the differentiation of the two taxa, as it was markedly more frequent in one of the varieties. AMOVA indicated that approx. 22 % of the total genetic diversity was found between the two varieties. Bayesian analysis identified varieties and ecosystems as evolutionary units, rather than the individual populations sampled. The results are in agreement with field observations and support the recognition of two varieties, as well as documenting the occurrence of hybridization between them.

Early testing of adaptedness to temperature and water availability in Pinus sylvestris and Picea abies

International Nuclear Information System (INIS)

Sonesson, Johan

2000-01-01

Long-term climate changes have been evident in the past. In the future an increase in the rate of climate change is predicted owing to man-made emissions. Studies of adaptedness to different climatic conditions are of great importance for the design of appropriate breeding and gene conservation programmes. This thesis presents studies of adaptedness to temperature and water availability in Pinus sylvestris and Picea abies and explores the possibilities of utilising differences in adaptedness to obtain juvenile-mature (J-M) correlations strong enough for efficient early testing. Offspring from clones in two Swedish Pinus sylvestris seed orchards and one Picea abies seed orchard were grown in growth chambers for one and two growth periods respectively. Two temperature regimes and two irrigation regimes were applied in a factorial design. Both species expressed high phenotypic plasticity and additive variance for height growth and biomass traits. This implies that these populations should be able to adapt both to short-term and to long-term climate changes. Genotype by environment (GxE) interaction indicated strong differences in adaptedness to temperature and low differences in adaptedness to water availability. Parent rank changes between treatments indicated that climate change could seriously alter the ranking of clones in breeding populations and thus decrease the genetic gain obtained in previous selections. Differences in stability among parents suggested that culling of unstable genotypes could be a way to reduce the negative effects of GxE interaction. Genetic correlations between growth chamber and 14-30 year old field progeny trials with the same parents were mainly weak for both species. The correlations were improved by the drought treatment in the Picea abies experiment suggesting that further development of early testing methods for this species should include treatments with limiting water availability

Plant parts of the apple tree (Malus spp.) as possible indicators of heavy metal pollution.

Science.gov (United States)

Tošić, Snežana; Alagić, Slađana; Dimitrijević, Mile; Pavlović, Aleksandra; Nujkić, Maja

2016-05-01

The content of Cu, Zn, Pb, As, Cd, and Ni was determined by ICP-OES in spatial soil and parts (root, branches, leaves, and fruit) of the apple tree (Malus spp.) from polluted sites near The Mining and Smelting Complex Bor (Serbia). The aim of this study was to examine if the obtained results can be used for biomonitoring purposes. Data recorded in plant parts, especially leaves, gave very useful information about the environmental state of the Bor region. Conveniently, these data described well the capability of investigated plant species to assimilate and tolerate severely high concentrations of heavy metals in its tissues, which may further allow the possibility for utilization of the apple tree for phytostabilization.

Chemical Composition and In Vitro Cytotoxic Activity of Essential Oil of Leaves of Malus domestica Growing in Western Himalaya (India)

OpenAIRE

Walia, Mayanka; Mann, Tavleen S.; Kumar, Dharmesh; Agnihotri, Vijai K.; Singh, Bikram

2012-01-01

Light pale-colored volatile oil was obtained from fresh leaves of Malus domestica tree, growing in Dhauladhar range of Himalaya (Himachal Pradesh, India), with characteristic eucalyptol dominant fragrance. The oil was found to be a complex mixture of mono-, sesqui-, di-terpenes, phenolics, and aliphatic hydrocarbons. Seventeen compounds accounting for nearly 95.3% of the oil were characterized with the help of capillary GC, GC-MS, and NMR. Major compounds of the oil were characterized as euca...

Determination of various elements in the Malva Sylvestris L. from Manisa region in Turkey by using ICP-OES

International Nuclear Information System (INIS)

Hicsoenmez, Ue.; Erees, F. S.; Cam, S.; Ozdemir, C.; Oezdemir, A.

2006-01-01

Various elements are transmitted into living metabolism through food intake. Although some of these elements are beneficial for living body, some of them may be toxic or radioactive. 4 0K, 2 38U, 2 35U or the radioactive daughters in the U and Th natural decay chains may be taken via consumption of these elements. In particular, since these radioactive elements have very long half-life and emit alpha particles, they may cause internal radiation risk. Manisa region located in the Western part of the Turkey has very productive agricultural soil. The Malva sylvestris L. is a herbaceous being consumed by human and animals in the region. In this work, Malva sylvestris samples were collected from different points in Muradiye areas of Manisa. Then, they were classified according to leaf size. These leaves were dissolved by wet digestion method using a mixture of mineral acid. Concentrations of Co, Na, Ca, Mg, Al, B, Ba, Cu, Mn, Ni, Zn, Cr, Cd, Ag, Sn, K, Ti, Fe, Sr, Sb, Si, Pb, Bi, U, La and Zr in prepared solutions and region soil were determined by using Inductively Coupled Plasma Optical Emission Spectrometry (ICP-OES), which is very sensitive and accurate detecting low level elements in sample, eg. in rocks, plants, animal tissue etc. Obtained values were compared with the internationally allowed values. The results of element were analyzed statistically. For different leaf sizes, concentration factors were calculated

Actividad antiinflamatoria local de Malva sylvestris L. (Malvaceae) en el edema inducido por carragenina en ratas

OpenAIRE

Chiclana, Carlos F.; Enrique, Andrea; Consolini, Alicia E.

2009-01-01

La malva (Malva sylvestris L., Malvaceae) es una planta medicinal ampliamente utilizada en aplicación tópica como demulcente, cicatrizante, anti-hemorroidal, para mucosas o piel. Sin embargo su actividad antiinflamatoria tópica no ha sido reportada en ensayos preclínicos ni clínicos. En este trabajo se estudió el efecto inhibidor del edema inducido por carragenina en ratas de una crema con extracto de malva al 5, 10 y 20%. Se obtuvo una inhibición significativa del edema con la crema de malva...

Dopamine alleviates nutrient deficiency-induced stress in Malus hupehensis.

Science.gov (United States)

Liang, Bowen; Li, Cuiying; Ma, Changqing; Wei, Zhiwei; Wang, Qian; Huang, Dong; Chen, Qi; Li, Chao; Ma, Fengwang

2017-10-01

Dopamine mediates many physiological processes in plants. We investigated its role in regulating growth, root system architecture, nutrient uptake, and responses to nutrient deficiencies in Malus hupehensis Rehd. Under a nutrient deficiency, plants showed significant reductions in growth, chlorophyll concentrations, and net photosynthesis, along with disruptions in nutrient uptake, transport, and distribution. However, pretreatment with 100 μM dopamine markedly alleviated such inhibitions. Supplementation with that compound enabled plants to maintain their photosynthetic capacity and development of the root system while promoting the uptake of N, P, K, Ca, Mg, Fe, Mn, Cu, Zn, and B, altering the way in which those nutrients were partitioned throughout the plant. The addition of dopamine up-regulated genes for antioxidant enzymes involved in the ascorbate-glutathione cycle (MdcAPX, MdcGR, MdMDHAR, MdDHAR-1, and MdDHAR-2) but down-regulated genes for senescence (SAG12, PAO, and MdHXK). These results indicate that exogenous dopamine has an important antioxidant and anti-senescence effect that might be helpful for improving nutrient uptake. Our findings demonstrate that dopamine offers new opportunities for its use in agriculture, especially when addressing the problem of nutrient deficiencies. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Ozone fumigation under dark/light conditions of Norway Spruce (Picea Abies) and Scots Pine (Pinus Sylvestris)

Science.gov (United States)

Canaval, Eva; Jud, Werner; Hansel, Armin

2015-04-01

Norway Spruce (Picea abies) and Scots Pine (Pinus sylvestris) represent dominating tree species in the northern hemisphere. Thus, the understanding of their ozone sensitivity in the light of the expected increasing ozone levels in the future is of great importance. In our experiments we investigated the emissions of volatile organic compounds (VOCs) of 3-4 year old Norway Spruce and Scots Pine seedlings under ozone fumigation (50-150 ppbv) and dark/light conditions. For the experiments the plants were placed in a setup with inert materials including a glass cuvette equipped with a turbulent air inlet and sensors for monitoring a large range of meteorological parameters. Typical conditions were 20-25°C and a relative humidity of 70-90 % for both plant species. A fast gas exchange rate was used to minimize reactions of ozone in the gas phase. A Switchable-Reagent-Ion-Time-of-Flight-MS (SRI-ToF-MS) was used to analyze the VOCs at the cuvette outlet in real-time during changing ozone and light levels. The use of H3O+ and NO+ as reagent ions allows the separation of certain isomers (e.g. aldehydes and ketones) due to different reaction pathways depending on the functional groups of the molecules. Within the Picea abies experiments the ozone loss, defined as the difference of the ozone concentration between cuvette inlet and outlet, remained nearly constant at the transition from dark to light. This indicates that a major part of the supplied ozone is depleted non-stomatally. In contrast the ozone loss increased by 50 % at the transition from dark to light conditions within Pinus sylvestris experiments. In this case the stomata represent the dominant loss channel. Since maximally 0.1% of the ozone loss could be explained by gas phase reactions with monoterpenes and sesquiterpenes, we suggest that ozone reactions on the surface of Picea abies represent the major sink in this case and lead to an light-independent ozone loss. This is supported by the fact that we detected

The volatile profiles of a rare apple (Malus domestica Borkh.) honey: shikimic acid-pathway derivatives, terpenes, and others.

Science.gov (United States)

Kuś, Piotr Marek; Jerković, Igor; Tuberoso, Carlo Ignazio Giovanni; Šarolić, Mladenka

2013-09-01

The volatile profiles of rare Malus domestica Borkh. honey were investigated for the first time. Two representative samples from Poland (sample I) and Spain (sample II) were selected by pollen analysis (44-45% of Malus spp. pollen) and investigated by GC/FID/MS after headspace solid-phase microextraction (HS-SPME) and ultrasonic solvent extraction (USE). The apple honey is characterized by high percentage of shikimic acid-pathway derivatives, as well as terpenes, norisoprenoids, and some other compounds such as coumaran and methyl 1H-indole-3-acetate. The main compounds of the honey headspace were (sample I; sample II): benzaldehyde (9.4%; 32.1%), benzyl alcohol (0.3%; 14.4%), hotrienol (26.0%, 6.2%), and lilac aldehyde isomers (26.3%; 1.7%), but only Spanish sample contained car-2-en-4-one (10.2%). CH2 Cl2 and pentane/Et2 O 1 : 2 (v/v) were used for USE. The most relevant compounds identified in the extracts were: benzaldehyde (0.9-3.9%), benzoic acid (2.0-11.2%), terpendiol I (0.3-7.4%), coumaran (0.0-2.8%), 2-phenylacetic acid (2.0-26.4%), methyl syringate (3.9-13.1%), vomifoliol (5.0-31.8%), and methyl 1H-indole-3-acetate (1.9-10.2%). Apple honey contained also benzyl alcohol, 2-phenylethanol, (E)-cinnamaldehyde, (E)-cinnamyl alcohol, eugenol, vanillin, and linalool that have been found previously in apple flowers, thus disclosing similarity of both volatile profiles. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

The fate of recently fixed carbon after drought release: towards unravelling C storage regulation in Tilia platyphyllos and Pinus sylvestris.

Science.gov (United States)

Galiano, Lucía; Timofeeva, Galina; Saurer, Matthias; Siegwolf, Rolf; Martínez-Vilalta, Jordi; Hommel, Robert; Gessler, Arthur

2017-09-01

Carbon reserves are important for maintaining tree function during and after stress. Increasing tree mortality driven by drought globally has renewed the interest in how plants regulate allocation of recently fixed C to reserve formation. Three-year-old seedlings of two species (Tilia platyphyllos and Pinus sylvestris) were exposed to two intensities of experimental drought during ~10 weeks, and 13 C pulse labelling was subsequently applied with rewetting. Tracking the 13 C label across different organs and C compounds (soluble sugars, starch, myo-inositol, lipids and cellulose), together with the monitoring of gas exchange and C mass balances over time, allowed for the identification of variations in C allocation priorities and tree C balances that are associated with drought effects and subsequent drought release. The results demonstrate that soluble sugars accumulated in P. sylvestris under drought conditions independently of growth trends; thus, non-structural carbohydrates (NSC) formation cannot be simply considered a passive overflow process in this species. Once drought ceased, C allocation to storage was still prioritized at the expense of growth, which suggested the presence of 'drought memory effects', possibly to ensure future growth and survival. On the contrary, NSC and growth dynamics in T. platyphyllos were consistent with a passive (overflow) view of NSC formation. © 2017 John Wiley & Sons Ltd.

Retracted: Long-term copper toxicity in apple trees (Malus pumila Mill) and bioaccumulation in fruits.

Science.gov (United States)

Sun, Bai-Ye; Kan, Shi-Hong; Zhang, Yan-Zong; Wu, Jun; Deng, Shi-Huai; Liu, Chun-Sheng; Yang, Gang

2010-01-15

The following article from Environmental Toxicology, 'Long-term Copper Toxicity in Apple Trees (Malus pumila Mill) and Bioaccumulation in Fruits' by Bai-Ye Sun, Shi- Hong Kan, Yan-Zong Zhang, Jun Wu, Shi-Huai Deng, Chun-Sheng Liu and Gang Yang, published online on January 15, 2010 in Wiley InterScience (www.interscience.wiley.com; DOI: 10.1002/tox.20565), has been retracted by agreement between the authors, the journal Editor in Chief, Dr. Paul Tchounwou, and Wiley Periodicals, Inc. The retraction has been agreed at the request of the authors due to overlap with 'Copper Toxicity and Bioaccumulation in Chinese Cabbage (Brassica pekinensis Rupr.)' by Zhi-Ting Xiong and Hai Wang, published in Environmental Toxicology, Volume 20, pages 188-194, 2005.

Mechanical properties of wood from Pinus sylvestris L. treated with Light Organic Solvent Preservative and with waterborne Copper Azole

Energy Technology Data Exchange (ETDEWEB)

Villasante, A.; Laina, R.; Rojas, J. A. M.; Rojas, I. M.; Vignote, S.

2013-07-01

Aim of study: To determine the effect on wood from Pinus sylvestris of treatment with preservatives on mechanical properties and to establish the relation between the penetration and compression strenght. Area of study: Spain. Material and methods: 40 samples of defect-free wood from Pinus sylvestris L. were treated with Light Organic Solvent Preservative (Vacsol Azure WR 2601) and 50 with waterborne Copper Azole (Tanalith E 3492). 40 control samples were not treated (water or preservative). Mechanical resistance to static bending, modulus of elasticity and compression strength parallel to the grain were compared with untreated wood. Regression analysis between the penetration and compression strength parallel was done with the samples treated with waterborne preservative. Main results: The results indicate that the treated wood (with either product) presents a statistically significant increase in mechanical resistance in all three mechanical characteristics. The results obtained differ from earlier studies carried out by other authors. There was no correlation between parallel compression strength and the degree of impregnation of the wood with waterborne Copper Azole. The most probable explanation for these results concerns changes in pressure during treatment. The use of untreated control samples instead of samples treated only with water is more likely to produce significant results in the mechanical resistance studies. Research highlights: Treated wood presents a statistically significant increase in MOE, modulus of rupture to static bending and parallel compression strength. There was no correlation between parallel compression strength and the degree of impregnation with waterborne preservative. (Author)

Saturated salt method determination of hysteresis of Pinus sylvestris L. wood for 35 ºC isotherms

Directory of Open Access Journals (Sweden)

García Esteban, L.

2004-12-01

Full Text Available The saturated salts method was used in this study to quantify hysteresis in Pinus sylvestris L. wood, in an exercise that involved plotting the 35 ºC desorption and sorption isotherms. Nine salts were used, all of which establish stable and known relative humidity values when saturated in water The wood was kept at the relative humidity generated by each of these salts until the equilibrium moisture content (EMC was reached, both in the water loss or desorption, and the water uptake or sorption processes. The Guggenheim method was used to fit the values obtained to the respective curves. Hysteresis was evaluated in terms of the hysteresis coefficient, for which a mean value of 0.87 was found.

Con este trabajo se ha cuantificado la histéresis de la madera de Pinus sylvestris L. Para ello, se han construido las isotermas de 35 ºC de adsorción y sorción, mediante el método de las sales saturadas. Se han utilizado nueve sales que cuando se saturan en agua dan lugar a unas humedades relativas estables y conocidas. La madera fue colocada bajo las distintas humedades relativas que confieren cada una de las sales hasta que alcanzaron las distintas humedades de equilibrio higroscópico, tanto en el proceso de pérdida de agua o desorción, como en el de adquisición de agua o de sorción. Los valores obtenidos fueron ajustados a las respectivas sigmoides, haciendo uso del método de Guggenheim. La valoración de la histéresis se determinó mediante el coeficiente de histéresis, obteniendo un valor medio de 0,87.

New insight into the history of domesticated apple: secondary contribution of the European wild apple to the genome of cultivated varieties.

Directory of Open Access Journals (Sweden)

Amandine Cornille

Full Text Available The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica, on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species.

New Insight into the History of Domesticated Apple: Secondary Contribution of the European Wild Apple to the Genome of Cultivated Varieties

Science.gov (United States)

Cornille, Amandine; Gladieux, Pierre; Smulders, Marinus J. M.; Roldán-Ruiz, Isabel; Laurens, François; Le Cam, Bruno; Nersesyan, Anush; Clavel, Joanne; Olonova, Marina; Feugey, Laurence; Gabrielyan, Ivan; Zhang, Xiu-Guo; Tenaillon, Maud I.; Giraud, Tatiana

2012-01-01

The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica), on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain) to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species. PMID:22589740

13C-isotopic fingerprint of Pinus pinaster Ait. and Pinus sylvestris L. wood related to the quality of standing tree mass in forests from NW Spain.

Science.gov (United States)

Fernandez, Irene; González-Prieto, Serafin J; Cabaneiro, Ana

2005-01-01

Pine forest plantations of Pinus pinaster Ait. and P. sylvestris L. located in Galicia, NW Spain, were selected to study the 13C/12C-isotopic fingerprint in wood core samples in order to find possible relationships between the delta(13)C at natural abundance levels and the quality of the standing tree mass. For each pine species, 24 forests growing on acidic soils were studied: half developed over granite and half over schists. Two dominant trees from each plot, corresponding to all possible combinations of forest stands with high or low site index and with adults or young trees, were drilled at the basal part of trunks using a Pressler drill to obtain tree ring samples. The C-isotopic compositions of the litter and the soil organic matter from different soil depths were also determined and statistically significant correlations between these values and the 13C content of the wood were observed. Despite internal variations due to the influence of site index, tree age and parent material, the isotopic fingerprint of P. pinaster wood (mean value delta13C=-26.2+/-0.8 per thousand) significantly differed (Ppinaster stands (r=-0.667, Ppinaster growing over schists (r=-0.833, Ppinaster trees is higher when plots over granite or schists are separately considered. A similar fact occurs for adult P. sylvestris trees from schists stands, high quality specimens being 13C-depleted compared with low quality ones. On the other hand, 13C natural abundance of wood from P. sylvestris trees seems to be also strongly influenced by the underlying parent material, young trees from granite stands having a statistically higher 13C-isotopic composition (P<0.05) than young trees from schists stands. Copyright (c) 2005 John Wiley & Sons, Ltd.

Association of FLOWERING LOCUS T/TERMINAL FLOWER 1-like gene FTL2 expression with growth rhythm in Scots pine (Pinus sylvestris).

Science.gov (United States)

Avia, Komlan; Kärkkäinen, Katri; Lagercrantz, Ulf; Savolainen, Outi

2014-10-01

Understanding the genetic basis of the timing of bud set, an important trait in conifers, is relevant for adaptation and forestry practice. In common garden experiments, both Scots pine (Pinus sylvestris) and Norway spruce (Picea abies) show a latitudinal cline in the trait. We compared the regulation of their bud set biology by examining the expression of PsFTL2, a Pinus sylvestris homolog to PaFTL2, a FLOWERING LOCUS T/TERMINAL FLOWER 1 (FT/TFL1)-like gene, the expression levels of which have been found previously to be associated with the timing of bud set in Norway spruce. In a common garden study, we analyzed the relationship of bud phenology under natural and artificial photoperiods and the expression of PsFTL2 in a set of Scots pine populations from different latitudes. The expression of PsFTL2 increased in the needles preceding bud set and decreased during bud burst. In the northernmost population, even short night periods were efficient to trigger this expression, which also increased earlier under all photoperiodic regimes compared with the southern populations. Despite the different biology, with few limitations, the two conifers that diverged 140 million yr ago probably share an association of FTL2 with bud set, pointing to a common mechanism for the timing of growth cessation in conifers. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

Xylem diameter changes during osmotic stress, desiccation and freezing in Pinus sylvestris and Populus tremula.

Science.gov (United States)

Lintunen, Anna; Lindfors, Lauri; Nikinmaa, Eero; Hölttä, Teemu

2017-04-01

Trees experience low apoplastic water potential frequently in most environments. Low apoplastic water potential increases the risk of embolism formation in xylem conduits and creates dehydration stress for the living cells. We studied the magnitude and rate of xylem diameter change in response to decreasing apoplastic water potential and the role of living parenchyma cells in it to better understand xylem diameter changes in different environmental conditions. We compared responses of control and heat-injured xylem of Pinus sylvestris (L.) and Populus tremula (L.) branches to decreasing apoplastic water potential created by osmotic stress, desiccation and freezing. It was shown that xylem in control branches shrank more in response to decreasing apoplastic water potential in comparison with the samples that were preheated to damage living xylem parenchyma. By manipulating the osmotic pressure of the xylem sap, we observed xylem shrinkage due to decreasing apoplastic water potential even in the absence of water tension within the conduits. These results indicate that decreasing apoplastic water potential led to withdrawal of intracellular water from the xylem parenchyma, causing tissue shrinkage. The amount of xylem shrinkage per decrease in apoplastic water potential was higher during osmotic stress or desiccation compared with freezing. During desiccation, xylem diameter shrinkage involved both dehydration-related shrinkage of xylem parenchyma and water tension-induced shrinkage of conduits, whereas dehydration-related shrinkage of xylem parenchyma was accompanied by swelling of apoplastic ice during freezing. It was also shown that the exchange of water between symplast and apoplast within xylem is clearly faster than previously reported between the phloem and the xylem. Time constant of xylem shrinkage was 40 and 2 times higher during osmotic stress than during freezing stress in P. sylvestris and P. tremula, respectively. Finally, it was concluded that the

GC/MS Analysis of Oil Extractives from Wood and Bark of Pinus sylvestris, Abies alba, Picea abies, and Larix decidua

Directory of Open Access Journals (Sweden)

Mohamed Zidan Mohamed Salem

2015-09-01

Full Text Available Wood and bark oil extractives components (OECs of Pinus sylvestris, Abies alba, Picea abies, and Larix decidua grown in the Czech Republic were analyzed using gas chromatography/ mass spectrometry (GC/MS. The analysis showed the presence of monoterpene, sesquiterpene, diterpenoids, and resin acids. The highest percentages of OECs in the wood of P. sylvestris were α-fenchyl alcohol (26.04%, D-fenchyl alcohol (12.39%, and L-borneol (8.81%; the OECs in the bark included α-methyl-γ-butyrolactone (31.88% and isodecyl octyl phthalate (15.85%. The most frequently occurring OEC in A. alba wood were 4-hydroxy-4-methyl-2-pentanone (73.36%, α-cedrol (10.08%, and 2,6-dimethyl-1,3,6-heptatriene (7.35%; the most OECs in the bark were di(2-ethylhexylphthalate (59.83%, methyl cyclopentane (16.63%, and 13-epimanool (6.31%. P. abies wood OECs included 4-hydroxy-4-methyl-2-pentanone (29.42%, α-cedrol (26.98%, ∆3-carene (6.08%, and terpinen-4-ol (5.42%; the most OECs in the bark were di(2-ethylhexylphthalate (30.91%, cyclohexane (12.89%, caryophyllene oxide (8.90%, and α-pinene (4.59%. OECs of L. decidua wood were α-terpineol (26.06%, isoborneol (14.12%, camphene (11.78%, D-fenchyl alcohol (10.39%, and larixol (4.85%; OECs in the bark were larixol (33.29%, phthalic acid mono-2-ethylhexyl ester (16.96%, 13-epimanool (15.40%, and cyclohexane (8.44%.

Morphology and stucture of wild apple (Malus silvestris Mill..common pear (Pyrus cofnmunis L. and Chaenomeles japonica (Thunb Lindl. seeds

Directory of Open Access Journals (Sweden)

Stanisław Pelc

2014-01-01

Full Text Available The outer and inner structure of wild apple (Malus silvestris Mill., common pear (Pyrus communis L. and Chaenomeles japonica (Thunb. Lindl. seeds was investigated. It was found that the outer structure exhibits good diagnostic features expressed in the first place in the relief of the seed coat and further in the arrangement and appearance of the site of attachment of the free end of the funiculus and the shape of the seeds. In ripe seeds there is, under the thick seed coat, an endosperm layer completely surrounding the embryo which has large cotyledons and a thick rootlet.

Estimation of diameter and height of individual trees for Pinus sylvestris L. based on the individualising of crowns using airborne LiDAR and the National Forestry Inventory data

Energy Technology Data Exchange (ETDEWEB)

Valbuena-Rabadán, M.A.; Santamaría-Peña, J.; Sanz-Adán, F.

2016-07-01

Aim of the study: The objective of this study is to test the validity of the DBH and total height allometric models fitted to the crown polygon data obtained by the application of a crown delineation and individualisation algorithm which uses the geometrical relationships between the points in the original LiDAR point clouds in the Pinus sylvestris L. stands. Area of study: The study area is located in the province of Álava in the Autonomous Community of the Basque Country. Material and Methods: The crowns are delineated using data from airborne LiDAR point clouds obtained in the 2008 overflight of the Basque Autonomous Community. The DBH and total height data for field trees are obtained from the plots in the 4th National forest inventory. Main Results: For the adjusted total height and DBH models coefficients of determination of 0.87 and 0.74 respectively were obtained. The root mean squared errors were 10.67% and 18.97% respectively. The distributions of obtained DBH and total height fitted values and the distributions of the DBH and total height of the field trees are very similar except for the DBH below 15 cm. Research highlights: For stands of Pinus sylvestris L. in Álava, the geometrical relationships between the points that correspond to laser signal echoes obtained with airborne LiDAR sensors can be used directly to delineate approximations of the horizontal projections of the crowns of the trees. Although the procedure set out here was developed for stands of P. sylvestris L. in Álava, it can be applied to other conifers in regular stands by adjusting the working parameters of the function which delineates the crowns on the basis of the point cloud. (Author)

Mechanical properties of wood from Pinus sylvestris L. treated with Light Organic Solvent Preservative and with waterborne Copper Azole

Directory of Open Access Journals (Sweden)

A.M. Villasante

2013-12-01

Full Text Available Aim of study: To determine the effect on wood from Pinus sylvestris of treatment with preservatives on mechanical properties and to establish the relation between the penetration and compression strength.Area of study: SpainMaterial and Methods: 40 samples of defect-free wood from Pinus sylvestris L. were treated with Light Organic Solvent Preservative (Vacsol Azure WR 2601 and 50 with waterborne Copper Azole (Tanalith E 3492. 40 control samples were not treated (water or preservative. Mechanical resistance to static bending, modulus of elasticity and compression strength parallel to the grain were compared with untreated wood. Regression analysis between the penetration and compression strength parallel was done with the samples treated with waterborne preservative.Main results: The results indicate that the treated wood (with either product presents a statistically significant increase in mechanical resistance in all three mechanical characteristics. The results obtained differ from earlier studies carried out by other authors.There was no correlation between parallel compression strength and the degree of impregnation of the wood with waterborne Copper Azole . The most probable explanation for these results concerns changes in pressure during treatment.The use of untreated control samples instead of samples treated only with water is more likely to produce significant results in the mechanical resistance studies.Research highlights: Treated wood presents a statistically significant increase in MOE, modulus of rupture to static bending  and parallel compression strength.There was no correlation between parallel compression strength and the degree of impregnation with waterborne preservative.Keywords: Light Organic Solvent Preservative; MOE; parallel compression; static bending; waterborne Copper Azole; wood technology.

Application of a high-speed breeding technology to apple (Malus × domestica) based on transgenic early flowering plants and marker-assisted selection.

Science.gov (United States)

Flachowsky, Henryk; Le Roux, Pierre-Marie; Peil, Andreas; Patocchi, Andrea; Richter, Klaus; Hanke, Magda-Viola

2011-10-01

Breeding of apple (Malus × domestica) remains a slow process because of protracted generation cycles. Shortening the juvenile phase to achieve the introgression of traits from wild species into prebreeding material within a reasonable time frame is a great challenge. In this study, we evaluated early flowering transgenic apple lines overexpressing the BpMADS4 gene of silver birch with regard to tree morphology in glasshouse conditions. Based on the results obtained, line T1190 was selected for further analysis and application to fast breeding. The DNA sequences flanking the T-DNA were isolated and the T-DNA integration site was mapped on linkage group 4. The inheritance and correctness of the T-DNA integration were confirmed after meiosis. A crossbred breeding programme was initiated by crossing T1190 with the fire blight-resistant wild species Malus fusca. Transgenic early flowering F(1) seedlings were selected and backcrossed with 'Regia' and 98/6-10 in order to introgress the apple scab Rvi2, Rvi4 and powdery mildew Pl-1, Pl-2 resistance genes and the fire blight resistance quantitative trait locus FB-F7 present in 'Regia'. Three transgenic BC'1 seedlings pyramiding Rvi2, Rvi4 and FB-F7, as well as three other BC'1 seedlings combining Pl-1 and Pl-2, were identified. Thus, the first transgenic early flowering-based apple breeding programme combined with marker-assisted selection was established. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

Somatic Embryogenesis in Olive (Olea europaea L. subsp. europaea var. sativa and var. sylvestris).

Science.gov (United States)

Rugini, Eddo; Silvestri, Cristian

2016-01-01

Protocols for olive somatic embryogenesis from zygotic embryos and mature tissues have been described for both Olea europaea sub. europaea var. sativa and var. sylvestris. Immature zygotic embryos (no more than 75 days old), used after fruit collection or stored at 12-14 °C for 2-3 months, are the best responsive explants and very slightly genotype dependent, and one single protocol can be effective for a wide range of genotypes. On the contrary, protocols for mature zygotic embryos and for mature tissue of cultivars are often genotype specific, so that they may require many adjustments according to genotypes. The use of thidiazuron and cefotaxime seems to be an important trigger for induction phase particularly for tissues derived from cultivars. Up to now, however, the application of this technique for large-scale propagation is hampered also by the low rate of embryo germination; it proves nonetheless very useful for genetic improvement.

Growth and Survival Variation among Scots Pine (Pinus sylvestris L. Provenances

Directory of Open Access Journals (Sweden)

Süleyman Gülcü

2017-01-01

Full Text Available Tree height, basal diameter, and survival were examined in thirteen-year-old provenance test established by 30 seed sources of Scots pine (Pinus sylvestris L. at two exotic sites of the species in Southern part of Turkey. Variations within provenance and among provenances and relations among the traits were estimated to compare Scots pine provenance and two other native species. Averages of tree height and basal diameter were 350 cm and 52.7 mm in Aydogmus site and 385 cm and 51.2 mm in Kemer site, respectively. There were large differences within and among provenances for the characters. Sites were similar (p>0.05 for the characters, while there were significant differences (p≤0.05 among provenances within site according to results of variance analysis (ANOVA. Scots pine provenances were higher and had more thickness than that of black pine (Pinus nigra Arnold and Taurus cedar (Cedrus libani A. Rich. which were natural species of the region. There were positive and significant (p<0.05 correlations between height and basal diameter in the species. Average survivals were 56% and 35% of the provenances in the sites. They were 71% and 11% in black pine and 53% in Taurus cedar for the sites respectively.

Methylated Fatty Acids from Heartwood and Bark of Pinus sylvestris, Abies alba, Picea abies, and Larix decidua: Effect of Strong Acid Treatment

Directory of Open Access Journals (Sweden)

Mohamed Zidan Mohamed Salem

2015-09-01

Full Text Available Methylated fatty acid (FA compounds in the heartwood and bark of some softwood species, specifically Pinus sylvestris, Abies alba, Picea abies, and Larix decidua, grown in the Czech Republic were evaluated. Strong H2SO4 was used for methylation of the lipids. The highest content of lipid was found in P. abies bark (40.132 mg/g o.d. sample, and the lowest content was in A. alba wood (11.027 mg/g o.d. sample. The highest concentration of FAs was observed in L. decidua bark. The highest percentages of FAs in wood of P. sylvestris were arachidic acid and oleic acid. In bark, the highest percentages of FAs were stearic acid, palmitic acid, and oleic acid. The FAs with the highest concentrations in A. alba wood were arachidic acid, palmitic acid, pentadecanoic acid, and margarinic, and those in bark were behenic acid, lignoceric acid, and arachidic acid. P. abies wood FAs showed arachidic acid, palmitic acid, and margarinic acid, and the bark contained lignoceric acid and arachidic acid. The FAs of L. decidua wood were arachidic acid, palmitic acid, and stearic acid, and in bark they were pentacosylic acid, docosahexaenoic acid (DHA, lignoceric acid, arachidic acid, and behenic acid. The lack of typically dominant unsaturated fatty acids (e.g. 18:1, 18:2, compared to literature values were attributed to the application of strong acid for the hydrolysis.

Cryopreservation of ectomycorrhizal fungi has minor effects on root colonization of Pinus sylvestris plantlets and their subsequent nutrient uptake capacity.

Science.gov (United States)

Crahay, Charlotte; Wevers, Jan; Munaut, Françoise; Colpaert, Jan V; Declerck, Stéphane

2013-08-01

The use of ectomycorrhizal (ECM) fungi for afforestation, bioremediation, and timber production requires their maintenance over long periods under conditions that preserve their genetic, phenotypic, and physiological stability. Cryopreservation is nowadays considered as the most suitable method to maintain the phenotypic and genetic stability of a large number of filamentous fungi including the ECM fungi. Here, we compared the ability of eight ECM fungal isolates to colonize Pinus sylvestris roots and to transport inorganic phosphate (Pi) and NH4 (+) from the substrate to the plant after cryopreservation for 6 months at -130 °C or after storage at 4 °C. Overall, the mode of preservation had no significant effect on the colonization rates of P. sylvestris, the concentrations of ergosterol in the roots and substrate, and the uptake of Pi and NH4 (+). Comparing the isolates, differences were sometimes observed with one or the other method of preservation. Suillus bovinus exhibited a reduced ability to form mycorrhizas and to take up Pi following cryopreservation, while one Suillus luteus isolate exhibited a decreased ability to take up NH4 (+). Conversely, Hebeloma crustuliniforme, Laccaria bicolor, Paxillus involutus, and Pisolithus tinctorius exhibited a reduced ability to form mycorrhizas after storage at 4 °C, although this did not result in a reduced uptake of Pi and NH4 (+). Cryopreservation appeared as a reliable method to maintain important phenotypic characteristics (i.e., root colonization and nutrient acquisition) of most of the ECM fungal isolates studied. For 50 % of the ECM fungal isolates, the colonization rate was even higher with the cultures cryopreserved at -130 °C as compared to those stored at 4 °C.

Chemical Composition and Cytotoxicity Evaluation of Essential Oil from Leaves of Casearia Sylvestris, Its Main Compound α-Zingiberene and Derivatives

Directory of Open Access Journals (Sweden)

Patricia Sartorelli

2013-08-01

Full Text Available Casearia sylvestris (Salicaceae, popularly known as “guaçatonga”, is a plant widely used in folk medicine to treat various diseases, including cancer. The present work deals with the chemical composition as well as the cytotoxic evaluation of its essential oil, its main constituent and derivatives. Thus, the crude essential oil from leaves of C. sylvestris was obtained using a Clevenger type apparatus and analyzed by GC/MS. This analysis afforded the identification of 23 substances, 13 of which corresponded to 98.73% of the total oil composition, with sesquiterpene a-zingiberene accounting for 50% of the oil. The essential oil was evaluated for cytotoxic activity against several tumor cell lines, giving IC50 values ranging from 12 to 153 mg/mL. Pure a-zingiberene, isolated from essential oil, was also evaluated against the tumor cell lines showing activity for HeLa, U-87, Siha and HL60 cell lines, but with IC50 values higher than those determined for the crude essential oil. Aiming to evaluate the effect of the double bonds of a-zingiberene on the cytotoxic activity, partially hydrogenated a-zingiberene (PHZ and fully hydrogenated a-zingiberene (THZ derivatives were obtained. For the partially hydrogenated derivative only cytotoxic activity to the B16F10-Nex2 cell line (IC50 65mg/mL was detected, while totally hydrogenated derivative showed cytotoxic activity for almost all cell lines, with B16F10-Nex2 and MCF-7 as exceptions and with IC50 values ranging from 34 to 65 mg/mL. These results indicate that cytotoxic activity is related with the state of oxidation of compound.

Chemical composition and cytotoxicity evaluation of essential oil from leaves of Casearia sylvestris, its main compound α-zingiberene and derivatives.

Science.gov (United States)

Bou, Diego Dinis; Lago, João Henrique G; Figueiredo, Carlos R; Matsuo, Alisson L; Guadagnin, Rafael C; Soares, Marisi G; Sartorelli, Patricia

2013-08-08

Casearia sylvestris (Salicaceae), popularly known as "guaçatonga", is a plant widely used in folk medicine to treat various diseases, including cancer. The present work deals with the chemical composition as well as the cytotoxic evaluation of its essential oil, its main constituent and derivatives. Thus, the crude essential oil from leaves of C. sylvestris was obtained using a Clevenger type apparatus and analyzed by GC/MS. This analysis afforded the identification of 23 substances, 13 of which corresponded to 98.73% of the total oil composition, with sesquiterpene a-zingiberene accounting for 50% of the oil. The essential oil was evaluated for cytotoxic activity against several tumor cell lines, giving IC50 values ranging from 12 to 153 mg/mL. Pure a-zingiberene, isolated from essential oil, was also evaluated against the tumor cell lines showing activity for HeLa, U-87, Siha and HL60 cell lines, but with IC50 values higher than those determined for the crude essential oil. Aiming to evaluate the effect of the double bonds of a-zingiberene on the cytotoxic activity, partially hydrogenated a-zingiberene (PHZ) and fully hydrogenated a-zingiberene (THZ) derivatives were obtained. For the partially hydrogenated derivative only cytotoxic activity to the B16F10-Nex2 cell line (IC50 65 mg/mL) was detected, while totally hydrogenated derivative showed cytotoxic activity for almost all cell lines, with B16F10-Nex2 and MCF-7 as exceptions and with IC50 values ranging from 34 to 65 mg/mL. These results indicate that cytotoxic activity is related with the state of oxidation of compound.

Changes in the Essential Oil Composition in the Needles of Scots Pine (Pinus sylvestris L. Under Anthropogenic Stress

Directory of Open Access Journals (Sweden)

Asta Judzentiene

2007-01-01

Full Text Available Unfavorable anthropogenic factors, such as air pollution, lead to biochemical responses in trees. Changes in the amounts of secondary metabolites may be early indicators of invisible injuries. The aim of this study was to evaluate composition of the essential oils in the needles of Scots pine (Pinus sylvestris L. growing in the areas affected by pollutant emissions of main factories in Lithuania: a nitrogen fertilizer factory (NFF, a cement factory (CF, and an oil refinery (OR. Totally, 14 pine stands were examined along transects from the factories (July 2005. Volatile components of the needles were extracted and analyzed by GC and GC/MS. Over 70 components of the essential oils were identified in current-year and 1-year-old needles.

RNA interference silencing of CHS greatly alters the growth pattern of apple (Malus x domestica).

Science.gov (United States)

Dare, Andrew P; Hellens, Roger P

2013-08-01

Plants produce a vast array of phenolic compounds which are essential for their survival on land. One major class of polyphenols are the flavonoids and their formation is dependent on the enzyme chalcone synthase (CHS). In a recent study we silenced the CHS genes of apple (Malus × domestica Borkh.) and observed a loss of pigmentation in the fruit skin, flowers and stems. More surprisingly, highly silenced lines were significantly reduced in size, with small leaves and shortened internode lengths. Chemical analysis also revealed that the transgenic shoots contained greatly reduced concentrations of flavonoids which are known to modulate auxin flow. An auxin transport study verified this, with an increased auxin transport in the CHS-silenced lines. Overall, these findings suggest that auxin transport in apple has adapted to take place in the presence of high endogenous concentrations of flavonoids. Removal of these compounds therefore results in abnormal auxin movement and a highly disrupted growth pattern.

The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars.

Science.gov (United States)

Wei, Xiaoyu; Liu, Fengli; Chen, Cheng; Ma, Fengwang; Li, Mingjun

2014-01-01

In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of "Gala" apple. Genes for sugar alcohol [including 17 sorbitol transporters (SOTs)], sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs). Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars

Directory of Open Access Journals (Sweden)

Xiaoyu eWei

2014-11-01

Full Text Available In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of ‘Gala’ apple. Genes for sugar alcohol (including 17 sorbitol transporters, sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs. Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

Antioxidant and antimicrobial properties of dried Portuguese apple variety (Malus domestica Borkh. cv Bravo de Esmolfe).

Science.gov (United States)

Pires, Tânia C S P; Dias, Maria Inês; Barros, Lillian; Alves, Maria José; Oliveira, M Beatriz P P; Santos-Buelga, Celestino; Ferreira, Isabel C F R

2018-02-01

Malus domestica Borkh apples are one of the most consumed fruits in the world, due to their sweetness and flavour. Herein, 'Bravo de Esmolfe' apple fruits were characterized regarding their nutritional value, chemical composition and bioactive properties. Besides nutrients, flavan-3-ols (i.e., epicatechin and B-type procyanidins) as also hydroxycinnamoyl-quinic acids and phloretin derivatives were identified in the samples. Extracts prepared from 'Bravo de Esmolfe' also proved to have antioxidant activity and antibacterial effects against Gram-positive bacteria, namely methicillin-susceptible Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), Listeria monocytogenes and Enterococcus faecalis, and against the Gram-negative bacteria Escherichia coli, Escherichia coli (ESBL) (producing extended spectrum β-lactamases) and Morganella morganii. There is very little information about 'Bravo de Esmolfe' apple, so this study is important to inform consumers about an alternative source of nutritional and bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.

Effects of photoperiod and thermal time on the growth rhythm of Pinus sylvestris seedlings

Energy Technology Data Exchange (ETDEWEB)

Partanen, Jouni; Beuker, Egbert [Finnish Forest Research Inst., Punkaharju (Finland). Punkaharju Research Station

1999-07-01

The effects of photoperiod and thermal time and their interaction on the timing of growth cessation were examined in seedlings of Scots pine (Pinus sylvestris L.) in greenhouses with 20 deg C day and 10 deg C night temperatures combined with the natural development of the photoperiod. Sowing was repeated five times during both 1995 and 1996 using origins from different altitudes and latitudes (> 60 deg N) in Sweden and Finland. In this way, gradients in temperature sums at a nearly constant photoperiod and different photoperiods at constant temperature sums were obtained. After the first growing season the timing of growth cessation of seedlings from different origins was flexible, i.e. it was determined by the specific combinations of accumulated temperature sum and night length illustrated by fitted straight lines. The photoperiod at the site of origin was a dominant factor in determining the timing of growth cessation in origins from northern latitudes. Because of predetermined growth, the sowing date did not affect the phenology during the second growing season.

Environmental pollution changes in membrane lipids, antioxidants and vitality of Scots pine (Pinus sylvestris L. pollen

Directory of Open Access Journals (Sweden)

Paweł M. Pukacki

2011-01-01

Full Text Available Investigations were carried out on pollen grains of Scots pine (Pinus sylvestris L. collected from trees at 1.5, 3, 4 km and control, 20 km from the Luboń factory producing mineral fertilisers. The percentage of germination of pollen formed close to the pollution source was ca 20% lower compared to the control pollen. Lowered vitality of the pollen was effected in changes of the structure of cytoplasmic membranes. Pollen from the polluted area contained ca 15% less total phospholipids, mainly phosphatidylcholine and phosphatytidylinositol and had a lower content of soluble proteins and less of low molecular antioxidants, such as thiols and ascorbic acid. Composition of total fatty acid in phospholipids fractions showed a significant reduction in the degree of unsaturation of fatty acids. Pollen originating from the polluted area and stored at -30°C showed considerably stronger degradation of cytoplasmic membranes than control.

Ectomycorrhizal colonization of naturally regenerating Pinus sylvestris L. seedlings growing in different micro-habitats in boreal forest.

Science.gov (United States)

Iwański, Michał; Rudawska, Maria

2007-07-01

We investigated the species richness and composition of ectomycorrhizal (EM) fungi colonizing Pinus sylvestris L. seedlings naturally regenerating in boreal forest, in three different microhabitats: on forest ground, on decaying stumps, and within moss layer on erratic boulders. We tested the hypothesis that habitat differences would affect the composition of the EM community of regenerating pine seedlings. In total, 16 EM species were detected, from which none occurred on seedlings growing in all three microhabitats. Piloderma croceum and Cenococcum geophilum were common for seedlings growing in forest ground and on boulders, while Tricholoma aestuans and Suillus luteus were shared between seedlings growing on forest ground and decaying stumps. EM species richness and composition were strikingly different between seedlings regenerating in different microhabitats. Results are discussed as a function of dispersal and niche differentiation of EM fungi.

Multivariate Correlation between Analysis Data on Dissolved Organic Material from Scots Pine (Pinus sylvestris Chips and their Autohydrolysis Pre-Treatment Conditions

Directory of Open Access Journals (Sweden)

Joni Lehto

2013-11-01

Full Text Available Various chemometric techniques were used to establish the relationship between the autohydrolysis conditions prior to pulping and the chemical compositions of the soluble organic materials removed from Scots pine (Pinus sylvestris wood chips. The aqueous chip pre-treatments (autohydrolysis were administered at 130 °C and 150 °C for 30, 60, 90, and 120 min, and the hydrolysates obtained were characterized in terms of total carbohydrates (various mono-, oligo-, and polysaccharides together with uronic acid side groups, volatile acids (acetic and formic acids, lignin, and furans (furfural and 5-(hydroxymethylfurfural. Based on the analytical data gathered, a relatively accurate model for pine chip autohydrolysis was developed.

The effects of exogenous hormones on rooting process and the activities of key enzymes of Malus hupehensis stem cuttings.

Science.gov (United States)

Zhang, Wangxiang; Fan, Junjun; Tan, Qianqian; Zhao, Mingming; Zhou, Ting; Cao, Fuliang

2017-01-01

Malus hupehensis is an excellent Malus rootstock species, known for its strong adverse-resistance and apomixes. In the present study, stem cuttings of M. hupehensis were treated with three types of exogenous hormones, including indole acetic acid (IAA), naphthalene acetic acid (NAA), or green growth regulator (GGR). The effects and mechanisms of exogenous hormone treatment and antioxidant enzyme activity on adventitious root formation were investigated. The results showed that the apparent morphology of the adventitious root had four stages, including root pre-emergence stage (S0), early stage of root formation (S1), massive root formation stage (S2), and later stage of root formation (S3). The suitable concentrations of the three exogenous hormones, IAA, NAA and GGR, were 100 mg·L-1, 300 mg·L-1, and 300 mg·L-1, respectively. They shortened the rooting time by 25-47.4% and increased the rooting percentages of cuttings by 0.9-1.3 times, compared with that in the control. The dispersion in S0 stage was 3.6 times of that in the S1 stage after exogenous hormone application. The earlier the third critical point (P3) appeared, the shorter the rooting time and the greater the rooting percentage of the cuttings. During rhizogenesis, the activities of three antioxidant enzymes (POD, SOD, and PPO) showed an A-shaped trend. However, peak values of enzyme activity appeared at different points, which were 9 d before the P3, P3, and the fourth critical point (P4), respectively. Exogenous hormone treatment reduced the time to reach the peak value by 18 days, although the peak values of the enzymatic activities did not significantly changed. Our results suggested that exogenous hormone treatment mainly acted during the root pre-emergence stage, accelerated the synthesis of antioxidant enzymes, reduced the rooting time, and consequently promoted root formation. The three kinds of antioxidant enzymes acted on different stages of rooting.

Determination of Pb and Cd pollution in Pine tree (Pinus Sylvestris) by atomic absorption spectrometry

International Nuclear Information System (INIS)

Rudovica, V.; Katkevic, J; Viksna, A.; Nulle, S.; Balcerbule, Z. . E-mai: wita@navigator.lv

2004-01-01

Forest is subordinate anthropogenic (carbon, petroleum, wood, waste incineration) and natural (climatic, biological, chemical) factors influencing. In current investigation pine tree as environmental indicator (Pinus Sylvestris L.) is selected. The aim of current investigations are to improve methods, that easy and unerring can establish threshold and critical toxic elements accumulation in the samples, such as pine needles, peels, trunk; the second - to find fact of pine reactions on pollution toxic elements concentrations in the soil, nutrition solutions. The reception efficiency of lead and cadmium from the solution with different concentrations of these toxic elements is estimated. The distribution of lead and cadmium in the different parts of pine trunk is edematous with some selective organic reagents. We find out that these toxic elements accumulate in pine trunk and peels and we cannot wash out from samples with water, so these elements are fixed in live tissue. The pollution of pine seedlings with Cd and Pb through the needles, peels, pulp, roots is connected with nutrition solutions, so with soil pollution

Higher-than-present Medieval pine (Pinus sylvestris treeline along the Swedish Scandes

Directory of Open Access Journals (Sweden)

Leif Kullman

2015-05-01

Full Text Available The upper treeline of Scots pine (Pinus sylvestris L. is renowned as a sensitive indicator of climate change and variability. By use of megafossil tree remains, preserved exposed on the ground surface, treeline shift over the past millennium was investigated at multiple sites along the Scandes in northern Sweden. Difference in thermal level between the present and the Medieval period, about AD 1000-1200, is a central, although controversial, aspect concerning the detection and attribution of anthropogenic climate warming. Radiocarbon-dated megafossil pines revealed that the treeline was consistently positioned as much as 115 m higher during the Medieval period than today (AD 2000-2010, after a century of warming and substantial treeline upshift. Drawing on the last-mentioned figure, and a lapse rate of 0.6 °C/100 m, it may be inferred that Medieval summer temperatures were about 0.7 °C warmer than much of the past 100 years. Extensive pine mortality and treeline descent after the Medieval warming peak reflect substantially depressed temperatures during the Little Ice Age. Warmer-than-present conditions during the Medieval period concur with temperature reconstructions from different parts of northern Fennoscandia, northwestern Russia and Greenland. Modern warming has not been sufficient to restore Medieval treelines. Against this background, there is little reason to view further modest warming as unnatural.

Anti-Inflammatory, Anti-Osteoclastogenic and Antioxidant Effects of Malva sylvestris Extract and Fractions: In Vitro and In Vivo Studies.

Directory of Open Access Journals (Sweden)

Bruna Benso

Full Text Available Given their medical importance, natural products represent a tremendous source of drug discovery. The aim of this study was to investigate Malva sylvestris L. extract and fractions and their pharmacological activities followed by chemical identification. The aqueous fraction (AF was identified as the bioactive fraction in the in vitro and in vivo assays. The AF controlled the neutrophil migration to the peritoneal cavity by 66%, inhibited the antiedematogenic activity by 58.8%, and controlled IL-1β cytokine expression by 54%. The in vitro viability tests showed a concentration-dependent effect, where the MSE and fractions at concentrations under 10 μg/mL were non-toxic to cells. Transcriptional factors of carbonic anhydrase II (CAII, cathepsin K (Ctsk and tartrate-resistant acid phosphatase (TRAP were analyzed by qPCR in RAW 264.7 cell lines. The gene expression analysis showed that the AF was the only treatment that could downregulate all the study genes: CAII, Ctsk and TRAP (p<0.05. TRAP staining was used to evaluate osteoclast formation. AF treatments reduced the number of osteoclastogenesis 2.6-fold compared to the vehicle control group. Matrix metalloproteinase 9 (MMP-9 activity decreased 75% with the AF treatment. Moreover, the bioactive fraction had the ability to regulate the oxidation pathway in the ABTS (2,2-Azino-bis (3-ethylbenzthiazoline-6-sulfonic acid assay with an activity equivalent to 1.30 μmol Trolox/g and DPPH (2,2-diphenyl-1-picrylhydrazyl radicals 1.01 g/L. Positive ion ESI-mass spectrometry for molecular ions at m/z 611 and 633 confirmed rutin as the major compound in the AF. The AF of M. sylvestris presented anti-inflammatory, controlled osteoclastogenic mechanisms and antioxidant abilities in different in vitro and in vivo methods. In addition, we suggest that given its multi-target activity the bioactive fraction may be a good candidate in the therapy of chronic inflammatory diseases.

Engineering fire blight resistance into the apple cultivar 'Gala' using the FB_MR5 CC-NBS-LRR resistance gene of Malus × robusta 5.

Science.gov (United States)

Broggini, Giovanni A L; Wöhner, Thomas; Fahrentrapp, Johannes; Kost, Thomas D; Flachowsky, Henryk; Peil, Andreas; Hanke, Maria-Viola; Richter, Klaus; Patocchi, Andrea; Gessler, Cesare

2014-08-01

The fire blight susceptible apple cultivar Malus × domestica Borkh. cv. 'Gala' was transformed with the candidate fire blight resistance gene FB_MR5 originating from the crab apple accession Malus × robusta 5 (Mr5). A total of five different transgenic lines were obtained. All transgenic lines were shown to be stably transformed and originate from different transgenic events. The transgenic lines express the FB_MR5 either driven by the constitutive CaMV 35S promoter and the ocs terminator or by its native promoter and terminator sequences. Phenotyping experiments were performed with Mr5-virulent and Mr5-avirulent strains of Erwinia amylovora, the causal agent of fire blight. Significantly less disease symptoms were detected on transgenic lines after inoculation with two different Mr5-avirulent E. amylovora strains, while significantly more shoot necrosis was observed after inoculation with the Mr5-virulent mutant strain ZYRKD3_1. The results of these experiments demonstrated the ability of a single gene isolated from the native gene pool of apple to protect a susceptible cultivar from fire blight. Furthermore, this gene is confirmed to be the resistance determinant of Mr5 as the transformed lines undergo the same gene-for-gene interaction in the host-pathogen relationship Mr5-E. amylovora. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Characterization of three chalcone synthase-like genes from apple (Malus x domestica Borkh.).

Science.gov (United States)

Yahyaa, Mosaab; Ali, Samah; Davidovich-Rikanati, Rachel; Ibdah, Muhammad; Shachtier, Alona; Eyal, Yoram; Lewinsohn, Efraim; Ibdah, Mwafaq

2017-08-01

Apple (Malus x domestica Brokh.) is a widely cultivated deciduous tree species of significant economic importance. Apple leaves accumulate high levels of flavonoids and dihydrochalcones, and their formation is dependent on enzymes of the chalcone synthase family. Three CHS genes were cloned from apple leaves and expressed in Escherichia coli. The encoded recombinant enzymes were purified and functionally characterized. In-vitro activity assays indicated that MdCHS1, MdCHS2 and MdCHS3 code for proteins exhibiting polyketide synthase activity that accepted either p-dihydrocoumaroyl-CoA, p-coumaroyl-CoA, or cinnamoyl-CoA as starter CoA substrates in the presence of malonyl-CoA, leading to production of phloretin, naringenin chalcone, and pinocembrin chalcone. MdCHS3 coded a chalcone-dihydrochalcone synthase enzyme with narrower substrate specificity than the previous ones. The apparent Km values of MdCHS3 for p-dihydrocoumaryl-CoA and p-coumaryl-CoA were both 5.0 μM. Expression analyses of MdCHS genes varied according to tissue type. MdCHS1, MdCHS2 and MdCHS3 expression levels were associated with the levels of phloretin accumulate in the respective tissues. Copyright © 2017 Elsevier Ltd. All rights reserved.

Apple ring rot-responsive putative microRNAs revealed by high-throughput sequencing in Malus × domestica Borkh.

Science.gov (United States)

Yu, Xin-Yi; Du, Bei-Bei; Gao, Zhi-Hong; Zhang, Shi-Jie; Tu, Xu-Tong; Chen, Xiao-Yun; Zhang, Zhen; Qu, Shen-Chun

2014-08-01

MicroRNAs (miRNAs) are small non-coding RNAs, which silence target mRNA via cleavage or translational inhibition to function in regulating gene expression. MiRNAs act as important regulators of plant development and stress response. For understanding the role of miRNAs responsive to apple ring rot stress, we identified disease-responsive miRNAs using high-throughput sequencing in Malus × domestica Borkh.. Four small RNA libraries were constructed from two control strains in M. domestica, crabapple (CKHu) and Fuji Naga-fu No. 6 (CKFu), and two disease stress strains, crabapple (DSHu) and Fuji Naga-fu No. 6 (DSFu). A total of 59 miRNA families were identified and five miRNAs might be responsive to apple ring rot infection and validated via qRT-PCR. Furthermore, we predicted 76 target genes which were regulated by conserved miRNAs potentially. Our study demonstrated that miRNAs was responsive to apple ring rot infection and may have important implications on apple disease resistance.

Old Apple (Malus domestica L. Borkh) Varieties with Hypoallergenic Properties: An Integrated Approach for Studying Apple Allergenicity.

Science.gov (United States)

Vegro, Mara; Eccher, Giulia; Populin, Francesca; Sorgato, Chiara; Savazzini, Federica; Pagliarani, Giulia; Tartarini, Stefano; Pasini, Gabriella; Curioni, Andrea; Antico, Andrea; Botton, Alessandro

2016-12-07

Freshly consumed apples (Malus domestica L. Borkh) can cause allergic reactions because of the presence of four classes of allergens. Knowledge of the genetic factors affecting the allergenic potential of apples would provide important information for the selection of hypoallergenic genotypes, which can be combined with the adoption of new agronomical practices to produce fruits with a reduced amount of allergens. In the present research, a multiple analytical approach was adopted to characterize the allergenic potential of 24 apple varieties released at different ages (pre- and post-green revolution). A specific workflow was set up including protein quantification by means of polyclonal antibodies, immunological analyses with sera of allergic subjects, enzymatic assays, clinical assessments on allergic patients, and gene expression assays on fruit samples. Taken as a whole, the results indicate that most of the less allergenic genotypes were found among those deriving from selection processes carried out prior to the so-called "green revolution".

Optimization of ultrasonic-assisted extraction of phenolic antioxidants from Malus baccata (Linn.) Borkh. using response surface methodology.

Science.gov (United States)

Wang, Lu; Wang, Zhenyu; Li, Xiaoyu

2013-05-01

In this study, the optimum extraction conditions for maximum recovery of the content of total phenolics (TPC) and total antioxidant abilities were analyzed for Malus baccata (Linn.) Borkh. using response surface methodology. The effects of ethanol percentage (X1 ,%), ultrasonic power (X2 , W) and extraction temperature (X3 , °C) on the total phenolic content (Y1 ) and antioxidant ability (Y2 ) were evaluated. A second-order polynomial model produced a satisfactory fitting of the experimental data with regard to total phenolic content (R(2) = 0.9942, P antioxidant ability (R(2) = 0.9966, P extraction temperature of 51.1°C for TPC and 60.5%, 311.4 W, 51.6°C for antioxidant ability, the predicted values agreed well with the experimental values. Results implied that the major phenolic compounds in obtained extracts as chlorogenic acid, quercetin-3-gal/glu, quercetin-3-xyl/ara, phloretin-2-xyloside, quercetin-3- rhamnoside, and phloridzin. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Effect of irradiance and spectral composition of radiation on in vitro shoot proliferation in Malus domestica

International Nuclear Information System (INIS)

Noè, N.; Eccher, T.; Bonini, L.

1997-01-01

Four clones of Malus domestica cv. Golden Delicious - namely Smoothee, Crielaard, Reinders and Golden B - were cultured in vitro from single-node microcuttings placed on solid medium under irradiance (PPFD) of 50 micromol m -2 s -1 . After 9 months an average shoot proliferation of 5.3 was achieved; Crielaard showed the highest rate (7.1), followed Golden B (5.4), Smoothee and Reinders (4.4). Proliferating shoots were then exposed to higher PPFD (80 micromol m -2 s -1 ) and different spectral composition of radiation using PMMA-B and PMMA-R/FR filters. High PPFD decreased the average proliferation rate to 4.5, in particular in Crielaard and Golden B, while it increased proliferation in Reinders. When a PMMA-R/FR filter was interposed, the mean proliferation rate slightly increased. PMMA-B filters decreased the overall proliferation rate to 3.0; only in Crielaard it was increased, but shoots were very small. Thus PPFD and spectral composition influenced in vitro shoot proliferation and growth and the responses were different among the clones. (author)

Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

International Nuclear Information System (INIS)

Oudalova, A.; Geras'kin, S.; Vasiliev, D.; Dikarev, V.

2004-01-01

Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute γ-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on time and techno

Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

Energy Technology Data Exchange (ETDEWEB)

Oudalova, A.; Geras' kin, S.; Vasiliev, D.; Dikarev, V. [Russian Institute of Agricultural Radiology and Agroecology, Obninsk (Russian Federation)

2004-07-01

Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute {gamma}-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on

Determination of metals in scots pine (Pinus Sylvestris) needles and soil samples

International Nuclear Information System (INIS)

Ludborzs, A.; Viksna, A.

2000-01-01

Current report is the finding to apply two modern and powerful methods of microanalysis - Total Reflection X-ray Fluorescence Spectrometry (TXRF) and Graphite Furnace Atomic Absorption Spectrometry - for the analysis of biological and geological materials. For some of the measurements Instrumental Neutron Activation Analysis (INAA) has been used as an arbitrary method. The goal of the research project is to find possible relationships between metals content in the Scots pine (Pinus sylvestris) needles and the soil samples, which have been taken under the trees. The objectives of the work are analysis of both needles and soils, pH measurements of the soil samples, and handling of a simplified metal speciation analysis in the soil samples. For statistical reliability of the project, seven pine trees from different locations in Latvia have been chosen as the analysis objects. Samples of 20 different age class needles have been collected from the trees and 21 soil sample has been sampled under the trees. K, Ca, Mn, Fe, Zn, Rb, Sr, Pb, and Cd content have been analysed in both samples of the needles and the soils. The obtained measurement data have been processed according to the aim of the project. Relevant questions about causal differences of metal concentrations in different age classes of needles, about subtle working principles of the plant's root system, about the role of some elements in the plant's living processes still remain unanswered. (author)

Early field performance of drought-stressed scots pine (pinus sylvestris l.) seedlings

International Nuclear Information System (INIS)

Kulac, S.; Clcek, E.; Tasdemir, U.

2015-01-01

Scots pine (Pinus sylvestris) has a large natural distribution throughout the world, including semi-arid areas of Turkey, where it is being used for afforestation. Determining the drought resistance of Scots pine provenances can increase the success of afforestation efforts in semi-arid regions. In the first stage of this study, water-stress treatments were applied to ten provenances of one-year-old Scots pine seedlings in their second vegetation period (between April and November). The diameter and height of the seedlings were evaluated in the nursery in order to determine their morphology. The four drought-stress treatments consisted of once-weekly irrigation (IR1), twice-weekly irrigation (IR2-Control), biweekly irrigation (IR3) and open field conditions (IR4). Later, the water-stressed seedlings were planted in a semi-arid district in Bayburt, Turkey, and their survival and growth performances were evaluated over a five-year period. The nursery study showed that drought stress and provenance as well as the interaction of the two significantly affected the morphological characteristics of the seedlings. Under water-stress conditions, the best growth performance was found in the Dokurcun, Degirmendere and Dirgine provenance seedlings. Water-stress and provenance factors and their interaction also affected the open field performance of the seedlings, where the Degirmendere, Dirgine and Dokurcun provenances again exhibited the best performance. Consequently, these Scots pine provenances can be recommended for afforestation sites having conditions similar to those of the study site. (author)

Traditional knowledge of wild edible plants of Iğdır Province (East Anatolia, Turkey

Directory of Open Access Journals (Sweden)

Ernaz Altundağ Çakır

2017-12-01

Full Text Available Iğdır Province is situated in the Eastern Anatolian Region of Turkey. Wild edible plants and their utilization methods have not been previously documented there. This study was conducted during an ethnobotanical survey of Iğdır Province from 2007 to 2012, in the period from May to October, when plants were in their flowering and fruiting periods. There were 210 interviews carried out in 78 villages. This study provides information about 154 wild plant taxa belonging to 27 families that have been used as foodstuffs, spices, or hot drinks. Seventeen wild edible plants were recorded for the first time during this study. Eight endemic species were reported as used for their edibility, and new local names for plants were also recorded. The cultural importance index was calculated for each taxon. The most culturally important species are Mentha longifolia, Falcaria vulgaris, Polygonum aviculare, Rosa canina, Crataegus azarolus, Capsella bursa-pastoris, and Malus sylvestris. This study presents the richest heritage in terms of the diversity of wild edible plants ever recorded in Turkey.

Direct and indirect effects of climate on demography and early growth of Pinus sylvestris at the rear edge: changing roles of biotic and abiotic factors.

Directory of Open Access Journals (Sweden)

Raquel Benavides

Full Text Available Global change triggers shifts in forest composition, with warming and aridification being particularly threatening for the populations located at the rear edge of the species distributions. This is the case of Scots pine (Pinus sylvestris in the Mediterranean Basin where uncertainties in relation to its dynamics under these changing scenarios are still high. We analysed the relative effect of climate on the recruitment patterns of Scots pine and its interactions with local biotic and abiotic variables at different spatial scales. Number of seedlings and saplings was surveyed, and their annual shoot growth measured in 96 plots located across altitudinal gradients in three different regions in the Iberian Peninsula. We found a significant influence of climate on demography and performance of recruits, with a non-linear effect of temperature on the presence of juveniles, and a positive effect of precipitation on their survival. Abundance of juveniles of P. sylvestris that underwent their first summer drought was skewed towards higher altitudes than the altitudinal mean range of the conspecific adults and the optimum elevation for seedlings' emergence. At local level, light availability did not influence juveniles' density, but it enhanced their growth. Biotic interactions were found between juveniles and the herb cover (competition and between the number of newly emerged seedlings and shrubs (facilitation. Results also highlighted the indirect effect that climate exerts over the local factors, modulating the interactions with the pre-existing vegetation that were more evident at more stressful sites. This multiscale approach improves our understanding of the dynamics of these marginal populations and some management criteria can be inferred to boost their conservation under the current global warming.

Direct and indirect effects of climate on demography and early growth of Pinus sylvestris at the rear edge: changing roles of biotic and abiotic factors.

Science.gov (United States)

Benavides, Raquel; Rabasa, Sonia G; Granda, Elena; Escudero, Adrián; Hódar, José A; Martínez-Vilalta, Jordi; Rincón, Ana M; Zamora, Regino; Valladares, Fernando

2013-01-01

Global change triggers shifts in forest composition, with warming and aridification being particularly threatening for the populations located at the rear edge of the species distributions. This is the case of Scots pine (Pinus sylvestris) in the Mediterranean Basin where uncertainties in relation to its dynamics under these changing scenarios are still high. We analysed the relative effect of climate on the recruitment patterns of Scots pine and its interactions with local biotic and abiotic variables at different spatial scales. Number of seedlings and saplings was surveyed, and their annual shoot growth measured in 96 plots located across altitudinal gradients in three different regions in the Iberian Peninsula. We found a significant influence of climate on demography and performance of recruits, with a non-linear effect of temperature on the presence of juveniles, and a positive effect of precipitation on their survival. Abundance of juveniles of P. sylvestris that underwent their first summer drought was skewed towards higher altitudes than the altitudinal mean range of the conspecific adults and the optimum elevation for seedlings' emergence. At local level, light availability did not influence juveniles' density, but it enhanced their growth. Biotic interactions were found between juveniles and the herb cover (competition) and between the number of newly emerged seedlings and shrubs (facilitation). Results also highlighted the indirect effect that climate exerts over the local factors, modulating the interactions with the pre-existing vegetation that were more evident at more stressful sites. This multiscale approach improves our understanding of the dynamics of these marginal populations and some management criteria can be inferred to boost their conservation under the current global warming.

[Evaluation of Molecular Genetic Diversity of Wild Apple Malus sieversii Populations from Zailiysky Alatau by Microsatellite Markers].

Science.gov (United States)

Omasheva, M E; Chekalin, S V; Galiakparov, N N

2015-07-01

The territory of Kazakhstan is part of the distribution range of Malus sieversii, which is one of the ancestors of cultivated apple tree varieties. The collected samples of Sievers apple leaves from five populations growing in the Zailiysky Alatau region served as a source not only for the creation of a bank of genomic DNA but also for determination ofthe wild apple genetic polymorphism. The seven microsatellite markers used in this study revealed 86 alleles with different frequencies, as well as the characteristic pools of rare alleles for each of the populations. Molecular genetic analysis showed a high level of genetic diversity (H(o) = 0.704; PIC = 0.752; I = 1.617). Moreover, interpopulation variability accounted only for 7.5% of total variability, confirming the genetic closeness of the populations examined. Based on phylogenetic analysis, it was demonstrated that the Bel'bulak and Almaty Reserve populations were closest to each other, while the most distant were the Ketmen and Great Almaty gorge populations, which suggests the dependence of genetic distance on the geographical.

Análisis fitoquímico y efecto sinérgico protector de las hojas de minthostachys mollis y malva sylvestris sobre la mucosa gástrica de rattus rattus var. albinus

OpenAIRE

Castillo Saavedra, Ericson Félix

2010-01-01

The peptic ulcer is a lesion that affects an area of the gastrointestinal mucose usually in the stomach or duodenum produced by a disbalance between defensives and protects factors. This report was oriented on determinating phytochemistry of Minthostachys mollis (Kunth) Griseb, Malva sylvestris L., and analyze if these plants in study had synergistic protect effect in the acute injure of gastric mucose induced by ethanol in Rattus rattus var. albinus. Phytochemical screening was realized usin...

Postglacial recolonization history of the European crabapple (Malus sylvestris Mill.), a wild contributor to the domesticated apple

NARCIS (Netherlands)

Cornille, A.; Giraud, T.; Bellard, C.; Tellier, A.; Cam, le B.; Smulders, M.J.M.; Kleinschmit, J.; Roldan-Ruiz, I.; Gladieux, P.

2013-01-01

Understanding the way in which the climatic oscillations of the Quaternary Period have shaped the distribution and genetic structure of extant tree species provides insight into the processes driving species diversification, distribution and survival. Deciphering the genetic consequences of past

Phytochemicals Screening and Activities of Hydrophilic and Lipophilic Antioxidant of Some Fruit Peels

International Nuclear Information System (INIS)

Khairusy Syakirah Zulkifli; Noriham Abdullah; Aminah Abdullah; Nurain Aziman; Wan Saidatul Syida Wan Kamarudin

2012-01-01

This study was conducted to screen the secondary metabolites compounds including alkaloids, tannins, saponins and flavonoids as well as to determine the antioxidant activities of four types of fruit peels namely Psidium guajava (guava), Mangifera indica (Chakonan mango), Citrus sinensis (Navel orange) and Malus sylvestris (Granny Smith apple). The hydrophilic and lipophilic antioxidant activities were investigated using three different assays such as Ferric Reducing Antioxidant Power (FRAP), 2, 2-diphenyl-1-picrylhydrazyl (DPPH) scavenging activity and Oxygen Radical Absorbance Capacity (ORAC). Total Phenolic Content (TPC) and Total Flavonoids Content (TFC) were also conducted and the correlations between the antioxidant assays with TPC and TFC were evaluated. The TPC in the peels extract ranged between 204.90 to 517.00 mg GAE/ g extract weight while TFC ranged between 97.48 to 177.86 mg QE/ g extract weight. The FRAP, EC 50 scavenging activity and ORAC values were 18.78 to 45.36 mM TE/ 100 g extract weight, 0.146 to 0.717 mg/ ml scavenging effect and 37.54 to 60.59 μM TE/ g extract weight respectively. The extract of M. indica peels appeared to be as potent as ascorbic acid with maximum inhibition of 74 % at 200 ppm. M. indica peels showed highest value in all antioxidant assays and in TPC while the highest in TFC was found in M. sylvestris peels. There were strong correlations between all antioxidant assays with TPC but very weak correlations with TFC. This study suggested that the extracts of fruit peels are convenient to be use as functional ingredients in food product development as they are rich in antioxidant activities. (author)

Criterio no asintótico para el diseño de sistemas Bonus-Malus mediante GPBM

Directory of Open Access Journals (Sweden)

Antonio Heras Martínez

2002-01-01

Full Text Available El diseño de sistemas Bonus-Malus habitualmente está basado en la distribución estacionaria de la probabilidad. Se supone que una póliza ha alcanzado el estado estacionario (n0 cuando la probabilidad de que dicha póliza pertenezca a la clase Ci es constante para todo n mayor o igual que n0 . Esta distribución estacionaria de probabilidad es sencilla de calcular. Su cálculo está basado en la Teoría de Cadenas de Markov y requiere que el sistema cumpla ciertas condiciones (sea Cadena de Markov irreducible y todos sus estados sean recurrentes en tiempo esperado finito. Podría ocurrir que estas condiciones no se cumplan y en este caso no se podría utilizar la distribución estacionaria. Por otra parte, los criterios basados en la distribución estacionaria no tienen en cuenta a las pólizas nuevas en la empresa ni a las que llevan poco tiempo. Por estos motivos, se propone un nuevo criterio que tenga en cuenta la edad de las pólizas de la cartera.

Phenotypic changes associated with RNA interference silencing of chalcone synthase in apple (Malus × domestica).

Science.gov (United States)

Dare, Andrew P; Tomes, Sumathi; Jones, Midori; McGhie, Tony K; Stevenson, David E; Johnson, Ross A; Greenwood, David R; Hellens, Roger P

2013-05-01

We have identified in apple (Malus × domestica) three chalcone synthase (CHS) genes. In order to understand the functional redundancy of this gene family RNA interference knockout lines were generated where all three of these genes were down-regulated. These lines had no detectable anthocyanins and radically reduced concentrations of dihydrochalcones and flavonoids. Surprisingly, down-regulation of CHS also led to major changes in plant development, resulting in plants with shortened internode lengths, smaller leaves and a greatly reduced growth rate. Microscopic analysis revealed that these phenotypic changes extended down to the cellular level, with CHS-silenced lines showing aberrant cellular organisation in the leaves. Fruit collected from one CHS-silenced line was smaller than the 'Royal Gala' controls, lacked flavonoids in the skin and flesh and also had changes in cell morphology. Auxin transport experiments showed increased rates of auxin transport in a CHS-silenced line compared with the 'Royal Gala' control. As flavonoids are well known to be key modulators of auxin transport, we hypothesise that the removal of almost all flavonoids from the plant by CHS silencing creates a vastly altered environment for auxin transport to occur and results in the observed changes in growth and development. © 2013 The Authors The Plant Journal © 2013 Blackwell Publishing Ltd.

Stem compression reversibly reduces phloem transport in Pinus sylvestris trees.

Science.gov (United States)

Henriksson, Nils; Tarvainen, Lasse; Lim, Hyungwoo; Tor-Ngern, Pantana; Palmroth, Sari; Oren, Ram; Marshall, John; Näsholm, Torgny

2015-10-01

Manipulating tree belowground carbon (C) transport enables investigation of the ecological and physiological roles of tree roots and their associated mycorrhizal fungi, as well as a range of other soil organisms and processes. Girdling remains the most reliable method for manipulating this flux and it has been used in numerous studies. However, girdling is destructive and irreversible. Belowground C transport is mediated by phloem tissue, pressurized through the high osmotic potential resulting from its high content of soluble sugars. We speculated that phloem transport may be reversibly blocked through the application of an external pressure on tree stems. Thus, we here introduce a technique based on compression of the phloem, which interrupts belowground flow of assimilates, but allows trees to recover when the external pressure is removed. Metal clamps were wrapped around the stems and tightened to achieve a pressure theoretically sufficient to collapse the phloem tissue, thereby aiming to block transport. The compression's performance was tested in two field experiments: a (13)C canopy labelling study conducted on small Scots pine (Pinus sylvestris L.) trees [2-3 m tall, 3-7 cm diameter at breast height (DBH)] and a larger study involving mature pines (∼15 m tall, 15-25 cm DBH) where stem respiration, phloem and root carbohydrate contents, and soil CO2 efflux were measured. The compression's effectiveness was demonstrated by the successful blockage of (13)C transport. Stem compression doubled stem respiration above treatment, reduced soil CO2 efflux by 34% and reduced phloem sucrose content by 50% compared with control trees. Stem respiration and soil CO2 efflux returned to normal within 3 weeks after pressure release, and (13)C labelling revealed recovery of phloem function the following year. Thus, we show that belowground phloem C transport can be reduced by compression, and we also demonstrate that trees recover after treatment, resuming C

The essential oil qualitative and quantitative composition in the needles of Pinus sylvestris L. growing along industrial transects.

Science.gov (United States)

Kupcinskiene, Eugenija; Stikliene, Aida; Judzentiene, Asta

2008-10-01

The aim of this study was to evaluate composition of the essential oils in the needles of Pinus sylvestris growing in the areas affected by a cement factory (CF), and an oil refinery (OR). Volatile components of the needles were analyzed by GC and GC/MS. The most heavily polluted CF stand had significantly higher concentration of gamma-Terpinene, Caryophyllene oxide in the current-year needles, while higher concentration of delta-3-Carene, alpha-Terpinene, gamma-Terpinene and Terpinolene was documented for 1-year-old needles. The most heavily polluted OR stand had a significantly higher concentration of Sabinene+beta-Pinene, 1-epi-Cubenol in the current-year needles and a significantly higher concentration of Camphene, Sabinene+beta-Pinene, Myrcene, alpha-Cadinene, 1-epi-Cubenol in the 1-year-old needles than the least polluted site. Along transects an increase in the amount of some diterpenes and a decrease in the components of the shorter chain essential oils was observed. These effects could be at least partially attributed to SO(2).

Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

DEFF Research Database (Denmark)

Arnous, Anis; Meyer, Anne S.

2009-01-01

On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported...... for the quantitative allocation of plant cell wall monomers into relevant structural polysaccharide elements. By this method the relative molar distribution (mol %) of the different polysaccharides in the red wine grape skins was estimated as 57-62 mol % homogalacturonan, 6.0-14 mol % cellulose, 10-11 mol % xyloglucan......, 7 mol % arabinan, 4.5-5.0 mol % rhamnogalacturonan I, 3.5-4.0 mol % rhamnogalacturonan II, 3 mol % arabinogalactan, and 0.5-1.0 mol % mannans; the ranges indicate minor variations in the skin composition of the three different cultivars. These cell wall polysaccharides made up similar to 43...

Provenance variations of scots pine (Pinus sylvestris L.) in the Southern PART of Turkey

International Nuclear Information System (INIS)

Gulcu, S.; Bilir, N.

2015-01-01

Tree height, basal diameter, stem form, number, angle and diameter of branches were assessed in eight-year-old provenance test established by 30 seed sources of Scots pine (Pinus sylvestris L.) at Aydogmus and Kemer experimental sites of Southern part of Turkey. Growth of the provenances was also compared to two native species (Taurus cedar- Cedrus libani A. Rich and Black pine-Pinus nigra Arnold.) of the region. Variations within provenance and among provenances, and relations among the traits were estimated. There were large differences (p <= 0.05) within provenance and among provenances for the traits, while sites showed similar (0.05 <= p) performance for tree height and stem form. For instance, average of tree height was 181 cm and varied between 138.3 cm and 229.8 cm in provenances of Aydogmus site, it was 184 cm and ranged from 130 cm to 246.1 cm in that of Kemer site. Averages of tree height of a provenance were 144.4 cm in Aydogmus and 194.5 cm in Kemer. Individual tree height of the provenance varied between 69 cm and 267 cm, and ranged from 51 cm to 280 cm in sites. Averages of tree height were 143.2 cm in Black pine 145.6 cm in Taurus cedar which were natural species of the region. There were mostly positive and significant (p <= 0.05) correlations among the traits. Results of the study were discussed for new plantations and breeding of the species. (author)

Using Landsat satellite imagery to detect small-size forest stands of Pinus nigra Arn. and Pinus sylvestris L. affected by Scolytidae; Uso de imagenes satelite Landsat para la deteccion de rodales de Pinus nigra Arn. y Pinus sylvestris L. afectados por escolitidos

Energy Technology Data Exchange (ETDEWEB)

Blanco, E.; Bonet, J. A.; Eizaguirre, M.

2009-07-01

Medium resolution images from multispectral sensors like Landsat TM have been extensively used for decades in order to identify decline and defoliation generated by insects and other forest pests. The present work analyses the usefulness of these kinds of images to detect small-size stands of Pinus nigra Arn. and Pinus sylvestris L. affected by Scolytidae attacks. The study area was located in the Solsones region (Eastern Pyrenees), selecting 34 training zones (17 damaged small-size stands and 17 healthy small-size stands). The exploratory analysis of the images was conducted with the ERDAS IMAGINE 8.x. program.The results of the study showed significant differences between the affected and non-affected stands in 5 of the 7 spectral bands analysed. TM5 and TM7 bands were identified as those having the highest power to detect damaged stands. The digital levels obtained and the spaces of characteristics created, both showed trends to group small-size affected stands versus healthy, achieving improvements in the methodological procedure employed. (Author) 31 refs.

Evidence for selection in response to radiation exposure: Pinus sylvestris in the Chernobyl exclusion zone

International Nuclear Information System (INIS)

Kuchma, Oleksandra; Finkeldey, Reiner

2011-01-01

Changes of genetic structures due to viability selection are likely to occur in populations exposed to rapidly and extremely changing environmental conditions after catastrophic events. However, very little is known about the extent of selective responses and in particular the proportion of the genome involved in putatively adaptive reactions for non-model plants. We used amplified fragment length polymorphisms (AFLPs) in order to investigate genetic differences between pine (Pinus sylvestris) trees which were partially exposed to extreme environmental conditions. Genetic variation patterns of pines exposed to high radiation in the Chernobyl exclusion zone with or without phenotypic stress symptoms were compared to control trees with a similar origin. Six percent of the investigated loci (15 of 222 loci) were identified as candidates for selective responses. Moderate differentiation was observed between groups of trees showing either weak or strong phenotypic responses to high radiation levels. - Highlights: → Genetic variation patterns of pines exposed to high radiation were investigated. → Pines with or without phenotypic stress symptoms were compared to control trees. → AFLP markers were used to reveal evidences of selection processes. → 15 of 222 loci are identified as candidates for selective responses. → Moderate differentiation is observed between irradiated and control trees. - Genetic responses to the exposure of trees to radiation in the Chernobyl zone may involve adaptive changes at a comparatively large part of the genome.

Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala

Directory of Open Access Journals (Sweden)

Wen Zhang

2017-02-01

Full Text Available Trehalose-6-phosphate (Tre6P is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala. Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple.

Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala)

Science.gov (United States)

Zhang, Wen; Lunn, John E.; Feil, Regina; Wang, Yufei; Zhao, Jingjing; Tao, Hongxia; Zhao, Zhengyang

2017-01-01

ABSTRACT Trehalose-6-phosphate (Tre6P) is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala). Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple. PMID:28069587

Annual ecosystem respiration budget for a Pinus sylvestris stand in central Siberia

International Nuclear Information System (INIS)

Shibistova, O.; Zrazhevskaya, G.; Astrakhantceva, N.; Shijneva, I.; Lloyd, J.; Arneth, A.; Kolle, J.; Knohl, A.; Schmerler, J.

2002-01-01

Using a ground-based and an above-canopy eddy covariance system in addition to stem respiration measurements, the annual respiratory fluxes attributable to soil, stems and foliage were determined for a Scots pine (Pinus sylvestris L.) forest growing in central Siberia. Night-time foliar respiration was estimated on the basis of the difference between fluxes measured below and above the canopy and the stem respiration measurements. Comparison of the effects of night-time turbulence on measured CO 2 fluxes showed flux loss above the canopy at low wind speeds, but no such effect was observed for the ground-based eddy system. This suggests that problems with flow homogeneity or flux divergence (both of which would be expected to be greater above the canopy than below) were responsible for above-canopy losses under these conditions. After correcting for this, a strong seasonality in foliar respiration was observed. This was not solely attributable to temperature variations, with intrinsic foliar respiratory capacities being much greater in spring and autumn. The opposite pattern was observed for stem respiration, with the intrinsic respiratory capacity being lower from autumn through early spring. Maximum respiratory activity was observed in early summer. This was not simply associated with a response to higher temperatures but seemed closely linked with cambial activity and the development of new xylem elements. Soil respiration rates exhibited an apparent high sensitivity to temperature, with seasonal data implying a Q 10 of about 7. We interpret this as reflecting covarying changes in soil microbial activity and soil temperatures throughout the snow-free season. Averaged over the two study years (1999 and 2000), the annual respiratory flux was estimated at 38.3 mol C/m 2 /a. Of this 0.61 was attributable to soil respiration, with stem respiration accounting for 0.21 and foliar respiration 0.18

Overexpression of a Novel Apple NAC Transcription Factor Gene, MdNAC1, Confers the Dwarf Phenotype in Transgenic Apple (Malus domestica)

Science.gov (United States)

Jia, Dongfeng; Gong, Xiaoqing; Li, Mingjun; Li, Chao; Sun, Tingting

2018-01-01

Plant height is an important trait for fruit trees. The dwarf characteristic is commonly associated with highly efficient fruit production, a major objective when breeding for apple (Malus domestica). We studied the function of MdNAC1, a novel NAC transcription factor (TF) gene in apple related to plant dwarfing. Localized primarily to the nucleus, MdNAC1 has transcriptional activity in yeast cells. Overexpression of the gene results in a dwarf phenotype in transgenic apple plants. Their reduction in size is manifested by shorter, thinner stems and roots, and a smaller leaf area. The transgenics also have shorter internodes and fewer cells in the stems. Levels of endogenous abscisic acid (ABA) and brassinosteroid (BR) are lower in the transgenic plants, and expression is decreased for genes involved in the biosynthesis of those phytohormones. All of these findings demonstrate that MdNAC1 has a role in plants dwarfism, probably by regulating ABA and BR production. PMID:29702625

Micrometeorología de masas forestales de pino silvestre (Pinus sylvestris L.) y rebollo (Quercus pyrenaica Willd.) en la vertiente norte del Sistema Central (Montes de Valsaín, Segovia). Consecuencias selvícolas

OpenAIRE

Gómez Sanz, Valentín

2011-01-01

La Tesis trata sobre el estudio y evaluación de los patrones microescálicos de variabilidad, tanto espacial como temporal, que bajo diferentes cubiertas forestales de pino silvestre (Pinus sylvestris L.) y rebollo (Quercus pyrenaica Wild.), presentan las variables de estado de uso más frecuente en la caracterización de] sistema atmósfera-superficie terrestre. Se ha buscado con ello analizar cualitativa y cuantitativamente el efecto modificador que, sobre la respuesta micrometereológica bajo e...

The essential oil qualitative and quantitative composition in the needles of Pinus sylvestris L. growing along industrial transects

International Nuclear Information System (INIS)

Kupcinskiene, Eugenija; Stikliene, Aida; Judzentiene, Asta

2008-01-01

The aim of this study was to evaluate composition of the essential oils in the needles of Pinus sylvestris growing in the areas affected by a cement factory (CF), and an oil refinery (OR). Volatile components of the needles were analyzed by GC and GC/MS. The most heavily polluted CF stand had significantly higher concentration of γ-Terpinene, Caryophyllene oxide in the current-year needles, while higher concentration of δ-3-Carene, α-Terpinene, γ-Terpinene and Terpinolene was documented for 1-year-old needles. The most heavily polluted OR stand had a significantly higher concentration of Sabinene + β-Pinene, 1-epi-Cubenol in the current-year needles and a significantly higher concentration of Camphene, Sabinene + β-Pinene, Myrcene, α-Cadinene, 1-epi-Cubenol in the 1-year-old needles than the least polluted site. Along transects an increase in the amount of some diterpenes and a decrease in the components of the shorter chain essential oils was observed. These effects could be at least partially attributed to SO 2 . - Quantities of components of essential oil in the needles of Scots pine growing around two factories are described in relation to pollution

The essential oil qualitative and quantitative composition in the needles of Pinus sylvestris L. growing along industrial transects

Energy Technology Data Exchange (ETDEWEB)

Kupcinskiene, Eugenija [Department of Biology, Vytautas Magnus University, Vileikos 8, LT-44404 Kaunas (Lithuania)], E-mail: e.kupcinskiene@gmail.com; Stikliene, Aida [Department of Ecology, Lithuanian University of Agriculture, Studentu 11, LT-53361 Kaunas, Akademija (Lithuania); Judzentiene, Asta [Institute of Chemistry, A. Gostauto 9, LT-01108 Vilnius (Lithuania)

2008-10-15

The aim of this study was to evaluate composition of the essential oils in the needles of Pinus sylvestris growing in the areas affected by a cement factory (CF), and an oil refinery (OR). Volatile components of the needles were analyzed by GC and GC/MS. The most heavily polluted CF stand had significantly higher concentration of {gamma}-Terpinene, Caryophyllene oxide in the current-year needles, while higher concentration of {delta}-3-Carene, {alpha}-Terpinene, {gamma}-Terpinene and Terpinolene was documented for 1-year-old needles. The most heavily polluted OR stand had a significantly higher concentration of Sabinene + {beta}-Pinene, 1-epi-Cubenol in the current-year needles and a significantly higher concentration of Camphene, Sabinene + {beta}-Pinene, Myrcene, {alpha}-Cadinene, 1-epi-Cubenol in the 1-year-old needles than the least polluted site. Along transects an increase in the amount of some diterpenes and a decrease in the components of the shorter chain essential oils was observed. These effects could be at least partially attributed to SO{sub 2}. - Quantities of components of essential oil in the needles of Scots pine growing around two factories are described in relation to pollution.

Uptake and translocation of 109Cd and stable Cd within tobacco plants (Nicotiana sylvestris)

International Nuclear Information System (INIS)

Rosén, K.; Eriksson, J.; Vinichuk, M.

2012-01-01

The availability, uptake, and translocation of recently added ( 109 Cd) and naturally occurring (stable) soil Cd within tobacco plants were compared. 109 Cd was added to soil in two treatments, A (0.25 MBq kg soil −1 DW) and B (eight-fold dose): stable Cd was measured in both treatments. Both the added and the stable Cd were higher in leaves and reproductive structures of the plant than in stalks and roots. The uptake of 109 Cd was 5.3 kBq plant −1 for treatment A and 36.7 kBq plant −1 for treatment B, and about 26 μg plant −1 for stable Cd. Leaves of the tobacco plants accumulated 40–45% of the total 109 Cd and about 50% of total stable Cd taken up by the plant. Cadmium concentration in the plant was three times higher than in roots and two times higher than the concentration in soil: the concentration in roots was lower than in the soil. - Capsule: The availability, uptake, and translocation of recently added ( 109 Cd) and naturally occurring (stable) soil Cd within tobacco plants (Nicotiana sylvestris) were investigated. - Highlights: ► We compared uptake recently added and naturally occurring soil Cd by tobacco plant. ► Both added and stable Cd display similar uptake and translocation within the plant. ► Leaves of tobacco plants accumulate half of the total Cd taken up by the plant. ► Recently added 109 Cd to soil is more available than naturally occurring cadmium.

Effect of inoculation with arbuscular mycorrhizas on rooting, weaning and subsequent growth of micropropagated Malus (L. Moench

Directory of Open Access Journals (Sweden)

Marjatta Uosukainen

1994-05-01

Full Text Available The importance of different rooting methods and the effects of arbuscular mycorrhizal (AMF inoculation on the rooting rate, weaning survival and subsequent growth of microcuttings of Malus rootstock YP and the Finnish crab apple cultivars Hanna and Marjatta were studied in four experiments conducted at the Laukaa Research and Elite Plant Unit, Finland. Sucrose in the in vitro rooting medium gave the best support to weaning survival in comparision with glucose and fructose. Directly rooted microcuttings had a higher survival rate than in vitro rooted microcuttings. AMF inoculation did not improve the rooting rate in direct rooting. However, the Glomus hoi strain V98 caused severe rotting of microcuttings and thus lowered the rooting rate of cv. Hanna, AMF inoculation increased the mean shoot height of established plants, particularly inoculation with G. hoi V98, G. claroideum V43a or G. fistulosum V128. This effect, however, varied considerably in different host-fungus combinations. Some AMF strains, e.g. G. hoi V1O4, caused strong growth retardation. After the rooting and weaning stage, many uninoculated plants lapsed into arrest of growth. This phenomenon was less frequent in AMF inoculated plants. Optimal timing of AMF inoculation and nutritional level of rooting and weaning substrate are discussed.

Actinobacteria possessing antimicrobial and antioxidant activities isolated from the pollen of scots pine (Pinus sylvestris) grown on the Baikal shore.

Science.gov (United States)

Axenov-Gribanov, Denis V; Voytsekhovskaya, Irina V; Rebets, Yuriy V; Tokovenko, Bogdan T; Penzina, Tatyana A; Gornostay, Tatyana G; Adelshin, Renat V; Protasov, Eugenii S; Luzhetskyy, Andriy N; Timofeyev, Maxim A

2016-10-01

Isolated ecosystems existing under specific environmental conditions have been shown to be promising sources of new strains of actinobacteria. The taiga forest of Baikal Siberia has not been well studied, and its actinobacterial population remains uncharacterized. The proximity between the huge water mass of Lake Baikal and high mountain ranges influences the structure and diversity of the plant world in Siberia. Here, we report the isolation of eighteen actinobacterial strains from male cones of Scots pine trees (Pinus sylvestris) growing on the shore of the ancient Lake Baikal in Siberia. In addition to more common representative strains of Streptomyces, several species belonging to the genera Rhodococcus, Amycolatopsis, and Micromonospora were isolated. All isolated strains exhibited antibacterial and antifungal activities. We identified several strains that inhibited the growth of the pathogen Candida albicans but did not hinder the growth of Saccharomyces cerevisiae. Several isolates were active against Gram-positive and Gram-negative bacteria. The high proportion of biologically active strains producing antibacterial and specific antifungal compounds may reflect their role in protecting pollen against phytopathogens.

Links between root carbohydrates and seasonal pattern of soil microbial activity of diverse european populations of Pinus sylvestris grown in a provenance plantation

Directory of Open Access Journals (Sweden)

Barbara Kaliszewska-Rokicka

2011-01-01

Full Text Available Activity of soil dehydrogenase (DHA was measured in the mineral soil in a forest stand of 15 to 16-year-old Scots pine (Pinus sylvestris L. from geographically diverse populations, as an indicator of biological activity of soil microorganisms, in a provenance experiment in Poland. The pine populations originated from six European countries (Sweden, Russia, Latvia, Poland, Germany, France and differed widely in aboveground biomass and productivity. Soil DHA during two growing seasons showed pronounced seasonal variability, which was significantly related to the fine root concentration of nonstructural carbohydrates. Higher DHA was found in soil under canopies of the central and southern European populations than in those from more northern parts of the Scots pine range. Significant positive correlation between soil DHA and aboveground tree biomass suggest that these patterns most likely resulted from differences in carbon dynamics and productivity among populations.

Evaluation of the hormonal state of columnar apple trees (Malus x domestica) based on high throughput gene expression studies.

Science.gov (United States)

Krost, Clemens; Petersen, Romina; Lokan, Stefanie; Brauksiepe, Bastienne; Braun, Peter; Schmidt, Erwin R

2013-02-01

The columnar phenotype of apple trees (Malus x domestica) is characterized by a compact growth habit with fruit spurs instead of lateral branches. These properties provide significant economic advantages by enabling high density plantings. The columnar growth results from the presence of a dominant allele of the gene Columnar (Co) located on chromosome 10 which can appear in a heterozygous (Co/co) or homozygous (Co/Co) state. Although two deep sequencing approaches could shed some light on the transcriptome of columnar shoot apical meristems (SAMs), the molecular mechanisms of columnar growth are not yet elaborated. Since the influence of phytohormones is believed to have a pivotal role in the establishment of the phenotype, we performed RNA-Seq experiments to study genes associated with hormone homeostasis and clearly affected by the presence of Co. Our results provide a molecular explanation for earlier findings on the hormonal state of columnar apple trees. Additionally, they allow hypotheses on how the columnar phenotype might develop. Furthermore, we show a statistically approved enrichment of differentially regulated genes on chromosome 10 in the course of validating RNA-Seq results using additional gene expression studies.

In silico analysis of the polygalacturonase inhibiting protein 1 from apple, Malus domestica.

Science.gov (United States)

Matsaunyane, Lerato Bt; Oelofse, Dean; Dubery, Ian A

2015-03-11

The Malus domestica polygalacturonase inhibiting protein 1 (MdPGIP1) gene, encoding the M. domestica polygalacturonase inhibiting protein 1 (MdPGIP1), was isolated from the Granny Smith apple cultivar (GenBank accession no. DQ185063). The gene was used to transform tobacco and potato for enhanced resistance against fungal diseases. Analysis of the MdPGIP1 nucleotide sequence revealed that the gene comprises 993 nucleotides that encode a 330 amino acid polypeptide. In silico characterization of the MdPGIP1 polypeptide revealed domains typical of PGIP proteins, which include a 24 amino acid putative signal peptide, a potential cleavage site [Alanine-Leucine-Serine (ALS)] for the signal peptide, a 238 amino acid leucine-rich repeat (LRR) domain, a 46 amino acid N-terminal domain and a 22 amino acid C-terminal domain. The hydropathic evaluation of MdPGIP1 indicated a repetitive hydrophobic motif in the LRR domain and a hydrophilic surface area consistent with a globular protein. The typical consensus glycosylation sequence of Asn-X-Ser/Thr was identified in MdPGIP1, indicating potential N-linked glycosylation of MdPGIP1. The molecular mass of non-glycosylated MdPGIP1 was calculated as 36.615 kDa and the theoretical isoelectric point as 6.98. Furthermore, the secondary and tertiary structure of MdPGIP1 was modelled, and revealed that MdPGIP1 is a curved and elongated molecule that contains sheet B1, sheet B2 and 310-helices on its LRR domain. The overall properties of the MdPGIP1 protein is similar to that of the prototypical Phaseolus vulgaris PGIP 2 (PvPGIP2), and the detected differences supported its use in biotechnological applications as an inhibitor of targeted fungal polygalacturonases (PGs).

Heavy and frequent thinning promotes drought adaptation in Pinus sylvestris forests.

Science.gov (United States)

Sohn, Julia A; Hartig, Florian; Kohler, Martin; Huss, Jürgen; Bauhus, Jürgen

2016-10-01

Droughts and their negative effects on forest ecosystems are projected to increase under climate change for many regions. It has been suggested that intensive thinning could reduce drought impacts on established forests in the short-term. Most previous studies on the effect of thinning on drought impacts, however, have been confined to single forest sites. It is therefore still unclear how general and persisting the benefits of thinning are. This study assesses the potential of thinning to increase drought tolerance of the wide spread Scots pine (Pinus sylvestris) in Central Europe. We hypothesized (1) that increasing thinning intensity benefits the maintenance of radial growth of crop trees during drought (resistance) and its recovery following drought, (2) that those benefits to growth decrease with time elapsed since the last thinning and with stand age, and (3) that they may depend on drought severity as well as water limitations in pre- and post-drought periods. To test these hypotheses, we assessed the effects of thinning regime, stand age, and drought severity on radial growth of 129 Scots pine trees during and after drought events in four long-term thinning experiments in Germany. We found that thinning improved the recovery of radial growth following drought and to a lesser extent the growth resistance during a drought event. Growth recovery following drought was highest after the first thinning intervention and in recently and heavily thinned stands. With time since the last thinning, however, this effect decreased and could even become negative when compared to unthinned stands. Further, thinning helped to avoid an age-related decline in growth resistance (and recovery) following drought. The recovery following drought, but not the resistance during drought, was related to water limitations in the drought period. This is the first study that analyzed drought-related radial growth in trees of one species across several stands of different age. The

Suppressing Sorbitol Synthesis Substantially Alters the Global Expression Profile of Stress Response Genes in Apple (Malus domestica) Leaves.

Science.gov (United States)

Wu, Ting; Wang, Yi; Zheng, Yi; Fei, Zhangjun; Dandekar, Abhaya M; Xu, Kenong; Han, Zhenhai; Cheng, Lailiang

2015-09-01

Sorbitol is a major product of photosynthesis in apple (Malus domestica) that is involved in carbohydrate metabolism and stress tolerance. However, little is known about how the global transcript levels in apple leaves respond to decreased sorbitol synthesis. In this study we used RNA sequencing (RNA-seq) profiling to characterize the transcriptome of leaves from transgenic lines of the apple cultivar 'Greensleeves' exhibiting suppressed expression of aldose-6-phosphate reductase (A6PR) to gain insights into sorbitol function and the consequences of decreased sorbitol synthesis on gene expression. We observed that, although the leaves of the low sorbitol transgenic lines accumulate higher levels of various primary metabolites, only very limited changes were found in the levels of transcripts associated with primary metabolism. We suggest that this is indicative of post-transcriptional and/or post-translational regulation of primary metabolite accumulation and central carbon metabolism. However, we identified significantly enriched gene ontology terms belonging to the 'stress related process' category in the antisense lines (P-value sorbitol plays a role in the responses of apple trees to abiotic and biotic stresses. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Growth and mycorrhizal community structure of Pinus sylvestris seedlings following the addition of forest litter.

Science.gov (United States)

Aucina, Algis; Rudawska, Maria; Leski, Tomasz; Skridaila, Audrius; Riepsas, Edvardas; Iwanski, Michal

2007-08-01

We report the effects of pine and oak litter on species composition and diversity of mycorrhizal fungi colonizing 2-year-old Pinus sylvestris L. seedlings grown in a bare-root nursery in Lithuania. A layer of pine or oak litter was placed on the surface of the nursery bed soil to mimic natural litter cover. Oak litter amendment appeared to be most favorable for seedling survival, with a 73% survival rate, in contrast to the untreated mineral bed soil (44%). The concentrations of total N, P, K, Ca, and Mg were higher in oak growth medium than in pine growth medium. Relative to the control (pH 6.1), the pH was lower in pine growth medium (5.8) and higher in oak growth medium (6.3). There were also twofold and threefold increases in the C content of growth medium with the addition of pine and oak litter, respectively. Among seven mycorrhizal morphotypes, eight different mycorrhizal taxa were identified: Suillus luteus, Suillus variegatus, Wilcoxina mikolae, a Tuber sp., a Tomentella sp., Cenococcum geophilum, Amphinema byssoides, and one unidentified ectomycorrhizal symbiont. Forest litter addition affected the relative abundance of mycorrhizal symbionts more than their overall representation. This was more pronounced for pine litter than for oak litter, with 40% and 25% increases in the abundance of suilloid mycorrhizae, respectively. Our findings provide preliminary evidence that changes in the supply of organic matter through litter manipulation may have far-reaching effects on the chemistry of soil, thus influencing the growth and survival of Scots pine seedlings and their mycorrhizal communities.

Growth and Mycorrhizal Community Structure of Pinus sylvestris Seedlings following the Addition of Forest Litter▿

Science.gov (United States)

Aučina, Algis; Rudawska, Maria; Leski, Tomasz; Skridaila, Audrius; Riepšas, Edvardas; Iwanski, Michal

2007-01-01

We report the effects of pine and oak litter on species composition and diversity of mycorrhizal fungi colonizing 2-year-old Pinus sylvestris L. seedlings grown in a bare-root nursery in Lithuania. A layer of pine or oak litter was placed on the surface of the nursery bed soil to mimic natural litter cover. Oak litter amendment appeared to be most favorable for seedling survival, with a 73% survival rate, in contrast to the untreated mineral bed soil (44%). The concentrations of total N, P, K, Ca, and Mg were higher in oak growth medium than in pine growth medium. Relative to the control (pH 6.1), the pH was lower in pine growth medium (5.8) and higher in oak growth medium (6.3). There were also twofold and threefold increases in the C content of growth medium with the addition of pine and oak litter, respectively. Among seven mycorrhizal morphotypes, eight different mycorrhizal taxa were identified: Suillus luteus, Suillus variegatus, Wilcoxina mikolae, a Tuber sp., a Tomentella sp., Cenococcum geophilum, Amphinema byssoides, and one unidentified ectomycorrhizal symbiont. Forest litter addition affected the relative abundance of mycorrhizal symbionts more than their overall representation. This was more pronounced for pine litter than for oak litter, with 40% and 25% increases in the abundance of suilloid mycorrhizae, respectively. Our findings provide preliminary evidence that changes in the supply of organic matter through litter manipulation may have far-reaching effects on the chemistry of soil, thus influencing the growth and survival of Scots pine seedlings and their mycorrhizal communities. PMID:17575001

Effect of irrigation on needle morphology, shoot and stem growth in a drought-exposed Pinus sylvestris forest.

Science.gov (United States)

Dobbertin, Matthias; Eilmann, Britta; Bleuler, Peter; Giuggiola, Arnaud; Graf Pannatier, Elisabeth; Landolt, Werner; Schleppi, Patrick; Rigling, Andreas

2010-03-01

In Valais, Switzerland, Scots pines (Pinus sylvestris L.) are declining, mainly following drought. To assess the impact of drought on tree growth and survival, an irrigation experiment was initiated in 2003 in a mature pine forest, approximately doubling the annual precipitation. Tree crown transparency (lack of foliage) and leaf area index (LAI) were annually assessed. Seven irrigated and six control trees were felled in 2006, and needles, stem discs and branches were taken for growth analysis. Irrigation in 2004 and 2005, both with below-average precipitation, increased needle size, area and mass, stem growth and, with a 1-year delay, shoot length. This led to a relative decrease in tree crown transparency (-14%) and to an increase in stand LAI (+20%). Irrigation increased needle length by 70%, shoot length by 100% and ring width by 120%, regardless of crown transparency. Crown transparency correlated positively with mean needle size, shoot length and ring width and negatively with specific leaf area. Trees with high crown transparency (low growth, short needles) experienced similar increases in needle mass and growth with irrigation than trees with low transparency (high growth, long needles), indicating that seemingly declining trees were able to 'recover' when water supply became sufficient. A simple drought index before and during the irrigation explained most of the variation found in the parameters for both irrigated and control trees.

No evidence for depletion of carbohydrate pools in Scots pine (Pinus sylvestris L.) under drought stress.

Science.gov (United States)

Gruber, A; Pirkebner, D; Florian, C; Oberhuber, W

2012-01-01

The physiological mechanisms leading to Scots pine (Pinus sylvestris L.) decline in the dry inner alpine valleys are still unknown. Testing the carbon starvation hypothesis, we analysed the seasonal course of mobile carbohydrate pools (NSC) of Scots pine growing at a xeric and a dry-mesic site within an inner alpine dry valley (750 m a.s.l., Tyrol, Austria) during 2009, which was characterised by exceptional soil dryness. Although, soil moisture content dropped to ca. 10% at both sites during the growing season, NSC concentrations rose in all tissues (branch, stem, root) until the end of July, except in needles, where maxima were reached around bud break. NSC concentrations were not significantly different in the analysed tissues at the xeric and the dry-mesic site. At the dry-mesic site, NSC concentrations in the aboveground tree biomass were significantly higher during the period of radial growth. An accumulation of NSC in roots at the end of July indicates a change in carbon allocation after an early cessation in aboveground growth, possibly due to elevated belowground carbon demand. In conclusion, our results revealed that extensive soil dryness during the growing season did not lead to carbon depletion. However, even though carbon reserves were not exhausted, sequestration of carbohydrate pools during drought periods might lead to deficits in carbon supply that weaken tree vigour and drive tree mortality. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.

A Malus crabapple chalcone synthase gene, McCHS, regulates red petal color and flavonoid biosynthesis.

Directory of Open Access Journals (Sweden)

Deqiang Tai

Full Text Available Chalcone synthase is a key and often rate-limiting enzyme in the biosynthesis of anthocyanin pigments that accumulate in plant organs such as flowers and fruits, but the relationship between CHS expression and the petal coloration level in different cultivars is still unclear. In this study, three typical crabapple cultivars were chosen based on different petal colors and coloration patterns. The two extreme color cultivars, 'Royalty' and 'Flame', have dark red and white petals respectively, while the intermediate cultivar 'Radiant' has pink petals. We detected the flavoniods accumulation and the expression levels of McCHS during petals expansion process in different cultivars. The results showed McCHS have their special expression patterns in each tested cultivars, and is responsible for the red coloration and color variation in crabapple petals, especially for color fade process in 'Radiant'. Furthermore, tobacco plants constitutively expressing McCHS displayed a higher anthocyanins accumulation and a deeper red petal color compared with control untransformed lines. Moreover, the expression levels of several anthocyanin biosynthetic genes were higher in the transgenic McCHS overexpressing tobacco lines than in the control plants. A close relationship was observed between the expression of McCHS and the transcription factors McMYB4 and McMYB5 during petals development in different crabapple cultivars, suggesting that the expression of McCHS was regulated by these transcription factors. We conclude that the endogenous McCHS gene is a critical factor in the regulation of anthocyanin biosynthesis during petal coloration in Malus crabapple.

Foliar application of amino acids modulates aroma components of 'FUJI' apple (malus domestica L.)

International Nuclear Information System (INIS)

Gou, W.; Zhang, L.; Chen, F.; Cui, Z.; Zhao, Y.; Zheng, P.; Tian, L.; Zhang, L.; Zhang, C.

2015-01-01

Volatile flavor compounds play a key role in determining the perception and acceptability as well as enhancing market competitiveness of apple (Malus domestica L.). In our study, we evaluated the effects of foliar-applied four different amino acids, i.e. leucine (Leu), isoleucine (Ile), valine (Val) and alanine (Ala), on aroma components and two key enzymes activities involved in aroma metabolism of Fuji apple. The total amount of aromatic components under Ala treatment was significantly higher than those under other treatments. There was a considerable increase in total aroma content, including hexanal, 2-methyl-butanol, nonanal, (E)-2-hexenal, methyleugenol, ethyl acetate, butanoic acid-pentyl ester, butanoic acid-hexyl ester, butyric acid ethyl ester, acetic acid-2-methyl-butyl ester, treated with spraying amino acids compared with the control. More specifically, hexanal, 2-methyl-butanol, methyleugenol and acetic acid-2-methyl-butyl ester exhibited a greater substantial increase of their contents than those of in other ingredients. However, butanoic acid-2-methyl-2-methyl butyl ester maintained a highest level among all aroma components regardless of different amino acids application. Furthermore, the activities of alcohol dehydrogenase (ADH) and alcohol acyltransferase (AAT) were much higher under Ala treatment than those under other treatments. We concluded that foliar-applied organic nitrogen (N), especially for Ala, can improve aroma metabolism and it could be used in production to enhance fruit quality on a commercial scale. (author)

Future bloom and blossom frost risk for Malus domestica considering climate model and impact model uncertainties.

Science.gov (United States)

Hoffmann, Holger; Rath, Thomas

2013-01-01

The future bloom and risk of blossom frosts for Malus domestica were projected using regional climate realizations and phenological ( = impact) models. As climate impact projections are susceptible to uncertainties of climate and impact models and model concatenation, the significant horizon of the climate impact signal was analyzed by applying 7 impact models, including two new developments, on 13 climate realizations of the IPCC emission scenario A1B. Advancement of phenophases and a decrease in blossom frost risk for Lower Saxony (Germany) for early and late ripeners was determined by six out of seven phenological models. Single model/single grid point time series of bloom showed significant trends by 2021-2050 compared to 1971-2000, whereas the joint signal of all climate and impact models did not stabilize until 2043. Regarding blossom frost risk, joint projection variability exceeded the projected signal. Thus, blossom frost risk cannot be stated to be lower by the end of the 21st century despite a negative trend. As a consequence it is however unlikely to increase. Uncertainty of temperature, blooming date and blossom frost risk projection reached a minimum at 2078-2087. The projected phenophases advanced by 5.5 d K(-1), showing partial compensation of delayed fulfillment of the winter chill requirement and faster completion of the following forcing phase in spring. Finally, phenological model performance was improved by considering the length of day.

Changes in the concentrations of phenolics and photosynthates in Scots pine (Pinus sylvestris L.) seedlings exposed to nickel and copper

Energy Technology Data Exchange (ETDEWEB)

Roitto, M. [MTT Agrifood Research Finland, Environmental Research, Karilantie 2A, FIN-50600 Mikkeli (Finland) and Department of Ecological and Environmental Sciences, University of Helsinki, Niemenkatu 73, FIN-15140 Lahti (Finland)]. E-mail: marja.roitto@mtt.fi; Rautio, P. [Finnish Forest Research Institute, Parkano Research Station, Kaironiementie 54, FIN-39700 Parkano (Finland); Julkunen-Tiitto, R. [Department of Biology, University of Joensuu, PO Box 111, FIN-80101 Joensuu (Finland); Kukkola, E. [University of Helsinki, Department of Biosciences, Division of Plant Physiology, PO Box 56, FIN-00014, Helsinki (Finland); Huttunen, S. [Department of Biology, University of Oulu, PO Box 3000, FIN-90014 Oulu (Finland)

2005-10-15

Studies were done on the effects of elevated soil concentrations of copper (Cu) and (Ni) on foliar carbohydrates and phenolics in Scots pine (Pinus sylvestris L.). Four year-old seedlings were planted in pots filled with metal-treated mineral forest soil in early June. The experimental design included all combinations of four levels of Cu (0, 25, 40 and 50 mg kg{sup -1} soil dw) and Ni (0, 5, 15 and 25 mg kg{sup -1} soil dw). Current year needles were sampled for soluble sugar, starch and phenolics at the end of September. Ni increased sucrose concentration in the needles, indicating disturbances in carbohydrate metabolism. Trees exposed to Ni had higher concentrations of condensed tannins compared with controls. In contrast, concentrations of several other phenolic compounds decreased when seedlings were exposed to high levels of Cu or to a combination of Ni and Cu. The results suggest that concentrations of phenolics in Scots pine needles vary in their responses to Ni and Cu in the forest soil. - Excess nickel in soil interferes with carbohydrate metabolism and induces an increase in concentration of condensed tannins in Scots pine needles.

Changes in the concentrations of phenolics and photosynthates in Scots pine (Pinus sylvestris L.) seedlings exposed to nickel and copper

International Nuclear Information System (INIS)

Roitto, M.; Rautio, P.; Julkunen-Tiitto, R.; Kukkola, E.; Huttunen, S.

2005-01-01

Studies were done on the effects of elevated soil concentrations of copper (Cu) and (Ni) on foliar carbohydrates and phenolics in Scots pine (Pinus sylvestris L.). Four year-old seedlings were planted in pots filled with metal-treated mineral forest soil in early June. The experimental design included all combinations of four levels of Cu (0, 25, 40 and 50 mg kg -1 soil dw) and Ni (0, 5, 15 and 25 mg kg -1 soil dw). Current year needles were sampled for soluble sugar, starch and phenolics at the end of September. Ni increased sucrose concentration in the needles, indicating disturbances in carbohydrate metabolism. Trees exposed to Ni had higher concentrations of condensed tannins compared with controls. In contrast, concentrations of several other phenolic compounds decreased when seedlings were exposed to high levels of Cu or to a combination of Ni and Cu. The results suggest that concentrations of phenolics in Scots pine needles vary in their responses to Ni and Cu in the forest soil. - Excess nickel in soil interferes with carbohydrate metabolism and induces an increase in concentration of condensed tannins in Scots pine needles

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

The Impact of Moss Species and Biomass on the Growth of Pinus sylvestris Tree Seedlings at Different Precipitation Frequencies

Directory of Open Access Journals (Sweden)

Babs M. Stuiver

2014-08-01

Full Text Available Boreal forests are characterized by an extensive moss layer, which may have both competitive and facilitative effects on forest regeneration. We conducted a greenhouse experiment to investigate how variation in moss species and biomass, in combination with precipitation frequency, affect Pinus sylvestris seedling growth. We found that moss species differed in their effects on seedling growth, and moss biomass had negative effects on seedlings, primarily when it reached maximal levels. When moss biomass was maximal, seedling biomass decreased, whereas height and above- relative to below-ground mass increased, due to competition for light. The effect that moss biomass had on seedling performance differed among the moss species. Hylocomium splendens and Polytrichum commune reduced seedling growth the most, likely because of their taller growth form. Seedlings were not adversely affected by Sphagnum girgensohnii and Pleurozium schreberi, possibly because they were not tall enough to compete for light and improved soil resource availability. Reduced precipitation frequency decreased the growth of all moss species, except P. commune, while it impaired the growth of seedlings only when they were grown with P. commune. Our findings suggest that changes in moss species and biomass, which can be altered by disturbance or climate change, can influence forest regeneration.

Bacterial microbiomes of individual ectomycorrhizal Pinus sylvestris roots are shaped by soil horizon and differentially sensitive to nitrogen addition.

Science.gov (United States)

Marupakula, Srisailam; Mahmood, Shahid; Jernberg, Johanna; Nallanchakravarthula, Srivathsa; Fahad, Zaenab A; Finlay, Roger D

2017-11-01

Plant roots select non-random communities of fungi and bacteria from the surrounding soil that have effects on their health and growth, but we know little about the factors influencing their composition. We profiled bacterial microbiomes associated with individual ectomycorrhizal Pinus sylvestris roots colonized by different fungi and analyzed differences in microbiome structure related to soils from distinct podzol horizons and effects of short-term additions of N, a growth-limiting nutrient commonly applied as a fertilizer, but known to influence patterns of carbon allocation to roots. Ectomycorrhizal roots growing in soil from different horizons harboured distinct bacterial communities. The fungi colonizing individual roots had a strong effect on the associated bacterial communities. Even closely related species within the same ectomycorrhizal genus had distinct bacterial microbiomes in unfertilized soil, but fertilization removed this specificity. Effects of N were rapid and context dependent, being influenced by both soil type and the particular ectomycorrhizal fungi involved. Fungal community composition changed in soil from all horizons, but bacteria only responded strongly to N in soil from the B horizon where community structure was different and bacterial diversity was significantly reduced, possibly reflecting changed carbon allocation patterns. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

The effect of apple (Malus Domestica juice on the damage of mice liver cells due to paracetamol treatment

Directory of Open Access Journals (Sweden)

Anthony Hartanto

2009-07-01

Full Text Available The liver is an important organ for body metabolism process. Liver disease is one of serious health problems in developing countries including Indonesia. Liver damage is caused by viral infection, toxic agent exposure (medications, alcohol, hormonal disturbance, neoplasm and autoimmune diseases. The use of high dose paracetamol to reduce pain also leads to liver damage. Apple (Malus domestica juice is a natural anti oxidant agent. This laboratory experimental study was performed to discover the effect of giving apple juice on damaged cell regeneration due to the use of paracetamol. The study was performed in 21 male mice from Swiss-Webster strain that were divided into group I, II, and III. Group, I served as control while group II received 1 mg/ml paracetamol dose for 5 days and Group III received 1 mg/ml paracetamol for 5 days and 1 ml of apple juice on the 5th to 10th day. The observation of the mice liver cells was conducted using a light microscope with 400x magnification to get the number of necrotic liver cells per view field. The results of this study showed a difference in the number of necrotic liver cells between Group II and III. ANOVA statistical test ( = 0.05 concluded that apple juice significantly helps regeneration process in damaged liver cells caused by paracetamol.

Hydrogen apparent fractionation between source water and epicuticular waxes of Pinus sylvestris in North East Finland

Science.gov (United States)

Newberry, S. L.; Grace, J.; Pedentchouk, N.

2010-12-01

Hydrogen isotopic composition of plant biomass provides crucial information about plant ecophysiology and local hydrology. Little is known about the apparent fractionation between hydrogen in source water and epicuticular leaf waxes of coniferous tree species that dominate the boreal forest ecosystem exposed to prolonged periods of sunlight during the growing season. In this study, single rope canopy access techniques were used to harvest needle and twig material from the upper, middle and lower crown of north and south facing branches of Pinus sylvestris within the subarctic forest of North East Finland. Samples were collected towards the beginning of the growing season in July and repeated in late September 2010. Leaf and twig waters were extracted cryogenically and analysed for D-enrichment. Individual n-alkanes are currently being quantified and analyzed for 13C/12C and D/H compositions. The molecular and isotopic data are supplemented by long-term in-situ cuvette photosynthetic assimilation measurements as well as relative humidity (RH), air temperature, precipitation and wind speed data collected by Helsinki University (SMEAR I). In addition RH, air temperature, wind speed and incoming solar radiation measurements were made at each individual sample point at the time of harvesting to quantify meteorological and microclimatological variation within individual trees. The outcome of this investigation will provide important insights into plant biochemistry and physiology of a crucial climate sensitive higher plant species subjected to continuous low light throughout the season. Furthermore, this work will expand our understanding of modern and palaeo-hydrology not only in northern Finland but also in other boreal forests around the world.

Impact of drought on the temporal dynamics of wood formation in Pinus sylvestris.

Science.gov (United States)

Gruber, Andreas; Strobl, Stefan; Veit, Barbara; Oberhuber, Walter

2010-04-01

We determined the temporal dynamics of cambial activity and xylem cell differentiation of Scots pine (Pinus sylvestris L.) within a dry inner Alpine valley (750 m a.s.l., Tyrol, Austria), where radial growth is strongly limited by drought in spring. Repeated micro-sampling of the developing tree ring of mature trees was carried out during two contrasting years at two study plots that differ in soil water availability (xeric and dry-mesic sites). In 2007, when air temperature at the beginning of the growing season in April exceeded the long-term mean by 6.4 degrees C, cambial cell division started in early April at both study plots. A delayed onset of cambial activity of c. 2 weeks was found in 2008, when average climate conditions prevailed in spring, indicating that resumption of cambial cell division after winter dormancy is temperature controlled. Cambial cell division consistently ended about the end of June/early July in both study years. Radial enlargement of tracheids started almost 3 weeks earlier in 2007 compared with 2008 at both study plots. At the xeric site, the maximum rate of tracheid production in 2007 and 2008 was reached in early and mid-May, respectively, and c. 2 weeks later at the dry-mesic site. Since in both study years more favorable growing conditions (i.e., an increase in soil water content) were recorded during summer, we suggest a strong sink competition for carbohydrates to mycorrhizal root and shoot growth. Wood formation stopped c. 4 weeks earlier at the xeric compared with the dry-mesic site in both years, indicating a strong influence of drought stress on cell differentiation. This is supported by radial widths of earlywood cells, which were found to be significantly narrower at the xeric than at the dry-mesic site (P drought is strongly influenced by water availability, the onset of cambial activity and cell differentiation is controlled by temperature.

Evaluation of five protocols for DNA extraction from leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris.

Science.gov (United States)

Aubakirova, K; Omasheva, M; Ryabushkina, N; Tazhibaev, T; Kampitova, G; Galiakparov, N

2014-02-27

Leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris contain substantial amounts of secondary metabolites, which limit the high-quality DNA extraction performance. In this study, five extraction protocols were compared for their ability to produce good quality DNA from fresh and dried (with silica gel) leaves of these species. The modified protocol of Dellaporta et al., using polyvinylpyrrolidone to bind the phenolic compounds and a high molar concentration of potassium acetate to inhibit co-precipitation of polysaccharides with DNA, produced the best DNA quality for all species tested. DNA extracted by this method had a 1.77-1.96 A260/280 nm ratio and successful amplification of the 18S ribosomal DNA gene. DNA concentrations of dried leaves were lower than those obtained from fresh leaves, which was likely due to aspects of the drying procedure. All five methods for grapevine produced DNA of obvious better quality from green canes compared to leaves, due to the relatively low content of secondary metabolites in the former. For grapevine and apricot, three methods can be equally used to obtain DNA of good quality: the Doyle and Doyle modified method using CTAB and high concentration of NaCl, the Jobes et al. modified method, and the sodium dodecyl sulfate mini preparation method of Edwards et al. The protocol of Jobes et al. using LiCl for RNA removal showed the best results for most of the M. sieversii samples examined.

7 CFR 319.37-1 - Definitions.

Science.gov (United States)

2010-01-01

...: mechanical transmission of the pest to an indicator plant for Dianthus, Malus, Prunus, Rubus, and Syringa..., Rubus, and Syringa; serology for Dianthus, Malus, Prunus, Pyrus, Rubus, and Syringa; electron microscopy for Dianthus and Prunus, and nucleic acid probes for Chaenomeles, Cydonia, Malus, and Pyrus. Inspector...

Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies.

Science.gov (United States)

Jung, Sook; Cestaro, Alessandro; Troggio, Michela; Main, Dorrie; Zheng, Ping; Cho, Ilhyung; Folta, Kevin M; Sosinski, Bryon; Abbott, Albert; Celton, Jean-Marc; Arús, Pere; Shulaev, Vladimir; Verde, Ignazio; Morgante, Michele; Rokhsar, Daniel; Velasco, Riccardo; Sargent, Daniel James

2012-04-04

Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA) algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

Genetic resources of autochthonous fruit species and varieties

Directory of Open Access Journals (Sweden)

Keserović Zoran

2017-01-01

Full Text Available The paper describes the plentitude of genetic resources of indigenous varieties of fruit species and their importance for further development of fruit growing, especially from the aspect of breeding new varieties resistant to pathogens and abiotic stress conditions (frost, drought, sunburns, etc.. Economic significance and importance in the human nutrition, as a raw or processed fruitage, were stated as well. Based on the unique biodiversity, the Balkan Peninsula can be considered as a secondary center of divergence for a large number of fruit species, such as Malus x domestica, Malus sylvestris, Pyrus communis, Prunus cerasifera, P. persica, P. armeniaca, P. fruticosa, P. amygdalus, P. nana, Juglans regia, Corilus colurna, Corilus avellana, Castanea sativa, Fragaria vesca, Cornus mas. The old indigenous and domesticated varieties and natural populations of fruit species on the Balkan Peninsula have never been the subject of comprehensive research work on their collecting and studying. Serbia has no national scientific institution that takes care of genetic resources. Nowadays, the issue of preserving genetic resources is of great importance because, due to the intensification and modernization of plant production, many local populations have disappeared or are reduced to a small number of biotypes. The varieties with huge genetic and breeding value have disappeared forever without any possibility of their return. By importing high quality fruit varieties, we imported many diseases and various pests as well. New varieties intended for intensive cultivation require the application of expensive growing technologies. The systematic scientific work on the study of wild fruit species and autochthonous varieties is of the great interest for fruit science and practice in the future. The establishment of in situ collections with the aim to preserve valuable genetic material is mandatory. In the following period, indigenous and domesticated varieties

Fungi in roots of nursery grown Pinus sylvestris: ectomycorrhizal colonisation, genetic diversity and spatial distribution.

Science.gov (United States)

Menkis, Audrius; Vasaitis, Rimvydas

2011-01-01

The aims of this study were to investigate patterns of ectomycorrhizal (ECM) colonisation and community structure on nursery grown seedlings of Pinus sylvestris, spatial distribution of ECMs in the nursery plot and genetic diversity of commonly isolated ECM basidiomycete Hebeloma cavipes. One hundred seedlings were sampled in 225 m(2) area using a systematic grid design. For each seedling, 20 individual root tips were randomly collected, morphotyped, and surface sterilised for fungal isolation in pure culture. Results showed that ECM community was comprised of nine distinct morphotypes among which Thelephora terrestris (39.7%), Hebeloma sp. (17.8%) and Suillus luteus (6.1%) were the most abundant. Spatial distribution of ECMs in the nursery plot was determined by their relative abundance: even in common ECMs and random in rare ones. Fungal isolation yielded 606 pure cultures, representing 71 distinct taxa. The most commonly isolated fungi were the ascomycetes Neonectria macrodidyma (20.3%), Phialocephala fortinii (13.5%), Neonectria radicicola (6.3%) and the ECM basidiomycete H. cavipes (4.5%). Intraspecific genetic diversity within 27 H. cavipes isolates was studied using two methods: restriction digestion of the amplified intergenic spacer of nuclear ribosomal DNA and genealogical concordance of five genetic markers. Five and eight genotypes were revealed by each respective method, but both of those were largely consistent, in particular, in determining the largest genotype (A) composed of 18 isolates. Mapping positions for each H. cavipes isolate and genotype in the field showed that isolates of the A genotype covered a large part of the nursery plot. This suggests that H. cavipes is largely disseminated by vegetative means of local genotypes and that nursery cultivation practices are likely to contribute to the dissemination of this species in the forest nursery soils.

Radioactive contamination of pine (Pinus sylvestris) in Krasnoyarsk (Russia) following fallout from the Fukushima accident

International Nuclear Information System (INIS)

Bolsunovsky, A.; Dementyev, D.

2014-01-01

Following the Fukushima accident in March 2011, samples of pine trees (Pinus sylvestris) were collected from three sites near the city of Krasnoyarsk (Siberia, Russia) during 2011–2012 and analyzed for artificial radionuclides. Concentrations of Fukushima-derived radionuclides in the samples of pine needles in April 2011 reached 5.51 ± 0.52 Bq kg −1131 I, 0.92 ± 0.04 Bq kg −1134 Cs, and 1.51 ± 0.07 Bq kg −1137 Cs. An important finding was the detection of 134 Cs from the Fukushima accident not only in the pine needles and branches but also in the new shoots in 2012, which suggested a transfer of Fukushima cesium isotopes from branches to shoots. In 2011 and 2012, the 137 Cs/ 134 Cs ratio for pine needles and branches collected in sampling areas Krasnoyarsk-1 and Krasnoyarsk-2 was greater than 1 (varying within a range of 1.2–2.6), suggesting the presence of “older”, pre-Fukushima accident 137 Cs. Calculations showed that for pine samples growing in areas of the Krasnoyarskii Krai unaffected by contamination from the nuclear facility, the activity of the Fukushima-derived cesium isotopes was two–three times higher than the activity of the pre-accident 137 Cs. - Highlights: • 137 Cs, 134 Cs and 131 I were detected in samples of pine trees near Krasnoyarsk (Russia). • 134 Cs was transferred from old tree parts to the new (2012) shoots of pine trees. • The 137 Cs total / 134 Cs activity ratio for pine samples was greater than 1 due to the presence of pre-accident 137 Cs. • The accident 137 Cs activity in pine samples was higher than the pre-accident 137 Cs activity

Genetic and environmental control of seasonal carbohydrate dynamics in trees of diverse Pinus sylvestris populations.

Science.gov (United States)

Oleksyn, J.; Zytkowiak, R.; Karolewski, P.; Reich, P. B.; Tjoelker, M. G.

2000-06-01

We explored environmental and genetic factors affecting seasonal dynamics of starch and soluble nonstructural carbohydrates in needle and twig cohorts and roots of Scots pine (Pinus sylvestris L.) trees of six populations originating between 49 degrees and 60 degrees N, and grown under common garden conditions in western Poland. Trees of each population were sampled once or twice per month over a 3-year period from age 15 to 17 years. Based on similarity in starch concentration patterns in needles, two distinct groups of populations were identified; one comprised northern populations from Sweden and Russia (59-60 degrees N), and another comprised central European populations from Latvia, Poland, Germany and France (49-56 degrees N). Needle starch concentrations of northern populations started to decline in late spring and reached minimum values earlier than those of central populations. For all populations, starch accumulation in spring started when minimum air temperature permanently exceeded 0 degrees C. Starch accumulation peaked before bud break and was highest in 1-year-old needles, averaging 9-13% of dry mass. Soluble carbohydrate concentrations were lowest in spring and summer and highest in autumn and winter. There were no differences among populations in seasonal pattern of soluble carbohydrate concentrations. Averaged across all populations, needle soluble carbohydrate concentrations increased from about 4% of needle dry mass in developing current-year needles, to about 9% in 1- and 2-year-old needles. Root carbohydrate concentration exhibited a bimodal pattern with peaks in spring and autumn. Northern populations had higher concentrations of fine-root starch in spring and autumn than central populations. Late-summer carbohydrate accumulation in roots started only after depletion of starch in needles and woody shoots. We conclude that Scots pine carbohydrate dynamics depend partially on inherited properties that are probably related to phenology of root

Genome-wide identification and expression analysis of the B-box gene family in the Apple (Malus domestica Borkh.) genome.

Science.gov (United States)

Liu, Xin; Li, Rong; Dai, Yaqing; Chen, Xuesen; Wang, Xiaoyun

2018-04-01

The B-box proteins (BBXs) are a family of zinc finger proteins containing one/two B-box domain(s). Compared with intensive studies of animal BBXs, investigations of the plant BBX family are limited, though some specific plant BBXs have been demonstrated to act as transcription factors in the regulation of flowering and photomorphogenesis. In this study, using a global search of the apple (Malus domestica Borkh.) genome, a total of 64 members of BBX (MdBBX) were identified. All the MdBBXs were divided into five groups based on the phylogenetic relationship, numbers of B-boxes contained and whether there was with an additional CCT domain. According to the characteristics of organ-specific expression, MdBBXs were divided into three groups based on the microarray information. An analysis of cis-acting elements showed that elements related to the stress response were prevalent in the promoter sequences of most MdBBXs. Twelve MdBBX members from different groups were randomly selected and exposed to abiotic stresses. Their expressions were up-regulated to some extent in the roots and leaves. Six among 12 MdBBXs were sensitive to osmotic pressure, salt, cold stress and exogenous abscisic acid treatment, with their expressions enhanced more than 20-fold. Our results suggested that MdBBXs may take part in response to abiotic stress.

Metabolic variation and antioxidant potential of Malus prunifolia (wild apple) compared with high flavon-3-ol containing fruits (apple, grapes) and beverage (black tea).

Science.gov (United States)

Maria John, K M; Enkhtaivan, Gansukh; Kim, Ju Jin; Kim, Doo Hwan

2014-11-15

Secondary metabolic variation of wild apple (Malus prunifolia) was compared with fruits that contained high flavan-3-ol like grapes (GR), apple (App) and the beverage, black tea (BT). The polyphenol contents in wild apple was higher than in GR and App but less than BT. The identified phenolic acids (gallic, protocatechuic, chlorogenic, p-coumaric and ferulic acids) and flavonoids (quercetin and myricetin) indicate that wild apple was higher than that of App. Among all the samples, BT had highest antioxidant potential in terms of 2,2'-Azinobis (3-thylbenzothiazoline-6-sulfonic acid) diammonium salt (95.36%), metal chelating (45.36%) and phosphomolybdenum activity (95.8 mg/g) because of the high flavan-3-ol content. The gallic acid and epigallocatechin gallate were highly correlated with antioxidant potential and these metabolites levels are higher in wild apple than that of App. Wild apples being a non-commercial natural source, a detailed study of this plant will be helpful for the food additive and preservative industry. Copyright © 2014 Elsevier Ltd. All rights reserved.

Actual evapotranspiration estimation in a Mediterranean mountain region by means of Landsat-5 TM and TERRA/AQUA MODIS imagery and Sap Flow measurements in Pinus sylvestris forest stands.

Science.gov (United States)

Cristóbal, J.; Poyatos, R.; Ninyerola, M.; Pons, X.; Llorens, P.

2009-04-01

Evapotranspiration monitoring has important implications on global and regional climate modelling, as well as in the knowledge of the hydrological cycle and in the assessment of environmental stress that affects forest and agricultural ecosystems. An increase of evapotranspiration while precipitation remains constant, or is reduced, could decrease water availability for natural and agricultural systems and human needs. Consequently, water balance methods, as the evapotranspiration modelling, have been widely used to estimate crop and forest water needs, as well as the global change effects. Nowadays, radiometric measurements provided by Remote Sensing and GIS analysis are the technologies used to compute evapotranspiration at regional scales in a feasible way. Currently, the 38% of Catalonia (NE of the Iberian Peninsula) is covered by forests, and one of the most important forest species is Scots Pine (Pinus sylvestris) which represents the 18.4% of the area occupied by forests. The aim of this work is to model actual evapotranspiration in Pinus sylvestris forest stands, in a Mediterranean mountain region, using remote sensing data, and compare it with stand-scale sap flow measurements measured in the Vallcebre research area (42° 12' N, 1° 49' E), in the Eastern Pyrenees. To perform this study a set of 30 cloud-free TERRA-MODIS images and 10 Landsat-5 TM images of path 198 and rows 31 and 32 from June 2003 to January 2005 have been selected to perform evapotranspiration modelling in Pinus sylvestris forest stands. TERRA/AQUA MODIS images have been downloaded by means of the EOS Gateway. We have selected two different types of products which contain the remote sensing data we have used to model daily evapotranspiration, daily LST product and daily calibrated reflectances product. Landsat-5 TM images have been corrected by means of conventional techniques based on first order polynomials taking into account the effect of land surface relief using a Digital

Genotoxicity of dill (Anethum graveolens L.), peppermint (Menthaxpiperita L.) and pine (Pinus sylvestris L.) essential oils in human lymphocytes and Drosophila melanogaster.

Science.gov (United States)

Lazutka, J R; Mierauskiene, J; Slapsyte, G; Dedonyte, V

2001-05-01

Genotoxic properties of the essential oils extracted from dill (Anethum graveolens L.) herb and seeds, peppermint (Menthaxpiperita L.) herb and pine (Pinus sylvestris L.) needles were studied using chromosome aberration (CA) and sister chromatid exchange (SCE) tests in human lymphocytes in vitro, and Drosophila melanogaster somatic mutation and recombination test (SMART) in vivo. In the CA test, the most active essential oil was from dill seeds, then followed essential oils from dill herb, peppermint herb and pine needles, respectively. In the SCE test, the most active essential oils were from dill herb and seeds followed by essential oils from pine needles and peppermint herb. Essential oils from dill herb and seeds and pine needles induced CA and SCE in a clear dose-dependent manner, while peppermint essential oil induced SCE in a dose-independent manner. All essential oils were cytotoxic for human lymphocytes. In the SMART test, a dose-dependent increase in mutation frequency was observed for essential oils from pine and dill herb. Peppermint essential oil induced mutations in a dose-independent manner. Essential oil from dill seeds was almost inactive in the SMART test.

Natural Regeneration in a Multi-Layered Pinus sylvestris-Picea abies Forest after Target Diameter Harvest and Soil Scarification

Directory of Open Access Journals (Sweden)

Lars Drössler

2017-01-01

Full Text Available Forest management in Sweden can be characterized by even-aged silviculture heavily relying on three established harvest regimes: clearcutting, the seed-tree method, and the shelterwood system. Less intense, small-scale retention harvest systems such as single tree and group selection harvest are rarely used. In addition, natural regeneration dynamics without enrichment planting have barely been studied. Consequently, this study examined natural regeneration establishment in a multi-layered Pinus sylvestris-Picea abies forest stand in southwest Sweden after target diameter harvesting and soil scarification. The creation of forest canopy gaps had a positive effect on total seedling density five years after harvest, mainly due to a significantly higher number of Betula pendula individuals. Seedling density of more desirable tree species suitable for continuous cover forestry such as Fagus sylvatica, Quercus petraea and Picea abies also increased substantially in gaps when compared to pre-harvest conditions or the unharvested plots. In contrast, soil scarification did not increase the number of seedlings of desired tree species due to a significant decrease in Picea abies abundance. Soil moisture and gap size significantly improved Betula pendula seedling establishment while a larger number of Quercus petraea seedlings were observed in Vaccinium myrtillus patches. We conclude that canopy gaps are beneficial under the encountered stand conditions to initiate forest regeneration, and that soil scarification without the timely occurrence of a mast year of desired tree species is not effective in the type of forest studied.

Equilibrium, kinetic and thermodynamic studies of the biosorption of textile dye (Reactive Red 195) onto Pinus sylvestris L

International Nuclear Information System (INIS)

Aksakal, Ozkan; Ucun, Handan

2010-01-01

This study investigated the biosorption of Reactive Red 195 (RR 195), an azo dye, from aqueous solution by using cone biomass of Pinus sylvestris Linneo. To this end, pH, initial dye concentration, biomass dosage and contact time were studied in a batch biosorption system. Maximum pH for efficient RR 195 biosorption was found to be 1.0 and the initial RR 195 concentration increased with decreasing percentage removal. Biosorption capacity increased from 6.69 mg/g at 20 deg. C to 7.38 mg/g at 50 deg. C for 200 mg/L dye concentration. Kinetics of the interactions was tested by pseudo-first-order and pseudo-second-order kinetics, the Elovich equation and intraparticle diffusion mechanism. Pseudo-second-order kinetic model provided a better correlation for the experimental data studied in comparison to the pseudo-first-order kinetic model and intraparticle diffusion mechanism. Moreover, the Elovich equation also showed a good fit to the experimental data. Freundlich and Langmuir adsorption isotherms were used for the mathematical description of the biosorption equilibrium data. The activation energy of biosorption (Ea) was found to be 8.904 kJ/mol by using the Arrhenius equation. Using the thermodynamic equilibrium coefficients obtained at different temperatures, the study also evaluated the thermodynamic constants of biosorption (ΔG o , ΔH o and ΔS). The results indicate that cone biomass can be used as an effective and low-cost biosorbent to remove reactive dyes from aqueous solution.

Characterisation of microRNAs from apple (Malus domestica 'Royal Gala') vascular tissue and phloem sap.

Science.gov (United States)

Varkonyi-Gasic, Erika; Gould, Nick; Sandanayaka, Manoharie; Sutherland, Paul; MacDiarmid, Robin M

2010-08-04

Plant microRNAs (miRNAs) are a class of small, non-coding RNAs that play an important role in development and environmental responses. Hundreds of plant miRNAs have been identified to date, mainly from the model species for which there are available genome sequences. The current challenge is to characterise miRNAs from plant species with agricultural and horticultural importance, to aid our understanding of important regulatory mechanisms in crop species and enable improvement of crops and rootstocks. Based on the knowledge that many miRNAs occur in large gene families and are highly conserved among distantly related species, we analysed expression of twenty-one miRNA sequences in different tissues of apple (Malus x domestica 'Royal Gala'). We identified eighteen sequences that are expressed in at least one of the tissues tested. Some, but not all, miRNAs expressed in apple tissues including the phloem tissue were also detected in the phloem sap sample derived from the stylets of woolly apple aphids. Most of the miRNAs detected in apple phloem sap were also abundant in the phloem sap of herbaceous species. Potential targets for apple miRNAs were identified that encode putative proteins shown to be targets of corresponding miRNAs in a number of plant species. Expression patterns of potential targets were analysed and correlated with expression of corresponding miRNAs. This study validated tissue-specific expression of apple miRNAs that target genes responsible for plant growth, development, and stress response. A subset of characterised miRNAs was also present in the apple phloem translocation stream. A comparative analysis of phloem miRNAs in herbaceous species and woody perennials will aid our understanding of non-cell autonomous roles of miRNAs in plants.

Genome-wide identification and expression analysis of MAPK and MAPKK gene family in Malus domestica.

Science.gov (United States)

Zhang, Shizhong; Xu, Ruirui; Luo, Xiaocui; Jiang, Zesheng; Shu, Huairui

2013-12-01

MAPK signal transduction modules play crucial roles in regulating many biological processes in plants, which are composed of three classes of hierarchically organized protein kinases, namely MAPKKKs, MAPKKs, and MAPKs. Although genome-wide analysis of this family has been carried out in some species, little is known about MAPK and MAPKK genes in apple (Malus domestica). In this study, a total of 26 putative apple MAPK genes (MdMPKs) and 9 putative apple MAPKK genes (MdMKKs) have been identified and located within the apple genome. Phylogenetic analysis revealed that MdMAPKs and MdMAPKKs could be divided into 4 subfamilies (groups A, B, C and D), respectively. The predicted MdMAPKs and MdMAPKKs were distributed across 13 out of 17 chromosomes with different densities. In addition, analysis of exon-intron junctions and of intron phase inside the predicted coding region of each candidate gene has revealed high levels of conservation within and between phylogenetic groups. According to the microarray and expressed sequence tag (EST) analysis, the different expression patterns indicate that they may play different roles during fruit development and rootstock-scion interaction process. Moreover, MAPK and MAPKK genes were performed expression profile analyses in different tissues (root, stem, leaf, flower and fruit), and all of the selected genes were expressed in at least one of the tissues tested, indicating that the MAPKs and MAPKKs are involved in various aspects of physiological and developmental processes of apple. To our knowledge, this is the first report of a genome-wide analysis of the apple MAPK and MAPKK gene family. This study provides valuable information for understanding the classification and putative functions of the MAPK signal in apple. © 2013.

In Vitro Culture Conditions and OeARF and OeH3 Expressions Modulate Adventitious Root Formation from Oleaster (Olea europaea L. subsp. europaea var. sylvestris) Cuttings

Science.gov (United States)

Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

2014-01-01

Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency. PMID:24587768

In vitro culture conditions and OeARF and OeH3 expressions modulate adventitious root formation from oleaster (Olea europaea L. subsp. europaea var. sylvestris) cuttings.

Science.gov (United States)

Chiappetta, Adriana; Gagliardi, Cinzia; Bruno, Leonardo; Bitonti, Maria Beatrice

2014-01-01

Olea europaea L. subsp. europaea var. sylvestris, also named oleaster, is the wild form of olive and it is used as rootstock and pollen donor for many cultivated varieties. An efficient procedure for in vitro propagation of oleaster was established in this study. A zeatin concentration of 2.5 mg/L was effective to induce an appreciable vegetative growth. Also high rooting efficiency was obtained by using a short IBA pulse, followed by two different IBA concentrations in the culture medium. With the aim to enlarge knowledge on the molecular aspects of adventitious rooting, we also evaluated the transcriptional modulation of an ARFs member and HISTONE H3 genes, involved in auxin signaling and cell replication, respectively, during the root induction phase of cuttings. The obtained results suggest that the selected genes, as markers of the induction phase, could be very useful for setting up efficient culture conditions along the rooting process, thus increasing micropropagation efficiency.

Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica) fruit.

Science.gov (United States)

Atkinson, Ross G; Sutherland, Paul W; Johnston, Sarah L; Gunaseelan, Kularajathevan; Hallett, Ian C; Mitra, Deepali; Brummell, David A; Schröder, Roswitha; Johnston, Jason W; Schaffer, Robert J

2012-08-02

While there is now a significant body of research correlating apple (Malus x domestica) fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1), there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in 'Royal Gala' apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. PG1-suppressed 'Royal Gala' apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. These findings confirm PG1's role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

Transcription Profiles Reveal Sugar and Hormone Signaling Pathways Mediating Flower Induction in Apple (Malus domestica Borkh.).

Science.gov (United States)

Xing, Li-Bo; Zhang, Dong; Li, You-Mei; Shen, Ya-Wen; Zhao, Cai-Ping; Ma, Juan-Juan; An, Na; Han, Ming-Yu

2015-10-01

Flower induction in apple (Malus domestica Borkh.) is regulated by complex gene networks that involve multiple signal pathways to ensure flower bud formation in the next year, but the molecular determinants of apple flower induction are still unknown. In this research, transcriptomic profiles from differentiating buds allowed us to identify genes potentially involved in signaling pathways that mediate the regulatory mechanisms of flower induction. A hypothetical model for this regulatory mechanism was obtained by analysis of the available transcriptomic data, suggesting that sugar-, hormone- and flowering-related genes, as well as those involved in cell-cycle induction, participated in the apple flower induction process. Sugar levels and metabolism-related gene expression profiles revealed that sucrose is the initiation signal in flower induction. Complex hormone regulatory networks involved in cytokinin (CK), abscisic acid (ABA) and gibberellic acid pathways also induce apple flower formation. CK plays a key role in the regulation of cell formation and differentiation, and in affecting flowering-related gene expression levels during these processes. Meanwhile, ABA levels and ABA-related gene expression levels gradually increased, as did those of sugar metabolism-related genes, in developing buds, indicating that ABA signals regulate apple flower induction by participating in the sugar-mediated flowering pathway. Furthermore, changes in sugar and starch deposition levels in buds can be affected by ABA content and the expression of the genes involved in the ABA signaling pathway. Thus, multiple pathways, which are mainly mediated by crosstalk between sugar and hormone signals, regulate the molecular network involved in bud growth and flower induction in apple trees. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies

Directory of Open Access Journals (Sweden)

Jung Sook

2012-04-01

Full Text Available Abstract Background Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Results Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Conclusion Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

Genome-wide identification and analysis of the SBP-box family genes in apple (Malus × domestica Borkh.).

Science.gov (United States)

Li, Jun; Hou, Hongmin; Li, Xiaoqin; Xiang, Jiang; Yin, Xiangjing; Gao, Hua; Zheng, Yi; Bassett, Carole L; Wang, Xiping

2013-09-01

SQUAMOSA promoter binding protein (SBP)-box genes encode a family of plant-specific transcription factors and play many crucial roles in plant development. In this study, 27 SBP-box gene family members were identified in the apple (Malus × domestica Borkh.) genome, 15 of which were suggested to be putative targets of MdmiR156. Plant SBPs were classified into eight groups according to the phylogenetic analysis of SBP-domain proteins. Gene structure, gene chromosomal location and synteny analyses of MdSBP genes within the apple genome demonstrated that tandem and segmental duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of the SBP-box gene family in apple. Additionally, synteny analysis between apple and Arabidopsis indicated that several paired homologs of MdSBP and AtSPL genes were located in syntenic genomic regions. Tissue-specific expression analysis of MdSBP genes in apple demonstrated their diversified spatiotemporal expression patterns. Most MdmiR156-targeted MdSBP genes, which had relatively high transcript levels in stems, leaves, apical buds and some floral organs, exhibited a more differential expression pattern than most MdmiR156-nontargeted MdSBP genes. Finally, expression analysis of MdSBP genes in leaves upon various plant hormone treatments showed that many MdSBP genes were responsive to different plant hormones, indicating that MdSBP genes may be involved in responses to hormone signaling during stress or in apple development. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

Possibilities of the chemical analysis of Scots pine (Pinus sylvestris) needles

International Nuclear Information System (INIS)

Viksna, A.

1999-01-01

Scots pine (Pinus sylvestris L.) is a good bio indicator. This species is widely distributed in Europe, including Latvia, is easily identified, and is used in bio indication studies. It is known that the concentrations of most elements in needles change with time. These changes are connected to the processes involved in the uptake, transportation, storage and retranslocation of the elements. Scots pine keeps their needles for several years (3 to 4 years) and are suitable for the study of time related processes. The chemical composition of pine needles is used for the study the deposition and impact of air pollutants. Coniferous needles are covered with epicuticular wax, which act as a trap for airborne deposits. A comparison of chemical composition of pine needles that were unwashed and washed with chloroform made it possible to distinguish which elements were on the needles and to evaluate the character of pollution. The most important stage of the analysis of pine needles is sampling. Nutrient concentrations in the needles of coniferous trees have been shown to vary with the needle age and tree age, the phase of the annual physiological cycle, availability of nutrients in the soil and needle position within the crown. It is very important to take representative sample for the analysis. In the current work the trace element concentrations of the single needle were analysed by electrothermal atomic absorption spectrometry (ETAAS) and total reflection X-ray spectrometry (TXRF). The results of analysis showed that concentration of some elements depends from the position of needle within branch for the same needle age class. The concentrations of trace elements in the single needles within main shoot were more or less constant compare with other order shoots at given needle age class. Some higher variations in the elemental concentrations between single needles were observed in the tip part of main shoot. The actual distribution of the elements within a needle has

Soil and Root Respiration Under Elevated CO2 Concentrations During Seedling Growth of Pinus sylvestris var. sylvestriformis

Institute of Scientific and Technical Information of China (English)

无

2007-01-01

The objectives of this study were to investigate the effect of higher CO2 concentrations (500 and 700 μmol mol-1) in atmosphere on total soil respiration and the contribution of root respiration to total soil respiration during seedling growth of Pinus sylvestris var. sylvestriformis. During the four growing seasons (May-October) from 1999 to 2003, the seedlings were exposed to elevated concentrations of CO2 in open-top chambers. The total soil respiration and contribution of root respiration were measured using an LI-6400-09 soil CO2 flux chamber on June 15 and October 8, 2003. To separate root respiration from total soil respiration, three PVC cylinders were inserted approximately 30 cm deep into the soil in each chamber. There were marked diurnal changes in air and soil temperatures on June 15. Both the total soil respiration and the soil respiration without roots showed a strong diurnal pattern, increasing from before sunrise to about 14:00in the afternoon and then decreasing before the next sunrise. No increase in the mean total soil respiration and mean soil respiration with roots severed was observed under the elevated CO2 treatments on June 15, 2003, as compared to the open field and control chamber with ambient CO2. However, on October 8, 2003, the total soil respiration and soil respiration with roots severed in the open field were lower than those in the control and elevated CO2 chambers. The mean contribution of root respiration measured on June 15, 2003, ranged from 8.3% to 30.5% and on October 8, 2003,from 20.6% to 48.6%.

Changes in the essential oil composition in the needles of Scots pine (Pinus sylvestris L.) under anthropogenic stress.

Science.gov (United States)

Judzentiene, Asta; Stikliene, Aida; Kupcinskiene, Eugenija

2007-03-21

Unfavorable anthropogenic factors, such as air pollution, lead to biochemical responses in trees. Changes in the amounts of secondary metabolites may be early indicators of invisible injuries. The aim of this study was to evaluate composition of the essential oils in the needles of Scots pine (Pinus sylvestris L.) growing in the areas affected by pollutant emissions of main factories in Lithuania: a nitrogen fertilizer factory (NFF), a cement factory (CF), and an oil refinery (OR). Totally, 14 pine stands were examined along transects from the factories (July 2005). Volatile components of the needles were extracted and analyzed by GC and GC/MS. Over 70 components of the essential oils were identified in current-year and 1-year-old needles. Along the CF transect for current-year needles, the percentage of diterpenes was decreasing with the increasing pH of the pine bark (r = -0.582; p essential oils in the needles allowed us to distinguish the most contrasting stands according to the concentration of air pollutants. Current-year needles were more effective as indicators of the effects of pollution than 1-year-old needles in the case of the NFF and the OR transects, and both-aged needles were equally valuable in the case of the CF transect. The changes detected in the proportions of components of the essential oils in the needles of the trees affected by the industrial emissions may play a significant role in modifying the susceptibility of the pine stands to the biotic factors, and also may alter emissions of terpenes from the stands to the atmosphere.

Sodium-hydrogen exchanger inhibitory potential of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale.

Science.gov (United States)

Verma, Vivek; Singh, Nirmal; Jaggi, Amteshwar Singh

2014-02-01

The involvement of sodium-hydrogen exchangers (NHE) has been described in the pathophysiology of diseases including ischemic heart and brain diseases, cardiomyopathy, congestive heart failure, epilepsy, dementia, and neuropathic pain. Synthetic NHE inhibitors have not achieved much clinical success; therefore, plant-derived phytoconstituents may be explored as NHE inhibitors. In the present study, the NHE inhibitory potential of hydroalcoholic and alkaloidal fractions of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale was evaluated. The different concentrations of hydroalcoholic and alkaloidal extracts of the selected plants were evaluated for their NHE inhibitory activity in the platelets using the optical swelling assay. Among the hydroalcoholic extracts, the highest NHE inhibitory activity was shown by M. domestica (IC50=2.350 ± 0.132 μg/mL) followed by Musa × paradisiaca (IC50=7.967 ± 0.451 μg/mL), D. carota (IC50=37.667 ± 2.517 μg/mL), and S. officinale (IC50=249.330 ± 1.155 μg/mL). Among the alkaloidal fractions, the highest NHE inhibitory activity was shown by the alkaloidal fraction of Musa × paradisiacal (IC50=0.010 ± 0.001 μg/mL) followed by D. carota (IC50=0.024 ± 0.002 μg/mL), M. domestica (IC50=0.031 ± 0.005 μg/mL), and S. officinale (IC50=4.233 ± 0.379 μg/mL). The IC50 of alkaloidal fractions was comparable to the IC50 of synthetic NHE inhibitor, EIPA [5-(N-ethyl-N-isopropyl)amiloride] (IC50=0.033 ± 0.004 μg/mL). It may be concluded that the alkaloidal fractions of these plants possess potent NHE inhibitory activity and may be exploited for their therapeutic potential in NHE activation-related pathological complications.

Shoot bending promotes flower bud formation by miRNA-mediated regulation in apple (Malus domestica Borkh.).

Science.gov (United States)

Xing, Libo; Zhang, Dong; Zhao, Caiping; Li, Youmei; Ma, Juanjuan; An, Na; Han, Mingyu

2016-02-01

Flower induction in apple (Malus domestica Borkh.) trees plays an important life cycle role, but young trees produce fewer and inferior quality flower buds. Therefore, shoot bending has become an important cultural practice, significantly promoting the capacity to develop more flower buds during the growing seasons. Additionally, microRNAs (miRNAs) play essential roles in plant growth, flower induction and stress responses. In this study, we identified miRNAs potentially involved in the regulation of bud growth, and flower induction and development, as well as in the response to shoot bending. Of the 195 miRNAs identified, 137 were novel miRNAs. The miRNA expression profiles revealed that the expression levels of 68 and 27 known miRNAs were down-regulated and up-regulated, respectively, in response to shoot bending, and that the 31 differentially expressed novel miRNAs between them formed five major clusters. Additionally, a complex regulatory network associated with auxin, cytokinin, abscisic acid (ABA) and gibberellic acid (GA) plays important roles in cell division, bud growth and flower induction, in which related miRNAs and targets mediated regulation. Among them, miR396, 160, 393, and their targets associated with AUX, miR159, 319, 164, and their targets associated with ABA and GA, and flowering-related miRNAs and genes, regulate bud growth and flower bud formation in response to shoot bending. Meanwhile, the flowering genes had significantly higher expression levels during shoot bending, suggesting that they are involved in this regulatory process. This study provides a framework for the future analysis of miRNAs associated with multiple hormones and their roles in the regulation of bud growth, and flower induction and formation in response to shoot bending in apple trees. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Involvement of plasma membrane peroxidases and oxylipin pathway in the recovery from phytoplasma disease in apple (Malus domestica).

Science.gov (United States)

Patui, Sonia; Bertolini, Alberto; Clincon, Luisa; Ermacora, Paolo; Braidot, Enrico; Vianello, Angelo; Zancani, Marco

2013-06-01

Apple trees (Malus domestica Borkh.) may be affected by apple proliferation (AP), caused by 'Candidatus Phytoplasma mali'. Some plants can spontaneously recover from the disease, which implies the disappearance of symptoms through a phenomenon known as recovery. In this article it is shown that NAD(P)H peroxidases of leaf plasma membrane-enriched fractions exhibited a higher activity in samples from both AP-diseased and recovered plants. In addition, an increase in endogenous SA was characteristic of the symptomatic plants, since its content increased in samples obtained from diseased apple trees. In agreement, phenylalanine ammonia lyase (PAL) activity, a key enzyme of the phenylpropanoid pathway, was increased too. Jasmonic acid (JA) increased only during recovery, in a phase subsequent to the pathological state, and in concomitance to a decline of salicylic acid (SA). Oxylipin pathway, responsible for JA synthesis, was not induced during the development of AP-disease, but it appeared to be stimulated when the recovery occurred. Accordingly, lipoxygenase (LOX) activity, detected in plasma membrane-enriched fractions, showed an increase in apple leaves obtained from recovered plants. This enhancement was paralleled by an increase of hydroperoxide lyase (HPL) activity, detected in leaf microsomes, albeit the latter enzyme was activated in either the disease or recovery conditions. Hence, a reciprocal antagonism between SA- and JA-pathways could be suggested as an effective mechanism by which apple plants react to phytoplasma invasions, thereby providing a suitable defense response leading to the establishment of the recovery phenomenon. Copyright © Physiologia Plantarum 2012.

Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development

Science.gov (United States)

Schaeffer, Scott M.; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie

2017-01-01

Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids—chromoplasts—are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant ‘Granny Smith’, carotenoid-predominant ‘Golden Delicious’, and anthocyanin-predominant ‘Top Red Delicious’. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex biochemistry of plastids in perennial non-model systems. PMID:28698906

Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica fruit

Directory of Open Access Journals (Sweden)

Atkinson Ross G

2012-08-01

Full Text Available Abstract Background While there is now a significant body of research correlating apple (Malus x domestica fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1, there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in ‘Royal Gala’ apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. Results PG1-suppressed ‘Royal Gala’ apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. Conclusions These findings confirm PG1’s role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

Influence of inorganic and organic amendments in the soil properties and the growth and survival of Olea Europaea var. Sylvestris in the semiarid Mediterranean area

Science.gov (United States)

Ortega, Raúl; Miralles, Isabel; Anguita-Maeso, Manuel; Domene, Miguel; Soriano, Miguel

2017-04-01

Selecting the most appropriate types of plants adapted to the harsh climatic conditions of restoring drylands is essential to success in landscape restoration. Besides improving soil quality is a key factor to consider when designing the restoration procedures. The use of organic and inorganic amendments can help with this task. On this study, we evaluated the influence of different mineral (clays) and organic (compost and poultry) amendments on the properties of a bare soil and how this influenced on the growth and survival of the Olea europaea var. sylvestrys, a perennial bush plant adapted to the Mediterranean semi-arid zone. Tests were designed and carried out in a greenhouse at the "Experimental Station of Cajamar foundation "Las Palmerillas" in El Ejido (Almería, Spain). Plants were grown in 250L pots and their substrate was bare soil and mineral and/or organic amendments. The experimental design consisted of three replicas for five treatments: 1. compost, 2. "ZeoPro", a cliptonolite commercial clay, 3. mordenite clay from local quarries plus compost, 4. cliptonolite clay from Turkey plus compost, 5. cliptonolite from Turquey plus poultry; with four levels each one: 5%, 10%, 20%, 30% volume of amendment. Including three control samples without amendment total plants accounted for 63. Climatic sensors inside and outside the greenhouse permitted to establish the same meteorological conditions for the plants and only emergency watering was supplied when necessary for the survival of the plants when arid conditions were extreme. The physico-chemical soil properties of each treatment and level were analyzed before planting and the biovolume and the survival rates of the plants were measured regularly along eleven months. Statistically the best treatment for the growing of the plants was number 3 (mordenite and compost) with no deaths recorded. According to the growing rates the best level was soil with 20% of amendment. Besides we analyzed the evolution of the

Methionine metabolism in apple tissue: implications of S-adenosylmethionine as an intermediate in the conversion of methionine to ethylene

International Nuclear Information System (INIS)

Adams, D.O.; Yang, S.F.

1977-01-01

If S-adenosylmethionine (SAM) is the direct precursor of ethylene as previously proposed, it is expected that 5'-S-methyl-5'-thioadenosine (MTA) would be the fragment nucleoside. When [Me- 14 C] or ( 35 S)methionine was fed to climacteric apple (Malus sylvestris Mill) tissue, radioactive 5-S-methyl-5-thioribose (MTR) was identified as the predominant product and MTA as a minor one. When the conversion of methionine into ethylene was inhibited by L-2-amino-4-(2'-amino-ethoxy)-trans-3-butenoic acid, the conversion of ( 35 S) or (Me- 14 C)methionine into MTR was similarly inhibited. Furthermore, the formation of MTA and MTR from ( 35 S)methionine was observed only in climacteric tissue which produced ethylene and actively converted methionine to ethylene but not in preclimacteric tissue which did not produce ethylene or convert methionine to ethylene. These observations suggest that the conversion of methionine into MTA and MTR is closely related to ethylene biosynthesis and provide indirect evidence that SAM may be an intermediate in the conversion of methionine to ethylene. When ( 35 S)MTA was fed to climacteric or preclimacteric apple tissue, radioactivity was efficiently incorporated into MTR and methionine. However, when ( 35 S)MTR was administered, radioactivity was efficiently incorporated into methionine but not MTA. A scheme is presented for the production of ethylene from methionine

Phytohormone Interaction Modulating Fruit Responses to Photooxidative and Heat Stress on Apple (Malus domestica Borkh.

Directory of Open Access Journals (Sweden)

Carolina A. Torres

2017-12-01

Full Text Available Sun-related physiological disorders such as sun damage on apples (Malus domestica Borkh are caused by cumulative photooxidative and heat stress during their growing season triggering morphological, physiological, and biochemical changes in fruit tissues not only while it is on the tree but also after it has been harvested. The objective of the work was to establish the interaction of auxin (indole-3-acetic acid; IAA, abscisic acid (ABA, jasmonic acid (JA, salicylic acid (SA, and ethylene (ET and its precursor ACC (free and conjugated, MACC during development of sun-injury-related disorders pre- and post-harvest on apples. Peel tissue was extracted from fruit growing under different sun exposures (Non-exposed, NE; Exposed, EX and with sun injury symptoms (Moderate, Mod. Sampling was carried out every 15 days from 75 days after full bloom (DAFB until 120 days post-harvest in cold storage (1°C, > 90%RH. Concentrations of IAA, ABA, JA, SA, were determined using UHPLC mass spectrometry, and ET and ACC (free and conjugated MACC using gas chromatography. IAA was found not to be related directly to sun injury development, but it decreased 60% in sun exposed tissue, and during fruit development. ABA, JA, SA, and ethylene concentrations were significantly higher (P ≤ 0.05 in Mod tissue, but their concentration, except for ethylene, were not affected by sun exposure. ACC and MACC concentrations increased until 105 DAFB in all sun exposure categories. During post-harvest, ethylene climacteric peak was delayed on EX compared to Mod. ABA and SA concentrations remained stable throughout storage in both tissue. JA dramatically increased post-harvest in both EX and Mod tissue, and orchards, confirming its role in low temperature tolerance. The results suggest that ABA, JA, and SA together with ethylene are modulating some of the abiotic stress defense responses on sun-exposed fruit during photooxidative and heat stress on the tree.

Variability of morphological needle traits of Scots pine (Pinus sylvestris L. among populations from mountain and lowland regions of Poland

Directory of Open Access Journals (Sweden)

Łabiszak Bartosz

2017-06-01

Full Text Available The main goal of this work was to examine interpopulational needle traits variability of Scots pine (Pinus sylvestris L. from four mountain, one foothill and three lowland, natural populations located in Poland. This choice of locations was motivated by the presumed different origins of mountainous populations and the necessity to demonstrate how closely they are related to lowland populations. Variation in the studied populations was determined using seven morphological traits of needles: 1 - needle length, 2 - number of stomatal rows on the flat side of a needle, 3 - number of stomata per 2 mm of needle length on the flat side, 4 - number of stomatal rows on the convex side of a needle, 5 - number of stomata per 2 mm of needle length on the convex side, 6 - number of serrations per 2 mm of the needle length on the left side and 7 - number of serrations per 2 mm of the needle length on the right side. Biometric data were analysed statistically, and it was found that (i needle traits differentiate studied populations; (ii the postulated division of the population into two groups is reflected in the obtained results; and (iii a particularly strong relationship was found between two relict pine populations from the Pieniny (Sokolica, Kazalnica, Czertezik and Tatra Mts. (Wielke Koryciska, which may be the result of the common origins and history of these two populations

The distribution and impact of common copy-number variation in the genome of the domesticated apple, Malus x domestica Borkh.

Science.gov (United States)

Boocock, James; Chagné, David; Merriman, Tony R; Black, Michael A

2015-10-23

Copy number variation (CNV) is a common feature of eukaryotic genomes, and a growing body of evidence suggests that genes affected by CNV are enriched in processes that are associated with environmental responses. Here we use next generation sequence (NGS) data to detect copy-number variable regions (CNVRs) within the Malus x domestica genome, as well as to examine their distribution and impact. CNVRs were detected using NGS data derived from 30 accessions of M. x domestica analyzed using the read-depth method, as implemented in the CNVrd2 software. To improve the reliability of our results, we developed a quality control and analysis procedure that involved checking for organelle DNA, not repeat masking, and the determination of CNVR identity using a permutation testing procedure. Overall, we identified 876 CNVRs, which spanned 3.5 % of the apple genome. To verify that detected CNVRs were not artifacts, we analyzed the B- allele-frequencies (BAF) within a single nucleotide polymorphism (SNP) array dataset derived from a screening of 185 individual apple accessions and found the CNVRs were enriched for SNPs having aberrant BAFs (P apple scab. We present the first analysis and catalogue of CNVRs in the M. x domestica genome. The enrichment of the CNVRs with R gene models and their overlap with gene loci of agricultural significance draw attention to a form of unexplored genetic variation in apple. This research will underpin further investigation of the role that CNV plays within the apple genome.

Growth decline assessment in Pinus sylvestris L. and Pinus nigra Arnold. forest by using 3-PG model

Energy Technology Data Exchange (ETDEWEB)

Navarro-Cerrillo, R.M.; Beira, J.; Suarez, J.; Xenakis, G.; Sánchez-Salguero, R.; Hernández-Clemente, R.

2016-07-01

Aim of the study: We assessed the ability of the 3-PG process-based model to accurately predict growth of Pinus sylvestris and P. nigra plantations across a range of sites, showing declining growth trends, in southern Spain. Area of study: The study area is located in “Sierra de Los Filabres” (Almería). Material and methods: The model was modified in fifteen parameters to predict diameter (DBH, cm), basal area increment (BAI, cm2 yr-1) and leaf area index (LAI, m2 m-2) in healthy trees and trees showing declining growth. We assumed that a set of specific physiological parameters (stem partitioning ratio-pFS20, maximum litterfall rate-γFx, maximum canopy conductance-gCx, specific leaf area for mature aged stands-σ1, age at which specific leaf area = ½ (σ0 + σ1), age at full canopy cover-tc, and canopy boundary layer conductance-gB) included in 3-PG would be suitable for predicting growth decline related to climate conditions. The calibrated model was evaluated using dendrochronological and LAI data obtained from plots. Main results: Observed and simulated DBH showed a high correlation (R2 > 0.99) between modelled and measured values for both species. In contrast, modelled and observed BAI showed lower correlation (R2 < 0.68). Sensitivity analysis on 3-PG outputs showed that the foliage parameters - maximum litterfall rate, maximum canopy conductance, specific leaf area for mature aged stands, age at which specific leaf area, and age at full canopy cover - were important for DBH and BAI predictions under drought stress. Research highlights: Our overall results indicated that the 3-PG model could predict growth response of pine plantations to climatic stress with desirable accuracy in southern Spain by using readily available soil and climatic data with physiological parameters derived from experiments. (Author)

Temperature responses of photosynthetic capacity parameters were not affected by foliar nitrogen content in mature Pinus sylvestris.

Science.gov (United States)

Tarvainen, Lasse; Lutz, Martina; Räntfors, Mats; Näsholm, Torgny; Wallin, Göran

2018-03-01

A key weakness in current Earth System Models is the representation of thermal acclimation of photosynthesis in response to changes in growth temperatures. Previous studies in boreal and temperate ecosystems have shown leaf-scale photosynthetic capacity parameters, the maximum rates of carboxylation (V cmax ) and electron transport (J max ), to be positively correlated with foliar nitrogen (N) content at a given reference temperature. It is also known that V cmax and J max exhibit temperature optima that are affected by various environmental factors and, further, that N partitioning among the foliar photosynthetic pools is affected by N availability. However, despite the strong recent anthropogenic influence on atmospheric temperatures and N deposition to forests, little is known about the role of foliar N contents in controlling the photosynthetic temperature responses. In this study, we investigated the temperature dependencies of V cmax and J max in 1-year-old needles of mature boreal Pinus sylvestris (Scots pine) trees growing under low and high N availabilities in northern Sweden. We found that needle N status did not significantly affect the temperature responses of V cmax or J max when the responses were fitted to a peaked function. If such N insensitivity is a common tree trait it will simplify the interpretation of the results from gradient and multi-species studies, which commonly use sites with differing N availabilities, on temperature acclimation of photosynthetic capacity. Moreover, it will simplify modeling efforts aimed at understanding future carbon uptake by precluding the need to adjust the shape of the temperature response curves to variation in N availability. © 2017 Scandinavian Plant Physiology Society.

Dormancy alleviation by NO or HCN leading to decline of protein carbonylation levels in apple (Malus domestica Borkh.) embryos.

Science.gov (United States)

Krasuska, Urszula; Ciacka, Katarzyna; Dębska, Karolina; Bogatek, Renata; Gniazdowska, Agnieszka

2014-08-15

Deep dormancy of apple (Malus domestica Borkh.) embryos can be overcome by short-term pre-treatment with nitric oxide (NO) or hydrogen cyanide (HCN). Dormancy alleviation of embryos modulated by NO or HCN and the first step of germination depend on temporary increased production of reactive oxygen species (ROS). Direct oxidative attack on some amino acid residues or secondary reactions via reactive carbohydrates and lipids can lead to the formation of protein carbonyl derivatives. Protein carbonylation is a widely accepted covalent and irreversible modification resulting in inhibition or alteration of enzyme/protein activities. It also increases the susceptibility of proteins to proteolytic degradation. The aim of this work was to investigate protein carbonylation in germinating apple embryos, the dormancy of which was removed by pre-treatment with NO or HCN donors. It was performed using a quantitative spectrophotometric method, while patterns of carbonylated protein in embryo axes were analyzed by immunochemical techniques. The highest concentration of protein carbonyl groups was observed in dormant embryos. It declined in germinating embryos pre-treated with NO or HCN, suggesting elevated degradation of modified proteins during seedling formation. A decrease in the concentration of carbonylated proteins was accompanied by modification in proteolytic activity in germinating apple embryos. A strict correlation between the level of protein carbonyl groups and cotyledon growth and greening was detected. Moreover, direct in vitro carbonylation of BSA treated with NO or HCN donors was analyzed, showing action of both signaling molecules as protein oxidation agents. Copyright © 2014 Elsevier GmbH. All rights reserved.

Apple (Malus domestica) MdERF2 negatively affects ethylene biosynthesis during fruit ripening by suppressing MdACS1 transcription.

Science.gov (United States)

Li, Tong; Jiang, Zhongyu; Zhang, Lichao; Tan, Dongmei; Wei, Yun; Yuan, Hui; Li, Tianlai; Wang, Aide

2016-12-01

Ripening in climacteric fruit requires the gaseous phytohormone ethylene. Although ethylene signaling has been well studied, knowledge of the transcriptional regulation of ethylene biosynthesis is still limited. Here we show that an apple (Malus domestica) ethylene response factor, MdERF2, negatively affects ethylene biosynthesis and fruit ripening by suppressing the transcription of MdACS1, a gene that is critical for biosynthesis of ripening-related ethylene. Expression of MdERF2 was suppressed by ethylene during ripening of apple fruit, and we observed that MdERF2 bound to the promoter of MdACS1 and directly suppressed its transcription. Moreover, MdERF2 suppressed the activity of the promoter of MdERF3, a transcription factor that we found to bind to the MdACS1 promoter, thereby increasing MdACS1 transcription. We determined that the MdERF2 and MdERF3 proteins directly interact, and this interaction suppresses the binding of MdERF3 to the MdACS1 promoter. Moreover, apple fruit with transiently downregulated MdERF2 expression showed higher ethylene production and faster ripening. Our results indicate that MdERF2 negatively affects ethylene biosynthesis and fruit ripening in apple by suppressing the transcription of MdACS1 via multiple mechanisms, thereby acting as an antagonist of positive ripening regulators. Our findings offer a deep understanding of the transcriptional regulation of ethylene biosynthesis during climacteric fruit ripening. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.

A PR-4 gene identified from Malus domestica is involved in the defense responses against Botryosphaeria dothidea.

Science.gov (United States)

Bai, Suhua; Dong, Chaohua; Li, Baohua; Dai, Hongyi

2013-01-01

Pathogenesis-related protein-4 (PR-4) family is a group of proteins with a Barwin domain in C-terminus and generally thought to be involved in plant defense responses. However, their detailed roles are poorly understood in defense of apple plant against pathogenic infection. In the present study, a new PR-4 gene (designated as MdPR-4) was identified from Malus domestica, and its roles in defense responses of apple were investigated. The open reading frame of MdPR-4 gene is of 447 bp encoding a protein of 148 amino acids with a Barwin domain in C-terminus and a signal peptide of 26 amino acids in N-terminus. Sequence and structural analysis indicated that MdPR-4 protein belongs to class II of PR-4 family. The high-level expression of MdPR-4 was observed in flowers and leaves as revealed by quantitative real time PCR. The temporal expression analysis demonstrated that MdPR-4 expression could be up-regulated by Botryosphaeria dothidea infection and salicylic acid (SA) or methyl jasmonate (MeJA) treatment, but suppressed by diethyldithiocarbamic acid (DIECA). In vitro assays, recombinant MdPR-4 protein exhibited ribonuclease activity specific for single strand RNA and significant inhibition to hyphal growth of three apple pathogenic fungi B. dothidea, Valsa ceratosperma and Glomerella cingulata. Moreover, the inhibition was reduced by the presence of 5'-ADP. Taken all together, the results indicate that MdPR-4 protein is involved in the defense responses of apple against pathogenic attack by directly inhibiting hyphal growth, and the inhibition is correlated with its ribonuclease activity, where as MdPR-4 expression is regulated by both SA and JA signaling pathway. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

Genome-wide identification and analysis of the aldehyde dehydrogenase (ALDH) gene superfamily in apple (Malus × domestica Borkh.).

Science.gov (United States)

Li, Xiaoqin; Guo, Rongrong; Li, Jun; Singer, Stacy D; Zhang, Yucheng; Yin, Xiangjing; Zheng, Yi; Fan, Chonghui; Wang, Xiping

2013-10-01

Aldehyde dehydrogenases (ALDHs) represent a protein superfamily encoding NAD(P)(+)-dependent enzymes that oxidize a wide range of endogenous and exogenous aliphatic and aromatic aldehydes. In plants, they are involved in many biological processes and play a role in the response to environmental stress. In this study, a total of 39 ALDH genes from ten families were identified in the apple (Malus × domestica Borkh.) genome. Synteny analysis of the apple ALDH (MdALDH) genes indicated that segmental and tandem duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of these gene families in apple. Moreover, synteny analysis between apple and Arabidopsis demonstrated that several MdALDH genes were found in the corresponding syntenic blocks of Arabidopsis, suggesting that these genes appeared before the divergence of lineages that led to apple and Arabidopsis. In addition, phylogenetic analysis, as well as comparisons of exon-intron and protein structures, provided further insight into both their evolutionary relationships and their putative functions. Tissue-specific expression analysis of the MdALDH genes demonstrated diverse spatiotemporal expression patterns, while their expression profiles under abiotic stress and various hormone treatments indicated that many MdALDH genes were responsive to high salinity and drought, as well as different plant hormones. This genome-wide identification, as well as characterization of evolutionary relationships and expression profiles, of the apple MdALDH genes will not only be useful for the further analysis of ALDH genes and their roles in stress response, but may also aid in the future improvement of apple stress tolerance. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

Effects of Reforestation and Site Preparation Methods on Early Growth and Survival of Scots Pine (Pinus sylvestris L. in South-Eastern Poland

Directory of Open Access Journals (Sweden)

Marta Aleksandrowicz-Trzcińska

2017-11-01

Full Text Available Successful tree regeneration is a key process in ensuring forest sustainability and one of the most crucial investments made in silviculture. This study compared the effects of three reforestation methods (planting, direct seeding, and natural regeneration and three mechanical site preparation methods (double mould-board forest plough (FP; active plough (AP; and forest mill (FM on biometric parameters, survival, and density of Scots pine (Pinus sylvestris L. seedlings in the first 4 years of growth in a clear-cut area in south-eastern Poland. Planted seedlings were higher, thicker in root collar, and had higher survival rates after the fourth growing season than trees from natural regeneration and direct seeding. Site preparation methods did not affect the density of planted seedlings. After natural regeneration and direct seeding, seedling density was lower and less homogeneous (plots with no seedlings in FM soil preparation in comparison to other methods. The survival of pines in all reforestation methods was not affected significantly by site preparation methods. Our results indicate that the best mechanical site preparation method for planting is FM, as this is the one that least disturbs the soil environment. For direct seeding the best results were achieved after AP preparation. Natural regeneration of Scots pine was most effective after FP use, and in relatively wet years also after AP use.

Seasonal dynamics of mobile carbohydrates and stem growth in Scots pine (Pinus sylvestris) exposed to drought

Science.gov (United States)

Oberhuber, Walter; Kofler, Werner; Schuster, Roman; Swidrak, Irene; Gruber, Andreas

2014-05-01

Tree growth requires a continuous supply of carbon as structural material and as a source for metabolic energy. To detect whether intra-annual stem growth is related to changes in carbon allocation, we monitored seasonal dynamics of shoot and radial growth and concentrations of mobile carbohydrates (NSC) in above- and belowground organs of Scots pine (Pinus sylvestris L.). The study area is situated within an inner Alpine dry environment (750 m asl, Tyrol, Austria), which is characterized by recurring drought periods at the start of the growing season in spring and limited water holding capacity of nutrient deficient, shallow stony soils. Shoot elongation was monitored on lateral branches in the canopy and stem radius changes were continuously followed by electronic band dendrometers. Daily radial stem growth and tree water deficit (ΔW) were extracted from dendrometer records. ΔW is regarded a reliable measure of drought stress in trees and develops when transpirational water loss from leaves exceeds water uptake by the root system. Daily radial stem growth and ΔW were related to environmental variables and determination of NSC was performed using specific enzymatic assays. Results revealed quite early culmination of aboveground growth rates in late April (shoot growth) and late May (radial growth), and increasing accumulation of NSC in coarse roots in June. NSC content in roots peaked at the end of July and thereafter decreased again, indicating a shift in carbon allocation after an early cessation of aboveground stem growth. ΔW was found to peak in late summer, when high temperatures prevailed. That maximum growth rates of aboveground organs peaked quite before precipitation increased during summer is related to the finding that ΔW and radial stem growth were more strongly controlled by the atmospheric environment, than by soil water content. We conclude that as a response to the seasonal development of ΔW a shift in carbon allocation from aboveground

Contamination of environment in the road surroudings - impact of road salting on Norway spruce (Picea abies) and Scots pine (Pinus sylvestris)

Science.gov (United States)

Hegrová, Jitka; Steiner, Oliver; Goessler, Walter; Tanda, Stefan; Anděl, Petr

2017-09-01

A comprehensive overview of the influence of transport on the environment is presented in this study. The complex analysis of soil and needle samples provides an extensive set of data, which presents elemental contamination of the environment near roads. Traffic pollution (including winter road treatment) has a significant negative influence on our environment. Besides sodium and chlorine from winter maintenance many other elements are emitted into the environment. Three possible sources of contamination are assumed for environmental contamination evaluation: car emission, winter maintenance and abrasion from breaks and clutches. The chemical analysis focused on the description of samples from inorganic point of view. The influence of the contamination potential on the sodium and chlorine content in the samples of 1st year-old and 2nd year-old needles of Norway spruce (Picea abies) and Scots pine (Pinus sylvestris) is discussed. Additional soil samples were taken from each sampling site and analyzed to get insight in the sodium and chlorine distribution. Statistical evaluation was used for interpretation of complex interaction patterns between element concentrations in different aged needles based on localities character including distance from the road and element concentration in soils. This species of needles were chosen because of its heightened sensitivity towards salinization. The study was conducted in different parts of the Czech Republic. The resulting database is a source of valuable information about the influence of transport on the environment.

Response of apple (malus domestica borkh.) cultivars grafted on two rootstocks under sub-humid temperate climate of azad jammu and kashmir

International Nuclear Information System (INIS)

Ahmed, M.J.; Gillani, G.M.; Kiani, F.A.

2013-01-01

Nine apple (Malus domestica Borkh.) cultivars grafted on two rootstocks were assessed on morphological and biochemical basis under sub-humid temperate region of Azad Jammu and Kashmir. Starking Delicious, Kala Kulu, Fuji, Red Chief, Royal Gala, Red Labnani, Red Delicious, Star Crimson and Sky Spur grafted on local Crab apple and MM.111 were studied for various growth characteristics. Red Chief exhibited maximum (415.8 cm) plant height on crab apple whereas, more flower (1866) tree-1, higher number (967.0) of fruit set tree/sup -1/, fruits matured (490.0) tree/sup -1/ and maximum (46.33 kg) weight of fruits tree/sup -1/ were recorded on MM.111. Minimum duration (5 days) of flowering was presented by Sky Spur on local crab apple while minimum (92.0) days for fruit maturation were required by Royal Gala on MM.111. Maximum (112.5 g) fruit weight, total soluble solids (13.95%), total sugars (10.9 %) and reducing sugars (7.94%) were recorded for Starking Delicious on MM.111. On the other hand more pH (3.51) and ascorbic acid (9.2 %) content were recorded for Kala Kulu on crab apple. Red Chief found to be high yielding cultivar on MM.111 than crab apple while total sugars, TSS and average fruit weight were better for Starking Delicious. It was concluded that performance of apple cultivars were variable on both rootstocks. However, MM.111 proved better than local crab apple under prevailing conditions. (author)

Effect of long-term drought on carbon allocation and nitrogen uptake of Pinus sylvestris seedlings

Science.gov (United States)

Pumpanen, Jukka; Aaltonen, Heidi; Lindén, Aki; Köster, Kajar; Biasi, Christina; Heinonsalo, Jussi

2015-04-01

Weather extremes such as drought events are expected to increase in the future as a result of climate change. The drought affects the allocation of carbon assimilated by plants e.g. by modifying the root to shoot ratio, amount of fine roots and the amount of mycorrhizal fungal hyphae. We studied the effect of long term drought on the allocation of carbon in a common garden experiment with 4-year-old Pinus sylvestris seedlings. Half of the seedlings were exposed to long-term drought by setting the soil water content close to wilting point for over two growing seasons whereas the other half was grown in soil close to field capacity. We conducted a pulse labelling with 13CO2 in the end of the study by injecting a known amount of 13C enriched CO2 to the seedlings and measuring the CO2 uptake and distribution of 13C to the biomass of the seedlings and to the root and rhizosphere respiration. In addition, we studied the effect of drought on the decomposition of needle litter and uptake of nitrogen by 15N labelled needles buried in the soil in litter bags. The litterbags were collected and harvested in the end of the experiment and the changes in microbial community in the litterbags were studied from the phospholipid fatty acid (PLFA) composition. We also determined the 15N isotope concentrations from the needles of the seedlings to study the effect of drought on the nitrogen uptake of the seedlings. Our results indicate that the drought had a significant effect both on the biomass allocation of the seedlings and on the microbial species composition. The amount of carbon allocated belowground was much higher in the seedlings exposed to drought compared to the control seedlings. The seedlings seemed to adapt their carbon allocation to long-term drought to sustain adequate needle biomass and water uptake. The seedlings also adapted their osmotic potential and photosynthesis capacity to sustain the long-term drought as was indicated by the measurements of osmotic potential

Development of FT-NIR Models for the Simultaneous Estimation of Chlorophyll and Nitrogen Content in Fresh Apple (Malus Domestica Leaves

Directory of Open Access Journals (Sweden)

Elena Tamburini

2015-01-01

Full Text Available Agricultural practices determine the level of food production and, to great extent, the state of the global environment. During the last decades, the indiscriminate recourse to fertilizers as well as the nitrogen losses from land application have been recognized as serious issues of modern agriculture, globally contributing to nitrate pollution. The development of a reliable Near-Infra-Red Spectroscopy (NIRS-based method, for the simultaneous monitoring of nitrogen and chlorophyll in fresh apple (Malus domestica leaves, was investigated on a set of 133 samples, with the aim of estimating the nutritional and physiological status of trees, in real time, cheaply and non-destructively. By means of a FT (Fourier Transform-NIR instrument, Partial Least Squares (PLS regression models were developed, spanning a concentration range of 0.577%–0.817% for the total Kjeldahl nitrogen (TKN content (R2 = 0.983; SEC = 0.012; SEP = 0.028, and of 1.534–2.372 mg/g for the total chlorophyll content (R2 = 0.941; SEC = 0.132; SEP = 0.162. Chlorophyll-a and chlorophyll-b contents were also evaluated (R2 = 0.913; SEC = 0.076; SEP = 0.101 and R2 = 0.899; SEC = 0.059; SEP = 0.101, respectively. All calibration models were validated by means of 47 independent samples. The NIR approach allows a rapid evaluation of the nitrogen and chlorophyll contents, and may represent a useful tool for determining nutritional and physiological status of plants, in order to allow a correction of nutrition programs during the season.

Chilling-related cell damage of apple (Malus × domestica Borkh.) fruit cortical tissue impacts antioxidant, lipid and phenolic metabolism.

Science.gov (United States)

Leisso, Rachel S; Buchanan, David A; Lee, Jinwook; Mattheis, James P; Sater, Chris; Hanrahan, Ines; Watkins, Christopher B; Gapper, Nigel; Johnston, Jason W; Schaffer, Robert J; Hertog, Maarten L A T M; Nicolaï, Bart M; Rudell, David R

2015-02-01

'Soggy breakdown' (SB) is an internal flesh disorder of 'Honeycrisp' apple (Malus × domestica Borkh.) fruit that occurs during low temperature storage. The disorder is a chilling injury (CI) in which visible symptoms typically appear after several weeks of storage, but information about the underlying metabolism associated with its induction and development is lacking. The metabolic profile of flesh tissue from wholly healthy fruit and brown and healthy tissues from fruit with SB was characterized using gas chromatography-mass spectrometry (GC-MS) and liquid chromatograph-mass spectrometry (LC-MS). Partial least squares discriminant analysis (PLS-DA) and correlation networks revealed correlation among ester volatile compounds by composition and differences in phytosterol, phenolic and putative triacylglycerides (TAGs) metabolism among the tissues. anova-simultaneous component analysis (ASCA) was used to test the significance of metabolic changes linked with tissue health status. ASCA-significant components included antioxidant compounds, TAGs, and phytosterol conjugates. Relative to entirely healthy tissues, elevated metabolite levels in symptomatic tissue included γ-amino butyric acid, glycerol, sitosteryl (6'-O-palmitoyl) β-d-glucoside and sitosteryl (6'-O-stearate) β-d-glucoside, and TAGs containing combinations of 16:0, 18:3, 18:2 and 18:1 fatty acids. Reduced metabolite levels in SB tissue included 5-caffeoyl quinate, β-carotene, catechin, epicatechin, α-tocopherol, violaxanthin and sitosteryl β-d glucoside. Pathway analysis indicated aspects of primary metabolism differed according to tissue condition, although differences in metabolites involved were more subtle than those of some secondary metabolites. The results implicate oxidative stress and membrane disruption processes in SB development and constitute a diagnostic metabolic profile for the disorder. © 2014 Scandinavian Plant Physiology Society.

Molecular cloning and functional analysis of a blue light receptor gene MdCRY2 from apple (Malus domestica).

Science.gov (United States)

Li, Yuan-Yuan; Mao, Ke; Zhao, Cheng; Zhao, Xian-Yan; Zhang, Rui-Fen; Zhang, Hua-Lei; Shu, Huai-Rui; Hao, Yu-Jin

2013-04-01

MdCRY2 was isolated from apple fruit skin, and its function was analyzed in MdCRY2 transgenic Arabidopsis. The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A (UV-A) light receptors involved in regulating various aspects of plant growth and development. Investigations of the structure and functions of cryptochromes in plants have largely focused on Arabidopsis (Arabidopsis thaliana), tomato (Solanum lycopersicum), pea (Pisum sativum), and rice (Oryza sativa). However, no data on the function of CRY2 are available in woody plants. In this study, we isolated a cryptochrome gene, MdCRY2, from apple (Malus domestica). The deduced amino acid sequences of MdCRY2 contain the conserved N-terminal photolyase-related domain and the flavin adenine dinucleotide (FAD) binding domain, as well as the C-terminal DQXVP-acidic-STAES (DAS) domain. Relationship analysis indicates that MdCRY2 shows the highest similarity to the strawberry FvCRY protein. The expression of MdCRY2 is induced by blue/UV-A light, which represents a 48-h circadian rhythm. To investigate the function of MdCRY2, we overexpressed the MdCRY2 gene in a cry2 mutant and wild type (WT) Arabidopsis, assessed the phenotypes of the resulting transgenic plants, and found that MdCRY2 functions to regulate hypocotyl elongation, root growth, flower initiation, and anthocyanin accumulation. Furthermore, we examined the interaction between MdCRY2 and AtCOP1 using a yeast two-hybrid assay and a bimolecular fluorescence complementation assay. These data provide functional evidence for a role of blue/UV-A light-induced MdCRY2 in controlling photomorphogenesis in apple.

Liberação de componentes do extrato de Casearia sylvestris Swartz empregando membranas de látex natural como suporte

Directory of Open Access Journals (Sweden)

Alberto Trecco

2014-01-01

Full Text Available A membrana de látex natural (NRL – Natural Rubber Latex, manipulada a partir do látex extraído da seringueira Hevea brasiliensis, tem apresentado grande potencial de aplicação no campo da biomedicina e dos biomateriais. Graças a sua biocompatibilidade e baixa taxa de rejeição, ela tem sido utilizada para próteses e enxertos, atuando como estimulante da angiogênese, adesão celular e barreira física a agentes infecciosos. Além dessas aplicações, as membranas são utilizadas como matriz de sistemas de liberação para avaliar o comportamento da liberação de fármacos e extratos de origem vegetal que apresentam propriedades medicinais. O sistema extrato-membrana tem como objeto de estudo uma nova abordagem dessas substâncias no tratamento de feridas visando à cicatrização e regeneração do tecido envolvido. Casearia sylvestris, conhecida popularmente como guaçatonga, pertence à família Salicaceae, conhecida na medicina popular pelos seus efeitos antiulcerogênicos, cicatrizantes, antiofídicos, anti-inflamatórios e antissépticos, propriedades já comprovadas por estudos. Trabalhos recentes demonstraram que a liberação controlada de fármacos e extratos utilizando membranas de látex natural é uma alternativa interessante e promissora para aplicações biomédicas. Assim, o objetivo deste projeto foi estudar a liberação do extrato de Casearia sylvestris incorporado à membrana de látex em soluções com diferentes valores de pH, com o propósito de estudar seu comportamento e sua liberação de forma controlada. A taxa de liberação do extrato do sistema extrato-membrana foi monitorada e analisada utilizando-se o método de espectroscopia ótica (UV. O pH básico age desestabilizando a membrana indicando que o polímero possui a habilidade de proteger o extrato de ser liberado em valores de pH ácidos, direcionando sua aplicação para o sítio de melhor absorção. Além disso, a liberação segue uma função bi

T3SS-dependent differential modulations of the jasmonic acid pathway in susceptible and resistant genotypes of Malus spp. challenged with Erwinia amylovora.

Science.gov (United States)

Dugé De Bernonville, Thomas; Gaucher, Matthieu; Flors, Victor; Gaillard, Sylvain; Paulin, Jean-Pierre; Dat, James F; Brisset, Marie-Noëlle

2012-06-01

Fire blight is a bacterial disease of Maloideae caused by Erwinia amylovora (Ea). This necrogenic enterobacterium uses a type III secretion system (T3SS) to inject type III effectors into the plant cells to cause disease on its susceptible hosts, including economically important crops like apple and pear. The expressions of marker genes of the salicylic acid (SA) and jasmonic acid (JA) defense regulation pathways were monitored by RT-qPCR in leaves of two apple genotypes, one susceptible and one resistant, challenged with a wild type strain, a T3SS-deficient strain or water. The transcriptional data taken together with hormone level measurements indicated that the SA pathway was similarly induced in both apple genotypes during infection by Ea. On the contrary, the data clearly showed a strong T3SS-dependent down-regulation of the JA pathway in leaves of the susceptible genotype but not in those of the resistant one. Accordingly, methyl-jasmonate treated susceptible plants displayed an increased resistance to Ea. Bacterial mutant analysis indicated that JA manipulation by Ea mainly relies on the type III effector DspA/E. Taken together, our data suggest that the T3SS-dependent down-regulation of the JA pathway is a critical step in the infection process of Malus spp. by Ea. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Root-zone temperatures affect phenology of bud break, flower cluster development, shoot extension growth and gas exchange of 'Braeburn' (Malus domestica) apple trees.

Science.gov (United States)

Greer, Dennis H; Wünsche, Jens N; Norling, Cara L; Wiggins, Harry N

2006-01-01

We investigated the effects of root-zone temperature on bud break, flowering, shoot growth and gas exchange of potted mature apple (Malus domestica (Borkh.)) trees with undisturbed roots. Soil respiration was also determined. Potted 'Braeburn' apple trees on M.9 rootstock were grown for 70 days in a constant day/night temperature regime (25/18 degrees C) and one of three constant root-zone temperatures (7, 15 and 25 degrees C). Both the proportion and timing of bud break were significantly enhanced as root-zone temperature increased. Rate of floral cluster opening was also markedly increased with increasing root-zone temperature. Shoot length increased but shoot girth growth declined as root-zone temperatures increased. Soil respiration and leaf photosynthesis generally increased as root-zone temperatures increased. Results indicate that apple trees growing in regions where root zone temperatures are or = 15 degrees C. The effect of root-zone temperature on shoot performance may be mediated through the mobilization of root reserves, although the role of phytohormones cannot be discounted. Variation in leaf photosynthesis across the temperature treatments was inadequately explained by stomatal conductance. Given that root growth increases with increasing temperature, changes in sink activity induced by the root-zone temperature treatments provide a possible explanation for the non-stomatal effect on photosynthesis. Irrespective of underlying mechanisms, root-zone temperatures influence bud break and flowering in apple trees.

Differentiation of mycoplasmalike organisms (MLOs) in European fruit trees by PCR using specific primers derived from the sequence of a chromosomal fragment of the apple proliferation MLO.

Science.gov (United States)

Jarausch, W; Saillard, C; Dosba, F; Bové, J M

1994-01-01

A 1.8-kb chromosomal DNA fragment of the mycoplasmalike organism (MLO) associated with apple proliferation was sequenced. Three putative open reading frames were observed on this fragment. The protein encoded by open reading frame 2 shows significant homologies with bacterial nitroreductases. From the nucleotide sequence four primer pairs for PCR were chosen to specifically amplify DNA from MLOs associated with European diseases of fruit trees. Primer pairs specific for (i) Malus-affecting MLOs, (ii) Malus- and Prunus-affecting MLOs, and (iii) Malus-, Prunus-, and Pyrus-affecting MLOs were obtained. Restriction enzyme analysis of the amplification products revealed restriction fragment length polymorphisms between Malus-, Prunus, and Pyrus-affecting MLOs as well as between different isolates of the apple proliferation MLO. No amplification with either primer pair could be obtained with DNA from 12 different MLOs experimentally maintained in periwinkle. Images PMID:7916180

Polyphenolic Characterization and Antioxidant Activity of Malus domestica and Prunus domestica Cultivars from Costa Rica.

Science.gov (United States)

Navarro, Mirtha; Moreira, Ileana; Arnaez, Elizabeth; Quesada, Silvia; Azofeifa, Gabriela; Vargas, Felipe; Alvarado, Diego; Chen, Pei

2018-01-30

The phenolic composition of skin and flesh from Malus domestica apples (Anna cultivar) and Prunus domestica plums (satsuma cultivar) commercial cultivars in Costa Rica, was studied using Ultra Performance Liquid Chromatography coupled with High Resolution Mass Spectrometry (UPLC-DAD-ESI-MS) on enriched-phenolic extracts, with particular emphasis in proanthocyanidin and flavonoids characterization. A total of 52 compounds were identified, including 21 proanthocyanidins ([(+)-catechin and (-)-epicatechin]) flavan-3-ols monomers, five procyanidin B-type dimers and two procyanidin A-type dimers, five procyanidin B-type trimers and two procyanidin A-type trimers, as well as one procyanidin B-type tetramer, two procyanidin B-type pentamers, and two flavan-3-ol gallates); 15 flavonoids (kaempferol, quercetin and naringenin derivatives); nine phenolic acids (protochatechuic, caffeoylquinic, and hydroxycinnamic acid derivatives); five hydroxychalcones (phloretin and 3-hydroxyphloretin derivatives); and two isoprenoid glycosides (vomifoliol derivatives). These findings constitute the first report of such a high number and diversity of compounds in skins of one single plum cultivar and of the presence of proanthocyanidin pentamers in apple skins. Also, it is the first time that such a large number of glycosylated flavonoids and proanthocyanidins are reported in skins and flesh of a single plum cultivar. In addition, total phenolic content (TPC) was measured with high values observed for all samples, especially for fruits skins with a TPC of 619.6 and 640.3 mg gallic acid equivalents/g extract respectively for apple and plum. Antioxidant potential using 2,2-diphenyl-1-picrylhidrazyl (DPPH) and oxygen radical absorbance capacity (ORAC) methods were evaluated, with results showing also high values for all samples, especially again for fruit skins with IC 50 of 4.54 and 5.19 µg/mL (DPPH) and 16.8 and 14.6 mmol TE/g (ORAC) respectively for apple and plum, indicating the potential

Seasonal patterns of ascorbate in the needles of Scots Pine (Pinus sylvestris L.) trees: Correlation analyses with atmospheric O3 and NO2 gas mixing ratios and meteorological parameters

International Nuclear Information System (INIS)

Haberer, Kristine; Jaeger, Lutz; Rennenberg, Heinz

2006-01-01

In the present field study the role of ascorbate in scavenging the harmful atmospheric trace gases O 3 and NO 2 was examined. For this purpose ascorbate contents were determined in needles of adult Scots pine trees (Pinus sylvestris L.) during three consecutive years. Ascorbate contents were correlated with ambient tropospheric O 3 and NO 2 concentrations and with meteorological parameters. The results showed a strong correlation of atmospheric O 3 but not of atmospheric NO 2 concentrations with the apoplastic content of ascorbate during the seasonal course. Ascorbate contents in needle extracts did not correlate with ambient trace gas concentrations. In the apoplastic space, but not in needle extracts ascorbate contents correlate highly significantly with global radiation. From these results it is assumed that apoplastic ascorbate in Scots pine needles is adapted to the actual atmospheric O 3 concentration to mediate immediate detoxification of O 3 , while the atmospheric O 3 concentration itself is largely dependent on light intensity. - Contents of apoplastic but not symplastic ascorbate correlate significantly with atmospheric ozone concentrations

Diversidad genética de levaduras aisladas a partir de uvas de Vitis vinifera ssp. Sylvestris (Gmelin Hegi en el área Euroasiática

Directory of Open Access Journals (Sweden)

Cordero-Bueso Gustavo

2017-01-01

Full Text Available Vitis vinifera L. ssp. Sylvestris(Gmelin Hegi is recognized as the dioecious parental generation of today's cultivars. Climatic change and the arrival in Europe of pathogens and pests have led it to be included on the IUCN Red List of Threatened Species in 1997. At best of our knowledge, no studies on microbial populations of grape-berry surfaces have been done. The present work has been focused on the study of yeast occurrence and diversity on grape-berries collected from wild vines. Final outputs have allowed: ito obtain precise information about yeast communities; ii to provide an objective framework for the classification of the broadest range of species according to their extinction risk; iii to select attractive yeast strains for their biotechnological potential, offering new opportunities to winemakers. Sampling plan was performed in Azerbaijan, Georgia, Italy, Romania and Spain. In all, 3180 yeast colonies were isolated and identified as belonging to 50 species, including Saccharomyces cerevisiae, by 26S rDNA D1/D2 domains and ITS region sequencing. Isolates of S. cerevisiaewere also analysed by SSR-PCR obtaining 163 different genotypes. This study highlights the biodiversity potential of pristine environments that still represent a fascinating source to face common problems in winemaking.

Genome-wide identification of genes involved in polyamine biosynthesis and the role of exogenous polyamines in Malus hupehensis Rehd. under alkaline stress.

Science.gov (United States)

Gong, Xiaoqing; Dou, Fangfang; Cheng, Xi; Zhou, Jing; Zou, Yangjun; Ma, Fengwang

2018-08-30

Polyamines (PAs) in plants are growth substrates with functions similar to phytohormones. Although they contribute to diverse processes, little is known about their role in stress responses, especially for perennial woody plants. We conducted a genome-wide investigation of 18 sequences involved in PA biosynthesis in the genome of apple (Malus domestica). Further analysis was performed to construct a phylogenetic tree, analyze their protein motifs and gene structures. In addition, we developed their expression profiles in response to stressed conditions. Both MDP0000171041 (MdSAMDC1) and MDP0000198590 (MdSPDS1) were induced by alkaline, salt, ABA, cold, and dehydration stress treatments, suggesting that these genes are the main contributors to activities of S-adenosylmethionine decarboxylase (EC 4.1.1.50) and spermidine synthase (EC 2.5.1.16) in apple. Changes in PA biosynthesis under stress conditions indicated that spermidine and spermine are more essential than putrescine for apple, especially when responding to alkaline or salt stress. When seedlings of M. hupehensis Rehd. were supplied with exogenous PAs, their leaves showed less chlorosis under alkaline stress when compared with untreated plants. This application also inhibited the decline in SPAD levels and reduced relative electrolyte leakage in those stressed seedlings, while increasing their concentration of active iron. These results suggest that the alteration in PA biosynthesis confers enhanced tolerance to alkaline stress in M. hupehensis Rehd. Copyright © 2018. Published by Elsevier B.V.

Interactive effects of juvenile defoliation, light conditions, and interspecific competition on growth and ectomycorrhizal colonization of Fagus sylvatica and Pinus sylvestris seedlings.

Science.gov (United States)

Trocha, Lidia K; Weiser, Ewa; Robakowski, Piotr

2016-01-01

Seedlings of forest tree species are exposed to a number of abiotic (organ loss or damage, light shortage) and biotic (interspecific competition) stress factors, which may lead to an inhibition of growth and reproduction and, eventually, to plant death. Growth of the host and its mycorrhizal symbiont is often closely linked, and hence, host damage may negatively affect the symbiont. We designed a pot experiment to study the response of light-demanding Pinus sylvestris and shade-tolerant Fagus sylvatica seedlings to a set of abiotic and biotic stresses and subsequent effects on ectomycorrhizal (ECM) root tip colonization, seedling biomass, and leaf nitrogen content. The light regime had a more pronounced effect on ECM colonization than did juvenile damage. The interspecific competition resulted in higher ECM root tip abundance for Pinus, but this effect was insignificant in Fagus. Low light and interspecific competition resulted in lower seedling biomass compared to high light, and the effect of the latter was partially masked by high light. Leaf nitrogen responded differently in Fagus and Pinus when they grew in interspecific competition. Our results indicated that for both light-demanding (Pinus) and shade-tolerant (Fagus) species, the light environment was a major factor affecting seedling growth and ECM root tip abundance. The light conditions favorable for the growth of seedlings may to some extent compensate for the harmful effects of juvenile organ loss or damage and interspecific competition.

Growth decline assessment in Pinus sylvestris L. and Pinus nigra Arnold. forest by using 3-PG model.

Directory of Open Access Journals (Sweden)

Rafael M. Navarro-Cerrillo

2016-12-01

Full Text Available Aim of the study: We assessed the ability of the 3-PG process-based model to accurately predict growth of Pinus sylvestris and P. nigra plantations across a range of sites, showing declining growth trends, in southern Spain. Area of study: The study area is located in “Sierra de Los Filabres” (Almería. Material and methods: The model was modified in fifteen parameters to predict diameter (DBH, cm, basal area increment (BAI, cm2 yr-1 and leaf area index (LAI, m2 m-2 in healthy trees and trees showing declining growth. We assumed that a set of specific physiological parameters (stem partitioning ratio-pFS20, maximum litterfall rate-γFx, maximum canopy conductance-gCx, specific leaf area for mature aged stands-σ1, age at which specific leaf area = ½ (σ0 + σ1, age at full canopy cover-tc, and canopy boundary layer conductance-gB included in 3-PG would be suitable for predicting growth decline related to climate conditions. The calibrated model was evaluated using dendrochronological and LAI data obtained from plots. Main results: Observed and simulated DBH showed a high correlation (R2 > 0.99 between modelled and measured values for both species. In contrast, modelled and observed BAI showed lower correlation (R2 < 0.68. Sensitivity analysis on 3-PG outputs showed that the foliage parameters - maximum litterfall rate, maximum canopy conductance, specific leaf area for mature aged stands, age at which specific leaf area, and age at full canopy cover - were important for DBH and BAI predictions under drought stress. Research highlights: Our overall results indicated that the 3-PG model could predict growth response of pine plantations to climatic stress with desirable accuracy in southern Spain by using readily available soil and climatic data with physiological parameters derived from experiments. Keywords: Hybrid process model; forest management models; growth prediction; Pinus spp, Parameterization; forest decline.

The role of mesophyll conductance during water stress and recovery in tobacco (Nicotiana sylvestris): acclimation or limitation?

Science.gov (United States)

Galle, Alexander; Florez-Sarasa, Igor; Tomas, Magdalena; Pou, Alicia; Medrano, Hipolito; Ribas-Carbo, Miquel; Flexas, Jaume

2009-01-01

While the responses of photosynthesis to water stress have been widely studied, acclimation to sustained water stress and recovery after re-watering is poorly understood. In particular, the factors limiting photosynthesis under these conditions, and their possible interactions with other environmental conditions, are unknown. To assess these issues, changes of photosynthetic CO(2) assimilation (A(N)) and its underlying limitations were followed during prolonged water stress and subsequent re-watering in tobacco (Nicotiana sylvestris) plants growing under three different climatic conditions: outdoors in summer, outdoors in spring, and indoors in a growth chamber. In particular, the regulation of stomatal conductance (g(s)), mesophyll conductance to CO(2) (g(m)), leaf photochemistry (chlorophyll fluorescence), and biochemistry (V(c,max)) were assessed. Leaf gas exchange and chlorophyll fluorescence data revealed that water stress induced a similar degree of stomatal closure and decreased A(N) under all three conditions, while V(c,max) was unaffected. However, the behaviour of g(m) differed depending on the climatic conditions. In outdoor plants, g(m) strongly declined with water stress, but it recovered rapidly (1-2 d) after re-watering in spring while it remained low many days after re-watering in summer. In indoor plants, g(m) initially declined with water stress, but then recovered to control values during the acclimation period. These differences were reflected in different velocities of recovery of A(N) after re-watering, being the slowest in outdoor summer plants and the fastest in indoor plants. It is suggested that these differences among the experiments are related to the prevailing climatic conditions, i.e. to the fact that stress factors other than water stress have been superimposed (e.g. excessive light and elevated temperature). In conclusion, besides g(s), g(m) contributes greatly to the limitation of photosynthesis during water stress and during

Pollen-mediated gene flow and fine-scale spatial genetic structure in Olea europaea subsp. europaea var. sylvestris.

Science.gov (United States)

Beghè, D; Piotti, A; Satovic, Z; de la Rosa, R; Belaj, A

2017-03-01

Wild olive ( Olea europaea subsp. europaea var. sylvestris ) is important from an economic and ecological point of view. The effects of anthropogenic activities may lead to the genetic erosion of its genetic patrimony, which has high value for breeding programmes. In particular, the consequences of the introgression from cultivated stands are strongly dependent on the extent of gene flow and therefore this work aims at quantitatively describing contemporary gene flow patterns in wild olive natural populations. The studied wild population is located in an undisturbed forest, in southern Spain, considered one of the few extant hotspots of true oleaster diversity. A total of 225 potential father trees and seeds issued from five mother trees were genotyped by eight microsatellite markers. Levels of contemporary pollen flow, in terms of both pollen immigration rates and within-population dynamics, were measured through paternity analyses. Moreover, the extent of fine-scale spatial genetic structure (SGS) was studied to assess the relative importance of seed and pollen dispersal in shaping the spatial distribution of genetic variation. The results showed that the population under study is characterized by a high genetic diversity, a relatively high pollen immigration rate (0·57), an average within-population pollen dispersal of about 107 m and weak but significant SGS up to 40 m. The population is a mosaic of several intermingled genetic clusters that is likely to be generated by spatially restricted seed dispersal. Moreover, wild oleasters were found to be self-incompatible and preferential mating between some genotypes was revealed. Knowledge of the within-population genetic structure and gene flow dynamics will lead to identifying possible strategies aimed at limiting the effect of anthropogenic activities and improving breeding programmes for the conservation of olive tree forest genetic resources. © The Author 2016. Published by Oxford University Press on behalf

Static and kinetic friction coefficients of Scots pine (Pinus sylvestris L., parallel and perpendicular to grain direction

Directory of Open Access Journals (Sweden)

Aira, J. R.

2014-09-01

Full Text Available In this study the static (µe and kinetic (µd coefficients of friction were obtained for Pinus sylvestis L. sawn timber of Spanish origin. Friction between transverse surfaces sliding perpendicular to the grain (tangential direction and radial surfaces sliding parallel to the grain was analyzed. A specifically designed device was used for tests, which makes it possible to apply contact pressure and measure displacements and applied loads simultaneously. Coefficients of friction between transverse surfaces (µe = 0,24; µd = 0,17 were about twice of the coefficients of friction between radial surfaces (µe = 0,12; µd = 0,08. Furthermore, these values are located within normal values of those commonly reported for softwood. The results are considered preliminary due to the small number of specimens.En este estudio se determinaron los coeficientes de rozamiento, estático (µe y dinámico (µd, en madera aserrada de Pinus sylvestris L. de procedencia española, diferenciando si se produce el contacto entre secciones de corte transversal con deslizamiento en dirección perpendicular a la fibra (en dirección tangencial, o entre secciones de corte radial con deslizamiento paralelo a la fibra. Para la realización de los ensayos se ha utilizado un dispositivo, diseñado específicamente, que posibilita la aplicación de una presión de contacto y la medición del desplazamiento y de la fuerza aplicada de manera simultánea, permitiendo la obtención de los coeficientes de rozamiento estático y dinámico. Los coeficientes de rozamiento obtenidos entre secciones transversales (µe = 0.24; µd = 0.17 fueron del orden del doble de los coeficientes de rozamiento entre secciones radiales (µe = 0.12; µd = 0.08. Además, estos valores se encuentran dentro de los valores que aparecen habitualmente en la bibliografía para madera de coníferas. Debido al escaso tamaño de la muestra los resultados se consideran preliminares.

Transpiration of montane Pinus sylvestris L. and Quercus pubescens Willd. forest stands measured with sap flow sensors in NE Spain

Directory of Open Access Journals (Sweden)

R. Poyatos

2005-01-01

Full Text Available Stand transpiration was measured during the 2003 and 2004 growing seasons using heat dissipation sap flow sensors in a Scots pine (Pinus sylvestris L. and a pubescent oak (Quercus pubescens Willd. forests located in a montane area of the Eastern Pyrenees (NE Spain. The first aim of the study was to assess the differences in quantitative estimates of transpiration (Ec and the response to evaporative demand of the two stands. Over the studied period of 2003, characterised by a severe drought episode during the summer, the oak stand (Ec was only 110 mm compared to the 239 mm transpired by the Scots pine stand, although the ratio of transpiration to reference evapotranspiration (Ec/ET0 in the oak stand compares well with the expected values predicted for low leaf area index (LAI oak forests in southern Europe. Scots pine showed a strong reduction in (Ec/ET0 as the drought developed, whereas pubescent oak was less affected by soil moisture deficits in the upper soil. As a second objective, and given the contrasting meteorological conditions between 2003 and 2004 summer periods, the interannual variability of transpiration was studied in the Scots pine plot. Rainfall during the summer months (June-September in 2003 was almost 40% less than in the same interval in 2004. Accordingly, transpiration was also reduced about 25% in 2003. Finally, Scots pine data from 2003 and 2004 was used to calibrate a simple transpiration model using ET0 and soil moisture deficit (SMD as input variables, and implicitly including stomatal responses to high vapour pressure deficits (Dd and soil water status.

Pinus sylvestris L. needle surface wettability parameters as indicators of atmospheric environment pollution impacts: Novel contact angle hysteresis methodology

Science.gov (United States)

Pogorzelski, Stanisław J.; Rochowski, Pawel; Szurkowski, Janusz

2014-02-01

An investigation of water contact angles (CAs), contact angle hysteresis (CAH) was carried out for 1-year to 4-year old needles (Pinus sylvestris) collected in urban (Gdansk) and rural (Karsin) locations using an original measuring technique based on the geometry of the drop on a vertical filament. Concentrations of air pollutants (SO2, NOx, C6H6, and suspended particular matter - SPM) currently considered to be most important in causing direct damage to vegetation were simultaneously monitored. A set of the surface wettability parameters: the apparent surface free energy γSV, adhesive film tension Π, work of adhesion WA, and spreading WS, were determined from CAH data using the approach developed by Chibowski (2003) to quantify the surface energetics of the needle substrata affected by aging and pollution impacts. This formalism relates the total apparent surface free energy of the solid γSV with only three measurable quantities: the surface tension of the probe liquid γLV and its advancing θA and receding θR contact angle hysteresis. Since CAH depends on the outermost wax layer surface roughness and spatial physicochemical heterogeneity of a solid surface, CA data were corrected using surface architecture profiles registered with confocal scanning laser microscopy. It was found that the roughness parameter r is significantly negatively correlated (R = -0.74) with the needle age (collected at Karsin). The needle surface aging process resulted in its surface hydrophilization (CA↓ and CAH↓ with γSV↑ and WA↑). A temporal evolution of the needles wettability was traced with the data point distribution in the 2D space of CAH plotted versus WS. The wettability parameters were closely correlated to pollutant concentrations as evidenced from Spearman's rank correlation procedure (R = 0.63-0.91; p biological systems.

Promotion of flavonoid biosynthesis in leaves and calli of ornamental crabapple (Malus sp.) by high carbon to nitrogen ratios.

Science.gov (United States)

Wan, Huihua; Zhang, Jie; Song, Tingting; Tian, Ji; Yao, Yuncong

2015-01-01

Flavonoids are secondary metabolites that play important roles in plant physiology. Despite numerous studies examined the effects of available carbon (C) or nitrogen (N) on flavonoid biosynthesis, the mechanism of C/N interactive effects on flavonoid metabolism is still unclear. In this study, we analyzed the composition of flavonoids and the expression levels of flavonoid-related genes in leaves and calli of crabapple (Malus sp.) cultivars with different leaf colors grown on media with different C/N ratios. Our results show that high C/N ratios induce anthocyanin pigmentation in leaves of the ever-red cultivar 'Royalty' and the spring-red cultivar 'Prairifire,' as well as in three types of calli derived from the ever-green cultivar 'Spring Snow,' but not in the leaves of the ever-green cultivar 'Flame.' This phenomenon therefore correlated with anthocyanin content in these different samples. In addition, high C/N ratios in the growth media resulted in an increase in the concentration of flavones and flavonols in the leaves of the three crabapple cultivars. The transcript levels of the general flavonoid pathway genes [from chalcone synthase (CHS) to uridine diphosphat-glucose: flavonoid 3-O-glycosyltransferase (UFGT) and flavonol synthase (FLS)] increased in response to high C/N ratios, and this in turn was correlated with the concentration of anthocyanins, flavones and flavonols in the leaves and calli. Expression of the late flavonoid/anthocyanin biosynthetic genes, anthocyanidin synthase (ANS), UFGT and FLS in particular, was more strongly influenced by C/N ratios than other structural genes, and the increased expression of the structural genes under high C/N ratios coincided with a coordinated increase in transcript levels of a MYB transcription factor, MYB10. These results are likely to be useful for future generation of plants with an optimized flavonoid/anthocyanin content or desirable organ coloration.

A gene expression analysis of cell wall biosynthetic genes in Malus × domestica infected by ‘Candidatus Phytoplasma mali’

Science.gov (United States)

Guerriero, Gea; Giorno, Filomena; Ciccotti, Anna Maria; Schmidt, Silvia; Baric, Sanja

2016-01-01

Apple proliferation (AP) represents a serious threat to several fruit-growing areas and is responsible for great economic losses. Several studies have highlighted the key role played by the cell wall in response to pathogen attack. The existence of a cell wall integrity signaling pathway which senses perturbations in the cell wall architecture upon abiotic/biotic stresses and activates specific defence responses has been widely demonstrated in plants. More recently a role played by cell wall-related genes has also been reported in plants infected by phytoplasmas. With the aim of shedding light on the cell wall response to AP disease in the economically relevant fruit-tree Malus × domestica Borkh., we investigated the expression of the cellulose (CesA) and callose synthase (CalS) genes in different organs (i.e., leaves, roots and branch phloem) of healthy and infected symptomatic outdoor-grown trees, sampled over the course of two time points (i.e., spring and autumn 2011), as well as in in vitro micropropagated control and infected plantlets. A strong up-regulation in the expression of cell wall biosynthetic genes was recorded in roots from infected trees. Secondary cell wall CesAs showed up-regulation in the phloem tissue from branches of infected plants, while either a down-regulation of some genes or no major changes were observed in the leaves. Micropropagated plantlets also showed an increase in cell wall-related genes and constitute a useful system for a general assessment of gene expression analysis upon phytoplasma infection. Finally, we also report the presence of several ‘knot’-like structures along the roots of infected apple trees and discuss the occurrence of this interesting phenotype in relation to the gene expression results and the modalities of phytoplasma diffusion. PMID:23086810

Promotion of flavonoid biosynthesis in leaves and calli of ornamental crabapple (Malus spp. by high carbon to nitrogen ratios

Directory of Open Access Journals (Sweden)

Huihua eWan

2015-09-01

Full Text Available Flavonoids are secondary metabolites that play important roles in plant physiology. Despite numerous studies examined the effects of available carbon (C or nitrogen (N on flavonoid biosynthesis, the mechanism of C/N interactive effects on flavonoid metabolism is still unclear. In this study, we analyzed the composition of flavonoids and the expression levels of flavonoid-related genes in leaves and calli of crabapple (Malus spp. cultivars with different leaf colors grown on media with different C/N ratios. Our results show that high C/N ratios induce anthocyanin pigmentation in leaves of the ever-red cultivar ‘Royalty’ and the spring-red cultivar ‘Prairifire’, as well as in three types of calli derived from the ever-green cultivar ‘Spring Snow’, but not in the leaves of the ever-green cultivar ‘Flame’. This phenomenon therefore correlated with anthocyanin content in these different samples. In addition, high C/N ratios in the growth media resulted in an increase in the concentration of flavones and flavonols in the leaves of the three crabapple cultivars. The transcript levels of the general flavonoid pathway genes [from chalcone synthase (CHS to uridine diphosphate (UDP-glucose: flavonoid 3-O-glycosyltransferase (UFGT and flavonol synthase (FLS] increased in response to high C/N ratios, and this in turn was correlated with the concentration of anthocyanin, flavone and flavonol in the leaves and calli. Expression of the late flavonoid/anthocyanin biosynthetic genes, anthocyanidin synthase (ANS, UFGT and FLS in particular, was more strongly influenced by C/N ratios than other structural genes, and the increased expression of the structural genes under high C/N ratios coincided with a coordinated increase in transcript levels of a MYB transcription factor, MYB10. These results are likely to be useful for future generation of plants with an optimized flavonoid/anthocyanin content or desirable organ coloration.

Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family.

Science.gov (United States)

Illa, Eudald; Sargent, Daniel J; Lopez Girona, Elena; Bushakra, Jill; Cestaro, Alessandro; Crowhurst, Ross; Pindo, Massimo; Cabrera, Antonio; van der Knaap, Esther; Iezzoni, Amy; Gardiner, Susan; Velasco, Riccardo; Arús, Pere; Chagné, David; Troggio, Michela

2011-01-12

Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family

Directory of Open Access Journals (Sweden)

Velasco Riccardo

2011-01-01

Full Text Available Abstract Background Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. Results We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. Conclusions A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development.

Science.gov (United States)

Schaeffer, Scott M; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie; Dhingra, Amit

2017-10-01

Comparative ultrastructural developmental time-course analysis has identified discrete stages at which the fruit plastids undergo structural and consequently functional transitions to facilitate subsequent development-guided understanding of the complex plastid biology. Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids-chromoplasts-are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant 'Granny Smith', carotenoid-predominant 'Golden Delicious', and anthocyanin-predominant 'Top Red Delicious'. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex

Evaluation of SNP Data from the Malus Infinium Array Identifies Challenges for Genetic Analysis of Complex Genomes of Polyploid Origin.

Directory of Open Access Journals (Sweden)

Michela Troggio

Full Text Available High throughput arrays for the simultaneous genotyping of thousands of single-nucleotide polymorphisms (SNPs have made the rapid genetic characterisation of plant genomes and the development of saturated linkage maps a realistic prospect for many plant species of agronomic importance. However, the correct calling of SNP genotypes in divergent polyploid genomes using array technology can be problematic due to paralogy, and to divergence in probe sequences causing changes in probe binding efficiencies. An Illumina Infinium II whole-genome genotyping array was recently developed for the cultivated apple and used to develop a molecular linkage map for an apple rootstock progeny (M432, but a large proportion of segregating SNPs were not mapped in the progeny, due to unexpected genotype clustering patterns. To investigate the causes of this unexpected clustering we performed BLAST analysis of all probe sequences against the 'Golden Delicious' genome sequence and discovered evidence for paralogous annealing sites and probe sequence divergence for a high proportion of probes contained on the array. Following visual re-evaluation of the genotyping data generated for 8,788 SNPs for the M432 progeny using the array, we manually re-scored genotypes at 818 loci and mapped a further 797 markers to the M432 linkage map. The newly mapped markers included the majority of those that could not be mapped previously, as well as loci that were previously scored as monomorphic, but which segregated due to divergence leading to heterozygosity in probe annealing sites. An evaluation of the 8,788 probes in a diverse collection of Malus germplasm showed that more than half the probes returned genotype clustering patterns that were difficult or impossible to interpret reliably, highlighting implications for the use of the array in genome-wide association studies.

Description et modélisation de la croissance et du développement du pommier (Malus x domestica Borkh. I. Structure la plus probable de l'arbre jeune

Directory of Open Access Journals (Sweden)

Planchon V.

2003-01-01

Full Text Available Description and modelisation of growth and development of appletree (Malus x domestica Borkh.. I. Most probable structure of young tree. Based on the observation of all or, at least, a large number of shoots growing on unpruned apple trees, cv. Cox's Orange Pippin and Jonagold grafted on EM9, an original codification system has been conceived. It allows to locate and identify quickly and unequivocally any shoot or growth. From a comprehensive collection of such codified observations, the most probable structure of young one to five year old trees has been established, with the amount and characters of the different observed shoot types. Both varieties display very similar gross structures, despite minor differences in form, flowering mode and productivity. The development of the trees occurs in two phases. The first one builds up a frame composed by the trunk and several storied sets of branches. Flowering is rather strictly alternate during this phase. The second one consists in the reinforcement of the branches by axillary growth, but even more by sympodial branching due to increasing and repeated terminal flowering. This basic structure provides a reference to appreciate changes in tree development brought about by rootstock, fruit load or training practices.

Growth, nutrient uptake and ectomycorrhizal function in Pinus sylvestris plants exposed to aluminium and heavy metals

Energy Technology Data Exchange (ETDEWEB)

Ahonen-Jonnarth, Ulla [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology

2000-07-01

The potential role of aluminium (Al) toxicity to trees has been of particular concern to forest owners and scientists since the early 1980's when Ulrich hypothesised that both Al and heavy metals were involved in forest dieback because of their increased concentrations in soil due to acidification. Since then, numerous studies have examined the effects of metals upon nutrient uptake by plants. However, most of these investigations have been carried out in the absence of mycorrhizal fungi, which, in most ecosystems, are crucial components in nutrient uptake by plants. The present work focused on the effects of elevated concentrations of Al and heavy metals on Scots pine (Pinus sylvestris L.) and the potential role of ectomycorrhiza in modifying these effects. Ectomycorrhizal colonisation enhanced the growth and nutrient uptake by seedlings. To some extent, colonisation also alleviated reduced nutrient uptake which was a feature of seedlings growing in the presence of the metals. This effect was particularly noticeable with respect to P uptake. In general, mycorrhizal seedlings grew better and had an improved P, K, Mg and S status compared with non-mycorrhizal seedlings. Significant differences were also found in nutrient uptake among seedlings colonised by different fungi. One fungus, Hebeloma cf. longicaudum, was more sensitive to the Al treatment than the pine seedlings. The use of the base cation / Al ratio as an indicator of the potential detrimental effects to trees to acidification and Al is discussed. The production of oxalic acid was found to increase when mycorrhizal and nonmycorrhizal seedlings were exposed to Al or Cu. Colonisation by Suillus variegatus or Rhizopogon roseolus, in particular, resulted in a marked increase. These results demonstrate that there is a capacity, especially by certain ectomycorrhizal fungi, for increased production of the metal-chelating oxalic acid when root systems are exposed to increased levels of metals. In a field

Growth, nutrient uptake and ectomycorrhizal function in Pinus sylvestris plants exposed to aluminium and heavy metals

International Nuclear Information System (INIS)

Ahonen-Jonnarth, Ulla

2000-01-01

The potential role of aluminium (Al) toxicity to trees has been of particular concern to forest owners and scientists since the early 1980's when Ulrich hypothesised that both Al and heavy metals were involved in forest dieback because of their increased concentrations in soil due to acidification. Since then, numerous studies have examined the effects of metals upon nutrient uptake by plants. However, most of these investigations have been carried out in the absence of mycorrhizal fungi, which, in most ecosystems, are crucial components in nutrient uptake by plants. The present work focused on the effects of elevated concentrations of Al and heavy metals on Scots pine (Pinus sylvestris L.) and the potential role of ectomycorrhiza in modifying these effects. Ectomycorrhizal colonisation enhanced the growth and nutrient uptake by seedlings. To some extent, colonisation also alleviated reduced nutrient uptake which was a feature of seedlings growing in the presence of the metals. This effect was particularly noticeable with respect to P uptake. In general, mycorrhizal seedlings grew better and had an improved P, K, Mg and S status compared with non-mycorrhizal seedlings. Significant differences were also found in nutrient uptake among seedlings colonised by different fungi. One fungus, Hebeloma cf. longicaudum, was more sensitive to the Al treatment than the pine seedlings. The use of the base cation / Al ratio as an indicator of the potential detrimental effects to trees to acidification and Al is discussed. The production of oxalic acid was found to increase when mycorrhizal and nonmycorrhizal seedlings were exposed to Al or Cu. Colonisation by Suillus variegatus or Rhizopogon roseolus, in particular, resulted in a marked increase. These results demonstrate that there is a capacity, especially by certain ectomycorrhizal fungi, for increased production of the metal-chelating oxalic acid when root systems are exposed to increased levels of metals. In a field

Nutrient uptake by intact mycorrhizal Pinus sylvestris seedlings: a diagnostic tool to detect copper toxicity.

Science.gov (United States)

Van Tichelen, Katia K.; Vanstraelen, Tom; Colpaert, Jan V.

1999-03-01

We developed a nondestructive method for detecting early toxic effects of inflethal copper (Cu) concentrations on ectomycorrhizal and non-mycorrhizal (NM) Scots pine (Pinus sylvestris L.) seedlings. The fungal symbionts examined were Paxillus involutus (Fr.) Fr., Suillus luteus (Fr.) S.F. Gray and Thelephora terrestris (Ehrh.) Fr. The accumulation of Cu in needles and fungal development (ergosterol) in roots and infstrate were assessed. Inorganic phosphate (P(i)) and ammonium (NH(4) (+)) uptake capacities were determined in a semi-hydroponic cultivation system on intact P-limited plants that were exposed for 3 weeks to 0.32 (control), 8 or 16 &mgr;moles Cu(2+). Short-term effects of a 1-hour exposure to 32 &mgr;moles Cu(2+) on nutrient uptake rates were also determined. None of the Cu(2+) treatments affected plant growth or root ergosterol concentrations. The active fungal biomass in infstrate invaded by S. luteus was reduced by 50% in the 16 &mgr;M Cu(2+) treatment compared with the control treatment; however, colonization by S. luteus prevented an increased accumulation of Cu in the needles. In contrast, the 16 &mgr;M Cu(2+) treatment caused a 2.2-fold increase in needle Cu concentration in NM plants. Ergosterol concentrations in the infstrate colonized by P. involutus and T. terrestris were not affected by 16 &mgr;molar Cu(2+). Although P. involutus and T. terrestris were less sensitive to Cu(2+) than S. luteus, T. terrestris did not prevent the accumulation of Cu in needles of its host plant in the 16 &mgr;molar Cu(2+) treatment. Mycorrhizal plants consistently had higher P(i) and NH(4) (+) uptake capacities than NM plants. In the control treatment, specific P(i) uptake rates were almost 10, 4 and 3 times higher in plants associated with P. involutus, S. luteus and T. terrestris, respectively, than in NM plants, and specific NH(4) (+) uptake rates were about 2, 2 and 5 times higher, respectively, than those of NM seedlings. Compared with the corresponding

Individual variability of Scots pine Pinus sylvestris L. by the drought resistance features in forest-steppe pine forests of south Siberia

Directory of Open Access Journals (Sweden)

N. A. Tikhonova

2016-10-01

Full Text Available The drought resistance of trees in the Scots pine Pinus sylvestris L. populations was studied under forest steppe conditions of southern Siberia. We found large differences amongthe treesin the time and rate of needles dehydration. In the populations of the more arid growing conditions (Shira, Balgazyn the rate of loss 50 % of the water was three to four times lower than in the population of the more favorable conditions for growth (Minusinsk. It has been established that the variability of water-holding capacity of needles from individual trees in populations varies from high to very high levels. On the contrary, for the water absorption capacity of needles characteristically has variability, as within population and between them. Is marked a great assessment reliability of water holding capacity of the needles under the pooled analysis of absolute and relative indicators of dynamics of the needles degradration. We investigated the correlation of needles’ water retention signs with a height and heterozygosity of trees. It was found that under more favorable conditions of the growth the large part of sample are the trees with a direct connection between heterozygosity and drought resistance of tree and in the worst conditions – with a reverse. The correlations of water-holding capacity of needles with the height of the tree are ambiguous: in the Minusinsk sample, the most of drought-resistant trees are characterized by better growth, in Balgazyn population – conversely. Some dwarf individuals from the Balgazyn and Shira populations in terms of drought tolerance are at same level as the typical trees, among the less drought-resistant trees found as dwarfs, and typical trees. It was concluded that there are trees in populations with different strategies to adaptation to the moisture deficit.

Long-term development of experimental mixtures of Scots pine (Pinus sylvestris L. and silver birch (Betula pendula Roth. in northern Britain

Directory of Open Access Journals (Sweden)

Bill Mason

2016-07-01

Full Text Available The Caledonian pinewoods of northern Scotland are a priority conservation habitat in Europe which are dominated by Scots pine (Pinus sylvestris, but varying proportions of a number of broadleaved species such as silver birch (Betula pendula can occur in these forests. Better understanding of the dynamics of mixed Scots pine-birch stands would be helpful in informing current initiatives to restore and increase the area of the pinewood ecosystem. Some evidence is provided by two experiments established in the 1960s which compared plots of pure Scots pine and pure birch with two treatments where the two species were mixed in 3:1 and 1:1 ratios. Some fifty years later, Scots pine was the more vigorous of the two species in these experiments, being both taller and significantly larger in diameter. The highest basal area was generally found in the pure Scots pine plots and the values in the mixed plots tended to be intermediate between those of the two component species. Examination of the growth in the mixed plots showed a slight, but non-significant, tendency towards overyielding. This appeared to be due to Scots pine growth being better than predicted, while that of birch was slightly less than predicted. These results suggest that in these mixtures, which are composed of two light demanding species, the main mechanism driving long-term performance is competition for light and there is little evidence of any complementary effect. These results suggest that any strategy seeking to increase the long-term representation of broadleaves such as birch in the Caledonian pinewoods will need to create discrete blocks that are large enough to withstand the competitive pressures exerted by the pine.

Impact of warming, moderate nitrogen addition and bark herbivory on BVOC emissions and growth of Scots pine (Pinus sylvestris L.) seedlings.

Science.gov (United States)

Tiiva, Päivi; Häikiö, Elina; Kasurinen, Anne

2018-04-10

The changing climate will expose boreal forests to rising temperatures, increasing soil nitrogen (N) levels and an increasing risk of herbivory. The single and interaction effects of warming (+2 °C increase), moderate N addition (30 kg ha-1 year-1) and bark herbivory by large pine weevil (Hylobius abietis L.) on growth and emissions of biogenic volatile organic compounds (BVOCs) from shoots of Scots pine (Pinus sylvestris L.) seedlings were studied in growth chambers over 175 days. In addition, warming and N addition effects on shoot net photosynthesis (Pn) were measured. Nitrogen addition increased both shoot and root dry weights, whereas warming, in combination with herbivory, reduced stem height growth. Warming together with N addition increased current-year shoot Pn, whereas N effects on previous-year shoot Pn were variable over time. Warming decreased non-oxygenated monoterpene (MT) emissions in June and increased them in July. Of individual MT compounds, α-pinene, δ-3-carene, γ-terpinene and terpinolene were among the most frequently responsive compounds in warming treatments in the May-July period. Sesquiterpene emissions were observed only from warming treatments in July. Moderate N addition increased oxygenated monoterpenes in May, and MTs in June and September. However, N addition effect on MTs in June was clearer without warming than with warming. Bark herbivory tended to increase MT emissions in combination with warming and N addition 3 weeks after the damage caused by weevils. Of individual compounds in other BVOC blends, herbivory increased the emissions of methyl-benzene, benzene and hexanal in July. Hence, though both warming and N addition have a potential to change BVOC emissions from Scots pines, the N effect may also be partly cancelled by warming. Furthermore, herbivory pressure in combination with climate warming and N addition may, at least periodically, increase BVOC release to the atmosphere from young Scots pine seedlings.

Late Neolithic vegetation history at the pile-dwelling site of Palù di Livenza (northeastern Italy

Science.gov (United States)

Pini, Roberta

2004-12-01

The Late Neolithic pile-dwelling of Palù di Livenza yielded archaeological remains typical of the Square Mouth Pottery and Lagozza Cultures. A palynological investigation reveals important changes in the vegetation due to anthropogenic pressure. Between ca. 6590 and 5960 cal. yr BP, dense oak wood forests with deciduous Quercus, Fagus and Corylus extended around the mire, with no signs of human impact. The establishment of the pile-dwelling, dated to ca. 5960 cal. yr BP, led to a strong reduction of forests, reclamation of wetlands, and expansion of herbaceous communities, with cultivated species, infestant weeds, nitrophilous and ruderal herbs, pastures and meadows. According to AMS dates and previous archaeological chronologies, the pile-dwelling persisted for about 700 years (from ca. 5960 to 5260 cal. yr BP). The history of the pile-dwelling after ca. 5260 cal. yr BP cannot be reconstructed because of recent contamination of the top part of the section. Rarefaction analysis was applied to estimate changes of palynological richness through time: the highest E(Tn) (between 56 and 69 taxa) are contemporaneous with the local development of the pile-dwelling. The comparison of pollen data with archaeobotanical evidence indicates that Fragaria vesca, Malus sylvestris, Papaver somniferum and Physalis alkekengi were gathered at some distance from the site and that Linum usitatissimum is strongly under-represented in pollen samples. Crop cultivation can be estimated for a radius of several hundred metres around the mire. Palù di Livenza is significant in the context of Neolithic archaeobotany of northern Italy and neighbouring countries. Copyright

Transformation of apple (Malus × domestica) using mutants of apple acetolactate synthase as a selectable marker and analysis of the T-DNA integration sites.

Science.gov (United States)

Yao, Jia-Long; Tomes, Sumathi; Gleave, Andrew P

2013-05-01

Apple acetolactate synthase mutants were generated by site-specific mutagenesis and successfully used as selection marker in tobacco and apple transformation. T-DNA/Apple genome junctions were analysed using genome-walking PCR and sequencing. An Agrobacterium-mediated genetic transformation system was developed for apple (Malus × domestica), using mutants of apple acetolactate synthase (ALS) as a selectable marker. Four apple ALS mutants were generated by site-specific mutagenesis and subsequently cloned under the transcriptional control of the CaMV 35S promoter and ocs 3' terminator, in a pART27-derived plant transformation vector. Three of the four mutations were found to confer resistance to the herbicide Glean(®), containing the active agent chlorsulfuron, in tobacco (Nicotiana tabacum) transformation. In apple transformation, leaf explants infected with Agrobacterium tumefaciens EHA105 containing one of the three ALS mutants resulted in the production of shoots on medium containing 2-8 μg L(-1) Glean(®), whilst uninfected wild-type explants failed to regenerate shoots or survive on medium containing 1 and 3 μg L(-1) Glean(®), respectively. Glean(®)-resistant, regenerated shoots were further multiplied and rooted on medium containing 10 μg L(-1) Glean(®). The T-DNA and apple genome-DNA junctions from eight rooted transgenic apple plants were analysed using genome-walking PCR amplification and sequencing. This analysis confirmed T-DNA integration into the apple genome, identified the genome integration sites and revealed the extent of any vector backbone integration, T-DNA rearrangements and deletions of apple genome DNA at the sites of integration.

Online investigation of respiratory quotients in Pinus sylvestris and Picea abies during drought and shading by means of cavity-enhanced Raman multi-gas spectrometry.

Science.gov (United States)

Hanf, Stefan; Fischer, Sarah; Hartmann, Henrik; Keiner, Robert; Trumbore, Susan; Popp, Jürgen; Frosch, Torsten

2015-07-07

Photosynthesis and respiration are major components of the plant carbon balance. During stress, like drought, carbohydrate supply from photosynthesis is reduced and the Krebs cycle respiration must be fueled with other stored carbon compounds. However, the dynamics of storage use are still unknown. The respiratory quotient (RQ, CO2 released per O2 consumed during respiration) is an excellent indicator of the nature of the respiration substrate. In plant science, however, online RQ measurements have been challenging or even impossible so far due to very small gas exchange fluxes during respiration. Here we apply cavity-enhanced multi-gas Raman spectrometry (CERS) for online in situ RQ measurements in drought-tolerant pine (Pinus sylvestris [L.]) and drought-intolerant spruce (Picea abies [L. H. Karst]). Two different treatments, drought and shading, were applied to reduce photosynthesis and force dependency on stored substrates. Changes in respiration rates and RQ values were continuously monitored over periods of several days with low levels of variance. The results show that both species switched from COH-dominated respiration (RQ = 1.0) to a mixture of substrates during shading (RQ = 0.77-0.81), while during drought only pine did so (RQ = 0.75). The gas phase measurements were complemented by concentration measurements of non-structural carbohydrates and lipids. These first results suggest a physiological explanation for greater drought tolerance in pine. CERS was proven as powerful technique for non-consumptive and precise real-time monitoring of respiration rates and respirational quotients for the investigation of plant metabolism under drought stress conditions that are predicted to increase with future climate change.

Scots pine (Pinus sylvestris L.) based reconstruction of 130 years of water table fluctuations in a peatland and its relevance for moisture variability assessments

Science.gov (United States)

Tamkevičiūtė, Marija; Edvardsson, Johannes; Pukienė, Rūtilė; Taminskas, Julius; Stoffel, Markus; Corona, Christophe; Kibirkštis, Gintautas

2018-03-01

Continuous water-table (WT) measurements from peatlands are scarce and - if existing at all -very short. Consequently, proxy indicators are critically needed to simulate hydrological changes in peatlands over longer time periods. In this study, we demonstrate that tree-ring width (TRW) records of Scots pine (Pinus sylvestris L.) growing in the Čepkeliai peatland (southern Lithuania) can be used as a proxy to reconstruct hydrological variability in a raised bog environment. A two-step modelling procedure was applied to extend existing measurements and to develop a new and longer peatland WT time series. To this end, we used instrumental WT measurements extending back to 2002, meteorological records, a P-PET (difference between precipitation and potential evapotranspiration) series covering the period 1935-2014, so as to construct a tree-ring based time series of WT fluctuations at the site for the period 1870-2014. Strongest correlations were obtained between average annual WT measured at the bog margin and total P-PET over 7 years (r = 0.923, p runoff since CE 1812 (r = 0.39, p < 0.00001, 1870-2014). We conclude that peatlands can act both as sinks and sources of greenhouse gases in case that hydrological conditions change, but that hydrological lags and complex feedbacks still hamper our understanding of several processes affecting the hydrology and carbon budget in peatlands. We therefore call for the development of further proxy records of water-table variability in peatlands to improve our understanding of peatland responses to climatic changes.

Recent advances in the cryopreservation of shoot-derived germplasm of economically important fruit trees of Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis.

Science.gov (United States)

Benelli, Carla; De Carlo, Anna; Engelmann, Florent

2013-01-01

This paper presents the advances made over the last decade in cryopreservation of economically important vegetatively propagated fruit trees. Cryopreservation protocols have been established using both dormant buds sampled on field-grown plants and shoot tips sampled on in vitro plantlets. In the case of dormant buds, scions are partially dehydrated by storage at -5 °C, and then cooled slowly to -30 °C using low cooling rates (c.a. 1 °C/h) before immersion in liquid nitrogen. After slow rewarming and rehydration of samples, regrowth takes place either through grafting of buds on rootstocks or excision of apices and inoculation in vitro. In the case of shoot tips of in vitro plantlets, the cryopreservation techniques employed are the following: controlled rate cooling procedures involving slow prefreezing followed by immersion in liquid nitrogen or vitrification-based procedures including encapsulation-dehydration, vitrification, encapsulation-vitrification and droplet-vitrification. The current status of cryopreservation for a series of fruit tree species including Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis is presented. Routine application of cryopreservation for long-term germplasm storage in genebanks is currently limited to apple and pear, for which large cryopreserved collections have been established at NCGRP, Fort Collins (USA), using dormant buds and in vitro shoot tips, respectively. However, there are a growing number of examples of pilot scale testing experiments under way for different species in various countries. Progress in the further development and application of cryopreservation techniques will be made through a better understanding of the mechanisms involved in the induction of tolerance to dehydration and cryopreservation in frozen explants. Copyright © 2012 Elsevier Inc. All rights reserved.

Asymmetric Information, Self-selection, and Pricing of Insurance Contracts

DEFF Research Database (Denmark)

Donnelly, Catherine; Englund, Martin Kristian; Nielsen, Jens Perch

2014-01-01

This article presents an optional bonus-malus contract based on a priori risk classification of the underlying insurance contract. By inducing self-selection, the purchase of the bonus-malus contract can be used as a screening device. This gives an even better pricing performance than both...... an experience rating scheme and a classical no-claims bonus system. An application to the Danish automobile insurance market is considered....

Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

Science.gov (United States)

Wei, Menghan; Wang, Sanhong; Dong, Hui; Cai, Binhua; Tao, Jianmin

2016-01-01

As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and strawberry (Fragaria vesca) in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD) or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA]), while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA). Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR). Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

Freezing pattern and frost killing temperature of apple (Malus domestica) wood under controlled conditions and in nature.

Science.gov (United States)

Pramsohler, Manuel; Hacker, Jürgen; Neuner, Gilbert

2012-07-01

The freezing pattern and frost killing temperatures of apple (Malus domestica Borkh.) xylem were determined by differential thermal analysis and infrared differential thermal analysis (IDTA). Results from detached or attached twigs in controlled freezing experiments and during natural field freezing of trees were compared. Non-lethal freezing of apoplastic water in apple xylem as monitored during natural winter frosts in the field occurred at -1.9 ± 0.4 °C and did not change seasonally. The pattern of whole tree freezing was variable and specific to the environmental conditions. On detached twigs high-temperature freezing exotherms (HTEs) occurred 2.8 K below the temperature observed under natural frosts in the field with a seasonal mean of -4.7 ± 0.5 °C. Microporous apple xylem showed freezing without a specific pattern within a few seconds in IDTA images during HTEs, which is in contrast to macroporous xylem where a 2D freezing pattern mirrors anatomical structures. The pith tissue always remained unfrozen. Increasing twig length increased ice nucleation temperature; for increased twig diameter the effect was not significant. In attached twigs frozen in field portable freezing chambers, HTEs were recorded at a similar mean temperature (-4.6 ± 1.0 °C) to those for detached twigs. Upon lethal intracellular freezing of apple xylem parenchyma cells (XPCs) low-temperature freezing exotherms (LTEs) can be recorded. Low-temperature freezing exotherms determined on detached twigs varied significantly between a winter minimum of -36.9 °C and a summer maximum -12.7 °C. Within the temperature range wherein LTEs were recorded by IDTA in summer (-12.7 ± 0.5 to -20.3 ± 1.1 °C) various tiny clearly separated discontinuous freezing events could be detected similar to that in other species with contrasting XPC anatomy. These freezing events appeared to be initially located in the primary and only later in the secondary xylem. During the LTE no

Mapping in an apple (Malus x domestica) F1 segregating population based on physical clustering of differentially expressed genes.

Science.gov (United States)

Jensen, Philip J; Fazio, Gennaro; Altman, Naomi; Praul, Craig; McNellis, Timothy W

2014-04-04

Apple tree breeding is slow and difficult due to long generation times, self-incompatibility, and complex genetics. The identification of molecular markers linked to traits of interest is a way to expedite the breeding process. In the present study, we aimed to identify genes whose steady-state transcript abundance was associated with inheritance of specific traits segregating in an apple (Malus × domestica) rootstock F1 breeding population, including resistance to powdery mildew (Podosphaera leucotricha) disease and woolly apple aphid (Eriosoma lanigerum). Transcription profiling was performed for 48 individual F1 apple trees from a cross of two highly heterozygous parents, using RNA isolated from healthy, actively-growing shoot tips and a custom apple DNA oligonucleotide microarray representing 26,000 unique transcripts. Genome-wide expression profiles were not clear indicators of powdery mildew or woolly apple aphid resistance phenotype. However, standard differential gene expression analysis between phenotypic groups of trees revealed relatively small sets of genes with trait-associated expression levels. For example, thirty genes were identified that were differentially expressed between trees resistant and susceptible to powdery mildew. Interestingly, the genes encoding twenty-four of these transcripts were physically clustered on chromosome 12. Similarly, seven genes were identified that were differentially expressed between trees resistant and susceptible to woolly apple aphid, and the genes encoding five of these transcripts were also clustered, this time on chromosome 17. In each case, the gene clusters were in the vicinity of previously identified major quantitative trait loci for the corresponding trait. Similar results were obtained for a series of molecular traits. Several of the differentially expressed genes were used to develop DNA polymorphism markers linked to powdery mildew disease and woolly apple aphid resistance. Gene expression profiling

Development and validation of a 20K single nucleotide polymorphism (SNP) whole genome genotyping array for apple (Malus × domestica Borkh).

Science.gov (United States)

Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

2014-01-01

High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

Development and validation of a 20K single nucleotide polymorphism (SNP whole genome genotyping array for apple (Malus × domestica Borkh.

Directory of Open Access Journals (Sweden)

Luca Bianco

Full Text Available High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus. A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs. Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

Development and Validation of a 20K Single Nucleotide Polymorphism (SNP) Whole Genome Genotyping Array for Apple (Malus × domestica Borkh)

Science.gov (United States)

Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

2014-01-01

High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs. PMID:25303088

Protein (Viridiplantae): 130362 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available Malus domestica MEDKLSIVAKSIAPSPIQELSHLARRCNAINLAEGFPDFPAPSHIKHAAISAIHSDFNQYRHVQGICDHLANIMKQMHGLDVNPLTDMA...ICCGQSEALAAAAFAIIDKGDEVILFDPCYETYEGCIKMAGGVSVYVPLDPPHWTLDPNRFINAFNERTKALVLNSPHNPTGK

Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

Directory of Open Access Journals (Sweden)

Menghan Wei

Full Text Available As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica, pear (Pyrus communis, peach (Prunus persica, plum (Prunus mume and strawberry (Fragaria vesca in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA], while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA. Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR. Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

High miR156 Expression Is Required for Auxin-Induced Adventitious Root Formation via MxSPL26 Independent of PINs and ARFs in Malus xiaojinensis

Directory of Open Access Journals (Sweden)

Xiaozhao Xu

2017-06-01

Full Text Available Adventitious root formation is essential for the vegetative propagation of perennial woody plants. During the juvenile-to-adult phase change mediated by the microRNA156 (miR156, the adventitious rooting ability decreases dramatically in many species, including apple rootstocks. However, the mechanism underlying how miR156 affects adventitious root formation is unclear. In the present study, we showed that in the presence of the synthetic auxin indole-3-butyric acid (IBA, semi-lignified leafy cuttings from juvenile phase (Mx-J and rejuvenated (Mx-R Malus xiaojinensis trees exhibited significantly higher expression of miR156, PIN-FORMED1 (PIN1, PIN10, and rootless concerning crown and seminal roots-like (RTCS-like genes, thus resulting in higher adventitious rooting ability than those from adult phase (Mx-A trees. However, the expression of SQUAMOSA-PROMOTER BINDING PROTEIN-LIKE26 (SPL26 and some auxin response factor (ARF gene family members were substantially higher in Mx-A than in Mx-R cuttings. The expression of NbRTCS-like but not NbPINs and NbARFs varied with miR156 expression in tobacco (Nicotiana benthamiana plants transformed with 35S:MdMIR156a6 or 35S:MIM156 constructs. Overexpressing the miR156-resistant MxrSPL genes in tobacco confirmed the involvement of MxSPL20, MxSPL21&22, and MxSPL26 in adventitious root formation. Together, high expression of miR156 was necessary for auxin-induced adventitious root formation via MxSPL26, but independent of MxPINs and MxARFs expression in M. xiaojinensis leafy cuttings.

A new approach to defining rotation ages on the basis of productive and technological aspects. Application to natural Pinus sylvestris L. stands in Central Spain

International Nuclear Information System (INIS)

Rojo-Alboreca, A.; García-Villabrille, J.D.; Corral-Rivas, J.J.; Alía, R.; Montero, G.

2017-01-01

Aim of study: To propose a new approach to defining rotation ages on the basis of productive and technological aspects and to present an example of application of the methodology to natural Pinus sylvestris stands in relation to silvicultural treatment (light or heavy thinning) and site index. Area of study: Central Spain. Material and methods: We assumed that the price per m3 of logwood suitable for veneer is four times higher than logwood not apt for veneer. Considering the yield distribution for different technological and commercial classes, a model of diameter distributions and yield tables, the variation in an average price index for different age classes, site indexes and silvicultural treatments was calculated. The age at which the price index rises by less than 3%, the proportion of trees with d.b.h. higher than 40 cm, and other aspects such as the possible presence of fungal decay in old-growth stands were also taken into account to establish three criteria for defining rotation ages. Main results: The proposed methodology generates a wide range of rotation ages between 100 and 140 years for lightly thinned stands, and between 90 and 140 years for heavily thinned stands, depending on the site index. Research highlights: The proposed approach is based on technological and productive criteria, with the limitations imposed by sanitary risks. The methodology can be applied to generate rotation ages in relation to different site indexes and silvicultural treatments, provided that the timber market prices and the yield distribution for different technological and commercial classes are known, and that a model of diameter distributions and yield tables are available.

A new approach to defining rotation ages on the basis of productive and technological aspects. Application to natural Pinus sylvestris L. stands in Central Spain

Energy Technology Data Exchange (ETDEWEB)

Rojo-Alboreca, A.; García-Villabrille, J.D.; Corral-Rivas, J.J.; Alía, R.; Montero, G.

2017-11-01

Aim of study: To propose a new approach to defining rotation ages on the basis of productive and technological aspects and to present an example of application of the methodology to natural Pinus sylvestris stands in relation to silvicultural treatment (light or heavy thinning) and site index. Area of study: Central Spain. Material and methods: We assumed that the price per m3 of logwood suitable for veneer is four times higher than logwood not apt for veneer. Considering the yield distribution for different technological and commercial classes, a model of diameter distributions and yield tables, the variation in an average price index for different age classes, site indexes and silvicultural treatments was calculated. The age at which the price index rises by less than 3%, the proportion of trees with d.b.h. higher than 40 cm, and other aspects such as the possible presence of fungal decay in old-growth stands were also taken into account to establish three criteria for defining rotation ages. Main results: The proposed methodology generates a wide range of rotation ages between 100 and 140 years for lightly thinned stands, and between 90 and 140 years for heavily thinned stands, depending on the site index. Research highlights: The proposed approach is based on technological and productive criteria, with the limitations imposed by sanitary risks. The methodology can be applied to generate rotation ages in relation to different site indexes and silvicultural treatments, provided that the timber market prices and the yield distribution for different technological and commercial classes are known, and that a model of diameter distributions and yield tables are available.

Synergistic, additive and antagonistic impacts of drought and herbivory on Pinus sylvestris: leaf, tissue and whole-plant responses and recovery.

Science.gov (United States)

Bansal, Sheel; Hallsby, Göran; Löfvenius, Mikael O; Nilsson, Marie-Charlotte

2013-05-01

Forests typically experience a mix of anthropogenic, natural and climate-induced stressors of different intensities, creating a mosaic of stressor combinations across the landscape. When multiple stressors co-occur, their combined impact on plant growth is often greater than expected based on single-factor studies (i.e., synergistic), potentially causing catastrophic dysfunction of physiological processes from an otherwise recoverable situation. Drought and herbivory are two stressors that commonly co-occur in forested ecosystems, and have the potential to 'overlap' in their impacts on various plant traits and processes. However, the combined impacts from these two stressors may not be predictable based on additive models from single-stressor studies. Moreover, the impacts and subsequent recovery may be strongly influenced by the relative intensities of each stressor. Here, we applied drought stress and simulated bark-feeding herbivory at three levels of intensity (control, moderate and severe) in a full factorial design on young Pinus sylvestris L. seedlings. We assessed if the combined effects from two stressors were additive (responses were equal to the sum of the single-factor effects), synergistic (greater than expected) or antagonistic (less than expected) on a suite of morphological and physiological traits at the leaf-, tissue- and whole-plant level. We additionally investigated whether recovery from herbivory was dependent on relief from drought. The two stressors had synergistic impacts on specific leaf area and water-use efficiency, additive effects on height and root-to-shoot ratios, but antagonistic effects on photosynthesis, conductance and, most notably, on root, shoot and whole-plant biomass. Nevertheless, the magnitude and direction of the combined impacts were often dependent on the relative intensities of each stressor, leading to many additive or synergistic responses from specific stressor combinations. Also, seedling recovery was far more

The role of defoliation and root rot pathogen infection in driving the mode of drought-related physiological decline in Scots pine (Pinus sylvestris L.).

Science.gov (United States)

Aguadé, D; Poyatos, R; Gómez, M; Oliva, J; Martínez-Vilalta, J

2015-03-01

Drought-related tree die-off episodes have been observed in all vegetated continents. Despite much research effort, however, the multiple interactions between carbon starvation, hydraulic failure and biotic agents in driving tree mortality under field conditions are still not well understood. We analysed the seasonal variability of non-structural carbohydrates (NSCs) in four organs (leaves, branches, trunk and roots), the vulnerability to embolism in roots and branches, native embolism (percentage loss of hydraulic conductivity (PLC)) in branches and the presence of root rot pathogens in defoliated and non-defoliated individuals in a declining Scots pine (Pinus sylvestris L.) population in the NE Iberian Peninsula in 2012, which included a particularly dry and warm summer. No differences were observed between defoliated and non-defoliated pines in hydraulic parameters, except for a higher vulnerability to embolism at pressures below -2 MPa in roots of defoliated pines. No differences were found between defoliation classes in branch PLC. Total NSC (TNSC, soluble sugars plus starch) values decreased during drought, particularly in leaves. Defoliation reduced TNSC levels across tree organs, especially just before (June) and during (August) drought. Root rot infection by the fungal pathogen Onnia P. Karst spp. was detected but it did not appear to be associated to tree defoliation. However, Onnia infection was associated with reduced leaf-specific hydraulic conductivity and sapwood depth, and thus contributed to hydraulic impairment, especially in defoliated pines. Infection was also associated with virtually depleted root starch reserves during and after drought in defoliated pines. Moreover, defoliated and infected trees tended to show lower basal area increment. Overall, our results show the intertwined nature of physiological mechanisms leading to drought-induced mortality and the inherent difficulty of isolating their contribution under field conditions. © The

Survival and development of Lymantria monacha (Lepidoptera: Lymantriidae) on North American and introduced Eurasian tree species.

Science.gov (United States)

Keena, M A

2003-02-01

Lymantria monacha (L.) (Lepidoptera: Lymantriidae), the nun moth, is a Eurasian pest of conifers that has potential for accidental introduction into North America. To project the potential host range of this insect if introduced into North America, survival and development of L. monacha on 26 North American and eight introduced Eurasian tree species were examined. Seven conifer species (Abies concolor, Picea abies, P. glauca, P. pungens, Pinus sylvestris with male cones, P. menziesii variety glance, and Tsuga canadensis) and six broadleaf species (Betula populifolia, Malus x domestica, Prunus serotiaa, Quercus lobata, Q. rubra, and Q. velutina) were suitable for L. monacha survival and development. Eleven of the host species tested were rated as intermediate in suitability, four conifer species (Larix occidentalis, P. nigra, P. ponderosa, P. strobus, and Pseudotsuga menziesii variety menziesii) and six broadleaf species (Carpinus caroliniana, Carya ovata, Fagus grandifolia, Populus grandidentata, Q. alba, and Tilia cordata) and the remaining 10 species tested were rated as poor (Acer rubrum, A. platanoidies, A. saccharum, F. americana, Juniperus virginiana, Larix kaempferi, Liriodendron tulipfera, Morus alba, P. taeda, and P. deltoides). The phenological state of the trees had a major impact on establishment, survival, and development of L. monacha on many of the tree species tested. Several of the deciduous tree species that are suitable for L. monacha also are suitable for L. dispar (L.) and L. mathura Moore. Establishment of L. monacha in North America would be catastrophic because of the large number of economically important tree species on which it can survive and develop, and the ability of mated females to fly and colonize new areas.

Alien plant species (ephemerophytes in Romensko-Poltavsky Geobotanical District, Ukraine

Directory of Open Access Journals (Sweden)

Dvirna Tetyana S.

2017-09-01

Full Text Available This paper presents the results of research on ephemerophytes of the alien portion of the flora of the Romensko-Poltavsky Geobotanical District (north-eastern Ukraine. It is a detailed study of this group of plants, conducted for the first time in the Ukraine. The checklist of alien vascular plants contains 345 species, of which 27 species are ephemerophytes (or 8%: Adonis aestivalis, A. annua, Papaver albiflorum, Urtica cannabina, Gypsophila perfoliata, Atriplex micrantha, Chenopodium × preissmannii, Ch. × thellungii, Rumex longifolius, Sisymbrium polymorphum, Euphorbia humifusa, Malus sylvestris, Onobrychis viciifolia, Astrodaucus orientalis, Datura tatula, Solanum schultesii, Lindernia procumbens, Melampyrum cristatum, Helianthus annuus, Petasites spurius, Xanthium ripicola × Xanthium albinum, Echinochloa tzvelevii, Panicum capillare, Panicum capillare L. subsp. barvipulvinatum, Phalaris canariensis, Setaria ×ambigua, Sorghum halepense. The basis of this work is original data of the author obtained during field studies, and a critical study of the literature, archival, cartographic materials and herbarium collections, and the use of classical methods of botanical classification. Complex research of this group of plants was conducted and as a result of these investigations the following characteristics were established: a predominance of kenophytes of Mediterranean origin in this group, species of arid areas, cosmopolitan species with a diffuse type of space structure, therophytes, herbaceous monocarpic plants, mesotrophes, heliophytes and xeromesophytes, with an insignificant degree of impact on native plant communities and with a limited distribution within the study region. The combination of these results indicates that ephemerophytes comprise a temporary, unstable component of the flora of this region of the Ukraine. The paper provides maps of the distribution of these 27 species.

Techniques for cold hardiness research for apple rootstocks

OpenAIRE

Privé, Jean-Pierre

2006-01-01

Three reliable methods are explained for estimating different types of cold hardiness in Malus. They include: 1) a whole plant controlled freezing experiment for the assessment of low mid-winter injury, 2) electrical impedance spectroscopy (Z), for the estimation of multiple freeze-thaw cycling injury and 3) a controlled freezing protocol to facilitate the rapid screening of large populations of Malus seedlings. The aim of this manuscript is not the results of these three methods but rather t...

Effects of location within the tree canopy on carbohydrates, organic acids, amino acids and phenolic compounds in the fruit peel and flesh from three apple (Malus × domestica) cultivars

Science.gov (United States)

Feng, Fengjuan; Li, Mingjun; Ma, Fengwang; Cheng, Lailiang

2014-01-01

Fruits from three cultivars of apple (Malus × domestica Borkh.)—‘McIntosh’, ‘Gala’ and ‘Mutsu’—were harvested from the exterior and interior of the tree canopy. Peel and flesh tissues were sampled separately to determine how the position of the fruit on the tree might affect the levels of the primary and secondary metabolites in the fruit. Fruit from the outer-canopy had a higher fresh weight and a higher soluble solids content compared with inner-canopy fruit. Both the flesh and peel of the outer-canopy fruit had higher concentrations of soluble sugars and sugar alcohols, but lower starch concentrations than the inner-canopy fruit. Canopy position did not significantly affect malic acid concentrations, except in the peel of ‘McIntosh’ and the flesh of ‘Mutsu’. Although levels of ascorbic and succinic acids were higher in the peel of the outer-canopy fruit, the responses of other organic acids to canopy position depended on tissue type and cultivar. Except for histidine, lysine, threonine and glycine, most amino acids accumulated at higher concentrations in the inner-canopy fruit. By contrast, levels of phenolic compounds from both the peel and flesh were significantly higher in the outer-canopy fruit. The significant effects of location within the canopy on both primary metabolites and secondary metabolites demonstrate the importance of light exposure on apple fruit quality. PMID:26504536

Pinus sylvestris L.

African Journals Online (AJOL)

STORAGESEVER

2009-01-19

Jan 19, 2009 ... Çamburnu) up to the Alpine Zone (Zigana Mountain) as high as 2400 m in Northeastern Black Sea Region. Within its distribution range ... adaptation and thus, of stability of the forest ecosystems. This is particularly important ...

Modelling the soil carbon cycle of pine ecosystems

International Nuclear Information System (INIS)

Nakane, K.

1994-01-01

Soil carbon cycling rates and carbon budgets were calculated for stands of four pine species. Pinus sylvestris (at Jaedraaas, Sweden), P. densiflora (Hiroshima, Japan), P. elliottii (Florida, USA) and P. radiata (Canberra, Australia), using a simulation model driven by daily observations of mean air temperature and precipitation. Inputs to soil carbon through litterfall differ considerably among the four pine forests, but the accumulation of the A 0 layer and humus in mineral soil is less variable. Decomposition of the A 0 layer and humus is fastest for P. densiflora and slowest for P. sylvestris stands with P. radiata and P. elliottii intermediate. The decomposition rate is lower for the P. elliottii stand than for P. densiflora in spite of its higher temperatures and slightly higher precipitation. Seasonal changes in simulated soil carbon are observed only for the A 0 layer at the P. densiflora site. Simulated soil respiration rates vary seasonally in three stands (P. sylvestris, P. densiflora and P. radiata). In simulations for pine trees planted on bare soil, all soil organic matter fractions except the humus in mineral soil recover to half their asymptotic values within 30 to 40 years of planting for P. sylvestris and P. densiflora, compared with 10 to 20 years for P. radiata and P. elliottii. The simulated recovery of soil carbon following clear-cutting is fastest for the P. elliottii stand and slowest for P. sylvestris. Management of P. elliottii and P. radiata stands on 40-years rotations is sustainable because carbon removed through harvest is restored in the interval between successive clear-cuts. However p. densiflora and P. sylvestris stands may be unable to maintain soil carbon under such a short rotation. High growth rates of P. elliottii and p. radiata stands in spite of relatively poor soil conditions and slow carbon cycling may be related to the physiological responses of species to environmental conditions. (Abstract Truncated)

Levels of selected trace elements in Scots pine (Pinus sylvestris L.), silver birch (Betula pendula L.), and Norway maple (Acer platanoides L.) in an urbanized environment.

Science.gov (United States)

Kosiorek, Milena; Modrzewska, Beata; Wyszkowski, Mirosław

2016-10-01

The aim of the study was to determine the concentrations of selected trace elements in needles and bark of Scots pine (Pinus sylvestris L.), leaves and bark of silver birch (Betula pendula L.), and Norway maple (Acer platanoides L.), as well as in the soil in which the trees grew, depending on their localization and hence the distribution of local pollution sources. The content of trace elements in needles of Scots pine, leaves of silver birch, and Norway maple and in bark of these trees depended on the location, tree species, and analyzed organ. The content of Fe, Mn, and Zn in needles, leaves, and bark of the examined tree species was significantly higher than that of the other elements. The highest average content of Fe and Mn was detected in leaves of Norway maple whereas the highest average content of Zn was found in silver birch leaves. The impact of such locations as the center of Olsztyn or roadside along Road 51 on the content of individual elements tended to be more pronounced than the influence of the other locations. The influence of the sampling sites on the content of trace elements in tree bark was less regular than the analogous effect in needles and leaves. Moreover, the relevant dependences were slightly different for Scots pine than for the other two tree species. The concentrations of heavy metals determined in the soil samples did not exceed the threshold values set in the Regulation of the Minister for the Environment, although the soil along Road 51 and in the center of Olsztyn typically had the highest content of these elements. There were also significant correlations between the content of some trace elements in soil and their accumulation in needles, leaves, and bark of trees.

Virus-induced gene silencing of the two squalene synthase isoforms of apple tree (Malus × domestica L.) negatively impacts phytosterol biosynthesis, plastid pigmentation and leaf growth.

Science.gov (United States)

Navarro Gallón, Sandra M; Elejalde-Palmett, Carolina; Daudu, Dimitri; Liesecke, Franziska; Jullien, Frédéric; Papon, Nicolas; Dugé de Bernonville, Thomas; Courdavault, Vincent; Lanoue, Arnaud; Oudin, Audrey; Glévarec, Gaëlle; Pichon, Olivier; Clastre, Marc; St-Pierre, Benoit; Atehortùa, Lucia; Yoshikawa, Nobuyuki; Giglioli-Guivarc'h, Nathalie; Besseau, Sébastien

2017-07-01

The use of a VIGS approach to silence the newly characterized apple tree SQS isoforms points out the biological function of phytosterols in plastid pigmentation and leaf development. Triterpenoids are beneficial health compounds highly accumulated in apple; however, their metabolic regulation is poorly understood. Squalene synthase (SQS) is a key branch point enzyme involved in both phytosterol and triterpene biosynthesis. In this study, two SQS isoforms were identified in apple tree genome. Both isoforms are located at the endoplasmic reticulum surface and were demonstrated to be functional SQS enzymes using an in vitro activity assay. MdSQS1 and MdSQS2 display specificities in their expression profiles with respect to plant organs and environmental constraints. This indicates a possible preferential involvement of each isoform in phytosterol and/or triterpene metabolic pathways as further argued using RNAseq meta-transcriptomic analyses. Finally, a virus-induced gene silencing (VIGS) approach was used to silence MdSQS1 and MdSQS2. The concomitant down-regulation of both MdSQS isoforms strongly affected phytosterol synthesis without alteration in triterpene accumulation, since triterpene-specific oxidosqualene synthases were found to be up-regulated to compensate metabolic flux reduction. Phytosterol deficiencies in silenced plants clearly disturbed chloroplast pigmentation and led to abnormal development impacting leaf division rather than elongation or differentiation. In conclusion, beyond the characterization of two SQS isoforms in apple tree, this work brings clues for a specific involvement of each isoform in phytosterol and triterpene pathways and emphasizes the biological function of phytosterols in development and chloroplast integrity. Our report also opens the door to metabolism studies in Malus domestica using the apple latent spherical virus-based VIGS method.

Transcriptome analysis of an apple (Malus × domestica) yellow fruit somatic mutation identifies a gene network module highly associated with anthocyanin and epigenetic regulation.

Science.gov (United States)

El-Sharkawy, Islam; Liang, Dong; Xu, Kenong

2015-12-01

Using RNA-seq, this study analysed an apple (Malus×domestica) anthocyanin-deficient yellow-skin somatic mutant 'Blondee' (BLO) and its red-skin parent 'Kidd's D-8' (KID), the original name of 'Gala', to understand the molecular mechanisms underlying the mutation. A total of 3299 differentially expressed genes (DEGs) were identified between BLO and KID at four developmental stages and/or between two adjacent stages within BLO and/or KID. A weighted gene co-expression network analysis (WGCNA) of the DEGs uncovered a network module of 34 genes highly correlated (r=0.95, P=9.0×10(-13)) with anthocyanin contents. Although 12 of the 34 genes in the WGCNA module were characterized and known of roles in anthocyanin, the remainder 22 appear to be novel. Examining the expression of ten representative genes in the module in 14 diverse apples revealed that at least eight were significantly correlated with anthocyanin variation. MdMYB10 (MDP0000259614) and MdGST (MDP0000252292) were among the most suppressed module member genes in BLO despite being undistinguishable in their corresponding sequences between BLO and KID. Methylation assay of MdMYB10 and MdGST in fruit skin revealed that two regions (MR3 and MR7) in the MdMYB10 promoter exhibited remarkable differences between BLO and KID. In particular, methylation was high and progressively increased alongside fruit development in BLO while was correspondingly low and constant in KID. The methylation levels in both MR3 and MR7 were negatively correlated with anthocyanin content as well as the expression of MdMYB10 and MdGST. Clearly, the collective repression of the 34 genes explains the loss-of-colour in BLO while the methylation in MdMYB10 promoter is likely causal for the mutation. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Genotyping-by-sequencing markers facilitate the identification of quantitative trait loci controlling resistance to Penicillium expansum in Malus sieversii.

Directory of Open Access Journals (Sweden)

John L Norelli

Full Text Available Blue mold caused by Penicillium expansum is the most important postharvest disease of apple worldwide and results in significant financial losses. There are no defined sources of resistance to blue mold in domesticated apple. However, resistance has been described in wild Malus sieversii accessions, including plant introduction (PI613981. The objective of the present study was to identify the genetic loci controlling resistance to blue mold in this accession. We describe the first quantitative trait loci (QTL reported in the Rosaceae tribe Maleae conditioning resistance to P. expansum on genetic linkage group 3 (qM-Pe3.1 and linkage group 10 (qM-Pe10.1. These loci were identified in a M.× domestica 'Royal Gala' X M. sieversii PI613981 family (GMAL4593 based on blue mold lesion diameter seven days post-inoculation in mature, wounded apple fruit inoculated with P. expansum. Phenotypic analyses were conducted in 169 progeny over a four year period. PI613981 was the source of the resistance allele for qM-Pe3.1, a QTL with a major effect on blue mold resistance, accounting for 27.5% of the experimental variability. The QTL mapped from 67.3 to 74 cM on linkage group 3 of the GMAL4593 genetic linkage map. qM-Pe10.1 mapped from 73.6 to 81.8 cM on linkage group 10. It had less of an effect on resistance, accounting for 14% of the experimental variation. 'Royal Gala' was the primary contributor to the resistance effect of this QTL. However, resistance-associated alleles in both parents appeared to contribute to the least square mean blue mold lesion diameter in an additive manner at qM-Pe10.1. A GMAL4593 genetic linkage map composed of simple sequence repeats and 'Golden Delicious' single nucleotide polymorphism markers was able to detect qM-Pe10.1, but failed to detect qM-Pe3.1. The subsequent addition of genotyping-by-sequencing markers to the linkage map provided better coverage of the PI613981 genome on linkage group 3 and facilitated discovery of q

evaluation of the antioxidant capacity of quercetin derived of natural extract from red onion ocañera (allilium strain l and red apple (pyrus malus l var. red delicius in palm oil refined industrial type continuous warm conditions

Directory of Open Access Journals (Sweden)

Golda Meyer Torres

2010-05-01

Full Text Available The research was based on the assessment of the quercetin antioxidant capacity existing in red apple (Pyrus malus L var. red delicious and ocañera red onion (Allilium cepa L. Then, antioxidant concentration was calculated by a standard curve of commercial quercetin (HPLC concentration ≥98% using spectrophotometry at 415 nm and dropped concentrations of 0.0955 mg/g in onion extract and 0.0144mg/g in apple extract. The antioxidant capacity of each extract was evaluated over industrial samples of industrial RDB (Refined, bleached and deodorized palm oil without antioxidant in order to observe the effect they had over peroxide creation. Actually, samples were treated in continuous heating for two, four and six hours and recording variables performance like acidity, iodine and peroxide index. Also, a sample of oil without antioxidant was evaluated adding pure commercial quercetin at 0.18 mg/g and a control sample of RBD palm oil added with commercial antioxidant (TBHQ, BHT. Finally, the outcome got by ANOVA analysis (Pvalue= 0.028, significance level of 5% on peroxide index formation calculated in mequivO2/kg highlighted the time of exposition than quercetin concentration in 0.0144 mg/g, hence a result alike the sample of oil added with commercial antioxidant.

Stand competition determines how different tree species will cope with a warming climate.

Directory of Open Access Journals (Sweden)

Laura Fernández-de-Uña

Full Text Available Plant-plant interactions influence how forests cope with climate and contribute to modulate species response to future climate scenarios. We analysed the functional relationships between growth, climate and competition for Pinus sylvestris, Quercus pyrenaica and Quercus faginea to investigate how stand competition modifies forest sensitivity to climate and simulated how annual growth rates of these species with different drought tolerance would change throughout the 21st century. Dendroecological data from stands subjected to thinning were modelled using a novel multiplicative nonlinear approach to overcome biases related to the general assumption of a linear relationship between covariates and to better mimic the biological relationships involved. Growth always decreased exponentially with increasing competition, which explained more growth variability than climate in Q. faginea and P. sylvestris. The effect of precipitation was asymptotic in all cases, while the relationship between growth and temperature reached an optimum after which growth declined with warmer temperatures. Our growth projections indicate that the less drought-tolerant P. sylvestris would be more negatively affected by climate change than the studied sub-Mediterranean oaks. Q. faginea and P. sylvestris mean growth would decrease under all the climate change scenarios assessed. However, P. sylvestris growth would decline regardless of the competition level, whereas this decrease would be offset by reduced competition in Q. faginea. Conversely, Q. pyrenaica growth would remain similar to current rates, except for the warmest scenario. Our models shed light on the nature of the species-specific interaction between climate and competition and yield important implications for management. Assuming that individual growth is directly related to tree performance, trees under low competition would better withstand the warmer conditions predicted under climate change scenarios but in

A Pine Is a Pine and a Spruce Is a Spruce--The Effect of Tree Species and Stand Age on Epiphytic Lichen Communities.

Science.gov (United States)

Bäcklund, Sofia; Jönsson, Mari; Strengbom, Joachim; Frisch, Andreas; Thor, Göran

2016-01-01

With an increasing demand for forest-based products, there is a growing interest in introducing fast-growing non-native tree species in forest management. Such introductions often have unknown consequences for native forest biodiversity. In this study, we examine epiphytic lichen species richness and species composition on the trunks of non-native Pinus contorta and compare these to the native Pinus sylvestris and Picea abies in managed boreal forests in northern Sweden across a chronosequence of age classes. Overall, we recorded a total of 66,209 lichen occurrences belonging to 57 species in the 96 studied forest stands. We found no difference in species richness of lichens between stands of P. contorta and P. sylvestris, but stands of P. abies had higher total species richness. However, species richness of lichens in stands of P. abies decreased with increasing stand age, while no such age effect was detected for P. contorta and P. sylvestris. Lichen species composition progressively diverged with increasing stand age, and in 30-year-old stands all three tree species showed species-specific assemblages. Epiphytic lichen assemblages in stands of 30-year-old P. contorta were influenced by greater basal area, canopy closure, and average diameter at breast height, P. abies stands by higher branch density and canopy closure, and stands of P. sylvestris by greater bark crevice depth. Differences in lichen species richness and composition were mainly explained by canopy closure and habitat availability, and the greater canopy closure in mature P. abies stands promoted the colonization and growth of calicioid lichen species. Our results indicate that the non-native P. contorta have similar species richness as the native P. sylvestris. The main difference in lichen species richness and composition is between P. abies and Pinus spp. in managed forests of boreal Sweden.

A Pine Is a Pine and a Spruce Is a Spruce--The Effect of Tree Species and Stand Age on Epiphytic Lichen Communities.

Directory of Open Access Journals (Sweden)

Sofia Bäcklund

Full Text Available With an increasing demand for forest-based products, there is a growing interest in introducing fast-growing non-native tree species in forest management. Such introductions often have unknown consequences for native forest biodiversity. In this study, we examine epiphytic lichen species richness and species composition on the trunks of non-native Pinus contorta and compare these to the native Pinus sylvestris and Picea abies in managed boreal forests in northern Sweden across a chronosequence of age classes. Overall, we recorded a total of 66,209 lichen occurrences belonging to 57 species in the 96 studied forest stands. We found no difference in species richness of lichens between stands of P. contorta and P. sylvestris, but stands of P. abies had higher total species richness. However, species richness of lichens in stands of P. abies decreased with increasing stand age, while no such age effect was detected for P. contorta and P. sylvestris. Lichen species composition progressively diverged with increasing stand age, and in 30-year-old stands all three tree species showed species-specific assemblages. Epiphytic lichen assemblages in stands of 30-year-old P. contorta were influenced by greater basal area, canopy closure, and average diameter at breast height, P. abies stands by higher branch density and canopy closure, and stands of P. sylvestris by greater bark crevice depth. Differences in lichen species richness and composition were mainly explained by canopy closure and habitat availability, and the greater canopy closure in mature P. abies stands promoted the colonization and growth of calicioid lichen species. Our results indicate that the non-native P. contorta have similar species richness as the native P. sylvestris. The main difference in lichen species richness and composition is between P. abies and Pinus spp. in managed forests of boreal Sweden.

A Pine Is a Pine and a Spruce Is a Spruce – The Effect of Tree Species and Stand Age on Epiphytic Lichen Communities

Science.gov (United States)

Bäcklund, Sofia; Jönsson, Mari; Strengbom, Joachim; Frisch, Andreas; Thor, Göran

2016-01-01

With an increasing demand for forest-based products, there is a growing interest in introducing fast-growing non-native tree species in forest management. Such introductions often have unknown consequences for native forest biodiversity. In this study, we examine epiphytic lichen species richness and species composition on the trunks of non-native Pinus contorta and compare these to the native Pinus sylvestris and Picea abies in managed boreal forests in northern Sweden across a chronosequence of age classes. Overall, we recorded a total of 66,209 lichen occurrences belonging to 57 species in the 96 studied forest stands. We found no difference in species richness of lichens between stands of P. contorta and P. sylvestris, but stands of P. abies had higher total species richness. However, species richness of lichens in stands of P. abies decreased with increasing stand age, while no such age effect was detected for P. contorta and P. sylvestris. Lichen species composition progressively diverged with increasing stand age, and in 30-year-old stands all three tree species showed species-specific assemblages. Epiphytic lichen assemblages in stands of 30-year-old P. contorta were influenced by greater basal area, canopy closure, and average diameter at breast height, P. abies stands by higher branch density and canopy closure, and stands of P. sylvestris by greater bark crevice depth. Differences in lichen species richness and composition were mainly explained by canopy closure and habitat availability, and the greater canopy closure in mature P. abies stands promoted the colonization and growth of calicioid lichen species. Our results indicate that the non-native P. contorta have similar species richness as the native P. sylvestris. The main difference in lichen species richness and composition is between P. abies and Pinus spp. in managed forests of boreal Sweden. PMID:26799558

Effects of species-specific leaf characteristics and reduced water availability on fine particle capture efficiency of trees

International Nuclear Information System (INIS)

Räsänen, Janne V.; Holopainen, Toini; Joutsensaari, Jorma; Ndam, Collins; Pasanen, Pertti; Rinnan, Åsmund; Kivimäenpää, Minna

2013-01-01

Trees can improve air quality by capturing particles in their foliage. We determined the particle capture efficiencies of coniferous Pinus sylvestris and three broadleaved species: Betula pendula, Betula pubescens and Tilia vulgaris in a wind tunnel using NaCl particles. The importance of leaf surface structure, physiology and moderate soil drought on the particle capture efficiencies of the trees were determined. The results confirm earlier findings of more efficient particle capture by conifers compared to broadleaved plants. The particle capture efficiency of P. sylvestris (0.21%) was significantly higher than those of B. pubescens, T. vulgaris and B. pendula (0.083%, 0.047%, 0.043%, respectively). The small leaf size of P. sylvestris was the major characteristic that increased particle capture. Among the broadleaved species, low leaf wettability, low stomatal density and leaf hairiness increased particle capture. Moderate soil drought tended to increase particle capture efficiency of P. sylvestris. -- Highlights: • Coniferous Scots pine was the most efficient particle collector. • Decreasing single leaf size increases particle deposition of the total leaf area. • Hairiness of the leaf increases particle deposition. -- Trees can improve air quality by removing PM 2.5 pollutants carried on the wind at a velocity of 3 m s −1 , the efficiency of which depends on species leaf characteristics and physical factors

Farklı tohum kaynaklarının Sarıçam (Pinus sylvestris L. tohum özelliklerine etkisi

Directory of Open Access Journals (Sweden)

Hakan KELEŞ

2014-12-01

Full Text Available Çalışmanın amacı; Sarıçam’da (Pinus sylvestris L. aynı orijinli ve farklı tohum kaynaklarının tohum özelliklerine etkisini belirlemektir. Araştırma alanı olarak; Çankırı-Ilgaz-Uzundağ mevkiindeki tohum meşceresi ile Çankırı-Ilgaz-Uzundağ orijinli Eskişehir-Mihalıçcık-Ormantepe mevkiindeki klonal tohum bahçesi seçilmiştir.Bu amaçla; 2004 bol tohum yılında, Ilgaz-Uzundağ mevkii 176 nolu tohum meşceresindeki 30 üstün ağaçtan ve Mihalıçcık-Ormantepe mevkiindeki 96 nolu klonal tohum bahçesinden 30 klonu temsil edecek şekilde her bir ağaçtan (ramet 20’şer adet olmak üzere toplam 1200 adet kozalak örneğinden tohum temin edilmiştir.Her bir kozalaktan elde edilen tohumlar üzerinde; tohum çapı (Thç, tohum boyu (Thb, tohum sayısı (Ths, tohum ağırlığı (Thag, bir tohum ağırlığı (BrThag,  kanat boyu (Knb, kanat eni (Knç ve kanat rengi (Knr gibi tohum ve kanata ilişkin morfolojik özellikleri belirlenmiştir.Yapılan ölçüm ve değerlendirmeler sonucunda; Ilgaz tohum meşceresine ve Mihalıçcık klonal tohum bahçesine ait tohumların ortalama değerleri sırasıyla; Ths: 30,18 adet ve 27,96 adet, Thç: 2,83 mm ve 2,73 mm, Thb: 5,13 mm ve 4,79 mm, Thag: 0,310 gr ve 0,180 gr, BrThag: 0,01 gr ve 0,006 gr, Knç: 5,82 mm ve 5,30 mm, Knb: 18,56 ve 16,6 mm olarak bulunmuştur.Sonuç olarak; Ilgaz tohum meşceresinden alınan örneklerin Mihalıçcık klonal tohum bahçesinden alınan örneklere göre, tüm özellikler bakımından daha yüksek değerlere sahip olduğu tespit edilmiştir. Bu sonuçlar; tohum bahçesindeki etkili klon sayısı, çiçeklenme fenolojisi/çiçeklenme senkronizasyonu, kendileme depresyonu gibi konuların ortaya konulmasını gerekli kılmaktadır.

Putative resistance gene markers associated with quantitative trait loci for fire blight resistance in Malus ‘Robusta 5’ accessions

Science.gov (United States)

2012-01-01

Background Breeding of fire blight resistant scions and rootstocks is a goal of several international apple breeding programs, as options are limited for management of this destructive disease caused by the bacterial pathogen Erwinia amylovora. A broad, large-effect quantitative trait locus (QTL) for fire blight resistance has been reported on linkage group 3 of Malus ‘Robusta 5’. In this study we identified markers derived from putative fire blight resistance genes associated with the QTL by integrating further genetic mapping studies with bioinformatics analysis of transcript profiling data and genome sequence databases. Results When several defined E.amylovora strains were used to inoculate three progenies from international breeding programs, all with ‘Robusta 5’ as a common parent, two distinct QTLs were detected on linkage group 3, where only one had previously been mapped. In the New Zealand ‘Malling 9’ X ‘Robusta 5’ population inoculated with E. amylovora ICMP11176, the proximal QTL co-located with SNP markers derived from a leucine-rich repeat, receptor-like protein ( MxdRLP1) and a closely linked class 3 peroxidase gene. While the QTL detected in the German ‘Idared’ X ‘Robusta 5’ population inoculated with E. amylovora strains Ea222_JKI or ICMP11176 was approximately 6 cM distal to this, directly below a SNP marker derived from a heat shock 90 family protein gene ( HSP90). In the US ‘Otawa3’ X ‘Robusta5’ population inoculated with E. amylovora strains Ea273 or E2002a, the position of the LOD score peak on linkage group 3 was dependent upon the pathogen strains used for inoculation. One of the five MxdRLP1 alleles identified in fire blight resistant and susceptible cultivars was genetically associated with resistance and used to develop a high resolution melting PCR marker. A resistance QTL detected on linkage group 7 of the US population co-located with another HSP90 gene-family member and a WRKY transcription factor

Characteristic of physical, chemical, and microbiological kombucha from various varieties of apples

Science.gov (United States)

Zubaidah, E.; Yurista, S.; Rahmadani, N. R.

2018-03-01

Kombucha is a fermented tea beverage with the addition of kombucha starter also called SCOBY (Symbiotic Culture Of Bacteria and Yeast). The purpose of this research was to know the physical, chemical and microbiological characteristics of kombucha from various varieties of apple kombucha. The study used Randomized Block Design (RAK) with one factor of apple varieties (Anna, Fuji, Granny Smith, Manalagi, Red Delicious, Rome Beauty, Royal Gala). Each treatment was repeated three times. Data was analyzed with ANOVA (Analysis of Variance). The best treatment was selected using Multiple Attribute method. Data of hedonic test was analysed using Friedman Test. The best treatment was obtained on Fuji varieties of kombucha apple with the characteristics as follows: total acid 1.33%; pH 2.95; Total phenol 268.57 μg/ml GAE; Total sugar 6.74%; Antibacterial activity against S.aureus 21.30 mm; Antibacterial activity E.coli 21.20 mm; Antioxidant activity 35.62%; Organoleptic aroma 3.55, taste 3.3; Color 3.4 (on a scale of 1-5)

The development and mapping of functional markers in Fragaria and their transferability and potential for mapping in other genera.

Science.gov (United States)

Sargent, D J; Rys, A; Nier, S; Simpson, D W; Tobutt, K R

2007-01-01

We have developed 46 primer pairs from exon sequences flanking polymorphic introns of 23 Fragaria gene sequences and one Malus sequence deposited in the EMBL database. Sequencing of a set of the PCR products amplified with the novel primer pairs in diploid Fragaria showed the products to be homologous to the sequences from which the primers were originally designed. By scoring the segregation of the 24 genes in two diploid Fragaria progenies FV x FN (F. vesca x F. nubicola F(2)) and 815 x 903BC (F. vesca x F. viridis BC(1)) 29 genetic loci at discrete positions on the seven linkage groups previously characterised could be mapped, bringing to 35 the total number of known function genes mapped in Fragaria. Twenty primer pairs, representing 14 genes, amplified a product of the expected size in both Malus and Prunus. To demonstrate the applicability of these gene-specific loci to comparative mapping in Rosaceae, five markers that displayed clear polymorphism between the parents of a Malus and a Prunus mapping population were selected. The markers were then scored and mapped in at least one of the two additional progenies.

Effects of Drought on Xylem Anatomy and Water-Use Efficiency of Two Co-Occurring Pine Species

Directory of Open Access Journals (Sweden)

Dario Martin-Benito

2017-09-01

Full Text Available Exploring how drought influences growth, performance, and survival in different species is crucial to understanding the impacts of climate change on forest ecosystems. Here, we investigate the responses of two co-occurring pines (Pinus nigra and Pinus sylvestris to interannual drought in east-central Spain by dendrochronological and wood anatomical features integrated with isotopic ratios of carbon (δ13C and oxygen (δ18O in tree rings. Our results showed that drought induces both species to allocate less carbon to build tracheid cell-walls but increases tracheid lumen diameters, particularly in the transition wood between early and latewood, potentially maximizing hydraulic conductivity but reducing resistance to embolism at a critical phase during the growing season. The thicker cell-wall-to-lumen ratio in P. nigra could imply that its xylem may be more resistant to bending stress and drought-induced cavitation than P. sylvestris. In contrast, the higher intrinsic water-use efficiency (iWUE in P. sylvestris suggests that it relies more on a water-saving strategy. Our results suggest that narrower cell-walls and reduced growth under drought are not necessarily linked to increased iWUE. At our site P. nigra showed a higher growth plasticity, grew faster and was more competitive than P. sylvestris. In the long term, these sustained differences in iWUE and anatomical characters could affect forest species performance and composition, particularly under increased drought stress.

Dynamics of Soil CO2 Profiles of Pinus sylvestris var. sylvestriformis Seedlings Under CO2 Concentration Doubled%CO2倍增条件下长白赤松幼苗土壤CO2廓线的动态

Institute of Scientific and Technical Information of China (English)

韩士杰; 张军辉; 周玉梅; 邹春静

2002-01-01

The gas-well system permanently installed in the soil was adopted for studying the dynamic relationship between CO2 profiles and seedling root growth of Pinus sylvestris var. sylvestriformis (Takenouchi) Cheng et C. D. Chu. The study was conducted in the Open Research Station of Changbai Mountain Forest Ecological System, The Chinese Academy of Sciences from 1999 to 2001. Four treatments were arranged in the rectangular open-top chambers (OTCs): ambient CO2+no-seedling, 700 μmol/mol CO2+no-seedling, ambient CO2 +seedlings, 700 μmol/mol CO2+seedlings. By collecting and analyzing soil gas synchronously, it was found that the dynamics of CO2 profiles were related to the biological activity of seedlings. There were more roots distributed in the top soil and the boundary layer across soil and sand, which made more contributions to the CO2 profiles due to respiration root. Compared with the ambient CO2, elevated CO2 led to the peak of CO2 concentration distribution shifted from soil surface layer to the boundary layer as seasonally growing of seedling roots. It is suggested the gas-well system is an inexpensive, non-destructive and relatively sensitive method for study of soil CO2 concentration profiles.%采用固定在土壤中的气井系统,监测土壤剖面的CO2动态及其与长白赤松 (Pinus sylvestris var. sylvestriformis (Takenouchi) Cheng et C. D. Chu) 幼苗根系发展之间的关系.实验研究共设4种CO2处理,分别是环境CO2浓度,无苗;CO2为700 μmol/mol,无苗;环境CO2浓度,有苗;CO2为700 μmol/mol,有苗.通过对土壤剖面CO2气体的同步采集与分析表明:土壤CO2廓线与幼苗根系的生物活性密切相关.在土壤表面及壤土和沙土的边界层中,根系分布密集,根系的呼吸作用对那两个土层CO2贡献大;随着幼苗的季节生长,与环境CO2浓度比较,CO2倍增将导致土壤剖面上CO2�

Tree Growth and Climate Relationship: Dynamics of Scots Pine (Pinus Sylvestris L.) Growing in the Near-Source Region of the Combined Heat and Power Plant During the Development of the Pro-Ecological Strategy in Poland.

Science.gov (United States)

Sensuła, Barbara; Wilczyński, Sławomir; Opała, Magdalena

Since the 1990s, the emission of pollutants was reduced in a majority of Polish and developing country factories whereas the level of energy production was similar to that prior to the 1990s. The conifer investigated in this study has grown for many years under the stress of industrial pollution. Despite this, the trees are preserved, to a large extent, sensitive to the natural climatic factors. We present a complex analysis of the climatic (sunshine, temperature, precipitation, humidity, and wind circulation) and anthropogenic factors influencing the radial increment dynamics of Scots pine ( Pinus sylvestris L.) growing in the vicinity of the combined heat and power station in Łaziska (Poland). We analyzed the spatiotemporal distribution of growth reductions, the depth of reduction with respect to the distance from the emitter, the relationship between tree growth and climate during the industry development period and during proecological strategy application . Samples of carbon isotopic composition in pine needles from 2012 to 2013 were additionally determined. Pines series of 3 positions indicate that they have a similar sensitivity to most climatic elements of the previous and given year, but there is also a different rhythm between the studied populations of incremental growth of pines. The causes of diversity are due to the different types of habitat (site types) and industrial pollution. The variation in carbon stable isotopic composition in pine needles was connected with an increase of CO 2 .

Comparing the intra-annual wood formation of three European species (Fagus sylvatica, Quercus petraea and Pinus sylvestris) as related to leaf phenology and non-structural carbohydrate dynamics.

Science.gov (United States)

Michelot, Alice; Simard, Sonia; Rathgeber, Cyrille; Dufrêne, Eric; Damesin, Claire

2012-08-01

Monitoring cambial phenology and intra-annual growth dynamics is a useful approach for characterizing the tree growth response to climate change. However, there have been few reports concerning intra-annual wood formation in lowland temperate forests with high time resolution, especially for the comparison between deciduous and coniferous species. The main objective of this study was to determine how the timing, duration and rate of radial growth change between species as related to leaf phenology and the dynamics of non-structural carbohydrates (NSC) under the same climatic conditions. We studied two deciduous species, Fagus sylvatica L. and Quercus petraea (Matt.) Liebl., and an evergreen conifer, Pinus sylvestris L. During the 2009 growing season, we weekly monitored (i) the stem radial increment using dendrometers, (ii) the xylem growth using microcoring and (iii) the leaf phenology from direct observations of the tree crowns. The NSC content was also measured in the eight last rings of the stem cores in April, June and August 2009. The leaf phenology, NSC storage and intra-annual growth were clearly different between species, highlighting their contrasting carbon allocation. Beech growth began just after budburst, with a maximal growth rate when the leaves were mature and variations in the NSC content were low. Thus, beech radial growth seemed highly dependent on leaf photosynthesis. For oak, earlywood quickly developed before budburst, which probably led to the starch decrease quantified in the stem from April to June. For pine, growth began before the needles unfolding and the lack of NSC decrease during the growing season suggested that the substrates for radial growth were new assimilates of the needles from the previous year. Only for oak, the pattern determined from the intra-annual growth measured using microcoring differed from the pattern determined from dendrometer data. For all species, the ring width was significantly influenced by growth duration

Protein (Viridiplantae): 175805 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 745:703 ... 171637:1864 ... 721813:1696 ... 3749:1696 ... 3750:1696 ... PREDICTED: cytochrome P450 87A3-like Malus domest...ica MWSLVGLSFLVSLVVIFITPWIXKWRYPKCNGALPPGSMGLPFIGETLSLIIPSYSHDLLPFIKKRVRRYGPIFRTS

Protein (Viridiplantae): 175804 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 745:703 ... 171637:1864 ... 721813:1696 ... 3749:1696 ... 3750:1696 ... PREDICTED: cytochrome P450 87A3-like Malus domest...ica MWSLVGLSFLVSLVVIFITPWIXKWRYPKCNGALPPGSMGLPFIGETLSLIIPSYSHDLLPFIKKRVRRYGPIFRTS

The diversity of polyprenol pattern in leaves of fruit trees belonging to Rosaceae and Cornaceae.

Science.gov (United States)

Wanke, M; Chojnacki, T; Swiezewska, E

1998-01-01

The polyprenol pattern in leaves of fruit trees belonging to the Rosaceae (genera: Prunus, Malus) and Cornaceae (genus: Cornus) families is presented. The content of polyprenyl acetates varied within plant species between 10-50 mg per gram of dry weight. In genus Prunus, Cornus and in representatives of species Malus domestica, a mixture of polyprenols composed of 18, 19, 20, 21 isoprene units was found. In six species of genus Prunus (sour-cherry): P. serrulata-spontanea, P. yedoensis, P. fruticosa. P. kurilensis, P. subhirtella and P. incisa the presence of a second polyprenol family, i.e. the group of prenologues consisting of prenol -35, -36, -37, etc. up to -42 was detected.

Enrichment planting without soil treatment

Energy Technology Data Exchange (ETDEWEB)

Hagner, Mats

1998-12-31

Where enrichment planting had been carried out with either of the two species Picea abies and Pinus contorta, the survival of the planted seedlings was at least as good as after planting in a normal clear cut area treated with soil scarification. This was in spite of the fact that the seedlings were placed shallow in the humus layer without any soil treatment. However, they were sheltered from insects by treatment before planting. Where enrichment planting was carried out with Pinus sylvestris the survival in dense forest was poor, but in open forest the survival was good. The growth of planted seedlings was enhanced by traditional clearing and soil treatment. However, this was for Pinus sylvestris not enough to compensate for the loss of time, 1-2 years, caused by arrangement of soil scarification. The growth of seedlings planted under crown cover was directly related to basal area of retained trees. However, the variation in height growth among individual seedlings was very big, which meant that some seedlings grow well also under a fairly dense forest cover. The pioneer species Pinus sylvestris reacted more strongly to basal area of retained trees than did the shade tolerant species Picea abies. Enrichment planting seems to be a necessary tool for preserving volume productivity, at places where fairly intensive harvest of mature trees has been carried out in stands of ordinary forest type in central Sweden. If double seedlings, with one Picea abies and one Pinus sylvestris, are used, the probability for long term establishment is enhanced 13 refs, 20 figs, 4 tabs

Genetic evaluation of seeds of highly endangered Pinus uliginosa Neumann from Węgliniec reserve for ex-situ conservation program

Directory of Open Access Journals (Sweden)

Andrzej Lewandowski

2011-01-01

Full Text Available Peat-bog pine Pinus uliginosa Neumann has become extinct or rare in many parts of Europe. We have investigated the levels of genetic variation and inbreeding in seeds collected from a highly endangered reserve of this species in Poland, using allozymes as genetic markers. Generally, a high level of genetic variation was observed. The mean expected heterozygosity was 0.376, while average (Na and effective (Ne numbers of alleles per locus were 2.45 and 1.67, respectively. Nevertheless, we have detected relatively low levels of outcrossing, and potential biparental inbreeding. The population-wide multilocus outcrossing rate was estimated to be 0.706 (±0.091, while the minimum variance mean of single-locus estimates was distinctly lower (ts=0.611. The estimates of outcrossing calculated for individual trees ranged widely from 0.051 to 1.017, indicating the complexity of outcrossing patterns. The investigated population of P. uliginasa from Węgliniec is small and surrounded by extensive forest stands of P. sylvestris. Our three-year records of phenological observations demonstrated that flowering periods for P. uliginosa and P. sylvestris overlap, allowing for cross-pollination. The possibility of P. uliginosa pollination by P. sylvestris creates a potential danger of genetic erosion of the P. uliginosa gene pool. Nonetheless, based on a species specific cpDNA marker we have found that among 533 seedlings of P. uliginosa there were only six seedlings carrying cpDNA marker specific for P. sylvestris, indicating that such hybridization seems to be rare.

Identification of host fruit volatiles from domestic apple (Malus domestica), native black hawthorn (Crataegus douglasii) and introduced ornamental hawthorn (C. monogyna) attractive to Rhagoletis pomonella flies from the western United States.

Science.gov (United States)

Cha, Dong H; Yee, Wee L; Goughnour, Robert B; Sim, Sheina B; Powell, Thomas H Q; Feder, Jeffrey L; Linn, Charles E

2012-03-01

The apple maggot fly, Rhagoletis pomonella, infests apple (Malus domestica) and hawthorn species (most notably the downy hawthorn, Crataegus mollis) in the eastern USA. Evidence suggests that the fly was introduced into the western USA sometime in the last 60 years. In addition to apple, R. pomonella also infests two species of hawthorns in the western USA as major hosts: the native black hawthorn (C. douglasii) and the introduced ornamental English hawthorn, C. monogyna. Apple and downy hawthorn-origin flies in the eastern USA use volatile blends emitted from the surface of their respective ripening fruit to find and discriminate among host trees. To test whether the same is true for western flies, we used coupled gas chromatography and electroantennographic detection (GC-EAD) and developed a 7-component apple fruit blend for western apple-origin flies, an 8-component black hawthorn fruit blend for flies infesting C. douglasii, and a 9-component ornamental hawthorn blend for flies from C. monogyna. Crataegus douglasii and C. monogyna-origin flies showed similar levels of upwind directed flight to their respective natal synthetic fruit blends in flight tunnel assays compared to whole fruit adsorbent extracts, indicating that the blends contain all the behaviorally relevant fruit volatiles to induce maximal response levels. The black and ornamental hawthorn blends shared four compounds in common including 3-methylbutan-1-ol, which appears to be a key volatile for R. pomonella populations in the eastern, southern, and western USA that show a preference for fruit from different Crataegus species. However, the blends also differed from one another and from domesticated apple in several respects that make it possible that western R. pomonella flies behaviorally discriminate among fruit volatiles and form ecologically differentiated host races, as is the case for eastern apple and hawthorn flies.

Características de qualidade de cultivares de maçã: avaliação físico-química e sensorial de quinze cultivares Quality profile of 15 apple cultivars

Directory of Open Access Journals (Sweden)

Gilvan Wosiacki

2004-09-01

Full Text Available Neste trabalho são apresentados aspectos de qualidade de interesse industrial de 15 cultivares de maçãs. A análise sensorial das frutas in natura discriminou as amostras de Melrose, Fred Housh, M 51/90 e Malus 71/90 como capazes de promover o processo de compra e de instalação do hábito de consumo. A análise sensorial dos sucos de frutas discrimina apenas a cultivar comercial Belgolden como interessante. Os sucos feitos com as amostras de maçãs apresentaram uma variação de 12 a 16ºBRIX e o valor médio de ácido málico foi de 0,362g/100mL. Os teores de compostos fenólicos apresentaram uma média de 316mg/L e um desvio padrão de 70mg/L (C.V.= 22%. Os indicadores industriais são elevados demais para serem comparados com aqueles necessários, abaixo de 20/25; os valores médios encontrados neste conjunto de maçãs foram de 45 (índice BRIX/acidez e 40,2 (índice ART/acidez. As amostras codificadas foram categorizadas como amargas, com um grupo de doces-amargas (as comerciais Fred Housh, Marquesa, Sansa e Romu, e as experimentais M 51/90 e todas as Malus e outro de ácidas-amargas (as demais cultivares estudadas. As amostras mais interessantes para o processamento industrial de suco clarificado são a Belgolden, as Coop 25 e 26, a Melrose e a Malus 67/90. A Sansa desponta como portadora de maior teor de frutose e potencialmente como matéria-prima para a elaboração de bebidas com apelo funcional.The article shows some figures concerning industrial aplications of samples from apple cultivars. Sensorial evaluation of the apples in natura indicated Melrose, Fred Housh, M 51/90 and Malus 71/90 as able to satisfy the consumer. Sensorial evaluation of the apple juice shows only one interesting variety, Belgolden. The juices showed 12 to 16ºBRX and a mean value of malic acid of 0,362g/100mL. Total phenol compounds showed a mean of 316mg/l (C.V.= 22%. Ratios concerning total sugar or total soluble solids: malic acid were too high as

Gene conversion of ribosomal DNA in Nicotiana tabacum is associated with undermethylated, decondensed and probably active gene units.

Science.gov (United States)

Lim, K Y; Kovarik, A; Matýăsek, R; Bezdĕk, M; Lichtenstein, C P; Leitch, A R

2000-06-01

We examined the structure, intranuclear distribution and activity of ribosomal DNA (rDNA) in Nicotiana sylvestris (2n = 2x = 24) and N. tomentosiformis (2n = 2x = 24) and compared these with patterns in N. tabacum (tobacco, 2n = 4x = 48). We also examined a long-established N. tabacum culture, TBY-2. Nicotiana tabacum is an allotetraploid thought to be derived from ancestors of N. sylvestris (S-genome donor) and N. tomentosiformis (T-genome donor). Nicotiana sylvestris has three rDNA loci, one locus each on chromosomes 10, 11, and 12. In root-tip meristematic interphase cells, the site on chromosome 12 remains condensed and inactive, while the sites on chromosomes 10 and 11 show activity at the proximal end of the locus only. Nicotiana tomentosiformis has one major locus on chromosome 3 showing activity and a minor, inactive locus on chromosome 11. In N. tabacum cv. 095-55, there are four rDNA loci on T3, S10, S11/t and S12 (S11/t carries a small T-genome translocation). The locus on S12 remains condensed and inactive in root-tip meristematic cells while the others show activity, including decondensation at interphase and secondary constrictions at metaphase. Nicotiana tabacum DNA digested with methylcytosine-sensitive enzymes revealed a hybridisation pattern for rDNA that resembled that of N. tomentosiformis and not N. sylvestris. The data indicate that active, undermethylated genes are of the N. tomentosiformis type. Since S-genome chromosomes of N. tabacum show rDNA expression, the result indicates rDNA gene conversion of the active rDNA units on these chromosomes. Gene conversion in N. tabacum is consistent with the results of previous work. However, using primers specific for the S-genome rDNA intergenic sequences (IGS) in the polymerase chain reaction (PCR) show that rDNA gene conversion has not gone to completion in N. tabacum. Furthermore, using methylation-insensitive restriction enzymes we demonstrate that about 8% of the rDNA units remain of the N

Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

Index Scriptorium Estoniae

Häniläne,, pseud.

2008-01-01

Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

Effects of temperature and drought manipulations on seedlings of Scots pine provenances.

Science.gov (United States)

Taeger, S; Sparks, T H; Menzel, A

2015-03-01

Rising temperatures and more frequent and severe climatic extremes as a consequence of climate change are expected to affect growth and distribution of tree species that are adapted to current local conditions. Species distribution models predict a considerable loss of habitats for Pinus sylvestris. These models do not consider possible intraspecific differences in response to drought and warming that could buffer those impacts. We tested 10 European provenances of P. sylvestris, from the southwestern to the central European part of the species distribution, for their response to warming and to drought using a factorial design. In this common-garden experiment the air surrounding plants was heated directly to prevent excessive soil heating, and drought manipulation, using a rain-out shelter, permitted almost natural radiation, including high light stress. Plant responses were assessed as changes in phenology, growth increment and biomass allocation. Seedlings of P. sylvestris revealed a plastic response to drought by increased taproot length and root-shoot ratios. Strongest phenotypic plasticity of root growth was found for southwestern provenances, indicating a specific drought adaptation at the cost of overall low growth of aboveground structures even under non-drought conditions. Warming had a minor effect on growth but advanced phenological development and had a contrasting effect on bud biomass and diameter increment, depending on water availability. The intraspecific variation of P. sylvestris provenances could buffer climate change impacts, although additional factors such as the adaptation to other climatic extremes have to be considered before assisted migration could become a management option. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

Efektifitas Fungsida Berbahan Aktif Pyraclostrobin 50 G/KG + Metiram G/KG untuk Mengendalikan Penyakit Embun Tepung (Podosphaera leucotrica Pada Tanaman Apel

Directory of Open Access Journals (Sweden)

Eli Korlina

2016-03-01

Full Text Available Pengujian efektifitas fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg untuk mengendalian  penyakit embun tepung (Podosphaera leucotricha pada tanaman apel telah dilaksanakan di kebun apel milik petani Desa Wringinanom, Kecamatan Poncokusumo, Kabupaten Malang yang beriklim tinggi kering dengan ketinggian tempat ±  850 diatas permukaan laut (dpl, mulai bulan Pebruari sampai dengan April 2011, menggunakan kultivar apel  Manalagi yang telah berumur 8-10 tahun.  Perlakuan terdiri atas Fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg dengan 4 (empat tingkat konsentrasi yaitu 0,5; 1,0; 1,5; dan 2,0 g/l air, dan kontrol (tanpa perlakuan, disusun dalam rancangan acak kelompok  (RAK dan diulang 4 kali. Hasil pengujian menunjukkan bahwa Fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg konsentrasi 0,5-2 g/l air telah efektif mengendalikan penyakit embun tepung P. leucotricha pada tanaman apel dengan penekanan  serangan sebesar 44,42-54,73%.  Rata-rata produksi buah apel berkisar antara 8,49 – 10,38 kg/pohon. Tanaman apel yang diaplikasi dengan fungisida tersebut tidak mengalami fitotoksisitas.Kata Kunci: Apel, penyakit embun tepung (Podosphaera leucotricha.

The chromosomal distribution of histone methylation marks in gymnosperms differs from that of angiosperms.

Science.gov (United States)

Fuchs, Jörg; Jovtchev, Gabriele; Schubert, Ingo

2008-01-01

The chromosomal distribution of seven histone methylation marks (H3K4me2, H3K9me1,2,3 and H3K27me1,2,3) was analysed in the gymnosperm species Pinus sylvestris and Picea abies. Similarly to the situation in other investigated eukaryotes, dimethylation of lysine 4 of histone H3 is restricted to euchromatin in gymnosperms. Surprisingly, also H3K9me1-a mark classified as heterochromatin-specific in angiosperms-labels the euchromatin in P. sylvestris and P. abies. The other investigated methylation marks are either equally distributed along the chromosomes, as H3K9me2 and H3K27me1 (in both species) and H3K9me3 (in P. abies), or enriched at specific types of heterochromatin, as H3K9me3 (in P. sylvestris) and H3K27me2 and H3K27me3 in both species. Although the methylation marks themselves are apparently conserved, their functional specificity within the frame of the 'epigenetic code' might have diverged during evolution.

Climate signals derived from cell anatomy of Scots pine in NE Germany.

Science.gov (United States)

Liang, Wei; Heinrich, Ingo; Simard, Sonia; Helle, Gerhard; Liñán, Isabel Dorado; Heinken, Thilo

2013-08-01

Tree-ring chronologies of Pinus sylvestris L. from latitudinal and altitudinal limits of the species distribution have been widely used for climate reconstructions, but there are many sites within the temperate climate zone, as is the case in northeastern Germany, at which there is little evidence of a clear climate signal in the chronologies. In this study, we developed long chronologies of several cell structure variables (e.g., average lumen area and cell wall thickness) from P. sylvestris growing in northeastern Germany and investigated the influence of climate on ring widths and cell structure variables. We found significant correlations between cell structure variables and temperature, and between tree-ring width and relative humidity and vapor pressure, respectively, enabling the development of robust reconstructions from temperate sites that have not yet been realized. Moreover, it has been shown that it may not be necessary to detrend chronologies of cell structure variables and thus low-frequency climate signals may be retrieved from longer cell structure chronologies. The relatively extensive resource of archaeological material of P. sylvestris covering approximately the last millennium may now be useful for climate reconstructions in northeastern Germany and other sites in the temperate climate zone.

Holocene distribution of woody taxa at the westernmost limit of the Circumboreal/Mediterranean boundary: Evidence from wood remains

Science.gov (United States)

Rubiales, Juan M.; Ezquerra, Javier; Muñoz Sobrino, Castor; Génova, María M.; Gil, Luis; Ramil-Rego, Pablo; Gómez Manzaneque, Fernando

2012-02-01

Macrofossils and megafossils of different genera, which were found in twelve localities in the mountains of northwest Iberia, provide spatially precise evidence of their distribution in the region during the Holocene. Macrofossils were recovered from mires, eroded peat bogs and lakes, identified by their wood anatomy and dated using radiocarbon methods. Conifers (Pinus), deciduous trees (Betula, Salix, Quercus) and shrubs (Erica, Fabaceae) were identified. The findings of Pinus gr. sylvestris/nigra have special biogeographical significance. The available palaeoecological data from the Cantabrian Range and nearby mountains (Ancares and Courel) indicate that pines have grown during the Holocene over the highlands of the western part of the Cantabrian Range area as a natural vegetation element. Nevertheless, Pinus sylvestris is the only pine species that is currently present in the Cantabrian Mountains, and its natural distribution area is now limited to a few enclaves. In this study, we provide a number of conclusive findings demonstrating that the past distribution of Pinus gr. sylvestris/nigra in this region suffered an important range contraction during the last two millennia. Historical data also support this idea, as they strongly suggest that this species survived well into the historical period.

The AINTEGUMENTA genes, MdANT1 and MdANT2, are associated with the regulation of cell production during fruit growth in apple (Malus × domestica Borkh.).

Science.gov (United States)

Dash, Madhumita; Malladi, Anish

2012-06-25

Fruit growth in apple (Malus × domestica Borkh.) is mediated by cell production and expansion. Genes involved in regulating these processes and thereby fruit growth, are not well characterized. We hypothesized that the apple homolog(s) of AINTEGUMENTA (ANT), an APETALA2-repeat containing transcription factor, regulates cell production during fruit growth in apple. Two ANT genes, MdANT1 and MdANT2, were isolated from apple and their expression was studied during multiple stages of fruit development. MdANT1 and MdANT2 expression was high during early fruit growth coincident with the period of cell production, rapidly declined during exit from cell production, and remained low during the rest of fruit development. The effects of increase in carbohydrate availability during fruit growth were characterized. Increase in carbohydrate availability enhanced fruit growth largely through an increase in cell production. Expression of MdANT1 and MdANT2 increased sharply by up to around 5-fold in response to an increase in carbohydrate availability. Expression of the ANT genes was compared across two apple genotypes, 'Gala' and 'Golden Delicious Smoothee' (GS), which differ in the extent of fruit growth, largely due to differences in cell production. In comparison to 'Gala', the larger fruit-size genotype, GS, displayed higher levels and a longer duration of MdANT1 and MdANT2 expression. Expression of the ANTs and cell cycle genes in the fruit core and cortex tissues isolated using laser capture microdissection was studied. During early fruit growth, expression of the MdANTs was higher within the cortex, the tissue that constitutes the majority of the fruit. Additionally, MdANT1 and MdANT2 expression was positively correlated with that of A- and B-type CYCLINS, B-type CYCLIN-DEPENDENT-KINASES (CDKBs) and MdDEL1. Multiple lines of evidence from this study suggest that MdANT1 and MdANT2 regulate cell production during fruit growth in apple. ANTs may coordinate the expression of

QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT90901 Malus x domestica Rosaceae ... Tensile testing of apple peels_Maximum force Maximum force..., one of the parameters measured during the tensile testing of apple peels. Highest force value

Role of nurse shrubs for restoration planting of two conifers in southeast of Mu Us Sandland, China.

Science.gov (United States)

Tian, Li; Wang, Xiaoan

2015-01-01

Two-year-old pine seedlings, Pinus tabulaeformis and Pinus sylvestris were planted under the canopies of three shrub species and in open areas to test for facilitation during seedling establishment in southeast of Mu Us Sandland in northern part of Shaanxi, China. Pine seedlings establishment were assessed three times within three consecutive growing seasons. Height, area and volume of shrubs were measured. Microclimate conditions (light intensity, air temperature and soil temperature and moisture) were recorded in four microhabitats. Near surface light intensity, air temperature and soil temperature were lower under shrubs, which led to higher soil moisture and pine seedlings under the canopy of shrub species. Pine seedlings survival was remarkably higher when planted under the canopy of shrub species (65.7% for P. tabulaeformis and 60.6% for P. sylvestris) as compared with open areas (22.4% for P. tabulaeformis and 38% for P. sylvestris). P. tabulaeformis with shade-tolerance trait expressed high survival of seedlings as compared to that of P. sylvestris seedlings under the canopy of shrub species (Tukey test, P shrub (Caragana korshinskii and Amorpha fruticosa) showed continuously facilitation during moderate drought stress (summer 2012, 2013 and 2014), but dense and small shrub (Caragana korshinskii) reduced the establishment of seedlings possibly for light competition. Salix cheilophila showed a facilitation effect in growing seasons, but the effect of allelopathy led to high mortality of seedlings under their canopy. in addition, two pine growths were not inhibited when planted under three shrubs. In conclusions, nurse-shrub facilitation can be used as an effective restoration strategy in this sandland. However, use of shrubs as nurse plants depends on their canopy structure and ecological impacts; the selection of target species depends on their shade tolerance traits.

Leaf non-structural carbohydrate allocation and C:N:P stoichiometry in response to light acclimation in seedlings of two subtropical shade-tolerant tree species.

Science.gov (United States)

Xie, Hongtao; Yu, Mukui; Cheng, Xiangrong

2018-03-01

Light availability greatly affects plant growth and development. In shaded environments, plants must respond to reduced light intensity to ensure a regular rate of photosynthesis to maintain the dynamic balance of nutrients, such as leaf non-structural carbohydrates (NSCs), carbon (C), nitrogen (N) and phosphorus (P). To improve our understanding of the nutrient utilization strategies of understory shade-tolerant plants, we compared the variations in leaf NSCs, C, N and P in response to heterogeneous controlled light conditions between two subtropical evergreen broadleaf shade-tolerant species, Elaeocarpus sylvestris (E. sylvestris) and Illicium henryi (I. henryi). Light intensity treatments were applied at five levels (100%, 52%, 33%, 15% and 6% full sunlight) for 30 weeks to identify the effects of reduced light intensity on leaf NSC allocation patterns and leaf C:N:P stoichiometry characteristics. We found that leaf soluble sugar, starch and NSC concentrations in E. sylvestris showed decreasing trends with reduced light intensity, whereas I. henryi presented slightly increasing trends from 100% to 15% full sunlight and then significant decreases at extremely low light intensity (6% full sunlight). The soluble sugar/starch ratio of E. sylvestris decreased with decreasing light intensity, whereas that of I. henryi remained stable. Moreover, both species exhibited increasing trends in leaf N and P concentrations but limited leaf N:P and C:P ratio fluctuations with decreasing light intensity, revealing their adaptive strategies for poor light environments and their growth strategies under ideal light environments. There were highly significant correlations between leaf NSC variables and C:N:P stoichiometric variables in both species, revealing a trade-off in photosynthesis production between leaf NSC and carbon allocation. Thus, shade-tolerant plants readjusted their allocation of leaf NSCs, C, N and P in response to light acclimation. Redundancy analysis showed

Arabidopsis CDS blastp result: AK063995 [KOME

Lifescience Database Archive (English)

Full Text Available AK063995 001-124-E11 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehy...drogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...

Arabidopsis CDS blastp result: AK101517 [KOME

Lifescience Database Archive (English)

Full Text Available AK101517 J033046H09 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehyd...rogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...

Pollen flora of pakistan-lxxi. rosaceae

International Nuclear Information System (INIS)

Perveen, A.; Qaiser, M.

2014-01-01

Pollen morphology of 50 species representing 17 genera of the family Rosaceae i.e., Alchemilla, Argimonia, Cotoneaster, Crataegus, Duchesnea, Fragaria, Eriybotyra, Filipandula, Geum, Malus, Prunus, Potentilla, Pyrus , Rosa, Sibbaldia, Sorbaria and Sorbus has been studied from Pakistan by light and scanning electron microscope. Pollen grains are usually free, radially symmetrical, isopolar, prolate-spheroidal to subprolate or oblate-spheroidal rarely perprolate, tricolporate rarely tricolpate. Tectum mostly coarsely-finely striate, rarely striate-rugulate, scabrate or spinulose often reticulate. Rosaceae is more or less eurypalynous family. Significant variation is found in P/E ratio, shape and exine ornamentation and on the basis of these characters family has been divided into seven pollen types viz., Agrimonia eupatoria-type, Alchemilla ypsilotoma-type, Cotoneaster affinis-type, Fragaria nubicola-type, Geum roylei-type, Malus pumila-type, Potentilla pamirica-type. Pollen data is useful at specific and generic level. (author)

A dose rate causes no fluctuating asymmetry indexes changes in silver birch (Betula pendula (L.) Roth.) leaves and Scots pine (Pinus sylvestris L.) needles in the Chernobyl Exclusion Zone.

Science.gov (United States)

Kashparova, Elena; Levchuk, Sviatoslav; Morozova, Valeriia; Kashparov, Valery

2018-06-04

The assessment of the fluctuating asymmetry based on measurement of the parameters of left and right parts of silver birch (Betula pendula (L.) Roth.) leaves and relative sizes of pairs of Scots pine (Pinus sylvestris L.) needles from the Chernobyl Exclusion Zone (ChEZ) was carried out. Twelve samples of both birch leaves and pairs of needles were collected from 10 trees at 5 sites in the Chernobyl Exclusion Zone and also at one control site located outside the ChEZ. Values of gamma dose rate in the air varied between the sites from 0.1 to 40 μGy h -1 . Activity concentrations of 90 Sr and 137 Cs in the birch leaves varied over the range of 0.9÷2460 kBq kg -1 and 0.1÷339 kBq·kg -1 (DW), respectively. In addition to the above, in the Scots pine needles, these ranges were 0.7 ÷1970 kBq kg -1 f for 90 Sr and 0.1÷78 kBq kg -1 (DW) for 137 Cs. From the values of the radionuclides activity concentrations in the plants, the internal dose rate is estimated to be in the range of 0.1 ÷ 274 μGy h -1 . The main sources of the internal dose rate were radiation of 90 Sr and 90 Y. Indices of fluctuating asymmetry of silver birch leaves and Scots pine needles varied over the range of 0.048 ± 0.007 ÷ 0.060 ± 0.009 and 0.014 ± 0.002 ÷ 0.018 ± 0.002, respectively, and did not statistically differ for all experimental sites. The indices also did not depend on the external or internal dose rate of ionizing radiation for plants. The above findings seem to be consistent with other research effort in terms of understanding the response of organisms to chronic pollutant exposure and the long-term effects of large scale nuclear accidents. Copyright © 2018 Elsevier Ltd. All rights reserved.

Influência de diferentes concentrações dos fitorreguladores ácido 6-benzilaminopurina e ácido naftalenoacético na propagação vegetativa de Malva sylvestris L.

Directory of Open Access Journals (Sweden)

M. Filter

2014-03-01

Full Text Available Malva sylvestris L. (família Malvaceae, conhecida como malva, é uma espécie medicinal nativa da Europa, cultivada no sul do Brasil. A espécie tem propriedade adstringente, suaviza a irritação dos tecidos e reduz inflamações, entre outras características e atributos medicinais. O estudo teve como objetivo verificar a eficiência dos hormônios ANA (ácido naftalenoacético e BAP (ácido 6-Benzilaminopurina na propagação vegetativa a partir do estabelecimento in vitro de segmentos nodais. Segmentos nodais obtidos de plantas matrizes mantidas em casa de vegetação foram submetidos à desinfestação e inoculados em meio MS (Murashige e Skoog com diferentes concentrações e combinações de ANA (ácido naftalenoacético e BAP (ácido 6-Benzilaminopurina totalizando oito tratamentos com 60 repetições cada. Os explantes foram mantidos em sala de crescimento e, ao completar sete dias, as plântulas obtidas foram retiradas e avaliadas quanto ao número de folhas, altura total (cm e massa fresca (g. As plântulas foram fixadas em substrato "Big bio" e transferidas para casa de vegetação com nebulização. Os dados obtidos foram submetidos à Análise de Variância, seguido pelo Teste de Tukey. As plântulas obtidas em meio MS acrescido de 2,0 mg/Lˉ¹ de BAP e de 0,5 mg/Lˉ¹ de ANA foram as que apresentaram maior média nas três variáveis avaliadas, sendo então o mais indicado para a produção de mudas. Em 10 dias foi observado o enraizamento de todas as plântulas transferidas para casa de vegetação. A aclimatização e o enraizamento ex vitro ocorrem em uma única etapa sem a necessidade da utilização de enraizadores. A técnica desenvolvida demonstra a possibilidade de produção de mudas com custos reduzidos, em larga escala, e com a garantia de fornecer mudas aptas para o cultivo em apenas 17 dias.

Banking culture and collective responsibility: A memorandum to the UK Parliamentary Commission on Banking Standards

NARCIS (Netherlands)

N. Dorn (Nicholas)

2013-01-01

textabstractBasic assumptions • There is wide interest in connecting issues of (i) occupational culture, (ii) compliance/ misconduct, (iii) remuneration and (iv) clawback (the bonus/malus debate). • Individual-focussed measures (supervision, remuneration and measures in civil or criminal law) must

Arabidopsis CDS blastp result: AK241265 [KOME

Lifescience Database Archive (English)

Full Text Available AK241265 J065132C02 At5g51970.2 68418.m06450 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

Arabidopsis CDS blastp result: AK241265 [KOME

Lifescience Database Archive (English)

Full Text Available AK241265 J065132C02 At5g51970.1 68418.m06449 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

Arabidopsis CDS blastp result: AK287708 [KOME

Lifescience Database Archive (English)

Full Text Available AK287708 J065132C02 At5g51970.2 68418.m06450 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT90902 Malus x domestica Rosaceae ... Tensile testing of apple peels_Max force distance Max force... the x-axis corresponding to the maximum force value. 1 ... Chr15 30.7 4.41 ... 10.1093/jxb/erv366 26220084

A comparative ultrastructural study of pit membranes with plasmodesmata associated thickenings in four angiosperm species

NARCIS (Netherlands)

Rabaey, D.; Lens, F.; Huysmans, S.; Smets, E.; Jansen, S.

2008-01-01

Recent micromorphological observations of angiosperm pit membranes have extended the number and range of taxa with pseudo-tori in tracheary elements. This study investigates at ultrastructural level (TEM) the development of pseudo-tori in the unrelated Malus yunnanensis, Ligustrum vulgare,

Anti-Helicobacter pylori activity of plant extracts traditionally used for the treatment of gastrointestinal disorders

Science.gov (United States)

Cogo, Laura Lúcia; Monteiro, Cristina Leise Bastos; Miguel, Marilis Dallarmi; Miguel, Obdulio Gomes; Cunico, Miriam Machado; Ribeiro, Marcelo Lima; de Camargo, Eloá Ramalho; Kussen, Gislene Maria Botão; Nogueira, Keite da Silva; Costa, Libera Maria Dalla

2010-01-01

The antibacterial activity of plant extracts obtained from Bixa orellana L., Chamomilla recutita L., Ilex paraguariensis A. St.-Hil., Malva sylvestris L., Plantago major L. and Rheum rhaponticum L. has been evaluated against two reference strains and eleven clinical isolates of Helicobacter pylori. All the plant species chosen are used in popular Brazilian cuisine and folk medicine in the treatment of gastrointestinal disorders. Initial screening was made by the disk diffusion test and then minimum inhibitory concentration was determined by the agar dilution method. The results presented in this work demonstrated that among the plant preparations analyzed, B. orellana L., C. recutita L., I. paraguariensis A. St.-Hil. and M. sylvestris L. were capable of inhibiting the in vitro growth of H. pylori. PMID:24031496

Seasonal variations in phosphorus fractions in semiarid sandy soils under different vegetation types

Science.gov (United States)

Qiong Zhao; Dehui Zeng; Zhiping Fan; Zhanyuan Yu; Yalin Hu; Jianwei Zhang

2009-01-01

We investigated the seasonal patterns of soil phosphorus (P) fractions under five vegetation types – Ulmus macrocarpa savanna, grassland, Pinus sylvestris var. mongolica plantation, Pinus tabulaeformis plantation, and Populus simonii plantation ...

In vitro seed germination and rootstock establishing for micrografting of Theobroma cacao L

Science.gov (United States)

Micrografting has been successfully implemented in several plant species of Acacia, Citrus, Eucalyptus, Havea, Malus, Olea, Opuntia, Prunus and other genera. This technique is employed for plant rejuvenation, true-to-type propagation, genetic improvement, recovery of virus-free plants, testing of po...

Dicty_cDB: VFN613 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available gnments: (bits) Value ( P49349 ) RecName: Full=Farnesyl pyrophosphate synthetase; ... 182 1e-44 EU399544_1( EU399544 |pid:none) Ganod...erma lucidum farnesyl-diphosp... 178 1e-43 AY083165_1( AY083165 |pid:none) Malus x

Phylogenetic relationships among Maloideae species

Science.gov (United States)

The Maloideae is a highly diverse sub-family of the Rosaceae containing several agronomically important species (Malus sp. and Pyrus sp.) and their wild relatives. Previous phylogenetic work within the group has revealed extensive intergeneric hybridization and polyploidization. In order to develop...

Tissue location of resistance in apple to the rosy apple aphid established by electrical penetration graphs

NARCIS (Netherlands)

Marchetti, E.; Civolani, S.; Leis, M.; Chicca, M.; Tjallingii, W.F.; Pasqualini, E.; Baroni, P.

2009-01-01

A study of the constitutive resistance of the apple cultivar Florina, Malus domestica Borkh. (Rosaceae), to the rosy apple aphid, Dysaphis plantaginea (Passerini) (Homoptera Aphididae), was performed for the first time by the electrical penetration graph (DC-EPG) system, using the susceptible apple

QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT96018 Malus x domestica Rosaceae ... phenotypic mean value of normalized difference... vegetation index phenotypic mean value of normalized difference vegetation index under the water stress (drought) condition 3 ... LG_06 ... 1 4.02 ... 10.1093/jxb/erv355 26208644

Environmental effects on stem water deficit in co-occurring conifers exposed to soil dryness

Science.gov (United States)

Oberhuber, Walter; Kofler, Werner; Schuster, Roman; Wieser, Gerhard

2015-04-01

We monitored dynamics of stem water deficit (Δ W) and needle water potential ( Ψ) during two consecutive growing seasons (2011 and 2012) in a dry inner Alpine environment (750 m above sea level, Tyrol, Austria), where Pinus sylvestris, Picea abies and Larix decidua form mixed stands. Δ W was extracted from stem circumference variations, which were continuously recorded by electronic band dendrometers (six trees per species) and correlations with environmental variables were performed. Results revealed that (i) Δ W reached highest and lowest values in P. abies and L. decidua, respectively, while mean minimum water potential ( Ψ ea) amounted to -3.0 MPa in L. decidua and -1.8 MPa in P. abies and P. sylvestris. (ii) Δ W and Ψ ea were significantly correlated in P. abies ( r = 0.630; P = 0.038) and L. decidua ( r = 0.646; P = 0.032). (iii) In all species, Δ W reached highest values in late summer and was most closely related to temperature ( P drought-sensitive L. decidua and drought-tolerant P. sylvestris indicate that various water storage locations are depleted in species showing different strategies of water status regulation, i.e. anisohydric vs. isohydric behavior, respectively, and/or water uptake efficiency differs among these species. Close coupling of Δ W to temperature suggests that climate warming affects plant water status through its effect on atmospheric demand for moisture.

Characterization of Cypress Wood for Kraft Pulp Production

Directory of Open Access Journals (Sweden)

António J. A. Santos

2014-06-01

Full Text Available Wood samples of Cupressus arizonica, C. lusitanica, and C. sempervirens were evaluated for chemical, anatomical, and pulp characteristics as raw material for pulp production. Two 17-year-old trees per species were harvested, and wood samples were taken at a height of 2 m. Wood chips from Pinus pinaster (Portugal and P. sylvestris (Finland were used as references. C. arizonica differed from C. lusitanica and C. sempervirens with significantly lower (p < 0.05 tracheid diameter and wall thickness in the earlywood. The total extractives contents were 3.9%, 3.3%, and 2.5% for C. lusitanica, C. sempervirens, and C. arizonica, respectively, lower than the 5.1% for P. pinaster and 4.5% for P. sylvestris. Klason lignin content ranged from 33.0 to 35.6%, higher than the 28.0 to 28.7% for the pinewoods. The kraft pulp yields for C. arizonica, C. lusitanica, and C. sempervirens were 37.7%, 36.7%, and 38.7%, respectively, with kappa numbers of 32.0, 31.6, and 28.7, respectively; the yield values were 40.8% and 42.8%, with kappa numbers of 23.4 and 21.0, for P. pinaster and P. sylvestris, respectively. The cypress species are clearly different from pine in relation to wood pulping behavior. Among the cypress, C. sempervirens provided the best pulping results.

Role of abscisic acid (aba) in modulating the responses of two apple rootstocks to drought stress

International Nuclear Information System (INIS)

Zhang, L.; Li, X.; Li, B.; Han, M.; Liu, F.; Zhang, L.; Zheng, P.

2014-01-01

Drought stress is considered as the main limiting factor for apple (Malus domestica L.) production in some semi-arid areas of China. In this study, we investigated the modulation role of abscisic acid (ABA) and fluridone (ABA synthesis inhibitor) on water relations and antioxidant enzyme system in 2-year-old seedlings of two apple rootstocks i.e. Malus sieversii (Ledeb.) Roem. (MS) and Malus hupehensis (Pamp.) Rehd. (MH). Drought stress induced ion leakage, accumulation of malondiadehyde (MDA) and decreases in leaf water potential and relative water content (RWC) in both rootstocks, which were significantly alleviated by exogenous ABA application. Drought stress also induced markedly increases in endogenous ABA content and activities of superoxide dismutase (SOD), peroxidase (POD), catalase (CAT), ascorbate peroxidase (APX), dehydroascorbate reductase (DHAR), monodehydroascorbate reductase (MDHAR), and glutathione reductase (GR), to a greater magnitude in MS as compared to MH rootstock. Concentration of 100 mol/L and 50 mol/L ABA had the most positive effects on drought-stressed rootstocks of MS and MH, respectively. Spraying optimum exogenous ABA contributed to enhancement in most of the above antioxidant enzymes activities but reduction in content of MDA and maintained the appropriate leaf water potential and RWC in both rootstocks. Pretreatment with fluridone aggravated ion leakage and the accumulation of MDA in two apple rootstocks under drought stress, which was overcome by exogenous ABA application to some extent. In conclusion, the endogenous ABA was probably involved in the regulation of two apple rootstocks in responses to drought stress. (author)

Gas exchange at whole plant level shows that a less conservative water use is linked to a higher performance in three ecologically distinct pine species

Science.gov (United States)

Salazar-Tortosa, D.; Castro, J.; Rubio de Casas, R.; Viñegla, B.; Sánchez-Cañete, E. P.; Villar-Salvador, P.

2018-04-01

Increasing temperatures and decreasing precipitation in large areas of the planet as a consequence of global warming will affect plant growth and survival. However, the impact of climatic conditions will differ across species depending on their stomatal response to increasing aridity, as this will ultimately affect the balance between carbon assimilation and water loss. In this study, we monitored gas exchange, growth and survival in saplings of three widely distributed European pine species (Pinus halepensis, P. nigra and P. sylvestris) with contrasting distribution and ecological requirements in order to ascertain the relationship between stomatal control and plant performance. The experiment was conducted in a common garden environment resembling rainfall and temperature conditions that two of the three species are expected to encounter in the near future. In addition, gas exchange was monitored both at the leaf and at the whole-plant level using a transient-state closed chamber, which allowed us to model the response of the whole plant to increased air evaporative demand (AED). P. sylvestris was the species with lowest survival and performance. By contrast, P. halepensis showed no mortality, much higher growth (two orders of magnitude), carbon assimilation (ca. 14 fold higher) and stomatal conductance and water transpiration (ca. 4 fold higher) than the other two species. As a consequence, P. halepensis exhibited higher values of water-use efficiency than the rest of the species even at the highest values of AED. Overall, the results strongly support that the weaker stomatal control of P. halepensis, which is linked to lower stem water potential, enabled this species to maximize carbon uptake under drought stress and ultimately outperform the more water conservative P. nigra and P. sylvestris. These results suggest that under a hotter drought scenario P. nigra and P. sylvestris would very likely suffer increased mortality, whereas P. halepensis could maintain

Establishment of high effective regeneration and propagation ...

African Journals Online (AJOL)

In order to establish efficient regeneration system for ornamental tissue culture, we used Malus spp. 'Indian Magic as the experimental materials and investigated the effects of disinfection and antibrowning agents, culture mediums and hormones proportion on differentiation, multiplication, callus induction and rooting, and ...

Genetic mapping of 14 avirulence genes in an EU-B04 x 1639 progeny of Venturia inaequalis

NARCIS (Netherlands)

Broggini, G.A.L.; Bus, V.G.M.; Parravicini, G.; Kumar, S.; Groenwold, R.; Gessler, C.

2011-01-01

Durable resistance to apple scab (Venturia inaequalis (Cke) Wint; anamorph Spilocaea pomi Fries) is one of the major goals of apple (Malus) breeding programs. Since current scab resistance breeding is heavily reliant on genes with gene-for-gene relationships, a good understanding of the genetic

Modern actuarial risk theory: using R

NARCIS (Netherlands)

Kaas, R.; Goovaerts, M.; Dhaene, J.; Denuit, M.

2008-01-01

Modern Actuarial Risk Theory -- Using R contains what every actuary needs to know about non-life insurance mathematics. It starts with the standard material like utility theory, individual and collective model and basic ruin theory. Other topics are risk measures and premium principles, bonus-malus

A review of apple anthracnose canker biology and management in cider apple orchards in the Maritime Pacific Northwest

Science.gov (United States)

Cider apple (Malus ×domestica Borkh.) is an emerging crop in western Washington and the Pacific Northwest (PNW) region, but a major obstacle to planting new orchards and orchard productivity is the widespread occurrence of apple anthracnose canker, caused by the fungal pathogen Neofabraea malicortic...

QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT96020 Malus x domestica Rosaceae ... phenotypic mean value of visible atmospherical...ly resistant index phenotypic mean value of visible atmospherically resistant index under well water (irrigation) condition 3 ... LG_01 ... 12.749 4.08 ... 10.1093/jxb/erv355 26208644

Modulation of gene expression as a new skin anti-aging strategy.

Science.gov (United States)

Talbourdet, Sylvie; Sadick, Neil S; Lazou, Kristell; Bonnet-Duquennoy, Mathilde; Kurfurst, Robin; Neveu, Michele; Heusèle, Catherine; André, Patrice; Schnebert, Sylvianne; Draelos, Zoe D; Perrier, Eric

2007-06-01

[corrected] The signs of aging may originate from natural processes or from exposure to the sun, wind, or other environmental factors. To evaluate the anti-aging effects of potential agents researchers must first identify and be able to quantify epidermal markers that change with aging. This paper summarizes the results of studies conducted to evaluate the transcriptional effects of an Aframomum angustifolium seed extract and Malva Sylvestris extract, and the antiaging efficacy of a skin care product containing the Aframomum angustifolium seed extract. The transcriptional effect of an Aframomum angustifolium seed extract on normal human keratinocytes (NHKs) and normal human fibroblasts (NHF) was evaluated in vitro with the use of a low-density DNA array technology. The Malva Sylvestris extract was studied with a commercial DNA macroarray and by a real-time quantitative reverse transcriptase-polymerase chain reaction. The in vitro anti-aging activities of the Malva sylvestris extract were compared with those of all-trans retinoic acid (RA), a well-established topical therapy for photodamage and wrinkles. The genes studied were known to be modified by RA. The anti-aging efficacy of a facial skin care product containing Aframomum angustifolium seed extract was evaluated in a single-center study using image processing analysis and in a 2-center study by evaluation of the photographs by the investigator, independent evaluators, and subjects. In general, the Aframomum angustifolium seed extract strongly modified the gene expression profiles of NHKs and weakly modified the gene expression profiles of NHFs. After incubation with Aframomum angustifolium seed extract, the expressions of 3 antioxidant genes (metallothionein 1, metallothionein 2, and thioredoxin) were increased in NHKs, while expressions of 1 antioxidant gene (glutathione peroxidase) was increased in NHFs. Concerning the Malva sylvestris extract, a cDNA macro-array technology experiment with the reconstructed

Induced resistance and gene expression in wheat against leaf rust ...

African Journals Online (AJOL)

uvp

2013-05-15

May 15, 2013 ... 2Department of Soil, Crop and Climate Sciences, University of the Free State, P.O Box ... Key words: Wheat leaf rust, induced resistance, priming, gene ..... transformation: susceptibility of transgenic Nicotiana sylvestris plants.

An insight into the sequential, structural and phylogenetic properties ...

Indian Academy of Sciences (India)

Prakash

composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.

Interactive use of disease models using a smartphone

NARCIS (Netherlands)

Boshuizen, A.J.; Boshuizen, P.C.; Jong, de P.F.

2015-01-01

Fruit tree canker (Neonectria ditissima syn. Nectria galligena Bres.) is an important fungal disease in apple (Malus × domestica Borkh.). Leaf fall is the predominant infection period for this disease. However, in The Netherlands and Belgium, no historical data on leaf fall of apple are available.

An atypical R2R3 MYB transcription factor increases cold hardiness by CBF-dependent and CBF-independent pathways in apple

NARCIS (Netherlands)

Xie, Yinpeng; Chen, Pengxiang; Yan, Yan; Bao, Chana; Li, Xuewei; Wang, Liping; Shen, Xiaoxia; Li, Haiyan; Liu, Xiaofang; Niu, Chundong; Zhu, Chen; Fang, Nan; Shao, Yun; Zhao, Tao; Yu, Jiantao; Zhu, Jianhua; Xu, Lingfei; Nocker, van Steven; Ma, Fengwang; Guan, Qingmei

2018-01-01

Apple (Malus × domestica) trees are vulnerable to freezing temperatures. However, there has been only limited success in developing cold-hardy cultivars. This lack of progress is due at least partly to lack of understanding of the molecular mechanisms of freezing tolerance in apple. In this study,

Diaporthe species on Rosaceae with descriptions of D. pyracanthae sp. nov. and D. malorum sp. nov.

NARCIS (Netherlands)

Santos, L.; Phillips, A.J.L.; Crous, P.W.; Alves, A.

2017-01-01

The family Rosaceae includes a large number of species ranging from herbaceous (Fragaria) to ornamental plants (Rosa and Pyracantha) and fruit trees (Malus and Pyrus). Diaporthe species have been associated with twig canker, shoot blight, dieback, wood decay and fruit rot on members of the Rosaceae.

First report of

NARCIS (Netherlands)

Wenneker, M.; Pham, K.T.K.; Boekhoudt, L.C.; Boer, de F.A.; Leeuwen, van P.J.; Hollinger, T.C.; Thomma, B.P.H.J.

2017-01-01

In the Netherlands, about 30% of the organic apple (Malus domestica Borkh.) production consists of apple scab resistant cultivars, such as Topaz and Santana. However, organic ‘Topaz’ apples show a high incidence of fungal rot after storage. Hot-water treatment (HWT) of freshly harvested apple

The effects of paclobutrazol and daminozide on in vitro ...

African Journals Online (AJOL)

Administrator

2011-06-06

Jun 6, 2011 ... Key words: Malus spp., micropropagation, plant growth regulators, tissue culture. ... addition of growth retardants to a culture medium can reduce or ...... Hydroponic culture of Gladiolus tristis: Application of paclobutrazol for flowering and height control. 5 February. ISSN 1684–5315. Academic Journals. Afr.

Towards durabale resistance to apple scab using cisgenes

NARCIS (Netherlands)

Joshi, S.G.

2010-01-01

Apple (Malus x domestica) is one of the important fruit crops of the world. It is mainly cultivated in temperate regions. Apple fruit contains many health beneficial compounds which may play an important role in reducing cancer cell proliferation and lowering the level of cholesterol.
Apple

Nr 17 - Private bill aiming at preparing transition towards a energy efficient system

International Nuclear Information System (INIS)

Bartolone, Claude

2012-01-01

This private bill indicates which new articles and which modifications are introduced in the French energy code to implement progressive energy tariffs and favour energy savings by households. These new articles define how a bonus-malus on household energy consumptions is determined. They also define accompanying measures

Development and validation of the Axiom

NARCIS (Netherlands)

Bianco, Luca; Cestaro, Alessandro; Linsmith, Gareth; Muranty, Hélène; Denancé, Caroline; Théron, Anthony; Poncet, Charles; Micheletti, Diego; Kerschbamer, Emanuela; Pierro, Di Erica A.; Larger, Simone; Pindo, Massimo; De Weg, Van Eric; Davassi, Alessandro; Laurens, François; Velasco, Riccardo; Durel, Charles Eric; Troggio, Michela

2016-01-01

Cultivated apple (Malus × domestica Borkh.) is one of the most important fruit crops in temperate regions, and has great economic and cultural value. The apple genome is highly heterozygous and has undergone a recent duplication which, combined with a rapid linkage disequilibrium decay, makes it

A xyloglucan from seeds of the native Brazilian species Hymenaea courbaril for micropropagation of Marubakaido and Jonagored apples.

Science.gov (United States)

Lima-Nishimura, N; Quoirin, M; Naddaf, Y G; Wilhelm, H M; Ribas, L L F; Sierakowski, M-R

2003-01-01

Xyloglucan was extracted from seeds of Hymenaea courbaril and mixed with agar to prepare a solid culture medium used for micropropagation of the Marubakaido apple rootstock (Malus prunifolia Borkh) and cv. Jonagored (Malus domestica). The performance on gels created from a blend of 0.4%agar and 0.2% xyloglucan (w/v) was compared with that on media gelled with a standard concentration 0.6% (w/v) of agar. The growth of shoots and the multiplication rate were higher on the modified culture medium than on the agar-gelled medium. The occurrence of hyperhydric shoots was lower on the modified medium. In the absence of auxin, shoot rooting reached 70% (Marubakaido) and 66% (Jonagored) on the agar-xyloglucan medium and 6.7% and 10.4%, respectively, on the agar medium. When 0.25 microM indole-3-butyric acid (IBA) was added to both media, the modified medium gave better results in terms of rooting percentage and quality of roots than the agar-gelled medium.

Surfactant mediated extraction of total phenolic contents (TPC) and antioxidants from fruits juices.

Science.gov (United States)

Sharma, Shweta; Kori, Shivpoojan; Parmar, Ankush

2015-10-15

The aim of this study was to enhance the extraction of total phenolic contents (TPC) and antioxidants from fruit juices by the application of surfactants formulations instead of conventional solvents (methanol, ethanol and acetone). A variety of fruit infusions: apple red delicious (apple (rd)) (Malus domestica), Mcintosh apple (apple (i)) (Malus pumila), sweet lemon (Citrus limetta) and mango (Magnifera indica) were studied. Effect of water, organic solvents and five different aqueous surfactant formulations viz. SDS, Brij-35, Brij-58, Triton X-100 and Span-40 were explored for the extraction of TPC and determining the antioxidant activity (AA). The TPC and AA (%) were determined using Folin-Ciocalteu (FCA) and DPPH assay, respectively. The effect of surfactant type, concentration and common organic solvents on the extraction of TPC and AA (%) was studied using UV-visible spectrophotometric technique. Among all the extracting systems employed, Brij-58 showed the highest extraction efficiency. Copyright © 2015 Elsevier Ltd. All rights reserved.

Measures to reduce car-fleet consumption - Estimation of effects; Massnahmen zur Absenkung des Flottenverbrauchs. Abschaetzung der Wirkung

Energy Technology Data Exchange (ETDEWEB)

Iten, R.; Hammer, S.; Keller, M.; Schmidt, N. [Infras, Zuerich (Switzerland); Sammer, K.; Wuestenhagen, R. [Institut fuer Wirtschaft und Oekologie (IWOE-HSG), Universitaet St. Gallen, St. Gallen (Switzerland)

2005-09-15

This comprehensive report for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a study that estimated the effects of measures that were to be taken in order to reduce the fuel consumption of fleets of vehicles as part of the SwissEnergy programme. The research reported on aimed to estimate the effects of the Energy Label on energy consumption and research concerning the results to be expected from the introduction of a bonus-malus system. Questions reviewed include the effect of fuel consumption data on making decisions concerning which vehicle to purchase, the effects of the Energy Label on consumption, the awareness of other appropriate information sources, the possible effects of a bonus-malus system and how the effectiveness of the Energy Label could be improved. The answers and results obtained are reviewed and commented on. Finally, an overall appraisal of the situation is presented and recommendations for increasing the effectiveness of the Energy Label are made

Measures to reduce car-fleet consumption - Estimation of effects

International Nuclear Information System (INIS)

Iten, R.; Hammer, S.; Keller, M.; Schmidt, N.; Sammer, K.; Wuestenhagen, R.

2005-09-01

This comprehensive report for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a study that estimated the effects of measures that were to be taken in order to reduce the fuel consumption of fleets of vehicles as part of the SwissEnergy programme. The research reported on aimed to estimate the effects of the Energy Label on energy consumption and research concerning the results to be expected from the introduction of a bonus-malus system. Questions reviewed include the effect of fuel consumption data on making decisions concerning which vehicle to purchase, the effects of the Energy Label on consumption, the awareness of other appropriate information sources, the possible effects of a bonus-malus system and how the effectiveness of the Energy Label could be improved. The answers and results obtained are reviewed and commented on. Finally, an overall appraisal of the situation is presented and recommendations for increasing the effectiveness of the Energy Label are made

The color changes on varnish layers after accelerated aging through ...

African Journals Online (AJOL)

USER

2010-06-14

Jun 14, 2010 ... varnish layers which were applied on the surfaces of Scots pine (Pinus sylvestris L.), Eastern beech .... should be considered 1 period; the performance of those ... removal of the dust, the topcoat varnish was applied.

75 FR 65213 - Removal of Varietal Restrictions on Apples From Japan

Science.gov (United States)

2010-10-22

...-0020] RIN 0579-AD08 Removal of Varietal Restrictions on Apples From Japan AGENCY: Animal and Plant... the importation of Fuji variety apples from Japan to allow all varieties of Malus domestica apples... that the risk associated with allowing other varieties of M. domestica apples from Japan into the...

75 FR 11071 - Removal of Varietal Restrictions on Apples from Japan

Science.gov (United States)

2010-03-10

... on Apples from Japan AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Proposed rule... Japan to allow all varieties of Malus domestica apples into the United States under the same conditions... apples from Japan to be imported into the United States while continuing to protect against the...

First report of Apple necrotic mosaic virus infecting apple trees in Korea

Science.gov (United States)

In September 2016, two apple trees (Malus domestica Borkh) cv. Shinano Sweet showing bright cream spot and mosaic patterns on leaves were observed in Pocheon, South Korea. Mosaic symptoms are common on leaves of apple trees infected with Apple mosaic virus (ApMV). Symptomatic leaves were tested by e...

Apple and quince peroxidase activity in response to essential oils ...

African Journals Online (AJOL)

Enzymatic browning arises by peroxidase in fruits. However, essential oils are recognized as natural antioxidant agents. So in this study, the effect of thyme, coriander and rosemary essential oils were evaluated on the reduction of peroxidase activity in apples (Malus domestica Mill. cv Golden delicious), (M. domestica Mill.

Genetic analysis of wild apple resources in Shandong province ...

African Journals Online (AJOL)

Jane

2011-08-22

Aug 22, 2011 ... Apple (malus domestica Borkh.), which is a widely cultivated, important and economic fruit crop with nutritive and medicinal importance, has emerged as a model horticultural crop in this post-genomic era. Wild apple resources are important and they develop gradually in apple industry and genetic diversity.

Potential hosts for Lambertella corni-maris and Phacidium lacerum within the family Rosaceae

Science.gov (United States)

Two fungi were described in 2015 and 2016 as pathogens of pome fruit in the Pacific Northwest USA: Lambertella corni-maris on apple (Malus domestica), and Phacidium lacerum (synonym, Ceuthospora pinastri) on apple and d’Anjou pear (Pyrus communis). We documented pathogenicity of L. corni-maris to d...

Relative Susceptibility of Quince, Pear, and Apple Cultivars to Fire Blight Following Greenhouse Inoculation

Science.gov (United States)

Fire blight caused by Erwinia amylovora (EA) is one of the most serious diseases of plants in the family Rosaceae, and Quince (Cydonia oblonga Mill.) is considered one of the most susceptible host genera. Apple (Malus sp.) and pear (Pyrus sp.) cultivars ranging from most susceptible to most resistan...

Apple mosaic virus

Science.gov (United States)

Apple mosaic virus (ApMV), a member of the ilarvirus group, naturally infects Betula, Aesculus, Humulus, and several crop genera in the family Rosaceae (Malus, Prunus, Rosa and Rubus). ApMV was first reported in Rubus in several blackberry and raspberry cultivars in the United States and subsequentl...

Arabidopsis CDS blastp result: AK105400 [KOME

Lifescience Database Archive (English)

Full Text Available AK105400 001-123-C10 At1g14130.1 2-oxoglutarate-dependent dioxygenase, putative similar to adventitious root...ing related oxygenase ARRO-1 from Malus x domestica, gi|3492806; contains Pfam domain PF03171, 2OG-Fe(II) oxygenase superfamily 2e-66 ...

Arabidopsis CDS blastp result: AK121520 [KOME

Lifescience Database Archive (English)

Full Text Available AK121520 J033028J23 At1g14130.1 2-oxoglutarate-dependent dioxygenase, putative similar to adventitious rooti...ng related oxygenase ARRO-1 from Malus x domestica, gi|3492806; contains Pfam domain PF03171, 2OG-Fe(II) oxygenase superfamily 2e-66 ...

The biophysics of plant cell wall degradation

DEFF Research Database (Denmark)

Digaitis, Ramūnas

different lignocellulosic biomass materials, namely flax (Linum usitatissimum L.) fibres and Scots pine (Pinus sylvestris L.) veneers. Mechanical and enzymatic treatments were applied either individually, simultaneously or in a sequential manner, where enzymatic hydrolysis was preceded or proceeded...

Gymnema

Science.gov (United States)

... diabetes medications might cause your blood sugar to go too low. Monitor your blood sugar closely. The ... sylvestre, Gymnéma, Gymnéma Sylvestre, Madhunashini, Merasingi, Meshasring, Meshashringi, Miracle Plant, Periploca sylvestris, Periploca of the woods, Shardunika, ...

Leptographium piriforme - first record for Europe and of potential pathogenicity

Czech Academy of Sciences Publication Activity Database

Jankowiak, R.; Kolařík, Miroslav

2010-01-01

Roč. 65, č. 4 (2010), s. 754-757 ISSN 0006-3088 Institutional research plan: CEZ:AV0Z50200510 Keywords : bark beetles * Leptographium piriforme * Pinus sylvestris Subject RIV: EE - Microbiology, Virology Impact factor: 0.609, year: 2010

Clonal variation in growth, flowering and cone production in a seed ...

African Journals Online (AJOL)

STORAGESEVER

2009-09-01

Sep 1, 2009 ... production in a seed orchard of Scots pine (Pinus sylvestris L.) in ... one of the important seed sources for forest plantations. And also, these seed ...... Ph.D. Thesis, Swedish University of Agricultural Science, Umea ,. Sweden.

Targeted isolation and identification of bioactive compounds lowering cholesterol in the crude extracts of crabapples using UPLC-DAD-MS-SPE/NMR based on pharmacology-guided PLS-DA.

Science.gov (United States)

Wen, Chao; Wang, Dongshan; Li, Xing; Huang, Tao; Huang, Cheng; Hu, Kaifeng

2018-02-20

The anti-hyperlipidemic effects of crude crabapple extracts derived from Malus 'Red jade', Malus hupehensis (Pamp.) Rehd. and Malus prunifolia (Willd.) Borkh. were evaluated on high-fat diet induced obese (HF DIO) mice. The results revealed that some of these extracts could lower serum cholesterol levels in HF DIO mice. The same extracts were also parallelly analyzed by LC-MS in both positive and negative ionization modes. Based on the pharmacological results, 22 LC-MS variables were identified to be correlated with the anti-hyperlipidemic effects using partial least square discriminant analysis (PLS-DA) and independent samples t-test. Further, under the guidance of the bioactivity-correlated LC-MS signals, 10 compounds were targetedly isolated and enriched using UPLC-DAD-MS-SPE and identified/elucidated by NMR together with MS/MS as citric acid(1), p-coumaric acid(2), hyperoside(3), myricetin(4), naringenin(5), quercetin(6), kaempferol(7), gentiopicroside(8), ursolic acid(9) and 8-epiloganic acid(10). Among these 10 compounds, 6 compounds, hyperoside(3), myricetin(4), naringenin(5), quercetin(6), kaempferol(7) and ursolic acid(9), were individually studied and reported to indeed have effects on lowering the serum lipid levels. These results demonstrated the efficiency of this strategy for drug discovery. In contrast to traditional routes to discover bioactive compounds in the plant extracts, targeted isolation and identification of bioactive compounds in the crude plant extracts using UPLC-DAD-MS-SPE/NMR based on pharmacology-guided PLS-DA of LC-MS data brings forward a new efficient dereplicated approach to natural products research for drug discovery. Copyright © 2017 Elsevier B.V. All rights reserved.

Phylogeny of cockroaches (Insecta, Dictyoptera, Blattodea), with placement of aberrant taxa and exploration of out-group sampling

DEFF Research Database (Denmark)

Djernæs, Marie; Klass, Klaus-Dieter; Picker, Mike D.

2012-01-01

hypotheses, we retain Lamproblattidae. S. montistabularis was consistently placed as sister to Ectobius sylvestris Poda (Blaberoidea: Ectobinae), indicating that the saltatorial hindlegs of this genus are a relatively recent adaptation. Isoptera was placed within Blattodea as sister to Cryptocercidae...

Screening of plants used in the European traditional medicine to treat memory disorders for acetylcholinesterase inhibitory activity and anti amyloidogenic activity

DEFF Research Database (Denmark)

Lobbens, Eva S B; Vissing, Karina J.; Jorgensen, Lene

2017-01-01

and the ability to inhibit the enzymatic activity of acetylcholinesterase was evaluated monitoring the hydrolysis of acetylthiocholine Results Under the experimental conditions investigated, extracts of two plants, Carum carvi and Olea sylvestris, inhibited amyloid beta fibrillation considerably, eight plant...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Auxin response factors (ARF) are transcription factors that regulate auxin responses in plants. Although the genomewide analysis of this family has been performed in some species, little is known regarding ARF genes in apple (Malus domestica). In this study, 31 putative apple ARF genes have been identified and located ...

Genetic analysis of wild apple resources in Shandong province ...

African Journals Online (AJOL)

Apple (malus domestica Borkh.), which is a widely cultivated, important and economic fruit crop with nutritive and medicinal importance, has emerged as a model horticultural crop in this post-genomic era. Wild apple resources are important and they develop gradually in apple industry and genetic diversity. In this study, two ...

First report of Sphaeropsis rot of apple caused by Sphaeropsis pyriputrescens in New York.

Science.gov (United States)

In March 2012, decayed ‘Empire’ apple fruit (Malus × domestica Borkh.) were sampled from apples stored in bins for 6 months under controlled atmosphere at a commercial packinghouse in Orleans County in New York State. The fruit were completely rotten, spongy to firm, and light brown. The incidence o...

First report of Colletotrichum godetiae causing bitter rot on ‘Golden Delicious’ apples in the Netherlands

NARCIS (Netherlands)

Wenneker, M.; Pham, K.T.K.; Lemmers, M.E.C.; Boer, de F.A.; Lans, van der A.M.; Leeuwen, van P.J.; Hollinger, T.C.

2016-01-01

Apple (Malus domestica) is an important fruit crop in the Netherlands, with a total production of 418,000 tons in 2011. Symptoms of apple bitter rot were observed on ‘Golden Delicious’ apples in the Netherlands in July 2013 after 9 months of storage in a packing house at controlled atmosphere.

First report of fusarium avenaceum causing wet core rot of ‘elstar’ apples in the Netherlands

NARCIS (Netherlands)

Wenneker, M.; Pham, K.T.K.; Lemmers, M.E.C.; Boer, de Fred; Lans, van der Arie; Leeuwen, van Paul; Hollinger, T.C.; Thomma, B.P.H.J.

2016-01-01

Apple (Malus domestica) is an important fruit crop in the Netherlands. ‘Elstar’, the main cultivar, occupies 40% of the apple production area. Symptoms of apple wet core rot were observed on Elstar in January to March 2013 after 4 to 6 months’ storage in different packing houses at controlled

Differences in acidity of apples are probably mainly caused by a malic acid transporter gene on LG16

NARCIS (Netherlands)

Khan, S.A.; Beekwilder, J.; Schaart, J.G.; Mumm, R.; Soriano, J.M.; Jacobsen, E.; Schouten, H.J.

2013-01-01

Acidity has profound effects on the taste of apples (Malus × domestica). Malic acid is the predominant organic acid in apples. Differences in malic acid content are caused by differences in accumulation of malic acid in the vacuole. This accumulation may be caused by a gene that is responsible for

Genetic mapping and annotation of genomic microsatellites isolated from globe artichoke

NARCIS (Netherlands)

Acquadro, A.; Lanteri, S.; Scaglione, D.; Arens, P.F.P.; Vosman, B.; Portis, E.

2009-01-01

Cynara cardunculus includes three taxa, the globe artichoke (subsp. scolymus L. Hegi), the cultivated cardoon (var. altilis) and their progenitor, the wild cardoon (var. sylvestris). Globe artichoke is an important component of the Mediterranean rural economy, but its improvement through breeding

Bark beetles, pityogenes bidentatus, orienting to aggregation pheromone avoid conifer monoterpene odors when flying but not when walking

Science.gov (United States)

Previous studies have provided evidence that monoterpene odors from healthy host Scotch pine (Pinus sylvestris) and non-host Norway spruce (Picea abies) significantly reduce the attraction of flying bark beetles, Pityogenes bidentatus, to their aggregation pheromone components (grandisol and cis-ver...

Gouden ribzaad (Chaerophyllum aureum L.); onopgemerkt ingeburgerd

NARCIS (Netherlands)

Beringen, Ruud; Dirkse, Gerard M.; Moorsel, van René C.M.J.

2005-01-01

In 2005 is Gouden ribzaad (Chaerophyllum aureum) op drie verschillende locaties (in vier km-hokken) binnen Nederland vastgesteld. Gouden ribzaad is op twee plaatsen waarschijnlijk al 20 jaar aanwezig. Door de gelijkenis met Fluitenkruid (Anthriscus sylvestris), Knolribzaad (C. bulbosum) en Dolle

Regeneration patterns in boreal Scots pine glades linked to cold-induced photoinhibition

NARCIS (Netherlands)

Slot, M.; Wirth, C.; Schumacher, J.; Mohren, G.M.J.; Shibistova, O.; Lloyd, J.; Ensminger, I.

2005-01-01

Summary Regeneration patterns of Pinus sylvestris L. juveniles in central Siberian glades were studied in relation to cold-induced photoinhibition. Spatial distribution of seedlings in different height classes revealed higher seedling densities beneath the canopy than beyond the canopy, and

Site fidelity and longevity of the Karoo Thrush Turdus smithi ...

African Journals Online (AJOL)

, and have a similar maximum longevity. We propose that adult thrushes are able to persist in a given home range because they are able to avoid resident predators, e.g. feral cats Felis sylvestris catus, by accurately predicting their hunting ...

Dynamics and stratification of functional groups of micro- and mesoarthropods in the organic layer of a Scots pine forest.

NARCIS (Netherlands)

Berg, M.P.; Kniese, J.P.; Bedaux, J.J.M.; Verhoef, H.A.

1998-01-01

This paper addresses the abundance, biomass and microstratification of functional groups of micro- and mesoarthropods inhabiting the organic layers of a Scots pine forest (Pinus sylvestris L.). An experiment using stratified litterbags, containing organic material of four degradation stages, i.e.,

Use of Pinus sylvestris L. (Pinaceae), Origanum vulgare L. (Lamiaceae), and Thymus vulgaris L. (Lamiaceae) essential oils and their main components to enhance itraconazole activity against azole susceptible/not-susceptible Cryptococcus neoformans strains.

Science.gov (United States)

Scalas, Daniela; Mandras, Narcisa; Roana, Janira; Tardugno, Roberta; Cuffini, Anna Maria; Ghisetti, Valeria; Benvenuti, Stefania; Tullio, Vivian

2018-05-03

Cryptococcal infections, besides being a problem for immunocompromised patients, are occasionally being a problem for immunocompetent patients. In addition, the lower susceptibility of this yeast to azoles is a growing problem in health care. To date, there are very few molecules with any activity towards Cryptococcus neoformans, leading to heightened interest in finding new alternatives or adjuvants to conventional drugs for the treatment of mycosis caused by this yeast. Since the essential oils (EOs) are considered as a potential rich source of bioactive antimicrobial compounds, we evaluated the antifungal activity of Origanum vulgare (oregano), Pinus sylvestris (pine), and Thymus vulgaris (thyme red) EOs, and their components (α-pinene, carvacrol, thymol) compared with fluconazole, itraconazole, and voriconazole, against C.neoformans clinical strains. Then, we investigated the effect of EOs and components in combination with itraconazole. EO composition was analysed by Gas chromatography-mass spectrometry (GC-MS). A broth microdilution method was used to evaluate the susceptibility of C.neoformans to azoles, EOs and components. Checkerboard tests, isobolograms and time-kill assays were carried out for combination studies. Six C.neoformans isolates were susceptible to azoles, while one C.neoformans exhibited a reduced susceptibility to all tested azole drugs. All EOs exerted a good inhibitory activity against all C.neoformans strains. Pine EO was the most effective. Among components, thymol exerted the most remarkable activity. By checkerboard testing and isobolographic analysis, combinations of itraconazole with oregano, pine, or thyme EOs, and carvacrol were found to be synergistic (FICI≤0.5) against azole susceptible C.neoformans. Regarding the azole not susceptible C.neoformans strain, the synergistic effect with itraconazole was observed with thyme EO (chemotype: thymol 26.52%; carvacrol 7.85%), and carvacrol. Time-kill assays confirmed the synergistic

Risks associated with the introduction of Pinus contorta in northern Sweden with special attention to Gremmeniella abietina and North American rusts

International Nuclear Information System (INIS)

Witzell, J.

1999-01-01

Sixty years after the first plantings of the North American Pinus contorta in northern Sweden and twenty years after start of the large scale planting programme, extensive epidemics of the native pathogen Gremmeniella abietina were recorded. A period with extremely cool and rainy summers (1984-1987) followed by a mild winter with large amounts of snow, appeared to be an important predisposing factor to the epidemics. There was a strong negative correlation between disease incidence of G. abietina and temperature sum at the site. The most severe attacks by G. abietina occurred in topographic depressions, on flat ground, and on sites where Picea abies was the dominant species of the old stand. The frequency of trees with stem cankers caused by G. abietina increased during the period of the study. Some cankers had fully girdled the stem and some were completely occluded at the end of the study period. A large proportion of wood damaged by G. abietina adversely influenced processability, and reduced the quality of kraft pulp, and should be sorted out and classed as not perfect raw material. G. abietina was found less frequently in regenerations of native Pinus sylvestris than in those of P. contorta. P. sylvestris showed susceptibility to the North American rusts Endocronartium harknessii, Cronartium coleosporioides and Cronartium comandrae. It was especially susceptible to Endocronartium harknessii, even though disease incidence was low in the studied areas. A high susceptibility to Endocronartium harknessii was found in the P. contorta provenances originating from the Yukon, and most frequently used in Sweden. The risk of a recurrence of predisposing weather conditions with subsequent epidemics of G. abietina in healthy P. contorta plantations should be considered, as well as the risk of severe epidemics on less affected plantations of P. sylvestris due to the high inoculum in nearby P. contorta plantations. Also the risk of North American rusts causing severe

21 CFR 145.110 - Canned applesauce.

Science.gov (United States)

2010-04-01

... ingredients. The following safe and suitable optional ingredients may be used: (i) Water. (ii) Apple juice... apples (Malus domestica Borkhausen), which may or may not be peeled and cored, and which may have added thereto one or more of the optional ingredients specified in paragraph (a)(2) of this section. The apple...

INTERACTIONS BETWEEN SOIL TEMPERATURE AND PLANT GROWTH STAGE ON NITROGEN UPTAKE AND AMINO ACID CONTENT OF APPLE NURSERY STOCK DURING EARLY SPRING GROWTH

Science.gov (United States)

In the spring, nitrogen (N) uptake by apple roots is known to be delayed about three weeks after bud break. We used one-year-old 'Fuji' (Malus domestica Borkh) on M26 bare-root apple trees to determine whether timing of N uptake in the spring is dependant solely on the growth st...

Fire ecology of Scots pine in Northwest Europe

NARCIS (Netherlands)

Hille, M.G.

2006-01-01

Keywords: biodiversity, fire ecology, fuel modelling, succession, tree regenerationIn this thesis the ecological consequences of forest fire are studied in North-west European Scots pine {Pinus sylvestris) forests. The focus is on post-fire succession, and the factors and mechanisms that influence

Soils of Mountainous Forests and Their Transformation under the Impact of Fires in Baikal Region

Science.gov (United States)

Krasnoshchekov, Yu. N.

2018-04-01

Data on postpyrogenic dynamics of soils under mountainous taiga cedar ( Pinus sibirica) and pine ( Pinus sylvestris) forests and subtaiga-forest-steppe pine ( Pinus sylvestris) forests in the Baikal region are analyzed. Ground litter-humus fires predominating in this region transform the upper diagnostic organic soil horizons and lead to the formation of new pyrogenic organic horizons (Opir). Adverse effects of ground fires on the stock, fractional composition, and water-physical properties of forest litters are shown. Some quantitative parameters of the liquid and solid surface runoff in burnt areas related to the slope gradient, fire intensity, and the time passed after the fire are presented. Pyrogenic destruction of forest ecosystems inevitably induces the degradation of mountainous soils, whose restoration after fires takes tens of years. The products of soil erosion from the burnt out areas complicate the current situation with the pollution of coastal waters of Lake Baikal.

Investigation of wild species potential to increase genetic diversity useful for apple breeding

Directory of Open Access Journals (Sweden)

Dan Catalina

2015-01-01

Full Text Available The potential of testing new apple cultivars and the possibility to induce valuable traits is directly dependent on the availability of sufficient genetic diversity, while apple breeding has narrowed the genetic ground of commercial cultivars. Wild species were studied in regard to their influence upon progenies and their capacity to enlarge apple genetic diversity. The interspecific seedlings were framed in five biparental mating (paired crosses, in which Malus species were crossed with different cultivars, obtaining half-sib families. The number of F1 progenies per combination varied from 31 (Cluj 218/2 × M. floribunda up to 142 (Reinette Baumann × M. floribunda, with a total of 1650 hybrids F1. The influences upon vigour and juvenile period and possible correlation among fruit size and taste were analyzed. Juvenile period varied from 6.00 (M. zumi × Jonathan to 9.31 years (Cluj 218/2 × M. floribunda. Data based on correlation coefficient illustrated that the fructification year was not influenced by the vigour of trees. The highest value of correlation for fruit’s size and taste was obtained among M. coronaria hybrids. This result might suggest that once the fruit are larger, there is a high chance the taste is also more appreciative and fruit quality for mouth feels increase. Depending on the parental formula, additive effects may be inferior compared to genetic effects of dominance and epistasis. Although M. zumi and M. floribunda achieved the same genetic gain (0.31, M. zumi had a higher expected selection response for fruit size. The difficulty of obtaining seedlings with tasty and large fruit when wild Malus species are used as genitors is resulting from the values of expected selection response data, but in the same time results confirm that wild Malus species are suitable resources for genetic variability, both for dessert and ornamental apple cultivars.

Wild apple growth and climate change in southeast Kazakhstan

Science.gov (United States)

Irina P. Panyushkina; Nurjan S. Mukhamadiev; Ann M. Lynch; Nursagim A. Ashikbaev; Alexis H. Arizpe; Christopher D. O' Connor; Danyar Abjanbaev; Gulnaz Z. Mengdbayeva; Abay O. Sagitov

2017-01-01

Wild populations of Malus sieversii [Ldb.] M. Roem are valued genetic and watershed resources in Inner Eurasia. These populations are located in a region that has experienced rapid and on-going climatic change over the past several decades. We assess relationships between climate variables and wild apple radial growth with dendroclimatological techniques to understand...

Presence of Nitrosospiral cluster 2 bacteria corresponds to N transformation rates in nine acid Scots pine forest soils.

NARCIS (Netherlands)

Nugroho, R. Adi; Roling, W.F.M.; Laverman, A.M.; Zoomer, R.; Verhoef, H.A.

2005-01-01

The relation between environmental factors and the presence of ammonia-oxidising bacteria (AOB), and its consequences for the N transformation rates were investigated in nine Scots pine (Pinus sylvestris L.) forest soils. In general, the diversity in AOB appears to be strikingly low compared to

Dendroclimatic signals deduced from riparian versus upland forest interior pines in North Karelia, Finland

DEFF Research Database (Denmark)

Helama, Samuli; Arentoft, Birgitte W.; Collin-Haubensak, Olivier

2013-01-01

Radial growth of boreal tree species is only rarely studied in riparian habitats. Here we investigated chronologies of earlywood, latewood, and annual ring widths and blue intensity (BI; a surrogate to latewood density) from riparian lake shore and upland forest interior pines (Pinus sylvestris L...

The threatened plant intermediate wintergreen (Pyrola media) associates with a wide range of biotrophic fungi in native Scottish pine woods

DEFF Research Database (Denmark)

Toftegaard, Tenna; Iason, Glenn R.; Alexander, Ian J.

2010-01-01

The plant intermediate wintergreen (Pyrola media, Ericaceae) is in need of conservation action in Scotland. Although widespread, it is locally distributed in dwarf shrub heath and more commonly in Scots pine (Pinus sylvestris) woodlands. A recent study on the mycorrhizal status of Pyrola suggeste...

Charcoal and activated carbon as adsorbate of phytotoxic compounds - a comparative study.

NARCIS (Netherlands)

Hille, M.G.; Ouden, den J.

2005-01-01

This study compares the potential of natural charcoal from Scots pine (Pinus sylvestris L.) and activated carbon to improve germination under the hypothesis that natural charcoal adsorbs phytotoxins produced by dwarf-shrubs, but due to it's chemical properties to a lesser extent than activated

[The in vitro action of plants on Vibrio cholerae].

Science.gov (United States)

Guevara, J M; Chumpitaz, J; Valencia, E

1994-01-01

Natural products of several plants, according to the geographic location, are used by Peruvian people in the popular treatment of diarrhea, with good success. When cholerae cases appeared in Peru, we were interested to know the "in vitro" effect against Vibrio cholerae 01, of these useful plants to treat diarrhea. The following plants were tested: Cichorium intybus, Althaea officinalis, Psorela glandulosa, Geranium maculatum, Punica granatum, Malus sativa, Cydonia oblonga, Chenopodium ambrosoides, Krameria triandria, Tea chinensis, Daucus carota, Persea gratissima, Psidium guayaba and Lippia dulcis. Decoction or infusion of the plants were used in the "in vitro" experiments. The following plants showed no "in vitro" effect against V. cholerae: Cichorium intybus, Althaea officinalis, Psorela glandulosa, Geranium maculatum, Chenopodium ambrosoides, Krameria triandria, Psidium guayaba, Lippia dulcis and Daucus carota. Decoction of Malus sativa and Cydenia oblonga showed bactericidal effect for their acidity and stone avocado (Persea gratissima) a late bactericidal effect. Tea infusión and the decoction of Punica granatum peel, showed the best bactericidal effect and we suggest to use them as to stop cholera spreading.

Isolation and preliminary function analysis of a Na + /H + antiporter ...

African Journals Online (AJOL)

A full-length cDNA Na+/H+ antiporter gene (MzNHX1) was isolated from Malus zumi according to the homologous Na+/H+ antiporter gene region in plants. Sequence analysis indicated that the cDNA was 2062 bp in length, including an open reading frame (ORF) of 1629 bp, which encoded a predicted polypeptide of 542 ...

Purification and characterisation of relevant natural and recombinant apple allergens

NARCIS (Netherlands)

Oberhuber, Christina; Ma, Yan; Marsh, Justin; Rigby, Neil; Smole, Ursula; Radauer, Christian; Alessandri, Stefano; Briza, Peter; Zuidmeer, Laurian; Maderegger, Bernhard; Himly, Martin; Sancho, Ana I.; van Ree, Ronald; Knulst, André; Ebner, Christof; Shewry, Peter; Mills, E. N. Clare; Wellner, Klaus; Breiteneder, Heimo; Hoffmann-Sommergruber, Karin; Bublin, Merima

2008-01-01

Apple (Malus domestica) is the most widely cultivated fruit crop in Europe and frequently causes allergic reactions with a variable degree of severity. So far, four apple allergens Mal d 1, Mal d 2, Mal d 3 and Mal d 4 have been identified. Mal d 1, a Bet v 1 related allergen, and Mal d 4, apple

Shikimate dehydrogenase from Pinu sylvestris L. needles

International Nuclear Information System (INIS)

Osipov, V.I.; Shein, I.V.

1986-01-01

Shikimate dehydrogenase was isolated by extraction from pine needles and partially purified by fractionation with ammonium sulfate. In conifers, in contrast to other plants, all three isoenzymes of shikimate dehydrogenase exhibit activity not only with NADP + , but also with NAD + . The values of K/sub m/ for shikimate, when NADP + and NAD + are used as cofactors, are 0.22 and 1.13 mM, respectively. The enzyme is maximally active at pH 10 with both cofactors. It is suggested that NAD-dependent shikimate dehydrogenase catalyzes the initial reaction of the alternative pathway of the conversion of shikimic acid to hydroxybenzoic acid. The peculiarities of the organization and regulation of the initial reactions of the shikimate pathway in conifers and in plants with shikimate dehydrogenase absolutely specific for NADP are discussed

Suitable level of suppression in Pinus sylvestris

Energy Technology Data Exchange (ETDEWEB)

Hagner, Mats

1999-10-01

It is `well known` among Swedish foresters that pine trees need light and cannot grow suppressed. It is also `well known` that old trees that have grown slowly are unable to react with good growth. However, these facts can be questioned in the light of new research as it has been found that thinning reaction is not correlated with age. It is also well known that the commercial value of a pine is closely related to the growth at young age. If the first 20 annual rings close to pith are wide (>3 mm) the log cannot be accepted as first class. This is related to number and size of branches on the young tree and to the features of the juvenile wood. This is to say that a pine must not grow fast when it is small and if this has happened it cannot be cured by artificial debranching or by growing the tree slowly at higher age. Accordingly, young pines should be grown under bigger trees that in their young age were grown under big trees, and so on. Today, when clear cutting is the dominating forest management system, the only way to obtain high quality pine trees is to start the rotation age with stands of very high density. This is of course a very expensive way as dense planting, followed by intensive thinning requires a lot of input. However, if pine is a pioneer species and cannot be grown in multistoried stands, then the economic solution is not present. This was the reason why the annual increment of three pines was measured. They were selected because their different growth pattern showed that old `well known facts` should be revised Working papers 139. 3 refs, 7 figs, 1 tab

Vector Affinity and Diversity of Geosmithia Fungi Living on Subcortical Insects Inhabiting Pinaceae Species in Central and Northeastern Europe

Czech Academy of Sciences Publication Activity Database

Kolařík, Miroslav; Jankowiak, R.

2013-01-01

Roč. 66, č. 3 (2013), s. 682-700 ISSN 0095-3628 R&D Projects: GA ČR(CZ) GAP506/11/2302 Institutional support: RVO:61388971 Keywords : SCOLYTIDAE COLONIZING BRANCHES * PINUS-SYLVESTRIS L * BARK BEETLES Subject RIV: EE - Microbiology, Virology Impact factor: 3.118, year: 2013

There is no direct relationship between N-status and frost hardiness in needles of NH3-exposed Scots pine seedlings

NARCIS (Netherlands)

Clement, JMAM; Venema, JH; Van Hasselt, PR

2000-01-01

The effect of short-term atmospheric ammonia deposition on frost hardening of needles of three-month-old seedlings of Scots pine (Pinus sylvestris L.) was studied. Plants were frost hardened under short day and moderate temperature conditions in the laboratory during exposure to gaseous NH3

Pollinator preferences and flower constancy: is it adaptive for plants to manipulate them?

Czech Academy of Sciences Publication Activity Database

Janovský, Zdeněk; Smyčka, J.; Smyčková, M.; Herben, Tomáš

2017-01-01

Roč. 121, č. 3 (2017), s. 475-483 ISSN 0024-4066 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : Achillea millefolium * Angelica sylvestris * floral evolution Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 2.288, year: 2016

Phenotypical and Molecular Characterisation of Fusarium circinatum: Correlation with Virulence and Fungicide Sensitivity

Directory of Open Access Journals (Sweden)

Martin Mullett

2017-11-01

Full Text Available Fusarium circinatum, causing pine pitch canker, is one of the most damaging pathogens of Pinus species. This study investigated the use of phenotypical and molecular characteristics to delineate groups in a worldwide collection of isolates. The groups correlated with virulence and fungicide sensitivity, which were tested in a subset of isolates. Virulence tests of twenty isolates on P. radiata, P. sylvestris and P. pinaster demonstrated differences in host susceptibility, with P. radiata most susceptible and P. sylvestris least susceptible. Sensitivity to the fungicides fludioxonil and pyraclostrobin varied considerably between isolates from highly effective (half-maximal effective concentration (EC50 < 0.1 ppm to ineffective (EC50 > 100 ppm. This study demonstrates the potential use of simply acquired phenotypical (cultural, morphological and molecular metrics to gain a preliminary estimate of virulence and sensitivity to certain fungicides. It also highlights the necessity of including a range of isolates in fungicide tests and host susceptibility assays, particularly of relevance to tree breeding programmes.

Quantitative Characteristics of Brown Bear (Ursus arctos L. Feeding on Umbelliferae Plants

Directory of Open Access Journals (Sweden)

S.S. Ogurtsov

2015-03-01

Full Text Available The natural feeding preferences of brown bear for Umbelliferae plants have been considered. The general quantitative characteristics of feeding on forbs have been revealed for bears inhabiting the Central Forest State Nature Biosphere Reserve (Tver region. Umbelliferae plants dominate in the diet of brown bears during late spring and early summer. Angelica sylvestris, Chaerophyllum aromaticum, Aegopodium podagraria, and Heracleum sibiricum are most frequently consumed by bears in the nature reserve. Feeding on A. sylvestris is directly associated with the overall abundance of this plant species and varies depending on its phenological stages. The preference is given to widely distributed age-size forb groups with the thickest stems. The maximum share of consumed plants has been observed in small forest herblands and overgrown fields adjacent to the forest cover. In all the biotopes, bears are attracted to herb sites with the highest abundance of consumed plants. Ch. aromaticum and H. sibiricum are distributed more locally and, therefore, less common in the diet of bears.

Browse Title Index

African Journals Online (AJOL)

Items 4851 - 4900 of 11090 ... Salman Mushtaq, Ishfaq Ahmad Hafiz, Syed Zia Ul Hasan, Muhammad Arif, Muhammad Asif Shehzad, Rizwan Rafique, Misbah Rasheed, Muhammad Ali, Muhammad Shahid Iqbal. Vol 7, No 24 (2008), Evaluation of seed production of scots pine (Pinus sylvestris L.) clonal seed orchard with cone ...

Korte mededeling

NARCIS (Netherlands)

Reijerse, Fons (A.) I.

1997-01-01

Tijdens de inventarisatie van km-hok 52.14.42 (N. van Venray) trof ik op 3 september 1996 een exemplaar aan van Galeopsis ladanum L. (Brede raai). De plant stond op de overgang van een geploegde akker naar een bosrand (merendeels Pinus sylvestris met ondergroei van Prunus serotina) met

Application of extracts from the poisonous plant, Nerium Oleander L ...

African Journals Online (AJOL)

The antifungal properties of poisonous plant extracts from oleanders (Nerium oleander L.) were determined when used as a wood preservative. The extract was prepared from oleanders leaves and flowers in 96% ethyl alcohol. The wood blocks of Turkish oriental beech (Fagus orientalis L.) and Scots pine (Pinus sylvestris ...

Анализ содержания эфирных масел и пигментов в хвое Pinus sylvestris L. в условиях породного отвала угольного разреза

OpenAIRE

ЦАНДЕКОВА ОКСАНА ЛЕОНИДОВНА; НЕВЕРОВА ОЛЬГА АЛЕКСАНДРОВНА

2015-01-01

Проведены исследования состава основных компонентов эфирного масла и содержания пигментного комплекса хвои Pinus sylvestris L. в условиях породного отвала угольного разреза «Кедровский». В составе эфирного масла идентифицировано 57 компонентов, причем наибольшее накопление принадлежит терпеновым соединениям. В хвое Pinus sylvestris L. максимальное накопление пигментов отмечено в июле, в течение вегетации содержание хлорофиллов превышало количество каротиноидов....

Comparing growth phenology of co-occurring deciduous and evergreen conifers exposed to drought.

Science.gov (United States)

Swidrak, Irene; Schuster, Roman; Oberhuber, Walter

2013-12-01

Plant phenological events are influenced by climate factors such as temperature and rainfall. To evaluate phenological responses to water availability in a Spring Heath-Pine wood (Erico-Pinetum typicum), the focus of this study was to determine intra-annual dynamics of apical and lateral growth of co-occurring early successional Larix decidua and Pinus sylvestris and late successional Picea abies exposed to drought. The effect of reduced plant water availability on growth phenology was investigated by conducting a rainfall exclusion experiment. Timing of key phenological dates (onset, maximum rate, end, duration) of growth processes were compared among species at the rain-sheltered and control plot during 2011 and 2012. Shoot and needle elongation were monitored on lateral branches in the canopy at c . 16 m height and radial growth was recorded by automatic dendrometers at c . 1.3 m height of > 120 yr old trees. Different sequences in aboveground growth phenology were detected among the three species under the same growing conditions. While onset of radial growth in April through early May was considerably preceded by onset of needle growth in Larix decidua (5 - 6 weeks) and shoot growth in Pinus sylvestris ( c . 3 weeks), it occurred quite simultaneously with onset of shoot growth in Picea abies . Low water availability had a minor impact on onset of aboveground growth, which is related to utilization of stored water, but caused premature cessation of aboveground growth. At the control plot mean growing season length was 130 days in Pinus sylvestris , 95 days in Larix decidua and 73 days in Picea abies supporting the hypothesis that early successional species are resource expenders, while late successional species are more efficient in utilizing resources and develop safer life strategies. High synchronicity found in culmination of radial growth in late spring (mid-May through early June) prior to occurrence of more favourable environmental conditions in summer

Een „oude” voor Nederland nieuwe Salvia-bastaard

NARCIS (Netherlands)

Adema, F.

1968-01-01

Among the Dutch material of Salvia nemorosa L. in the collections of the Rijksherbarium, Leiden, the author found several specimens of the hybrid S. X sylvestris L. (S. nemorosa L. X S. pratensis L.). L.). A short description of this hybrid and the differences between the parent species are given.

Problem of industrial fumes in the forested valleys of Savoy

Energy Technology Data Exchange (ETDEWEB)

Bossavy, J

1962-01-01

A study of injury to forest trees in the Maurienne valley, caused by F in the fumes from aluminum factories was made. Of the local conifers, Pinus sylvestris was the most susceptible, followed by Picea abies and Abies alba; Larch has so far proved resistant, as have broadleaved deciduous species.

Prospects of fatty acid profile and bioactive composition from lipid seeds for the discrimination of apple varieties with the application of chemometrics

Energy Technology Data Exchange (ETDEWEB)

Arain, S.; Sherazzi, S. T. H.; Bhanger, M. I.; Memon, N.; Mahesar, S. A.; Rajput, M. T.

2012-11-01

The extracted oils from four apple seed varieties (Royal Gala, Red Delicious, Pyrus Malus and Golden Delicious) from Pakistan were investigated for their fatty acid profiles and lipid biactives by GC-MS. The oil contents in the seeds of the apple varieties ranged from 26.8-28.7%. The results revealed that linoleic acid (40.5-49.6%) was the main fatty acid in the Royal Gala, Red Delicious and Pyrus Malus seeds, and oleic acid (38.7-45.5%) was the main fatty acid in the Golden Delicious seeds. Palmitic acid (6.1-7.4%) and stearic acid (2.0-3.1%) were the dominant saturated fatty acids, besides the small amount of palmitoleic, heptadecanoic, linolenic, archidic, eicosanoic, and behenic acids. Sterols, tocopherols, hydrocarbons and some other minor components were also identified from the unsaponifiable lipid fraction. The variation among the results of both fatty acids and lipid bio actives for the four different varieties was assessed by principal component analysis, discriminant analysis and cluster analyses. The results conclude that both oil fractions could be applied as a useful tool to discriminate among the apple seed varieties. (Author) 42 refs.

Chemical constituents of gold-red apple and their α-glucosidase inhibitory activities.

Science.gov (United States)

He, Qian-Qian; Yang, Liu; Zhang, Jia-Yu; Ma, Jian-Nan; Ma, Chao-Mei

2014-10-01

Ten compounds were isolated and purified from the peels of gold-red apple (Malus domestica) for the 1st time. The identified compounds are 3β, 20β-dihydroxyursan-28-oic acid (1), 2α-hydroxyoleanolic acid (2), euscaphic acid (3), 3-O-p-coumaroyl tormentic acid (4), ursolic acid (5), 2α-hydroxyursolic acid (6), oleanolic acid (7), betulinic acid (8), linolic acid (9), and α-linolenic acid (10). Their structures were determined by interpreting their nuclear magnetic resonance and mass spectrometry (MS) spectra, and by comparison with literature data. Compound 1 is new, and compound 2 is herein reported for the 1st time for the genus Malus. α-Glucosidase inhibition assay revealed 6 of the triterpenoid isolates as remarkable α-glucosidase inhibitors, with betulinic acid showing the strongest inhibition (IC50 = 15.19 μM). Ultra-performance liquid chromatography-electrospray ionization MS analysis of the fruit peels, pomace, flesh, and juice revealed that the peels and pomace contained high levels of triterpenes, suggesting that wastes from the fruit juice industry could serve as rich sources of bioactive triterpenes. © 2014 Institute of Food Technologists®

Geoecology of a forest watershed underlain by serpentine in Central Europe

Science.gov (United States)

Pavel Krám; Filip Oulehle; Veronika Štedrá; Jakub Hruška; James B. Shanley; Rakesh Minocha; Elena. Traister

2009-01-01

The geoecology of a serpentinite-dominated site in the Czech Republic was investigated by rock, soil, water, and plant analyses. The 22-ha Pluhuv Bor watershed is almost entirely forested by a nearly 110-year old plantation of Picea abies (Norway Spruce) mixed with native Pinus sylvestris (Scots Pine) in the highest elevations...

Pest risk analysis for Conogethes punctiferalis (Yellow peach moth or castor capsule borer)

OpenAIRE

Food and Environment Research Agency

2012-01-01

This is a highly polyphagous pest, the larvae boring into fruit, seeds and stems of plants in many different families. Economic hosts grown in the UK include Allium cepa (onion), Malus (apple), Prunus (plum, cherry), Pyrus (pear), Vitis vinifera (grape vine), and Zea mays (maize). Other recorded hosts include Castanea (chestnut), Citrus, Curcuma longa (tumeric), Durio zibethinus (durian), Elettaria cardamomum (cardamom), Helianthus annuus (sunflower), Punica granatum (po...

Xylem and phloem phenology in co-occurring conifers exposed to drought.

Science.gov (United States)

Swidrak, Irene; Gruber, Andreas; Oberhuber, Walter

2014-01-01

Variability in xylem and phloem phenology among years and species is caused by contrasting temperatures prevailing at the start of the growing season and species-specific sensitivity to drought. The focus of this study was to determine temporal dynamics of xylem and phloem formation in co-occurring deciduous and evergreen coniferous species in a dry inner Alpine environment (750 m a.s.l., Tyrol, Austria). By repeated micro-sampling of the stem, timing of key phenological dates of xylem and phloem formation was compared among mature Pinus sylvestris , Larix decidua and Picea abies during two consecutive years. Xylem formation in P. sylvestris started in mid and late April 2011 and 2012, respectively, and in both years about 2 week later in P. abies and L. decidua . Phloem formation preceded xylem formation on average by 3 week in P. sylvestris , and c . 5 week in P. abies and L. decidua . Based on modeled cell number increase, tracheid production peaked between early through late May 2011 and late May through mid-June 2012. Phloem formation culminated between late April and mid-May in 2011 and in late May 2012. Production of xylem and phloem cells continued for about 4 and 5-6 months, respectively. High variability in xylem increment among years and species is related to exogenous control by climatic factors and species-specific sensitivity to drought, respectively. On the other hand, production of phloem cells was quite homogenous and showed asymptotic decrease with respect to xylem cells indicating endogenous control. Results indicate that onset and culmination of xylem and phloem formation are controlled by early spring temperature, whereby strikingly advanced production of phloem compared to xylem cells suggests lower temperature requirement for initiation of the former.

Variability of fire behavior, fire effects, and emissions in Scotch pine forests of central Siberia

Science.gov (United States)

D. J. McRae; Susan Conard; G. A. Ivanova; A. I. Sukhinin; Steve Baker; Y. N. Samsonov; T. W. Blake; V. A. Ivanov; A. V. Ivanov; T. V. Churkina; WeiMin Hao; K. P. Koutzenogij; Nataly Kovaleva

2006-01-01

As part of the Russian FIRE BEAR (Fire Effects in the Boreal Eurasia Region) Project, replicated 4-ha experimental fires were conducted on a dry Scotch pine (Pinus sylvestris)/lichen (Cladonia sp.)/feathermoss (Pleurozeum schreberi) forest site in central Siberia. Observations from the initial seven surface fires (2000-2001) ignited under a range of burning...

Caledonian scots pine: origins and genetic structure

Science.gov (United States)

Bohun B Kinloch; R. D. Westfall; G. I. Forrest

1986-01-01

Monoterpene and isozyme loci, used as markers to study the genetic structure of Scots pine (Pinus sylvestris L.) native to Scotland, showed that the endemic populations are not genetically impoverished, in spite of severe contraction in range and numbers as a result of both natural and anthropogenic causes. On the contrary, variability in the relict...

Time-of-Flight Adjustment Procedure for Acoustic Measurements in Structural Timber

Science.gov (United States)

Danbiel F. Llana; Guillermo Iñiguez-Gonzalez; Francisco Arriaga; Xiping Wang

2016-01-01

The effect of timber length on time-of-flight acoustic longitudinal measurements was investigated on the structural timber of four Spanish species: radiata pine (Pinus radiata D. Don), Scots pine (Pinus sylvestris L.), laricio pine (Pinus nigra Arn.), and maritime pine (Pinus pinaster Ait.). Time-of-flight longitudinal measurements were conducted on 120 specimens of...

Chemical composition of needles and cambial activity of stems of Scots pine trees affected by air pollutants in Polish forests

Science.gov (United States)

Wojciech Dmuchowski; Ewa U. Kurczynska; Wieslaw Wloch

1998-01-01

The impact of environmental pollution is defined for the chemical composition of Scots pine (Pinus sylvestris L.) needles and cambial activity in the tree stems in Polish forests. The research investigated 20-year-old trees growing in two areas in significantly different levels of pollution. The highly polluted area was located near the Warsaw...

Tree seedling response to LED spectra: Implications for forest restoration

Science.gov (United States)

Antonio Montagnoli; R. Kasten Dumroese; Mattia Terzaghi; Jeremiah R. Pinto; Nicoletta Fulgaro; Gabriella Stefania Scippa; Donato Chiatante

2018-01-01

We found that different spectra, provided by light-emitting diodes or a fluorescent lamp, caused different photomorphological responses depending on tree seedling type (coniferous or broad-leaved), species, seedling development stage, and seedling fraction (shoot or root). For two conifers (Picea abies and Pinus sylvestris) soon after germination (≤40 days), more...

Mistletoe lectin is not the only cytotoxic component in fermented preparations of Viscum album from white fir (Abies pectinata

Directory of Open Access Journals (Sweden)

Ramos Mac

2007-05-01

Full Text Available Abstract Background Preparations of mistletoe (Viscum album are the form of cancer treatment that is most frequently used in the complementary medicine. Previous work has shown that these preparations are able to exert cytotoxic effects on carcinoma cells, the extent of which might be influenced by the host tree species and by the content of mistletoe lectin. Methods Using colorimetric assays, we have now compared the cytotoxic effects of Viscum album preparations (VAPs obtained from mistletoe growing on oak (Quercus robur and Q. petraea, VAP-Qu, apple tree (Malus domestica,, VAP-M, pine (Pinus sylvestris, VAP-P or white fir (Abies pectinata, VAP-A, on the in vitro growth of breast and bladder carcinoma cell lines. While MFM-223, KPL-1, MCF-7 and HCC-1937 were the breast carcinoma cell lines chosen, the panel of tested bladder carcinoma cells comprised the T-24, TCC-SUP, UM-UC-3 and J-82 cell lines. Results Each of the VAPs inhibited cell growth, but the extent of this inhibition differed with the preparation and with the cell line. The concentrations of VAP-Qu, VAP-M and VAP-A which led to a 50 % reduction of cell growth (IC50 varied between 0.6 and 0.03 mg/ml. Higher concentrations of VAP-P were required to obtain a comparable effect. Purified mistletoe lectin I (MLI led to an inhibition of breast carcinoma cell growth at concentrations lower than those of VAPs, but the sensitivity towards purified MLI did not parallel that towards VAPs. Bladder carcinoma cells were in most cases more sensitive to VAPs treatment than breast carcinoma cells. The total mistletoe lectin content was very high in VAP-Qu (54 ng/mg extract, intermediate in VAP-M (25 ng/mg extract, and very low in VAP-P (1.3 ng/mg extract and in VAP-A (1 ng/mg extract. As to be expected from the low content of mistletoe lectin, VAP-P led to relatively weak cytotoxic effects. Most remarkably, however, the lectin-poor VAP-A revealed a cytotoxic effect comparable to, or even stronger

Toxic effects of six plant oils alone and in combination with controlled atmosphere on Liposcelis bostrychophila (Psocoptera: Liposcelididae).

Science.gov (United States)

Wang, J J; Tsai, J H; Ding, W; Zhao, Z M; Li, L S

2001-10-01

Six plant essential oils alone as repellent and fumigant, and in combination with the controlled atmosphere against Liposcelis bostrychophila Badonnel were assessed in the laboratory. These essential oils were extracted from the leaves of six source plants: Citrus tangerina Tanaka, Citrus aurantium L., Citrus bergamia Risso et Poiteau, Pinus sylvestris L., Cupressus funebris End]., and Eucalyptus citriodora Hook. The repellency test indicated that L. bostrychophila adults were repelled by filter paper strips treated with six essential oils. Of these essential oils, the C. funebris oil was most effective followed by that of F. sylvestris, C. tangerina, C. bergamia, and E. citriodora. The average repellency of the C. aurantium oil against L. bostrychophila adults was significantly lower than other five test oils by day 14. These essential oils had a high level of toxicity in the fumigation assay against L. bostrychophila adults at both 10 and 20 ppm. When combined with two controlled atmosphere treatments (12% CO2 + 9% O2, and 10% CO2 + 5% O2, balanced N2), the toxicity of plant oils was enhanced significantly.

Defence activation in strawberry and pine- Epigenetic changes in treated plants

OpenAIRE

Komajda, Ludwika

2016-01-01

Strawberry plants (Fragaria x ananassa) and Scots pine (Pinus sylvestris) represent species, withinagriculture and forestry respectively, that are traditionally protected by utilization of pesticidesincluding neurotoxic insecticides. More environmentally friendly protection strategies are thereforehighly desirable. Treating plants with specific metabolites naturally occurring in their tissues might alterepigenetic mechanisms, which in turn may strengthen plants self-defense against diseases a...

INTERACTIONS OF ELEVATED CO2, NH3 AND O-3 ON MYCORRHIZAL INFECTION, GAS-EXCHANGE AND N-METABOLISM IN SAPLINGS OF SCOTS PINE

NARCIS (Netherlands)

PEREZSOBA, M; DUECK, TA; PUPPI, G; KUIPER, PJC

Four-year-old saplings of Scots pine (Pinus sylvestris L.) were exposed for 11 weeks in controlled-environment chambers to charcoal-filtered air, or to charcoal-filtered air supplemented with NH3 (40 mu g m(-3)), O-3 (110 mu g m(-3) during day/ 40 mu g m(-3) during night) or NH3 + O-3. All

Fulltext PDF

Indian Academy of Sciences (India)

Phoenix sylvestris Roxb. of Palmaceae is a tall palm bearing long compound leaves in terminal cluster forming the crown. The large inflorescence carries small and unisexualflowers and the fruit which is a one-seeded berry is edible when ripe. Stem as well as the young inflorescence are tapped for a exudate that is rich in ...

Smoke hardiness of pines

Energy Technology Data Exchange (ETDEWEB)

Pelz, E

1958-01-01

It has been determined in East Germany that some species of pines are more susceptible to the damaging effects of sulfates than others. On sites that are deficient in nutrients, the trees were found to be more susceptible to injuries. Pinus nigra was the most resistant, then Pinus strobus was next, and Pinus sylvestris was the most sensitive.

The ratio of NPP to GPP: evidence of change over the course of stand development

Science.gov (United States)

Annikki Makela; Harry T. Valentine

2001-01-01

Using Scots pine (Pinus sylvestris L.) in Fenno-Scandia as a case study, we investigate whether net primary production (NPP) and maintenance respiration are constant fractions of gross primary production (GPP) as even-aged mono-specific stands progress from initiation to old age. A model of the ratio of NPP to GPP is developed based on (1) the...

Parasitic macrofungi (Basidiomycetes on fruit shrubs and trees in the Tarnów town (S Poland

Directory of Open Access Journals (Sweden)

Marcin Piątek

2014-08-01

Full Text Available Results of 6 years of research carried out in the Tarnów town, southern Poland, are presented. Total number of 27 species of Basidiomycetes were recorded on 7 species of fruit shrubs and trees. Some of them were found on hosts new for Poland, on Malus domestica - Abortiporus biennis, Ganoderma australe, Meripilus giganteus, Stereum hirsutum and Volvariella bombycina; on Juglans regia - Ganoderma applanalum and Hineola auricula-judae.

The Balance of Expression of Dihydroflavonol 4-reductase and Flavonol Synthase Regulates Flavonoid Biosynthesis and Red Foliage Coloration in Crabapples.

Science.gov (United States)

Tian, Ji; Han, Zhen-yun; Zhang, Jie; Hu, YuJing; Song, Tingting; Yao, Yuncong

2015-07-20

Red leaf color is an attractive trait of Malus families, including crabapple (Malus spp.); however, little is known about the molecular mechanisms that regulate the coloration. Dihydroflavonols are intermediates in the production of both colored anthocyanins and colorless flavonols, and this current study focused on the gene expression balance involved in the relative accumulation of these compounds in crabapple leaves. Levels of anthocyanins and the transcript abundances of the anthocyanin biosynthetic gene, dihydroflavonol 4-reductase (McDFR) and the flavonol biosynthetic gene, flavonol synthase (McFLS), were assessed during the leaf development in two crabapple cultivars, 'Royalty' and 'Flame'. The concentrations of anthocyanins and flavonols correlated with leaf color and we propose that the expression of McDFR and McFLS influences their accumulation. Further studies showed that overexpression of McDFR, or silencing of McFLS, increased anthocyanin production, resulting in red-leaf and red fruit peel phenotypes. Conversely, elevated flavonol production and green phenotypes in crabapple leaves and apple peel were observed when McFLS was overexpressed or McDFR was silenced. These results suggest that the relative activities of McDFR and McFLS are important determinants of the red color of crabapple leaves, via the regulation of the metabolic fate of substrates that these enzymes have in common.

Designing incentive schemes for promoting energy-efficient appliances: A new methodology and a case study for Spain

International Nuclear Information System (INIS)

Galarraga, Ibon; Abadie, Luis M.; Kallbekken, Steffen

2016-01-01

The energy-efficiency gap has been high on research and policy agendas for several decades. Incentive schemes such as subsidies, taxes and bonus-malus schemes are widely used to promote energy-efficient appliances. Most research, however, considers instruments in isolation, and only rarely in the context of political constraints on instrument use, or for alternative policy goals. This paper presents a methodology for the optimal design of incentive schemes based on the minimisation of Dead Weight Loss for different policy goals and policy restrictions. The use of the methodology is illustrated by designing optimal combinations of taxes and subsidies in Spain for three types of appliance: dishwashers, refrigerators and washing machines. The optimal policies are designed subject to different policy goals such as achieving a fixed reduction in emissions or a certain increased market share for efficient appliances, and for policy constraints such as budget neutrality. The methodology developed here can also be used to evaluate past and current incentive schemes. - Highlights: • A new methodology for the optimal design of incentive schemes is presented. • This is done minimising the Dead Weight Loss for different goals and restrictions. • Efficient bonus malus schemes can be designed with this method.

Patterns of low temperature induced accumulation of dehydrins in Rosaceae crops-Evidence for post-translational modification in apple.

Science.gov (United States)

Haimi, Perttu; Vinskienė, Jurgita; Stepulaitienė, Inga; Baniulis, Danas; Stanienė, Gražina; Šikšnianienė, Jūratė Bronė; Rugienius, Rytis

2017-11-01

Important crop plants of Rosaceae family are often damaged during winter due to the lack of acclimation and cold hardiness. One of the cellular responses of plants to cold stress is the accumulation of dehydrin proteins. We studied the expression of dehydrins in several Rosaceae species during low temperature treatment in vitro. Microshoots of Pyrus communis, Malus×domestica, Fragaria vesca, Fragaria×ananassa, Prunus cerasus and Prunus avium cultivars were grown in low temperature conditions. Genotype -specific accumulation of dehydrins was detected by immunoblot analysis of the extracted proteins. Untargeted difference gel electrophoresis of Malus x domestica microshoots revealed an extensive accumulation of three dehydrins. In a protein phosphatase assay, MdDHN2 and MdDHN4, but not MdDHN6 proteins were found to be extensively phosphorylated. In terms of the amount of protein synthesized, dehydrins are a major protein-level adaptation mechanism to low temperature in M. x domestica. In addition to dehydrins, the induction of proteins involved in the response for oxidative stress were observed. Additionally, a Xero2 -like dehydrin of F. vesca was detected by difference gel electrophoresis and identified by nano LC-MS/MS. Copyright © 2017 Elsevier GmbH. All rights reserved.

Asignación de primas en el seguro del automóvil utilizando el Análisis en ComponentesPrincipales Funcionales = Premium allocation in the car insurance by using Functional Principal Component Analysis.

Directory of Open Access Journals (Sweden)

Herranz Peinado, C. Patricia

2007-01-01

Full Text Available El estudio de las primas de riesgo en el seguro del automóvil es de suma importancia, debido a la gran competitividad existente en el mercado asegurador. En este artículo se pretende proponer un sistema de bonificación-penalización de las primas de riesgo utilizando el Análisis Funcional en Componentes Principales. En concreto, se realiza un estudio empírico con los datos reales de una compañía aseguradora con cobertura nacional. Aplicando el sistema propuesto de bonificación-penalización a los perfiles de comportamiento de los asegurados, se obtienen las primas de riesgo para cada uno de los perfiles considerados y tramos de edad. = The study of the premium risk in the car insurance is really important because the insurance market is very competitive. In this article we show a bonus-malus method of risk premiums. To do this, we use the Functional Principal Component Analysis. More precisely, we explain an empirical study with the real data of an insurance company. By applying the bonus-malus method that we have given, we are able to obtain the premium risk for different profiles and age ranges.

The Influence of Industrial Air Pollution Forest Lichens at Tomaszów Mazowiecki Region (Central Poland

Directory of Open Access Journals (Sweden)

Krystyna Czyżewska

2014-08-01

Full Text Available The influence of mixed gases pollution (SO2, H2S and CS2 on epiphytic and epixylic lichens growing on Pinus sylvestris in the nature conditions is the matter of consideration. In the case of some lichens, e.g. Lecanora conizaeoides, Scoliciosporum chlorococcum and Thelocarpon laureri the toxitolerant to the air pollution is proved by the authoress.

The history of mercury pollution near the Spolana chlor-alkali plant (Neratovice, Czech Republic) as recorded by Scots pine tree rings and other bioindicators

Czech Academy of Sciences Publication Activity Database

Navrátil, Tomáš; Šimeček, Martin; Shanley, J. B.; Rohovec, Jan; Hojdová, Maria; Houška, J.

2017-01-01

Roč. 586, 15 May (2017), s. 1182-1192 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA16-14762S Institutional support: RVO:67985831 Keywords : point source * Hg emissions * dendrochemistry * bioindicators * soil * bark * needles * Pinus sylvestris * electrolysis * caustic soda Subject RIV: DD - Geochemistry OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.900, year: 2016

Aceitação e preferência de frutos para oviposição em duas populações de Ceratitis capitata (Diptera, Tephritidae)

OpenAIRE

Joachim-Bravo,Iara Sordi; Silva-Neto,Alberto Moreira da

2004-01-01

The influence of four host fruits, orange (Citrus sinensis L.), papaya (Carica papaya L.), mango (Mangifera indica L.) and apple (Malus domestica Borkh) on oviposition behavior of Ceratitis capitata (Wiedemann, 1824) was evaluated. Experiments were carried out on two C. capitata laboratory-reared populations: one with artificial diet for 10 years with periodic introduction of wild flies and other reared with artificial diet for 20 years without wild flies introduction. In acceptance experimen...

Acceptance and preference of fruits for oviposition in two Ceratitis capitata (Diptera, Tephritidae) populations

OpenAIRE

Joachim-Bravo, Iara Sordi; Silva-Neto, Alberto Moreira da

2004-01-01

The influence of four host fruits, orange (Citrus sinensis L.), papaya (Carica papaya L.), mango (Mangifera indica L.) and apple (Malus domestica Borkh) on oviposition behavior of Ceratitis capitata (Wiedemann, 1824) was evaluated. Experiments were carried out on two C. capitata laboratory-reared populations: one with artificial diet for 10 years with periodic introduction of wild flies and other reared with artificial diet for 20 years without wild flies introduction. In acceptance experimen...

Free amino nitrogen concentration correlates to total yeast assimilable nitrogen concentration in apple juice

OpenAIRE

Boudreau, Thomas F.; Peck, Gregory M.; O'Keefe, Sean F.; Stewart, Amanda C.

2017-01-01

Abstract Yeast assimilable nitrogen (YAN) is essential for yeast growth and metabolism during apple (Malus x domestica Borkh.) cider fermentation. YAN concentration and composition can impact cider fermentation kinetics and the formation of volatile aroma compounds by yeast. The YAN concentration and composition of apples grown in Virginia, USA over the course of two seasons was determined through analysis of both free amino nitrogen (FAN) and ammonium ion concentration. FAN was the largest f...

General Characteristics of Flora and Vegetation Formations of Eastern Anatolia Region and Its Environs (Türkiye

Directory of Open Access Journals (Sweden)

Münir ÖZTÜRK

2015-07-01

Full Text Available ABSTRACT: Eastern Anatolia and its environs are included in the Irano-Turanian phytogeographical region of Türkiye. The region abounds in highest mountain ranges (average 1900 m of the country some of which are of quarternary age and volcanic character. Many rivers of historical and international importance like Euphrates, Dicle, Murat, Karasu and Aras. Tigris, Aras and Çoruh flow through the region. It experiencens a typical continental climate. Soils are generally of alluvial, colluvial, chestnut-brown, regosal and basaltic types. The area embodies over 8 million ha of meadows and grasslands which is 41% of Türkiye's total pasturelands as such cattle raising is very high in this area. Forest vegetation is represented mainly by Pinus sylvestris, Quercus libani, Q. longipes, Q. brantii, Q. macranthera, Juniperus excelsa and Betula pendula. Most of these are highly degraded. Plant cover is rich in Irano - Turanian elements but we find Mediterranean and Euro-Siberian elements too to some extent, richest families being Asteraceae, Fabaceae and Poaceae, Lamiaceae, Caryophyllaceae and Apiaceae richest genera being Astragalus, Verbascum, Centaurea, Ranunculus, Alyssum, Vicia, Silene, Dianthus, Veronica and Trifolium. The number of endemics is very high, being around 950. And also the region has gene centers of genera Astragalus, Gypsophila, Cousinia, Acanthophyllum etc. The some typical associations one comes across in this area are; Triseto-Pinetum sylvestris, Trifolio-Pinetum sylvestris, Ballato-Rhamnetum pallasii, Caragano-Minuartietum lineatea, Hippophaetum rhamnoidis, Typho-Juncetum inflecii, Hordeetum violaceumii, Deschampsio-Ranunculetum brachylobus, Hordeeto-Ranunculetum comosae and Polygon-Primuletum auriculatae. Dominantly vegetation of the region is steppe. The are a lot of natural plant taxa using local people. Key Words: Eastern Anatolia, Flora, Vegetation, Biodiversity, Geobotany, Endemism, Türkiye. Doğu Anadolu Bölgesi ve �

Soil microbial biomass under pine forests in the north-western Spain: influence of stand age, site index and parent material

Energy Technology Data Exchange (ETDEWEB)

Mahia, J.; Perez-Ventura, L.; Cabaneiro, A.; Diaz-Ravina, M.

2006-07-01

The effects of stand age, site index and parent material on soil biochemical properties related to biomass (extractable C, microbial C and metabolic quotient) were examined in the 0-15 cm mineral soil layers of Pinus pinaster and Pinus sylvestris stand from NW Spain. Two productivity levels (low and high site index), two ages (young and old) and two parent soil materials (granite and acid schists) were considered. The data indicated that there were differences in microbial parameters in soils under different species. In general in P. pinaster forest higher values of biochemical parameters expressed on organic C basis, were observed in the stands of high site index as compared with the low ones; in contrast, in P. sylvestris no differences among stand site index were detected. In both species different results were also observed depending on parent material and a significant effect of stand age was detected for extractable C and microbial C in P. pinaster forest developed over granite. The data seem to indicate that measured parameters may have the potential to be used as indicators of the effect of forest management on soil organic matter quality. (Author) 25 refs.

Mycorrhization helper bacteria: a case of specificity for altering ectomycorrhiza architecture but not ectomycorrhiza formation.

Science.gov (United States)

Aspray, Thomas J; Frey-Klett, Pascale; Jones, Julie E; Whipps, John M; Garbaye, Jean; Bending, Gary D

2006-11-01

Mycorrhization helper bacteria (MHB), isolated from phylogenetically distinct ectomycorrhizal symbioses involving Lactarius rufus, Laccaria bicolor or Suillus luteus, were tested for fungus specificity to enhance L. rufus-Pinus sylvestris or L. bicolor-P. sylvestris mycorrhiza formation. As MHB isolated from the L. rufus and S. luteus mycorrhiza were originally characterised using a microcosm system, we assessed their ability to enhance mycorrhiza formation in a glasshouse system in order to determine the extent to which MHB are system-specific. Paenibacillus sp. EJP73, an MHB for L. rufus in the microcosm, significantly enhanced L. bicolor mycorrhiza formation in the glasshouse, demonstrating that the MHB effect of this bacterium is neither fungus-specific nor limited to the original experimental system. Although the five MHB strains studied were unable to significantly enhance L. rufus mycorrhiza formation, two of them did have a significant effect on dichotomous short root branching by L. rufus. The effect was specific to Paenibacillus sp. EJP73 and Burkholderia sp. EJP67, the two strains isolated from L. rufus mycorrhiza, and was not associated with auxin production. Altered mycorrhiza architecture rather than absolute number of mycorrhizal roots may be an important previously overlooked parameter for defining MHB effects.