WorldWideScience

Sample records for malus zumi matsumura

  1. Intracellular localization of Na + /H + antiporter from Malus zumi ...

    African Journals Online (AJOL)

    In this study, we examined the intracellular localization of the product of Na+/H+ antiporter gene (MzNHX1) cloned from Malus zumi. Analysis using yeast cells expressing a fusion protein of MzNHX1 and green fluorescent protein confirmed the localization of MzNHX1 on the tonoplast.

  2. A genome-wide expression profile of salt-responsive genes in the apple rootstock Malus zumi.

    Science.gov (United States)

    Li, Qingtian; Liu, Jia; Tan, Dunxian; Allan, Andrew C; Jiang, Yuzhuang; Xu, Xuefeng; Han, Zhenhai; Kong, Jin

    2013-10-18

    In some areas of cultivation, a lack of salt tolerance severely affects plant productivity. Apple, Malus x domestica Borkh., is sensitive to salt, and, as a perennial woody plant the mechanism of salt stress adaption will be different from that of annual herbal model plants, such as Arabidopsis. Malus zumi is a salt tolerant apple rootstock, which survives high salinity (up to 0.6% NaCl). To examine the mechanism underlying this tolerance, a genome-wide expression analysis was performed, using a cDNA library constructed from salt-treated seedlings of Malus zumi. A total of 15,000 cDNA clones were selected for microarray analysis. In total a group of 576 cDNAs, of which expression changed more than four-fold, were sequenced and 18 genes were selected to verify their expression pattern under salt stress by semi-quantitative RT-PCR. Our genome-wide expression analysis resulted in the isolation of 50 novel Malus genes and the elucidation of a new apple-specific mechanism of salt tolerance, including the stabilization of photosynthesis under stress, involvement of phenolic compounds, and sorbitol in ROS scavenging and osmoprotection. The promoter regions of 111 genes were analyzed by PlantCARE, suggesting an intensive cross-talking of abiotic stress in Malus zumi. An interaction network of salt responsive genes was constructed and molecular regulatory pathways of apple were deduced. Our research will contribute to gene function analysis and further the understanding of salt-tolerance mechanisms in fruit trees.

  3. Investigation of wild species potential to increase genetic diversity useful for apple breeding

    Directory of Open Access Journals (Sweden)

    Dan Catalina

    2015-01-01

    Full Text Available The potential of testing new apple cultivars and the possibility to induce valuable traits is directly dependent on the availability of sufficient genetic diversity, while apple breeding has narrowed the genetic ground of commercial cultivars. Wild species were studied in regard to their influence upon progenies and their capacity to enlarge apple genetic diversity. The interspecific seedlings were framed in five biparental mating (paired crosses, in which Malus species were crossed with different cultivars, obtaining half-sib families. The number of F1 progenies per combination varied from 31 (Cluj 218/2 × M. floribunda up to 142 (Reinette Baumann × M. floribunda, with a total of 1650 hybrids F1. The influences upon vigour and juvenile period and possible correlation among fruit size and taste were analyzed. Juvenile period varied from 6.00 (M. zumi × Jonathan to 9.31 years (Cluj 218/2 × M. floribunda. Data based on correlation coefficient illustrated that the fructification year was not influenced by the vigour of trees. The highest value of correlation for fruit’s size and taste was obtained among M. coronaria hybrids. This result might suggest that once the fruit are larger, there is a high chance the taste is also more appreciative and fruit quality for mouth feels increase. Depending on the parental formula, additive effects may be inferior compared to genetic effects of dominance and epistasis. Although M. zumi and M. floribunda achieved the same genetic gain (0.31, M. zumi had a higher expected selection response for fruit size. The difficulty of obtaining seedlings with tasty and large fruit when wild Malus species are used as genitors is resulting from the values of expected selection response data, but in the same time results confirm that wild Malus species are suitable resources for genetic variability, both for dessert and ornamental apple cultivars.

  4. Isolation and preliminary function analysis of a Na + /H + antiporter ...

    African Journals Online (AJOL)

    A full-length cDNA Na+/H+ antiporter gene (MzNHX1) was isolated from Malus zumi according to the homologous Na+/H+ antiporter gene region in plants. Sequence analysis indicated that the cDNA was 2062 bp in length, including an open reading frame (ORF) of 1629 bp, which encoded a predicted polypeptide of 542 ...

  5. SEBARAN STASIONER PADA SISTEM BONUS-MALUS SWISS SERTA MODIFIKASINYA (Stationary Distribution of Swiss Bonus-Malus System and its Modification

    Directory of Open Access Journals (Sweden)

    Cherry Galatia Ballangan

    2002-01-01

    Full Text Available Bonus-Malus System is a system in actuary that introduce the premium class (state partition, where the state is influenced by the number of annual claims reported by the policy holder. We could base the determination of the state on the stationary distribution that represent the number of policy holders in any state. Swiss Bonus-Malus System has 22 state. The number of state that involved in this system result in the difficulty of stationary distribution determination. Therefore, the aim of this paper is to study a method to obtain stationary distribution of Swiss Bonus-Malus System by recursive formula, with this recursive formula, the stationary distribution of Swiss Bonus-Malus System can be determined easier. Modification of this system with infinite state result in the changes of recursive formula to obtain the stationary. This changes including the determining of base value of the recursive formula. Abstract in Bahasa Indonesia : Sistem Bonus-Malus merupakan sistem dalam aktuaria yang memperkenalkan pembagian kelas premi (state yang dipengaruhi oleh jumlah klaim yang diajukan oleh pemegang polis tiap tahunnya. Penetapan state dalam sistem ini didasarkan pada pencarian sebaran stasioner yang menyatakan banyaknya pemegang polis dalam tiap state. Sistem Bonus-Malus Swiss (BMS memiliki 22 state. Banyaknya state yang terlibat dalam sistem ini mengakibatkan sulitnya penentuan sebaran stasioner pada sistem BMS tersebut. Karena itu dalam tulisan ini dipelajari suatu metode penentuan sebaran stasioner dari sistem BMS tersebut, yaitu dengan menggunakan formula rekursif. Dengan formula rekursif ini, sebaran stasioner sistem BMS dapat ditentukan dengan mudah. Modifikasi sistem BMS untuk jumlah state yang tak hingga mengakibatkan perubahan pada formula rekursif untuk mencari sebaran stasionernya. Perubahan ini meliputi penetapan nilai awal dari formula rekursif tersebut. Kata kunci: sebaran stasioner, formula rekursif, sistem Monus-Malus Swiss.

  6. Malus spp.

    African Journals Online (AJOL)

    Jane

    2011-07-11

    Jul 11, 2011 ... differences in cultivars and plant materials, technology steps such as preventing the explants contamination, selecting culture medium, regulating hormone proportion and exercising seedlings outdoor have been the difficulties in the establishment of regeneration system for. Malus plant, especially for ...

  7. Cryobiotechnology of apple (Malus spp.): development, progress and future prospects.

    Science.gov (United States)

    Wang, Min-Rui; Chen, Long; Teixeira da Silva, Jaime A; Volk, Gayle M; Wang, Qiao-Chun

    2018-05-01

    Cryopreservation provides valuable genes for further breeding of elite cultivars, and cryotherapy improves the production of virus-free plants in Malus spp., thus assisting the sustainable development of the apple industry. Apple (Malus spp.) is one of the most economically important temperate fruit crops. Wild Malus genetic resources and existing cultivars provide valuable genes for breeding new elite cultivars and rootstocks through traditional and biotechnological breeding programs. These valuable genes include those resistant to abiotic factors such as drought and salinity, and to biotic factors such as fungi, bacteria and aphids. Over the last three decades, great progress has been made in apple cryobiology, making Malus one of the most extensively studied plant genera with respect to cryopreservation. Explants such as pollen, seeds, in vivo dormant buds, and in vitro shoot tips have all been successfully cryopreserved, and large Malus cryobanks have been established. Cryotherapy has been used for virus eradication, to obtain virus-free apple plants. Cryopreservation provided valuable genes for further breeding of elite cultivars, and cryotherapy improved the production of virus-free plants in Malus spp., thus assisting the sustainable development of the apple industry. This review provides updated and comprehensive information on the development and progress of apple cryopreservation and cryotherapy. Future research will reveal new applications and uses for apple cryopreservation and cryotherapy.

  8. New record for the invasive Spotted Wing Drosophila, Drosophila suzukii Matsumura (Diptera: Drosophilidae) in Anillaco, Argentina

    Science.gov (United States)

    The invasive Spotted Wing Drosophila (SWD), Drosophila suzukii Matsumura, is reported for the first time in La Rioja, Argentina. This represents a major range expansion for this species. The natural enemies of SWD, Leptopilina clavipes and Ganaspis hookeri were also collected with the SWD at the s...

  9. Cryopreservation of apple (Malus spp.): development, progress and future prospects

    Science.gov (United States)

    Apple (Malus sp.) is one of the most economically important temperate fruit crops. Wild Malus genetic resources and existing cultivars provide valuable genes for breeding new elite cultivars and rootstocks through traditional and biotechnological breeding programs. Over the last three decades, great...

  10. Estudio comparativo entre metodologías para el diseño de Sistemas Bonus-Malus.

    Directory of Open Access Journals (Sweden)

    Núñez del Prado, José Antonio

    2004-01-01

    Full Text Available El objetivo de este trabajo es mostrar un método para hacer comparaciones entre Sistemas Bonus Malus. Se comparan Sistemas Bonus Malus obtenidos mediante la metodología GPBM, basada en Programación por Metas y Sistemas Bonus Malus obtenidos mediante la metodología clásica, conocida como Escala de Bayes.

  11. Identification and evaluation of attractiveness of lactic acid bacteria as a bait for Drosophila suzukii Matsumura

    OpenAIRE

    Maddalena, Giuseppe

    2016-01-01

    The spotted-wing drosophila (SWD), Drosophila suzukii Matsumura (Diptera: Drosophilidae), native of Eastern Asia, is an invasive alien species in Europe and the Americas and is one of the main emerging pests of valuable crops, including soft fruits and wine grapes. The conventional approach to handle infestations of SWD involves the use of commercially available insecticides, but these do not seem able to ensure effective results; consequently, alternative strategies are strongly required. Ma...

  12. Descriptions of four new species of Semia Matsumura (Hemiptera: Cicadidae: Psithyristriini) from Vietnam, with a key to the species of Semia.

    Science.gov (United States)

    Emery, David L; Lee, Young June; Pham, Hong-Thai

    2017-01-04

    This paper provides descriptions of four new species of the genus Semia Matsumura, 1917 from Vietnam: Semia magna sp. nov., Semia spiritus sp. nov., Semia pallida sp. nov., and Semia albusequi sp. nov. A key to the 13 species of Semia is provided.

  13. Molecular genetic features of polyploidization and aneuploidization reveal unique patterns for genome duplication in diploid Malus.

    Directory of Open Access Journals (Sweden)

    Michael J Considine

    Full Text Available Polyploidization results in genome duplication and is an important step in evolution and speciation. The Malus genome confirmed that this genus was derived through auto-polyploidization, yet the genetic and meiotic mechanisms for polyploidization, particularly for aneuploidization, are unclear in this genus or other woody perennials. In fact the contribution of aneuploidization remains poorly understood throughout Plantae. We add to this knowledge by characterization of eupolyploidization and aneuploidization in 27,542 F₁ seedlings from seven diploid Malus populations using cytology and microsatellite markers. We provide the first evidence that aneuploidy exceeds eupolyploidy in the diploid crosses, suggesting aneuploidization is a leading cause of genome duplication. Gametes from diploid Malus had a unique combinational pattern; ova preserved euploidy exclusively, while spermatozoa presented both euploidy and aneuploidy. All non-reduced gametes were genetically heterozygous, indicating first-division restitution was the exclusive mode for Malus eupolyploidization and aneuploidization. Chromosome segregation pattern among aneuploids was non-uniform, however, certain chromosomes were associated for aneuploidization. This study is the first to provide molecular evidence for the contribution of heterozygous non-reduced gametes to fitness in polyploids and aneuploids. Aneuploidization can increase, while eupolyploidization may decrease genetic diversity in their newly established populations. Auto-triploidization is important for speciation in the extant Malus. The features of Malus polyploidization confer genetic stability and diversity, and present heterozygosity, heterosis and adaptability for evolutionary selection. A protocol using co-dominant markers was proposed for accelerating apple triploid breeding program. A path was postulated for evolution of numerically odd basic chromosomes. The model for Malus derivation was considerably revised

  14. Molecular genetic features of polyploidization and aneuploidization reveal unique patterns for genome duplication in diploid Malus.

    Science.gov (United States)

    Considine, Michael J; Wan, Yizhen; D'Antuono, Mario F; Zhou, Qian; Han, Mingyu; Gao, Hua; Wang, Man

    2012-01-01

    Polyploidization results in genome duplication and is an important step in evolution and speciation. The Malus genome confirmed that this genus was derived through auto-polyploidization, yet the genetic and meiotic mechanisms for polyploidization, particularly for aneuploidization, are unclear in this genus or other woody perennials. In fact the contribution of aneuploidization remains poorly understood throughout Plantae. We add to this knowledge by characterization of eupolyploidization and aneuploidization in 27,542 F₁ seedlings from seven diploid Malus populations using cytology and microsatellite markers. We provide the first evidence that aneuploidy exceeds eupolyploidy in the diploid crosses, suggesting aneuploidization is a leading cause of genome duplication. Gametes from diploid Malus had a unique combinational pattern; ova preserved euploidy exclusively, while spermatozoa presented both euploidy and aneuploidy. All non-reduced gametes were genetically heterozygous, indicating first-division restitution was the exclusive mode for Malus eupolyploidization and aneuploidization. Chromosome segregation pattern among aneuploids was non-uniform, however, certain chromosomes were associated for aneuploidization. This study is the first to provide molecular evidence for the contribution of heterozygous non-reduced gametes to fitness in polyploids and aneuploids. Aneuploidization can increase, while eupolyploidization may decrease genetic diversity in their newly established populations. Auto-triploidization is important for speciation in the extant Malus. The features of Malus polyploidization confer genetic stability and diversity, and present heterozygosity, heterosis and adaptability for evolutionary selection. A protocol using co-dominant markers was proposed for accelerating apple triploid breeding program. A path was postulated for evolution of numerically odd basic chromosomes. The model for Malus derivation was considerably revised. Impacts of

  15. Intracellular localization of Na /H antiporter from Malus zumi (MzNHX1)

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-15

    Dec 15, 2009 ... protein since 1980s. The exogenous protein can be located on different membrane in yeast cells, which is impossible in bacteria. There are ... porter protein which locates on the plasma membrane or the tonoplast, it is wise to use eGFP as fluorescence mark in yeast cells, because that the technology of this.

  16. Differential dependence of apple ( Malus domestica Borkh.) cultivars ...

    African Journals Online (AJOL)

    Golden Delicious' and 'Topred' apple (Malus domestica Borkh.) peel on the xanthophyll cycle for photoprotection was studied under laboratory conditions. Mature fruit peel was either treated with 1 mm dithiothreitol (DTT) to inhibit the ...

  17. Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study

    OpenAIRE

    Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

    2018-01-01

    RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an...

  18. Recovery patterns, histological observations and genetic integrity in Malus shoot tips cryopreserved using droplet vitrification and encapsulation-dehydration procedures

    Science.gov (United States)

    A droplet-vitrification procedure is described for cryopreservation of Malus shoot tips. Survival patterns, recovery types, histological observations, and genetic integrity were compared for Malus shoot tips cryopreserved using this droplet-vitrification procedure and an encapsulation-dehydration pr...

  19. Delta 13C predicts water deficit sensitivity in Malus sieversii (Ledeb.) M. Roem. from a xerophytic site in Kazakhstan

    Science.gov (United States)

    Modern apples [Malus x domestica (Borkh.)] are thought to have originated in western China from the progenitor species, Malus sieversii (Ledeb.) M. Roem. Due to many generations of selection for traits associated with high fruit quality, our current breeding germplasm has become dangerously narrow....

  20. The Polarization of Light and Malus' Law Using Smartphones

    Science.gov (United States)

    Monteiro, Martín; Stari, Cecilia; Cabeza, Cecilia; Marti, Arturo C.

    2017-01-01

    Originally an empirical law, nowadays Malus' law is seen as a key experiment to demonstrate the transverse nature of electromagnetic waves, as well as the intrinsic connection between optics and electromagnetism. In this work, a simple and inexpensive setup is proposed to quantitatively verify the nature of polarized light. A flat computer screen…

  1. Antioxidant, antimicrobial activity and mineral composition of low-temperature fractioning products of Malus domestica Borkh (common Antonovka

    Directory of Open Access Journals (Sweden)

    Elena Kuznetsova

    2017-01-01

    Full Text Available The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has been performed. We obtained by fractionation the biologically active products that are the dehydrated concentrate of juice and the powder of pomace fibers. Use of low temperature minimizes biological value losses during processing. These fractions of fruit Malus domestica Borkh (Common Antonovka are experimentally studied. It is found that the fractions have high antioxidant activity and include bioflavonoids and organic and phenol carboxylic acids. Analysis of chromatograms showed availability of the identical compounds in the products of low-temperature fractionation. Sodium and potassium are part of the cells of biological systems as highly mobile ionic forms. Therefore, these elements prevail in the concentrated juice. Iron, manganese, copper, and zinc are biogenic trace elements or components of enzyme systems and are evenly distributed as in plant cell walls as well in protoplasm. It follows from the results of the study of the mineral composition that the products of the low-temperature fractioning can be used for a functional food as a result of its high content of magnesium and iron. The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has antimicrobial activity against the standard strains of spoilage: Bacillus subtilis VKM-B-501, Micrococcus luteus VKM-As-2230, Aspergillus flavus VKM-F-1024, Penicillium expansion VKM-F-275, Mucor mucedo VKM- F-1257, Rhizopus stolonifer VKM- F-2005. Experimental data show that the products of low-temperature fractioning of Malus domestica Borkh (Common Antonovka inhibit microorganism's growth. The detected composition of Malus domestica Borkh (Common Antonovka fractions allows using these products as natural additives in food technology to maintain and increase period of storage and also for preventive nutrition.

  2. Wound Healing Effects of Prunus yedoensis Matsumura Bark in Scalded Rats

    Directory of Open Access Journals (Sweden)

    Jin-Ho Lee

    2017-01-01

    Full Text Available Pruni Cortex has been used to treat asthma, measles, cough, urticaria, pruritus, and dermatitis in traditional Korean medicine. The objective of this study was to investigate the effects of Prunus yedoensis Matsumura bark methanol extract (PYE on scald-induced dorsal skin wounds in rats. Scalds were produced in Sprague-Dawley rats with 100°C water and treated with 5% and 20% PYE (using Vaseline as a base, silver sulfadiazine (SSD, and Vaseline once a day for 21 days, beginning 24 hours after scald by treatment group allocation. The PYE-treated groups showed accelerated healing from 12 days after scald, demonstrated by rapid eschar exfoliation compared to the control and SSD groups. PYE-treated groups showed higher wound contraction rates and better tissue regeneration in comparison with the control group. Serum analysis showed that transforming growth factor beta 1 and vascular endothelial growth factor levels remained high or gradually increased up to day 14 in both PYE groups and then showed a sharp decline by day 21, implying successful completion of the inflammatory phase and initiation of tissue regeneration. These findings suggested that PYE is effective in promoting scald wound healing in the inflammation and tissue proliferation stages.

  3. Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study.

    Science.gov (United States)

    Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

    2018-01-31

    RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an integrated approach of pathway- and gene- set enrichment analysis, Mapman visualization tool, gene ontology analysis and inferred protein-protein interaction network. Our meta-analysis revealed that the bacterial infection enhanced specifically genes involved in sugar alcohol metabolism. Brassinosteroids were upregulated by fungal pathogens while ethylene was highly affected by Erwinia amylovora. Gibberellins and jasmonates were strongly repressed by fungal and viral infections. The protein-protein interaction network highlighted the role of WRKYs in responses to the studied pathogens. In summary, our meta-analysis provides a better understanding of the Malus X domestica transcriptome responses to different biotic stress conditions; we anticipate that these insights will assist in the development of genetic resistance and acute therapeutic strategies. This work would be an example for next meta-analysis works aiming at identifying specific common molecular features linked with biotic stress responses in other specialty crops.

  4. Genetic variability in apple fruit polyphenol composition in Malus × domestica and Malus sieversii germplasm grown in New Zealand.

    Science.gov (United States)

    Volz, Richard K; McGhie, Tony K

    2011-11-09

    Variations in the concentrations of flavan-3-ol, oligomeric procyanidin, chlorogenic acid, dihydrochalcone, flavonol, and anthocyanin polyphenol groups and total polyphenols were examined in the fruit peel and cortical flesh of 93 (80 Malus × domestica and 13 Malus sieversii) apple genotypes in at least 1 year between 2003 and 2005 grown at one site in New Zealand (NZ). Differences among genotypes accounted for 46-97% of the total variation in the concentrations of total polyphenols and each of the individual phenol groups in the flesh and peel in both species, whereas effects of year and genotype × year were minimal, except for peel flavonols in M. × domestica and flesh flavonols in both species. In these cases, differences among genotypes accounted for less than 30% of the total variation, which was less than the variation found for the interaction between genotype and year. Total polyphenol concentrations among genotypes were spread over a 7- and 9-fold range in the flesh and a 4- and 3-fold range in the peel of M. sieversii and M. × domestica, respectively, with the spread in concentrations of individual polyphenol groups in each tissue and within each species varying from a 2-fold to over a 500-fold range. Higher concentrations were generally found in M. sieversii. In M. × domestica, cultivars and breeding selections originating in NZ had lower average flesh and peel total polyphenols and chlorogenic acid than older cultivars previously imported into NZ from overseas countries.

  5. Modeling and performance of Bonus-Malus Systems: Stationarity versus age-correction

    DEFF Research Database (Denmark)

    Asmussen, Søren

    In a bonus-malus system in car insurance, the bonus class of a customer is updated from a year to the next as a function of the current class and the number of claims in the year (assumed Poisson). Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of t...

  6. Salinity-Induced Callus Browning and Re-Differentiation, Root Formation by Plantlets and Anatomical Structures of Plantlet Leaves in Two Malus Species

    International Nuclear Information System (INIS)

    Gou, W.; Zheng, P.; Zheng, P.; Wang, K.; Zhang, L.; Akram, N. A.

    2016-01-01

    Apple (Malus domestica L.) is widely grown in northern China. However, soil salinization has become one of the most severe factors limiting apple productivity in some regions including the Loess Plateau. In our study, the regeneration system of both rootstock Rehd (Malus robusta Rehd) and scion Fuji (Malus domestica Borkh. cv. Fuji) was established In vitro. The two Malus species were cultured on the MS medium containing 0 or 150 mM NaCl to examine salt-induced effects on callus browning and re-differentiation, root formation of plantlets and anatomical structures of plantlet leaves at 15 days old callus and plantlet stages. Salt stress caused a marked increase in callus browning rate, while a decrease in re-differentiation rate, rooting rate, root number and length in both species. Additionally, anatomical structures of plantlet leave showed salt-induced damage such as reduced palisade tissue and intracellular chloroplast, incomplete development of xylem and severe damage of the phloem tissue. Salt stress also caused a few adaptive structural features in leaves including increased thickness of upper and lower epidermis, elevated proportion of spongy tissue and formation of lignified vessels. The responses of the two Malus species did not differ significantly at the differentiation stage. However, they were more sensitive to salinity at the callus stage than those at the plantlet stage in each species. Therefore, callus stage has been found to be more suitable for evaluating responses of the two apple species to salt stress. The Fuji and Rehd could be treated as a good scion/rootstock combination of apple to adapt to soil salinity based on their similar degree of salt stress-tolerance. (author)

  7. DL-β-aminobutyric acid-induced resistance in soybean against Aphis glycines Matsumura (Hemiptera: Aphididae.

    Directory of Open Access Journals (Sweden)

    Yunpeng Zhong

    Full Text Available Priming can improve plant innate capability to deal with the stresses caused by both biotic and abiotic factors. In this study, the effect of DL-β-amino-n-butyric acid (BABA against Aphis glycines Matsumura, the soybean aphid (SA was evaluated. We found that 25 mM BABA as a root drench had minimal adverse impact on plant growth and also efficiently protected soybean from SA infestation. In both choice and non-choice tests, SA number was significantly decreased to a low level in soybean seedlings drenched with 25 mM BABA compared to the control counterparts. BABA treatment resulted in a significant increase in the activities of several defense enzymes, such as phenylalanine ammonia-lyase (PAL, peroxidase (POX, polyphenol oxidase (PPO, chitinase (CHI, and β-1, 3-glucanase (GLU in soybean seedlings attacked by aphid. Meanwhile, the induction of 15 defense-related genes by aphid, such as AOS, CHS, MMP2, NPR1-1, NPR1-2, and PR genes, were significantly augmented in BABA-treated soybean seedlings. Our study suggest that BABA application is a promising way to enhance soybean resistance against SA.

  8. Boron toxicity causes multiple effects on Malus domestica pollen tube growth

    Directory of Open Access Journals (Sweden)

    Kefeng eFang

    2016-02-01

    Full Text Available Boron is an essential micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this stress is not known. This study aimed to evaluate the effect of boron stress on Malus domestica pollen tube growth and its possible regulatory pathway. Our results show that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron stress could decrease [Ca2+]c and induce the disappearance of the [Ca2+]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron stress. Immuno-localization and fluorescence labeling, together with Fourier-transform infrared analysis (FTIR, suggested that boron stress influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca2+]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

  9. Boron Toxicity Causes Multiple Effects on Malus domestica Pollen Tube Growth.

    Science.gov (United States)

    Fang, Kefeng; Zhang, Weiwei; Xing, Yu; Zhang, Qing; Yang, Liu; Cao, Qingqin; Qin, Ling

    2016-01-01

    Boron is an important micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this toxicity is not known. This study aimed to evaluate the effect of boron toxicity on Malus domestica pollen tube growth and its possible regulatory pathway. Our results showed that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron toxicity could decrease [Ca(2+)]c and induce the disappearance of the [Ca(2+)]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron toxicity. Immuno-localization and fluorescence labeling, together with fourier-transform infrared analysis, suggested that boron toxicity influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins, and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca(2+)]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

  10. Characteristics of blooming, floral nectaries and nectar of Malus sargentii Rehd.

    Directory of Open Access Journals (Sweden)

    Elżbieta Weryszko-Chmielewska

    2012-12-01

    Full Text Available In the years 2007-2008, the flowering biology of Malus sargentii, an ornamental apple tree native to Japan, was studied in the conditions of Lublin (Poland. The daily rate of flower opening, flowering duration and flower visitation by insects were determined. The amount of nectar produced per flower and sugar content in the nectar were investigated. The size of nectaries and the micromorphology of their surface were examined using light and scanning electron microscopy. It was found that the greatest amount of flowers opened between 11.00 and 13.00. During this time, the largest number of insects was observed in the flowers. Bees (90% were predominant among the insects, with a much smaller number of bumblebees (6% and butterflies (4%. The flower life span was 5 days. Over this period, the flower produced, on the average, 0.71 mg of nectar with an average sugar content of 32%. The nectaries of Malus sargentii are orange-yellow coloured and they represent the hypanthial type. Due to the protrusion of the nectariferous tissue, they are classified as automorphic nectaries. The surface of the epidermal cells of the nectary was distinguished by distinct cuticle folds. A small number of stomata were located only in the basal part of the nectary. At the beginning of flowering, all stomata were closed, but secretion traces were observed near well-developed outer cuticular ledges.

  11. The effect of bonus/malus systems on the sales of new vehicles; Wirkung von Bonus-Malus-Systemen beim Neuwagenkauf

    Energy Technology Data Exchange (ETDEWEB)

    Haan, P. de

    2008-07-01

    This presentation made at the Swiss 2008 research conference on traffic by Peter de Haan from the Institute for Environmental Decisions at the Swiss Federal Institute of Technology ETH in Zurich takes a look at the effects of bonus/malus systems on the sales of new vehicles. The author notes that in spite of technological progress made, increasing car size, weight and mileage along with increased motor power has eaten up two-thirds of energy-efficiency progress made. The effect of the long lifetime of modern vehicles is commented on. The results of a survey made are presented and discussed, as are the results of simulations. Further aspects discussed include effects on the motor trade and road safety and the indirect effects of bonuses. Finally, trends in the area are noted.

  12. Optimal Claiming Strategies in Bonus Malus Systems and Implied Markov Chains

    Directory of Open Access Journals (Sweden)

    Arthur Charpentier

    2017-11-01

    Full Text Available In this paper, we investigate the impact of the accident reporting strategy of drivers, within a Bonus-Malus system. We exhibit the induced modification of the corresponding class level transition matrix and derive the optimal reporting strategy for rational drivers. The hunger for bonuses induces optimal thresholds under which, drivers do not claim their losses. Mathematical properties of the induced level class process are studied. A convergent numerical algorithm is provided for computing such thresholds and realistic numerical applications are discussed.

  13. Identification, genealogical structure and population genetics of S-alleles in Malus sieversii, the wild ancestor of domesticated apple.

    Science.gov (United States)

    Ma, X; Cai, Z; Liu, W; Ge, S; Tang, L

    2017-09-01

    The self-incompatibility (SI) gene that is specifically expressed in pistils encodes the SI-associated ribonuclease (S-RNase), functioning as the female-specificity determinant of a gametophytic SI system. Despite extensive surveys in Malus domestica, the S-alleles have not been fully investigated for Malus sieversii, the primary wild ancestor of the domesticated apple. Here we screened the M. sieversii S-alleles via PCR amplification and sequencing, and identified 14 distinct alleles in this species. By contrast, nearly 40 are present in its close wild relative, Malus sylvestris. We further sequenced 8 nuclear genes to provide a neutral reference, and investigated the evolution of S-alleles via genealogical and population genetic analyses. Both shared ancestral polymorphism and an excess of non-synonymous substitution were detected in the S-RNases of the tribe Maleae in Rosaceae, indicating the action of long-term balancing selection. Approximate Bayesian Computations based on the reference neutral loci revealed a severe bottleneck in four of the six studied M. sieversii populations, suggesting that the low number of S-alleles found in this species is mainly the result of diversity loss due to a drastic population contraction. Such a bottleneck may lead to ambiguous footprints of ongoing balancing selection detected at the S-locus. This study not only elucidates the constituents and number of S-alleles in M. sieversii but also illustrates the potential utility of S-allele number shifts in demographic inference for self-incompatible plant species.

  14. ‘Fuji’ apple (Malus domestica Borkh) volatile production during high pCO2 controlled atmosphere storage

    Science.gov (United States)

    ‘Fuji’apple [Malus sylvestris var. domestica (Borkh.) Mansf.] volatile compound dynamics were characterized during cold storage in air or at low pO2 controlled atmosphere (CA) with up to 5 kPa CO2. Volatile compounds in storage chambers were adsorbed onto solid sorbent traps and analyzed by GC-MS....

  15. Development of a dense SNP-based linkage map of an apple rootstock progeny using the Malus Infinium whole genome genotyping array.

    Science.gov (United States)

    Antanaviciute, Laima; Fernández-Fernández, Felicidad; Jansen, Johannes; Banchi, Elisa; Evans, Katherine M; Viola, Roberto; Velasco, Riccardo; Dunwell, Jim M; Troggio, Michela; Sargent, Daniel J

    2012-05-25

    A whole-genome genotyping array has previously been developed for Malus using SNP data from 28 Malus genotypes. This array offers the prospect of high throughput genotyping and linkage map development for any given Malus progeny. To test the applicability of the array for mapping in diverse Malus genotypes, we applied the array to the construction of a SNP-based linkage map of an apple rootstock progeny. Of the 7,867 Malus SNP markers on the array, 1,823 (23.2%) were heterozygous in one of the two parents of the progeny, 1,007 (12.8%) were heterozygous in both parental genotypes, whilst just 2.8% of the 921 Pyrus SNPs were heterozygous. A linkage map spanning 1,282.2 cM was produced comprising 2,272 SNP markers, 306 SSR markers and the S-locus. The length of the M432 linkage map was increased by 52.7 cM with the addition of the SNP markers, whilst marker density increased from 3.8 cM/marker to 0.5 cM/marker. Just three regions in excess of 10 cM remain where no markers were mapped. We compared the positions of the mapped SNP markers on the M432 map with their predicted positions on the 'Golden Delicious' genome sequence. A total of 311 markers (13.7% of all mapped markers) mapped to positions that conflicted with their predicted positions on the 'Golden Delicious' pseudo-chromosomes, indicating the presence of paralogous genomic regions or mis-assignments of genome sequence contigs during the assembly and anchoring of the genome sequence. We incorporated data for the 2,272 SNP markers onto the map of the M432 progeny and have presented the most complete and saturated map of the full 17 linkage groups of M. pumila to date. The data were generated rapidly in a high-throughput semi-automated pipeline, permitting significant savings in time and cost over linkage map construction using microsatellites. The application of the array will permit linkage maps to be developed for QTL analyses in a cost-effective manner, and the identification of SNPs that have been

  16. Towards the onset of fruit tree growing north of the Alps: ancient DNA from waterlogged apple (Malus sp.) seed fragments.

    Science.gov (United States)

    Schlumbaum, Angela; van Glabeke, Sabine; Roldan-Ruiz, Isabel

    2012-01-20

    Wild apples (Malus sp.) have been a major food source in the northern Alpine region since prehistory and their use is well understood. The onset of deliberate fruit tree growing in the area is, however, less clear. It is generally assumed that horticulture was practised in Roman times, but it might be even earlier. In the archaeological record seed testa and pericarp remains are particularly frequent at sites with waterlogged preservation such as lakeshore settlements or wells, pits and ditches, but the distinction between wild and domestic plants is not morphologically possible. With waterlogged remains being one main source of information about past fruit cultivation, we have tested the feasibility of analysing ancient DNA from waterlogged preserved bulk samples of testa fragments. We studied apple seeds from three Neolithic and three Roman sites with waterlogged preservation in the Alpine foreland. Chloroplast markers failed in all samples, but nuclear ITS1 (internal transcribed spacer region 1) of the ribosomal DNA was successfully typed in two Roman samples from the site Oedenburg/Biesheim-Kunheim (Haut-Rhin, F). The retrieved ITS1 sequences are identical to each other and are shared with wild Malus sylvestris and Malus sieversii, and with domestic apple cultivars, supporting the potential of using waterlogged remains for identifying the genetic status of apple diachronically. Copyright © 2011 Elsevier GmbH. All rights reserved.

  17. Fumio Matsumura--accomplishments at the University of California, Davis, and in the Sierra Nevada Mountains.

    Science.gov (United States)

    Seiber, James N

    2015-05-01

    Fumio Matsumura joined the University of California, Davis, faculty in 1987 where he served as founding director of the Center for Environmental Health Sciences, associate director of the U.C. Toxic Substances Research and Teaching Program, and chair of the Department of Environmental Toxicology. He was an active affiliate with the NIEHS-funded Superfund Basic Research Program and the NIH Comprehensive Cancer Center. He was in many instances a primary driver or otherwise involved in most activities related to environmental toxicology at Davis, including the education of students in environmental biochemistry and ecotoxicology. A significant part of his broad research program was focused on the long range transport of chemicals such as toxaphene, PCBs and related contaminants used or released in California to the Sierra Nevada mountains, downwind of the urban and agricultural regions of the state. He hypothesized that these chemical residues adversely affected fish and wildlife, and particularly the declining populations of amphibians in Sierra Nevada streams and lakes. Fumio and his students and colleagues found residues of toxaphene and PCBs at higher elevations, an apparent result of atmospheric drift and deposition in the mountains. Fumio and his wife Teruko had personal interests in, and a love of the mountains, as avid skiers, hikers, and outdoor enthusiasts. Copyright © 2014 Elsevier Inc. All rights reserved.

  18. WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations.

    Science.gov (United States)

    Riccio, Gennaro; Maisto, Maria; Bottone, Sara; Badolati, Nadia; Rossi, Giovanni Battista; Tenore, Gian Carlo; Stornaiuolo, Mariano; Novellino, Ettore

    2017-11-18

    Inhibitors of the Wingless-related Integration site (WNT)/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP). This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i) test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. 'Annurca' and Malus domestica cv 'Limoncella'; (ii) identify the mechanisms underpinning their activities and; (iii) evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

  19. WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations

    Directory of Open Access Journals (Sweden)

    Gennaro Riccio

    2017-11-01

    Full Text Available Inhibitors of the Wingless-related Integration site (WNT/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP. This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. ‘Annurca’ and Malus domestica cv ‘Limoncella’; (ii identify the mechanisms underpinning their activities and; (iii evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

  20. Characterization of resistance gene analogues (RGAs) in apple (Malus × domestica Borkh.) and their evolutionary history of the Rosaceae family.

    Science.gov (United States)

    Perazzolli, Michele; Malacarne, Giulia; Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

    2014-01-01

    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  1. Characterization of resistance gene analogues (RGAs in apple (Malus × domestica Borkh. and their evolutionary history of the Rosaceae family.

    Directory of Open Access Journals (Sweden)

    Michele Perazzolli

    Full Text Available The family of resistance gene analogues (RGAs with a nucleotide-binding site (NBS domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh. cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80% of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15, and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  2. Characterization of Resistance Gene Analogues (RGAs) in Apple (Malus × domestica Borkh.) and Their Evolutionary History of the Rosaceae Family

    Science.gov (United States)

    Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

    2014-01-01

    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar ‘Golden Delicious’. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera. PMID:24505246

  3. The Occurrence of the Cicada Cicadatra persica on Apple Trees, Malus domestica, in Erneh, Syria

    Science.gov (United States)

    Dardar, Marah A.; Belal, Hamzeh M.R.; Basheer, Abedlnabi M.

    2013-01-01

    An infestation of Cicadatra persica KirKaldy (Hemiptera: Cicadidae) on apple trees, Malus domestica Borkhausen (Rosales: Rosaceae), was reported for the first time in the apple fruit orchards of Erneh, Syria. Nymphs, adults, exuvia, and exit holes in the soil were observed. The species was identified as C. persica based on morphological characters. Some biological observations and an acoustic analysis of the male's songs were also achieved. PMID:23909877

  4. Flavonoid Accumulation Plays an Important Role in the Rust Resistance of Malus Plant Leaves

    Directory of Open Access Journals (Sweden)

    Yanfen Lu

    2017-07-01

    Full Text Available Cedar-apple rust (Gymnosporangium yamadai Miyabe is a fungal disease that causes substantial injury to apple trees and results in fruit with reduced size and quality and a lower commercial value. The molecular mechanisms underlying the primary and secondary metabolic effects of rust spots on the leaves of Malus apple cultivars are poorly understood. Using HPLC, we found that the contents of flavonoid compounds, especially anthocyanin and catechin, were significantly increased in rust-infected symptomatic tissue (RIT. The expression levels of structural genes and MYB transcription factors related to flavonoid biosynthesis were one- to seven-fold higher in the RIT. Among these genes, CHS, DFR, ANS, FLS and MYB10 showed more than a 10-fold increase, suggesting that these genes were expressed at significantly higher levels in the RIT. Hormone concentration assays showed that the levels of abscisic acid (ABA, ethylene (ETH, jasmonate (JA and salicylic acid (SA were higher in the RIT and were consistent with the expression levels of McNCED, McACS, McLOX and McNPR1, respectively. Our study explored the complicated crosstalk of the signal transduction pathways of ABA, ETH, JA and SA; the primary metabolism of glucose, sucrose, fructose and sorbitol; and the secondary metabolism of flavonoids involved in the rust resistance of Malus crabapple leaves.

  5. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple

    OpenAIRE

    Tian, Ji; Zhang, Jie; Han, Zhen-yun; Song, Ting-ting; Li, Jin-yan; Wang, Ya-ru; Yao, Yun-cong

    2017-01-01

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to th...

  6. Uji Aktivitas Ekstrak Etanol Kulit Buah Apel ( Pyrus malus, L Terhadap

    Directory of Open Access Journals (Sweden)

    Suparmia, Khusnul Khotimah Amal Fadho

    2013-08-01

    Full Text Available Apple (Pyrus malus, L is a fruit having much uses for health containing phytochemical and flavonoid substances. One of the substances contained in apple rind is quercetin. Quercetin capable to reduce vascular permeability (Mochizuki et al., 2004. The recent study has an aim to know activity of ethanol extract on apple rind to the reducing of vascular permeability thus it can used as therapies for plasma leakage in curing Dengue Blood Fever. The vascular permeability test it was done an induction method using acetate acid. Testing done on white male mice of the BALB/c strain where the mice were divided into 5 groups. The first and second groups were control groups that are a positive control were given 0.2 mg/20 g standard quersetin suspension and the negative one was given 0.5% Na CMC suspension. The third, fourth and fifth groups were treatment groups where each testing animals were given ethanol extract suspension of apple rind by dosages 0.2, 0.4, and 0.8 mg/20 g of Body Weight mice per oral. Taking data was done by measuring pigment intensities from abdominal cavity liquid had been washed with acetate saline. From percentages of vascular permeability reducing each group then analyzed using statistic analyses those were the one-way anova. If there was found any significant difference then it was continued a Tukey test and bivariate-correlation. From results in the study it was known that percentages of vascular permeability reduces of ethanol extract that were made from apple rind having dosages 0.2, 0.4, and 0.8 mg in sequences as big as 42.15%, 63.28% and 84.19%.Keywords: Pyrus malus, L, kuersetin, vascular permeability

  7. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple.

    Science.gov (United States)

    Tian, Ji; Zhang, Jie; Han, Zhen-Yun; Song, Ting-Ting; Li, Jin-Yan; Wang, Ya-Ru; Yao, Yun-Cong

    2017-03-03

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to their promoters, but to be only partially responsible for regulating PAs biosynthetic genes. In contrast, McMYB12b showed preferential binding to the promoters of PAs biosynthetic genes. Overexpression of McMYB12a and McMYB12b in tobacco (Nicotiana tabacum) altered the expression of flavonoid biosynthetic genes and promoted the accumulation of PAs and anthocyanins in tobacco petals. Conversely, transient silencing their expression in crabapple plants, using a conserved gene region, resulted in reduced PAs and anthocyanin production a green leaf phenotype. Meanwhile, transient overexpression of the two genes and silenced McMYB12s in apple (Malus domestica) fruit had a similar effect as overexpression in tobacco and silenced in crabapple. This study reveals a new mechanism for the coordinated regulation of PAs and anthocyanin accumulation in crabapple leaves, which depends on an auto-regulatory balance involving McMYB12a and McMYB12b expression.

  8. Exogenous melatonin improves Malus resistance to Marssonina apple blotch.

    Science.gov (United States)

    Yin, Lihua; Wang, Ping; Li, Mingjun; Ke, Xiwang; Li, Cuiying; Liang, Dong; Wu, Shan; Ma, Xinli; Li, Chao; Zou, Yangjun; Ma, Fengwang

    2013-05-01

    We examined whether exogenously applied melatonin could improve resistance to Marssonina apple blotch (Diplocarpon mali) by apple [Malus prunifolia (Willd.) Borkh. cv. Donghongguo]. This serious disease leads to premature defoliation in the main regions of apple production. When plants were pretreated with melatonin, resistance was increased in the leaves. We investigated the potential roles for melatonin in modulating levels of hydrogen peroxide (H2O2), as well the activities of antioxidant enzymes and pathogenesis-related proteins during these plant-pathogen interactions. Pretreatment enabled plants to maintain intracellular H2O2 concentrations at steady-state levels and enhance the activities of plant defence-related enzymes, possibly improving disease resistance. Because melatonin is safe and beneficial to animals and humans, exogenous pretreatment might represent a promising cultivation strategy to protect plants against this pathogen infection. © 2012 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.

  9. Evaluation of Off-season Potential Breeding Sources for Spotted Wing Drosophila (Drosophila suzukii Matsumura) in Michigan.

    Science.gov (United States)

    Bal, Harit K; Adams, Christopher; Grieshop, Matthew

    2017-12-05

    It has been suggested that fruit wastes including dropped and unharvested fruits, and fruit byproducts (i.e., pomace) found in fruit plantings and cideries or wine-making facilities could serve as potential off-season breeding sites for spotted wing Drosophila (Drosophila suzukii Matsumura (Diptera: Drosophilidae)). This idea, however, has yet to be widely tested. The goal of our study was to determine the potential of dropped fruit and fruit wastes as Fall spotted wing Drosophila breeding resources in Michigan, USA. Fruit waste samples were collected from 15 farms across the lower peninsula of Michigan and were evaluated for spotted wing Drosophila and other drosophilid emergence and used in host suitability bioassays. All of the dropped apples, pears, grapes, and raspberries and 40% of apple and 100% of grape fruit pomace evaluated were found to contain spotted wing Drosophila with the highest numbers collected from dropped grapes and pears. Greater spotted wing Drosophila recovery was found in fruit wastes at sites attached with cideries and wine-making facilities and with multiple cultivated fruit crops than sites with no cideries and only one crop. Females oviposited in raspberry, pear, apple, grape, apple pomace and grape pomace samples with the highest rates of reproduction in raspberries. Our results demonstrate that fruit wastes including dropped berry, pomme and stone fruits, as well as fruit compost may be important late season reproductive resources for spotted wing Drosophila. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  10. Optimizing dehydration of apples Malus Domestica with fructo-oligosaccharide incorporation

    Directory of Open Access Journals (Sweden)

    Mariana Buranelo Egea

    2012-10-01

    Full Text Available The objective of the present study was to study the effect of the variables of the osmotic dehydration process on sliced Fuji apples (Malus domestica using a 2 x 3² factorial design. The variables studied in the apple slices were the pretreatment (blanching or acidification, the temperatures (30, 45 and 60ºC and the FOS concentration (40%, 50% and 60% m/v of the osmotic solution. There was no difference among the pretreatments for the water activity and titratable acidity. The slices pre-treated by the acidification presented less enzymatic browning (greatest luminosity L* value combined with a greater soluble solid contents (thus, this treatment was selected. Treatments T4 (45ºC and 40% m/v and T7 (60ºC and 40%m/v, using the acidification presented responses within the recommended standards and FOS were validated by the repetition.

  11. Genome-wide analysis of the GH3 family in apple (Malus × domestica).

    Science.gov (United States)

    Yuan, Huazhao; Zhao, Kai; Lei, Hengjiu; Shen, Xinjie; Liu, Yun; Liao, Xiong; Li, Tianhong

    2013-05-02

    Auxin plays important roles in hormone crosstalk and the plant's stress response. The auxin-responsive Gretchen Hagen3 (GH3) gene family maintains hormonal homeostasis by conjugating excess indole-3-acetic acid (IAA), salicylic acid (SA), and jasmonic acids (JAs) to amino acids during hormone- and stress-related signaling pathways. With the sequencing of the apple (Malus × domestica) genome completed, it is possible to carry out genomic studies on GH3 genes to indentify candidates with roles in abiotic/biotic stress responses. Malus sieversii Roem., an apple rootstock with strong drought tolerance and the ancestral species of cultivated apple species, was used as the experimental material. Following genome-wide computational and experimental identification of MdGH3 genes, we showed that MdGH3s were differentially expressed in the leaves and roots of M. sieversii and that some of these genes were significantly induced after various phytohormone and abiotic stress treatments. Given the role of GH3 in the negative feedback regulation of free IAA concentration, we examined whether phytohormones and abiotic stresses could alter the endogenous auxin level. By analyzing the GUS activity of DR5::GUS-transformed Arabidopsis seedlings, we showed that ABA, SA, salt, and cold treatments suppressed the auxin response. These findings suggest that other phytohormones and abiotic stress factors might alter endogenous auxin levels. Previous studies showed that GH3 genes regulate hormonal homeostasis. Our study indicated that some GH3 genes were significantly induced in M. sieversii after various phytohormone and abiotic stress treatments, and that ABA, SA, salt, and cold treatments reduce the endogenous level of axuin. Taken together, this study provides evidence that GH3 genes play important roles in the crosstalk between auxin, other phytohormones, and the abiotic stress response by maintaining auxin homeostasis.

  12. Identification and cloning of an NADPH-dependent hydroxycinnamoyl-CoA double bond reductase involved in dihydrochalcone formation in Malus×domestica Borkh.

    Science.gov (United States)

    Ibdah, Mwafaq; Berim, Anna; Martens, Stefan; Valderrama, Andrea Lorena Herrera; Palmieri, Luisa; Lewinsohn, Efraim; Gang, David R

    2014-11-01

    The apple tree (Malus sp.) is an agriculturally and economically important source of food and beverages. Many of the health beneficial properties of apples are due to (poly)phenolic metabolites that they contain, including various dihydrochalcones. Although many of the genes and enzymes involved in polyphenol biosynthesis are known in many plant species, the specific reactions that lead to the biosynthesis of the dihydrochalcone precursor, p-dihydrocoumaroyl-CoA (3), are unknown. To identify genes involved in the synthesis of these metabolites, existing genome databases of the Rosaceae were screened for apple genes with significant sequence similarity to Arabidopsis alkenal double bond reductases. Herein described are the isolation and characterization of a Malus hydroxycinnamoyl-CoA double bond reductase, which catalyzed the NADPH-dependent reduction of p-coumaroyl-CoA and feruloyl-CoA to p-dihydrocoumaroyl-CoA and dihydroferuloyl-CoA, respectively. Its apparent Km values for p-coumaroyl-CoA, feruloyl-CoA and NADPH were 96.6, 92.9 and 101.3μM, respectively. The Malus double bond reductase preferred feruloyl-CoA to p-coumaroyl-CoA as a substrate by a factor of 2.1 when comparing catalytic efficiencies in vitro. Expression analysis of the hydroxycinnamoyl-CoA double bond reductase gene revealed that its transcript levels showed significant variation in tissues of different developmental stages, but was expressed when expected for involvement in dihydrochalcone formation. Thus, the hydroxycinnamoyl-CoA double bond reductase appears to be responsible for the reduction of the α,β-unsaturated double bond of p-coumaroyl-CoA, the first step of dihydrochalcone biosynthesis in apple tissues, and may be involved in the production of these compounds. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Two QTL characterized for soft scald and soggy breakdown in apple (Malus × domestica) through pedigree-based analysis of a large population of interconnected families

    NARCIS (Netherlands)

    Howard, Nicholas P.; Weg, van de Eric; Tillman, John; Tong, Cindy B.S.; Silverstein, Kevin A.T.; Luby, James J.

    2018-01-01

    Soft scald and soggy breakdown are important postharvest physiological disorders of apple (Malus × domestica). ‘Honeycrisp’ and some of its offspring are particularly susceptible to developing these disorders. The purpose of this study was to identify molecular markers associated with high

  14. Using multilevel systematic sampling to study apple fruit (Malus domestica Borkh.) quality and its variability at the orchard scale

    DEFF Research Database (Denmark)

    Martínez Vega, Mabel V.; Wulfsohn, Dvoralai; Clemmensen, Line Katrine Harder

    2013-01-01

    sample of ‘Granny Smith’ (Malus x domestica cv. ‘Granny Smith’) apples obtained from a 17 ha orchard based on a final sample of 74 fruit. Estimates of fruit marketable yield and fruit size distribution agreed well with packing house records. The estimated marketable yield was 356.6 ± 89.2 t compared...... recommended sample sizes to accurately describe the distribution of various quality variables of apples at the orchard scale....

  15. Maize Lc transcription factor enhances biosynthesis of anthocyanins, distinct proanthocyanidins and phenylpropanoids in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Li, Houhua; Flachowsky, Henryk; Fischer, Thilo C; Hanke, Magda-Viola; Forkmann, Gert; Treutter, Dieter; Schwab, Wilfried; Hoffmann, Thomas; Szankowski, Iris

    2007-10-01

    Flavonoids are a large family of polyphenolic compounds with manifold functions in plants. Present in a wide range of vegetables and fruits, flavonoids form an integral part of the human diet and confer multiple health benefits. Here, we report on metabolic engineering of the flavonoid biosynthetic pathways in apple (Malus domestica Borkh.) by overexpression of the maize (Zea mays L.) leaf colour (Lc) regulatory gene. The Lc gene was transferred into the M. domestica cultivar Holsteiner Cox via Agrobacterium tumefaciens-mediated transformation which resulted in enhanced anthocyanin accumulation in regenerated shoots. Five independent Lc lines were investigated for integration of Lc into the plant genome by Southern blot and PCR analyses. The Lc-transgenic lines contained one or two Lc gene copies and showed increased mRNA levels for phenylalanine ammonia-lyase (PAL), chalcone synthase (CHS), flavanone 3 beta-hydroxylase (FHT), dihydroflavonol 4-reductase (DFR), leucoanthocyanidin reductases (LAR), anthocyanidin synthase (ANS) and anthocyanidin reductase (ANR). HPLC-DAD and LC-MS analyses revealed higher levels of the anthocyanin idaein (12-fold), the flavan 3-ol epicatechin (14-fold), and especially the isomeric catechin (41-fold), and some distinct dimeric proanthocyanidins (7 to 134-fold) in leaf tissues of Lc-transgenic lines. The levels of phenylpropanoids and their derivatives were only slightly increased. Thus, Lc overexpression in Malus domestica resulted in enhanced biosynthesis of specific flavonoid classes, which play important roles in both phytopathology and human health.

  16. Modeling and Performance of Bonus-Malus Systems: Stationarity versus Age-Correction

    Directory of Open Access Journals (Sweden)

    Søren Asmussen

    2014-03-01

    Full Text Available In a bonus-malus system in car insurance, the bonus class of a customer is updated from one year to the next as a function of the current class and the number of claims in the year (assumed Poisson. Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of the literature measures performance of the system in terms of the stationary characteristics of this Markov chain. However, the rate of convergence to stationarity may be slow in comparison to the typical sojourn time of a customer in the portfolio. We suggest an age-correction to the stationary distribution and present an extensive numerical study of its effects. An important feature of the modeling is a Bayesian view, where the Poisson rate according to which claims are generated for a customer is the outcome of a random variable specific to the customer.

  17. [Interspecific polymorphism of the glucosyltransferase domain of the sucrose synthase gene in the genus Malus and related species of Rosaceae].

    Science.gov (United States)

    Boris, K V; Kochieva, E Z; Kudryavtsev, A M

    2014-12-01

    The sequences that encode the main functional glucosyltransferase domain of sucrose synthase genes have been identified for the first time in 14 species of the genus Malus and related species of the family Rosaceae, and their polymorphism was investigated. Single nucleotide substitutions leading to amino acid substitutions in the protein sequence, including the conservative transmembrane motif sequence common to all sucrose synthase genes of higher plants, were detected in the studied sequences.

  18. MzPIP2;1: An Aquaporin Involved in Radial Water Movement in Both Water Uptake and Transportation, Altered the Drought and Salt Tolerance of Transgenic Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Lin Wang

    Full Text Available Plants are unavoidably subjected to various abiotic stressors, including high salinity, drought and low temperature, which results in water deficit and even death. Water uptake and transportation play a critical role in response to these stresses. Many aquaporin proteins, localized at different tissues, function in various transmembrane water movements. We targeted at the key aquaporin in charge of both water uptake in roots and radial water transportation from vascular tissues through the whole plant.The MzPIP2;1 gene encoding a plasma membrane intrinsic protein was cloned from salt-tolerant apple rootstock Malus zumi Mats. The GUS gene was driven by MzPIP2;1 promoter in transgenic Arabidopsis. It indicated that MzPIP2;1 might function in the epidermal and vascular cells of roots, parenchyma cells around vessels through the stems and vascular tissues of leaves. The ectopically expressed MzPIP2;1 conferred the transgenic Arabidopsis plants enhanced tolerance to slight salt and drought stresses, but sensitive to moderate salt stress, which was indicated by root length, lateral root number, fresh weight and K+/Na+ ratio. In addition, the possible key cis-elements in response to salt, drought and cold stresses were isolated by the promoter deletion experiment.The MzPIP2;1 protein, as a PIP2 aquaporins subgroup member, involved in radial water movement, controls water absorption and usage efficiency and alters transgenic plants drought and salt tolerance.

  19. Plant parts of the apple tree (Malus spp.) as possible indicators of heavy metal pollution.

    Science.gov (United States)

    Tošić, Snežana; Alagić, Slađana; Dimitrijević, Mile; Pavlović, Aleksandra; Nujkić, Maja

    2016-05-01

    The content of Cu, Zn, Pb, As, Cd, and Ni was determined by ICP-OES in spatial soil and parts (root, branches, leaves, and fruit) of the apple tree (Malus spp.) from polluted sites near The Mining and Smelting Complex Bor (Serbia). The aim of this study was to examine if the obtained results can be used for biomonitoring purposes. Data recorded in plant parts, especially leaves, gave very useful information about the environmental state of the Bor region. Conveniently, these data described well the capability of investigated plant species to assimilate and tolerate severely high concentrations of heavy metals in its tissues, which may further allow the possibility for utilization of the apple tree for phytostabilization.

  20. Chemical Composition and In Vitro Cytotoxic Activity of Essential Oil of Leaves of Malus domestica Growing in Western Himalaya (India)

    OpenAIRE

    Walia, Mayanka; Mann, Tavleen S.; Kumar, Dharmesh; Agnihotri, Vijai K.; Singh, Bikram

    2012-01-01

    Light pale-colored volatile oil was obtained from fresh leaves of Malus domestica tree, growing in Dhauladhar range of Himalaya (Himachal Pradesh, India), with characteristic eucalyptol dominant fragrance. The oil was found to be a complex mixture of mono-, sesqui-, di-terpenes, phenolics, and aliphatic hydrocarbons. Seventeen compounds accounting for nearly 95.3% of the oil were characterized with the help of capillary GC, GC-MS, and NMR. Major compounds of the oil were characterized as euca...

  1. Elevated expression of esterase and cytochrome P450 are related with lambda-cyhalothrin resistance and lead to cross resistance in Aphis glycines Matsumura.

    Science.gov (United States)

    Xi, Jinghui; Pan, Yiou; Bi, Rui; Gao, Xiwu; Chen, Xuewei; Peng, Tianfei; Zhang, Min; Zhang, Hua; Hu, Xiaoyue; Shang, Qingli

    2015-02-01

    A resistant strain of the Aphis glycines Matsumura (CRR) has developed 76.67-fold resistance to lambda-cyhalothrin compared with the susceptible (CSS) strain. Synergists piperonyl butoxide (PBO), S,S,S-Tributyltrithiophosphate (DEF) and triphenyl phosphate (TPP) dramatically increased the toxicity of lambda-cyhalothrin to the resistant strain. Bioassay results indicated that the CRR strain had developed high levels of cross-resistance to chlorpyrifos (11.66-fold), acephate (8.20-fold), cypermethrin (53.24-fold), esfenvalerate (13.83-fold), cyfluthrin (9.64-fold), carbofuran (14.60-fold), methomyl (9.32-fold) and bifenthrin (4.81-fold), but did not have cross-resistance to chlorfenapyr, imidacloprid, diafenthiuron, abamectin. The transcriptional levels of CYP6A2-like, CYP6A14-like and cytochrome b-c1 complex subunit 9-like increased significantly in the resistant strain than that in the susceptible. Similar trend were observed in the transcripts and DNA copy number of CarE and E4 esterase. Overall, these results demonstrate that increased esterase hydrolysis activity, combined with elevated cytochrome P450 monooxygenase detoxicatication, plays an important role in the high levels of lambda-cyhalothrin resistance and can cause cross-resistance to other insecticides in the CRR strain. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Dopamine alleviates nutrient deficiency-induced stress in Malus hupehensis.

    Science.gov (United States)

    Liang, Bowen; Li, Cuiying; Ma, Changqing; Wei, Zhiwei; Wang, Qian; Huang, Dong; Chen, Qi; Li, Chao; Ma, Fengwang

    2017-10-01

    Dopamine mediates many physiological processes in plants. We investigated its role in regulating growth, root system architecture, nutrient uptake, and responses to nutrient deficiencies in Malus hupehensis Rehd. Under a nutrient deficiency, plants showed significant reductions in growth, chlorophyll concentrations, and net photosynthesis, along with disruptions in nutrient uptake, transport, and distribution. However, pretreatment with 100 μM dopamine markedly alleviated such inhibitions. Supplementation with that compound enabled plants to maintain their photosynthetic capacity and development of the root system while promoting the uptake of N, P, K, Ca, Mg, Fe, Mn, Cu, Zn, and B, altering the way in which those nutrients were partitioned throughout the plant. The addition of dopamine up-regulated genes for antioxidant enzymes involved in the ascorbate-glutathione cycle (MdcAPX, MdcGR, MdMDHAR, MdDHAR-1, and MdDHAR-2) but down-regulated genes for senescence (SAG12, PAO, and MdHXK). These results indicate that exogenous dopamine has an important antioxidant and anti-senescence effect that might be helpful for improving nutrient uptake. Our findings demonstrate that dopamine offers new opportunities for its use in agriculture, especially when addressing the problem of nutrient deficiencies. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. The volatile profiles of a rare apple (Malus domestica Borkh.) honey: shikimic acid-pathway derivatives, terpenes, and others.

    Science.gov (United States)

    Kuś, Piotr Marek; Jerković, Igor; Tuberoso, Carlo Ignazio Giovanni; Šarolić, Mladenka

    2013-09-01

    The volatile profiles of rare Malus domestica Borkh. honey were investigated for the first time. Two representative samples from Poland (sample I) and Spain (sample II) were selected by pollen analysis (44-45% of Malus spp. pollen) and investigated by GC/FID/MS after headspace solid-phase microextraction (HS-SPME) and ultrasonic solvent extraction (USE). The apple honey is characterized by high percentage of shikimic acid-pathway derivatives, as well as terpenes, norisoprenoids, and some other compounds such as coumaran and methyl 1H-indole-3-acetate. The main compounds of the honey headspace were (sample I; sample II): benzaldehyde (9.4%; 32.1%), benzyl alcohol (0.3%; 14.4%), hotrienol (26.0%, 6.2%), and lilac aldehyde isomers (26.3%; 1.7%), but only Spanish sample contained car-2-en-4-one (10.2%). CH2 Cl2 and pentane/Et2 O 1 : 2 (v/v) were used for USE. The most relevant compounds identified in the extracts were: benzaldehyde (0.9-3.9%), benzoic acid (2.0-11.2%), terpendiol I (0.3-7.4%), coumaran (0.0-2.8%), 2-phenylacetic acid (2.0-26.4%), methyl syringate (3.9-13.1%), vomifoliol (5.0-31.8%), and methyl 1H-indole-3-acetate (1.9-10.2%). Apple honey contained also benzyl alcohol, 2-phenylethanol, (E)-cinnamaldehyde, (E)-cinnamyl alcohol, eugenol, vanillin, and linalool that have been found previously in apple flowers, thus disclosing similarity of both volatile profiles. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  4. The Effect of Ozone Oxydans in Plastic of Polyethylene used for The Storage of Apple Manalagi (malus Sylvestris M)

    International Nuclear Information System (INIS)

    Isyuniarto; Agus-Purwadi

    2007-01-01

    The effect of ozone oxydans in plastic of polyethylene used for the storage of apple Manalagi (malus sylvestris M) have been done. Firstly, apple selected according to form and size then packed into storage of plastic polyethylene 3 and 5 mm in thickness and ozonization process is done from 0, 20, 40 and 60 seconds. The sample is monitored every 7, 14 and 21 days. Parameter perceived is texture of fruit, colour, smell and panelist option to this research. The result is thickly of plastic 3 mm and ozonization time 60 seconds. (author)

  5. Retracted: Long-term copper toxicity in apple trees (Malus pumila Mill) and bioaccumulation in fruits.

    Science.gov (United States)

    Sun, Bai-Ye; Kan, Shi-Hong; Zhang, Yan-Zong; Wu, Jun; Deng, Shi-Huai; Liu, Chun-Sheng; Yang, Gang

    2010-01-15

    The following article from Environmental Toxicology, 'Long-term Copper Toxicity in Apple Trees (Malus pumila Mill) and Bioaccumulation in Fruits' by Bai-Ye Sun, Shi- Hong Kan, Yan-Zong Zhang, Jun Wu, Shi-Huai Deng, Chun-Sheng Liu and Gang Yang, published online on January 15, 2010 in Wiley InterScience (www.interscience.wiley.com; DOI: 10.1002/tox.20565), has been retracted by agreement between the authors, the journal Editor in Chief, Dr. Paul Tchounwou, and Wiley Periodicals, Inc. The retraction has been agreed at the request of the authors due to overlap with 'Copper Toxicity and Bioaccumulation in Chinese Cabbage (Brassica pekinensis Rupr.)' by Zhi-Ting Xiong and Hai Wang, published in Environmental Toxicology, Volume 20, pages 188-194, 2005.

  6. Economic analysis of revenue losses and control costs associated with the spotted wing drosophila, Drosophila suzukii (Matsumura), in the California raspberry industry.

    Science.gov (United States)

    Farnsworth, Derek; Hamby, Kelly A; Bolda, Mark; Goodhue, Rachael E; Williams, Jeffrey C; Zalom, Frank G

    2017-06-01

    The spotted wing drosophila (SWD), Drosophila suzukii (Matsumura), is an invasive vinegar fly with a preference for infesting commercially viable berries and stone fruits. SWD infestations can reduce yields significantly, necessitating additional management activities. This analysis estimates economic losses in the California raspberry industry that have resulted from the SWD invasion. California raspberry producers experienced considerable revenue losses and management costs in the first years following SWD's invasion of North America. Conventional producers have since developed effective chemical management programs, virtually eliminating revenue losses due to SWD and reducing the cost of management to that of purchasing and applying insecticides more often. Organic raspberry producers, who do not have access to the same chemical controls, continue to confront substantial SWD-related revenue losses. These losses can be mitigated only by applying expensive insecticides registered for organic use and by performing labor-intensive field sanitation. SWD's invasion into North America has caused extensive crop losses to berry and cherry crops in California and elsewhere. Agricultural producers and researchers have responded quickly to this pest by developing management programs that significantly reduce revenue losses. Economic losses are expected to continue to fall as producers learn to manage SWD more efficiently and as new control tactics become available. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  7. Koolileht reklaamib hiliseid lokaale / Marta Karu

    Index Scriptorium Estoniae

    Karu, Marta

    1999-01-01

    Tamme gümnaasiumi ajalehes 'Tammepress' on esiküljele paigutatud Tartu ärimehele Rein Kilgile kuuluva Zum-Zumi-nimelise lokaali reklaam. Pildil joovad loomad õlut ja viina ning suitsetavad. Samas numbris reklaamitakse koolilastele R. Kilgi suurprojekti Ammende villat ja lõbusõidulaeva 'Pegasus'.

  8. Morphology and stucture of wild apple (Malus silvestris Mill..common pear (Pyrus cofnmunis L. and Chaenomeles japonica (Thunb Lindl. seeds

    Directory of Open Access Journals (Sweden)

    Stanisław Pelc

    2014-01-01

    Full Text Available The outer and inner structure of wild apple (Malus silvestris Mill., common pear (Pyrus communis L. and Chaenomeles japonica (Thunb. Lindl. seeds was investigated. It was found that the outer structure exhibits good diagnostic features expressed in the first place in the relief of the seed coat and further in the arrangement and appearance of the site of attachment of the free end of the funiculus and the shape of the seeds. In ripe seeds there is, under the thick seed coat, an endosperm layer completely surrounding the embryo which has large cotyledons and a thick rootlet.

  9. Application of a high-speed breeding technology to apple (Malus × domestica) based on transgenic early flowering plants and marker-assisted selection.

    Science.gov (United States)

    Flachowsky, Henryk; Le Roux, Pierre-Marie; Peil, Andreas; Patocchi, Andrea; Richter, Klaus; Hanke, Magda-Viola

    2011-10-01

    Breeding of apple (Malus × domestica) remains a slow process because of protracted generation cycles. Shortening the juvenile phase to achieve the introgression of traits from wild species into prebreeding material within a reasonable time frame is a great challenge. In this study, we evaluated early flowering transgenic apple lines overexpressing the BpMADS4 gene of silver birch with regard to tree morphology in glasshouse conditions. Based on the results obtained, line T1190 was selected for further analysis and application to fast breeding. The DNA sequences flanking the T-DNA were isolated and the T-DNA integration site was mapped on linkage group 4. The inheritance and correctness of the T-DNA integration were confirmed after meiosis. A crossbred breeding programme was initiated by crossing T1190 with the fire blight-resistant wild species Malus fusca. Transgenic early flowering F(1) seedlings were selected and backcrossed with 'Regia' and 98/6-10 in order to introgress the apple scab Rvi2, Rvi4 and powdery mildew Pl-1, Pl-2 resistance genes and the fire blight resistance quantitative trait locus FB-F7 present in 'Regia'. Three transgenic BC'1 seedlings pyramiding Rvi2, Rvi4 and FB-F7, as well as three other BC'1 seedlings combining Pl-1 and Pl-2, were identified. Thus, the first transgenic early flowering-based apple breeding programme combined with marker-assisted selection was established. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  10. Decision-making in a bisexual line and a thelytokous Wolbachia-infected line of Trichogramma dendrolimi Matsumura (Hymenoptera: Trichogrammatidae) regarding behavior toward their hosts.

    Science.gov (United States)

    Liu, Quan-Quan; Zhang, Tong-Shu; Li, Chun-Xue; Gu, Jun-Wen; Hou, Jie-Bin; Dong, Hui

    2018-07-01

    The use of thelytokous Wolbachia-infected Trichogramma (parasitic wasps) has long been considered as a way to enhance the efficacy of biocontrol. However, Wolbachia can affect the host physiology. We compared decision-making between bisexual and thelytokous Wolbachia-infected lines of Trichogramma dendrolimi Matsumura regarding behavior toward fresh and old eggs of Corcyra cephalonica at 25 ± 1 °C and 70 ± 5% relative humidity. The behavioral patterns and sequences of the two lines were basically the same. The durations of various behavioral patterns and values of fitness indicators of the bisexual line on fresh eggs were generally significantly shorter and better, respectively, than on old eggs, whereas the thelytokous line behaved similarly toward the two types of eggs, and differences in most fitness indicators between fresh and old eggs were not significant. On fresh eggs, the durations of various behaviors in the bisexual line were generally significantly shorter than in the thelytokous line and the fitness indicators were generally significantly better. Wolbachia affected the fitness of T. dendrolimi negatively. The potential of the thelytokous line as a biocontrol agent would not be as good as that of the bisexual line when decision-making only is considered. Therefore, further evaluations need to be carried out before the thelytokous line can be used in practical biocontrol. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  11. RNA interference silencing of CHS greatly alters the growth pattern of apple (Malus x domestica).

    Science.gov (United States)

    Dare, Andrew P; Hellens, Roger P

    2013-08-01

    Plants produce a vast array of phenolic compounds which are essential for their survival on land. One major class of polyphenols are the flavonoids and their formation is dependent on the enzyme chalcone synthase (CHS). In a recent study we silenced the CHS genes of apple (Malus × domestica Borkh.) and observed a loss of pigmentation in the fruit skin, flowers and stems. More surprisingly, highly silenced lines were significantly reduced in size, with small leaves and shortened internode lengths. Chemical analysis also revealed that the transgenic shoots contained greatly reduced concentrations of flavonoids which are known to modulate auxin flow. An auxin transport study verified this, with an increased auxin transport in the CHS-silenced lines. Overall, these findings suggest that auxin transport in apple has adapted to take place in the presence of high endogenous concentrations of flavonoids. Removal of these compounds therefore results in abnormal auxin movement and a highly disrupted growth pattern.

  12. The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars.

    Science.gov (United States)

    Wei, Xiaoyu; Liu, Fengli; Chen, Cheng; Ma, Fengwang; Li, Mingjun

    2014-01-01

    In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of "Gala" apple. Genes for sugar alcohol [including 17 sorbitol transporters (SOTs)], sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs). Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

  13. The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars

    Directory of Open Access Journals (Sweden)

    Xiaoyu eWei

    2014-11-01

    Full Text Available In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of ‘Gala’ apple. Genes for sugar alcohol (including 17 sorbitol transporters, sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs. Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

  14. Antioxidant and antimicrobial properties of dried Portuguese apple variety (Malus domestica Borkh. cv Bravo de Esmolfe).

    Science.gov (United States)

    Pires, Tânia C S P; Dias, Maria Inês; Barros, Lillian; Alves, Maria José; Oliveira, M Beatriz P P; Santos-Buelga, Celestino; Ferreira, Isabel C F R

    2018-02-01

    Malus domestica Borkh apples are one of the most consumed fruits in the world, due to their sweetness and flavour. Herein, 'Bravo de Esmolfe' apple fruits were characterized regarding their nutritional value, chemical composition and bioactive properties. Besides nutrients, flavan-3-ols (i.e., epicatechin and B-type procyanidins) as also hydroxycinnamoyl-quinic acids and phloretin derivatives were identified in the samples. Extracts prepared from 'Bravo de Esmolfe' also proved to have antioxidant activity and antibacterial effects against Gram-positive bacteria, namely methicillin-susceptible Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), Listeria monocytogenes and Enterococcus faecalis, and against the Gram-negative bacteria Escherichia coli, Escherichia coli (ESBL) (producing extended spectrum β-lactamases) and Morganella morganii. There is very little information about 'Bravo de Esmolfe' apple, so this study is important to inform consumers about an alternative source of nutritional and bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Effects of Indole-3-Acetic Acid on Germination in Lead Polluted Petri Dish of Citrullus lanatus (Thunberg Matsumura and Nakai, Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Matthew Chidozie Ogwu

    2015-12-01

    Full Text Available Watermelon, Citrullus lanatus (Thunberg Matsumura and Nakai is a tropical fruit vegetable. Indole-3-acetic acid (IAA is a popular phytohormone while lead (Pb is a common environmental pollutant in urban and sub-urban centers. C. lanatus were obtained from Benin City with a view to study the effects of IAA on their germination in Pb polluted environment.  Germination percentage without IAA and Pb treatment in petri dish was significant after ten days. Hastened germination was observed when IAA and lead were used. About 100 % germination was recorded after seven days. This suggests that water melon seeds can initiate growth even in lead polluted environment. Optimum level of 5 ppm IAA with the different levels of lead treatments may be recommended. Most important was that higher concentrations of Pb in the control (without IAA did not inhibit seedling shoot nor root growth. Longest seedling shoot length (cm was 10.33 ± 1.24 and 12.13 ± 2.06 on the seventh and eighth day respectively with the combined treatment levels of 1 ppm IAA and 15 ppm Pb. On the ninth day, 15.27 ± 0.96 was obtained from 1 ppm IAA and 20 ppm Pb. Longest seedling root length (cm values were recorded from the combined treatment levels of 0 ppm IAA and 10 ppm Pb for the seventh (9.10 ± 0.47 and ninth (10.37 ± 1.81 day respectively and 0 ppm and 15 ppm Pb on the eighth (9.37 ± 0.84 day. Significant means were also obtained with the treatment level of 0 and 20 ppm IAA. This present study suggest the germination of C. lanatus under Pb polluted environment may be rescued with optimum IAA.

  16. The effects of exogenous hormones on rooting process and the activities of key enzymes of Malus hupehensis stem cuttings.

    Science.gov (United States)

    Zhang, Wangxiang; Fan, Junjun; Tan, Qianqian; Zhao, Mingming; Zhou, Ting; Cao, Fuliang

    2017-01-01

    Malus hupehensis is an excellent Malus rootstock species, known for its strong adverse-resistance and apomixes. In the present study, stem cuttings of M. hupehensis were treated with three types of exogenous hormones, including indole acetic acid (IAA), naphthalene acetic acid (NAA), or green growth regulator (GGR). The effects and mechanisms of exogenous hormone treatment and antioxidant enzyme activity on adventitious root formation were investigated. The results showed that the apparent morphology of the adventitious root had four stages, including root pre-emergence stage (S0), early stage of root formation (S1), massive root formation stage (S2), and later stage of root formation (S3). The suitable concentrations of the three exogenous hormones, IAA, NAA and GGR, were 100 mg·L-1, 300 mg·L-1, and 300 mg·L-1, respectively. They shortened the rooting time by 25-47.4% and increased the rooting percentages of cuttings by 0.9-1.3 times, compared with that in the control. The dispersion in S0 stage was 3.6 times of that in the S1 stage after exogenous hormone application. The earlier the third critical point (P3) appeared, the shorter the rooting time and the greater the rooting percentage of the cuttings. During rhizogenesis, the activities of three antioxidant enzymes (POD, SOD, and PPO) showed an A-shaped trend. However, peak values of enzyme activity appeared at different points, which were 9 d before the P3, P3, and the fourth critical point (P4), respectively. Exogenous hormone treatment reduced the time to reach the peak value by 18 days, although the peak values of the enzymatic activities did not significantly changed. Our results suggested that exogenous hormone treatment mainly acted during the root pre-emergence stage, accelerated the synthesis of antioxidant enzymes, reduced the rooting time, and consequently promoted root formation. The three kinds of antioxidant enzymes acted on different stages of rooting.

  17. Engineering fire blight resistance into the apple cultivar 'Gala' using the FB_MR5 CC-NBS-LRR resistance gene of Malus × robusta 5.

    Science.gov (United States)

    Broggini, Giovanni A L; Wöhner, Thomas; Fahrentrapp, Johannes; Kost, Thomas D; Flachowsky, Henryk; Peil, Andreas; Hanke, Maria-Viola; Richter, Klaus; Patocchi, Andrea; Gessler, Cesare

    2014-08-01

    The fire blight susceptible apple cultivar Malus × domestica Borkh. cv. 'Gala' was transformed with the candidate fire blight resistance gene FB_MR5 originating from the crab apple accession Malus × robusta 5 (Mr5). A total of five different transgenic lines were obtained. All transgenic lines were shown to be stably transformed and originate from different transgenic events. The transgenic lines express the FB_MR5 either driven by the constitutive CaMV 35S promoter and the ocs terminator or by its native promoter and terminator sequences. Phenotyping experiments were performed with Mr5-virulent and Mr5-avirulent strains of Erwinia amylovora, the causal agent of fire blight. Significantly less disease symptoms were detected on transgenic lines after inoculation with two different Mr5-avirulent E. amylovora strains, while significantly more shoot necrosis was observed after inoculation with the Mr5-virulent mutant strain ZYRKD3_1. The results of these experiments demonstrated the ability of a single gene isolated from the native gene pool of apple to protect a susceptible cultivar from fire blight. Furthermore, this gene is confirmed to be the resistance determinant of Mr5 as the transformed lines undergo the same gene-for-gene interaction in the host-pathogen relationship Mr5-E. amylovora. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  18. Characterization of three chalcone synthase-like genes from apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Yahyaa, Mosaab; Ali, Samah; Davidovich-Rikanati, Rachel; Ibdah, Muhammad; Shachtier, Alona; Eyal, Yoram; Lewinsohn, Efraim; Ibdah, Mwafaq

    2017-08-01

    Apple (Malus x domestica Brokh.) is a widely cultivated deciduous tree species of significant economic importance. Apple leaves accumulate high levels of flavonoids and dihydrochalcones, and their formation is dependent on enzymes of the chalcone synthase family. Three CHS genes were cloned from apple leaves and expressed in Escherichia coli. The encoded recombinant enzymes were purified and functionally characterized. In-vitro activity assays indicated that MdCHS1, MdCHS2 and MdCHS3 code for proteins exhibiting polyketide synthase activity that accepted either p-dihydrocoumaroyl-CoA, p-coumaroyl-CoA, or cinnamoyl-CoA as starter CoA substrates in the presence of malonyl-CoA, leading to production of phloretin, naringenin chalcone, and pinocembrin chalcone. MdCHS3 coded a chalcone-dihydrochalcone synthase enzyme with narrower substrate specificity than the previous ones. The apparent Km values of MdCHS3 for p-dihydrocoumaryl-CoA and p-coumaryl-CoA were both 5.0 μM. Expression analyses of MdCHS genes varied according to tissue type. MdCHS1, MdCHS2 and MdCHS3 expression levels were associated with the levels of phloretin accumulate in the respective tissues. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Apple ring rot-responsive putative microRNAs revealed by high-throughput sequencing in Malus × domestica Borkh.

    Science.gov (United States)

    Yu, Xin-Yi; Du, Bei-Bei; Gao, Zhi-Hong; Zhang, Shi-Jie; Tu, Xu-Tong; Chen, Xiao-Yun; Zhang, Zhen; Qu, Shen-Chun

    2014-08-01

    MicroRNAs (miRNAs) are small non-coding RNAs, which silence target mRNA via cleavage or translational inhibition to function in regulating gene expression. MiRNAs act as important regulators of plant development and stress response. For understanding the role of miRNAs responsive to apple ring rot stress, we identified disease-responsive miRNAs using high-throughput sequencing in Malus × domestica Borkh.. Four small RNA libraries were constructed from two control strains in M. domestica, crabapple (CKHu) and Fuji Naga-fu No. 6 (CKFu), and two disease stress strains, crabapple (DSHu) and Fuji Naga-fu No. 6 (DSFu). A total of 59 miRNA families were identified and five miRNAs might be responsive to apple ring rot infection and validated via qRT-PCR. Furthermore, we predicted 76 target genes which were regulated by conserved miRNAs potentially. Our study demonstrated that miRNAs was responsive to apple ring rot infection and may have important implications on apple disease resistance.

  20. Old Apple (Malus domestica L. Borkh) Varieties with Hypoallergenic Properties: An Integrated Approach for Studying Apple Allergenicity.

    Science.gov (United States)

    Vegro, Mara; Eccher, Giulia; Populin, Francesca; Sorgato, Chiara; Savazzini, Federica; Pagliarani, Giulia; Tartarini, Stefano; Pasini, Gabriella; Curioni, Andrea; Antico, Andrea; Botton, Alessandro

    2016-12-07

    Freshly consumed apples (Malus domestica L. Borkh) can cause allergic reactions because of the presence of four classes of allergens. Knowledge of the genetic factors affecting the allergenic potential of apples would provide important information for the selection of hypoallergenic genotypes, which can be combined with the adoption of new agronomical practices to produce fruits with a reduced amount of allergens. In the present research, a multiple analytical approach was adopted to characterize the allergenic potential of 24 apple varieties released at different ages (pre- and post-green revolution). A specific workflow was set up including protein quantification by means of polyclonal antibodies, immunological analyses with sera of allergic subjects, enzymatic assays, clinical assessments on allergic patients, and gene expression assays on fruit samples. Taken as a whole, the results indicate that most of the less allergenic genotypes were found among those deriving from selection processes carried out prior to the so-called "green revolution".

  1. Optimization of ultrasonic-assisted extraction of phenolic antioxidants from Malus baccata (Linn.) Borkh. using response surface methodology.

    Science.gov (United States)

    Wang, Lu; Wang, Zhenyu; Li, Xiaoyu

    2013-05-01

    In this study, the optimum extraction conditions for maximum recovery of the content of total phenolics (TPC) and total antioxidant abilities were analyzed for Malus baccata (Linn.) Borkh. using response surface methodology. The effects of ethanol percentage (X1 ,%), ultrasonic power (X2 , W) and extraction temperature (X3 , °C) on the total phenolic content (Y1 ) and antioxidant ability (Y2 ) were evaluated. A second-order polynomial model produced a satisfactory fitting of the experimental data with regard to total phenolic content (R(2) = 0.9942, P antioxidant ability (R(2) = 0.9966, P extraction temperature of 51.1°C for TPC and 60.5%, 311.4 W, 51.6°C for antioxidant ability, the predicted values agreed well with the experimental values. Results implied that the major phenolic compounds in obtained extracts as chlorogenic acid, quercetin-3-gal/glu, quercetin-3-xyl/ara, phloretin-2-xyloside, quercetin-3- rhamnoside, and phloridzin. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Eesti keele grammatika ja sõnaraamat jaapanlastele / Enn Veldi

    Index Scriptorium Estoniae

    Veldi, Enn

    1994-01-01

    Arvustus: Matsumura, Kazuto. Eesti keele grammatika jaapanlastele. Tokyo : Institute for the Study of Languages and Cultures of Asia and Africa, 1991 ; Matsumura, Kazuto. Väike eesti-jaapani õppesõnaraamat. Tokyo : Institute for the Study of Languages and Cultures of Asia and Africa, 1991

  3. Effect of irradiance and spectral composition of radiation on in vitro shoot proliferation in Malus domestica

    International Nuclear Information System (INIS)

    Noè, N.; Eccher, T.; Bonini, L.

    1997-01-01

    Four clones of Malus domestica cv. Golden Delicious - namely Smoothee, Crielaard, Reinders and Golden B - were cultured in vitro from single-node microcuttings placed on solid medium under irradiance (PPFD) of 50 micromol m -2 s -1 . After 9 months an average shoot proliferation of 5.3 was achieved; Crielaard showed the highest rate (7.1), followed Golden B (5.4), Smoothee and Reinders (4.4). Proliferating shoots were then exposed to higher PPFD (80 micromol m -2 s -1 ) and different spectral composition of radiation using PMMA-B and PMMA-R/FR filters. High PPFD decreased the average proliferation rate to 4.5, in particular in Crielaard and Golden B, while it increased proliferation in Reinders. When a PMMA-R/FR filter was interposed, the mean proliferation rate slightly increased. PMMA-B filters decreased the overall proliferation rate to 3.0; only in Crielaard it was increased, but shoots were very small. Thus PPFD and spectral composition influenced in vitro shoot proliferation and growth and the responses were different among the clones. (author)

  4. Pixel super resolution using wavelength scanning

    Science.gov (United States)

    2016-04-08

    13 Celebi ME, Schaefer G. Color Medical Image Analysis. Netherlands: Springer. 2013. 14 Yamaguchi I, Matsumura T, Kato J. Phase-shifting color...2016.60 15 Kato J, Yamaguchi I, Matsumura T. Multicolor digital holography with an achromatic phase shifter. Opt Lett 2002; 27: 1403–1405. 16 Ferraro P

  5. [Evaluation of Molecular Genetic Diversity of Wild Apple Malus sieversii Populations from Zailiysky Alatau by Microsatellite Markers].

    Science.gov (United States)

    Omasheva, M E; Chekalin, S V; Galiakparov, N N

    2015-07-01

    The territory of Kazakhstan is part of the distribution range of Malus sieversii, which is one of the ancestors of cultivated apple tree varieties. The collected samples of Sievers apple leaves from five populations growing in the Zailiysky Alatau region served as a source not only for the creation of a bank of genomic DNA but also for determination ofthe wild apple genetic polymorphism. The seven microsatellite markers used in this study revealed 86 alleles with different frequencies, as well as the characteristic pools of rare alleles for each of the populations. Molecular genetic analysis showed a high level of genetic diversity (H(o) = 0.704; PIC = 0.752; I = 1.617). Moreover, interpopulation variability accounted only for 7.5% of total variability, confirming the genetic closeness of the populations examined. Based on phylogenetic analysis, it was demonstrated that the Bel'bulak and Almaty Reserve populations were closest to each other, while the most distant were the Ketmen and Great Almaty gorge populations, which suggests the dependence of genetic distance on the geographical.

  6. Criterio no asintótico para el diseño de sistemas Bonus-Malus mediante GPBM

    Directory of Open Access Journals (Sweden)

    Antonio Heras Martínez

    2002-01-01

    Full Text Available El diseño de sistemas Bonus-Malus habitualmente está basado en la distribución estacionaria de la probabilidad. Se supone que una póliza ha alcanzado el estado estacionario (n0 cuando la probabilidad de que dicha póliza pertenezca a la clase Ci es constante para todo n mayor o igual que n0 . Esta distribución estacionaria de probabilidad es sencilla de calcular. Su cálculo está basado en la Teoría de Cadenas de Markov y requiere que el sistema cumpla ciertas condiciones (sea Cadena de Markov irreducible y todos sus estados sean recurrentes en tiempo esperado finito. Podría ocurrir que estas condiciones no se cumplan y en este caso no se podría utilizar la distribución estacionaria. Por otra parte, los criterios basados en la distribución estacionaria no tienen en cuenta a las pólizas nuevas en la empresa ni a las que llevan poco tiempo. Por estos motivos, se propone un nuevo criterio que tenga en cuenta la edad de las pólizas de la cartera.

  7. Phenotypic changes associated with RNA interference silencing of chalcone synthase in apple (Malus × domestica).

    Science.gov (United States)

    Dare, Andrew P; Tomes, Sumathi; Jones, Midori; McGhie, Tony K; Stevenson, David E; Johnson, Ross A; Greenwood, David R; Hellens, Roger P

    2013-05-01

    We have identified in apple (Malus × domestica) three chalcone synthase (CHS) genes. In order to understand the functional redundancy of this gene family RNA interference knockout lines were generated where all three of these genes were down-regulated. These lines had no detectable anthocyanins and radically reduced concentrations of dihydrochalcones and flavonoids. Surprisingly, down-regulation of CHS also led to major changes in plant development, resulting in plants with shortened internode lengths, smaller leaves and a greatly reduced growth rate. Microscopic analysis revealed that these phenotypic changes extended down to the cellular level, with CHS-silenced lines showing aberrant cellular organisation in the leaves. Fruit collected from one CHS-silenced line was smaller than the 'Royal Gala' controls, lacked flavonoids in the skin and flesh and also had changes in cell morphology. Auxin transport experiments showed increased rates of auxin transport in a CHS-silenced line compared with the 'Royal Gala' control. As flavonoids are well known to be key modulators of auxin transport, we hypothesise that the removal of almost all flavonoids from the plant by CHS silencing creates a vastly altered environment for auxin transport to occur and results in the observed changes in growth and development. © 2013 The Authors The Plant Journal © 2013 Blackwell Publishing Ltd.

  8. Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.

    2009-01-01

    On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported...... for the quantitative allocation of plant cell wall monomers into relevant structural polysaccharide elements. By this method the relative molar distribution (mol %) of the different polysaccharides in the red wine grape skins was estimated as 57-62 mol % homogalacturonan, 6.0-14 mol % cellulose, 10-11 mol % xyloglucan......, 7 mol % arabinan, 4.5-5.0 mol % rhamnogalacturonan I, 3.5-4.0 mol % rhamnogalacturonan II, 3 mol % arabinogalactan, and 0.5-1.0 mol % mannans; the ranges indicate minor variations in the skin composition of the three different cultivars. These cell wall polysaccharides made up similar to 43...

  9. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala

    Directory of Open Access Journals (Sweden)

    Wen Zhang

    2017-02-01

    Full Text Available Trehalose-6-phosphate (Tre6P is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala. Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple.

  10. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala)

    Science.gov (United States)

    Zhang, Wen; Lunn, John E.; Feil, Regina; Wang, Yufei; Zhao, Jingjing; Tao, Hongxia; Zhao, Zhengyang

    2017-01-01

    ABSTRACT Trehalose-6-phosphate (Tre6P) is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala). Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple. PMID:28069587

  11. Overexpression of a Novel Apple NAC Transcription Factor Gene, MdNAC1, Confers the Dwarf Phenotype in Transgenic Apple (Malus domestica)

    Science.gov (United States)

    Jia, Dongfeng; Gong, Xiaoqing; Li, Mingjun; Li, Chao; Sun, Tingting

    2018-01-01

    Plant height is an important trait for fruit trees. The dwarf characteristic is commonly associated with highly efficient fruit production, a major objective when breeding for apple (Malus domestica). We studied the function of MdNAC1, a novel NAC transcription factor (TF) gene in apple related to plant dwarfing. Localized primarily to the nucleus, MdNAC1 has transcriptional activity in yeast cells. Overexpression of the gene results in a dwarf phenotype in transgenic apple plants. Their reduction in size is manifested by shorter, thinner stems and roots, and a smaller leaf area. The transgenics also have shorter internodes and fewer cells in the stems. Levels of endogenous abscisic acid (ABA) and brassinosteroid (BR) are lower in the transgenic plants, and expression is decreased for genes involved in the biosynthesis of those phytohormones. All of these findings demonstrate that MdNAC1 has a role in plants dwarfism, probably by regulating ABA and BR production. PMID:29702625

  12. Effect of inoculation with arbuscular mycorrhizas on rooting, weaning and subsequent growth of micropropagated Malus (L. Moench

    Directory of Open Access Journals (Sweden)

    Marjatta Uosukainen

    1994-05-01

    Full Text Available The importance of different rooting methods and the effects of arbuscular mycorrhizal (AMF inoculation on the rooting rate, weaning survival and subsequent growth of microcuttings of Malus rootstock YP and the Finnish crab apple cultivars Hanna and Marjatta were studied in four experiments conducted at the Laukaa Research and Elite Plant Unit, Finland. Sucrose in the in vitro rooting medium gave the best support to weaning survival in comparision with glucose and fructose. Directly rooted microcuttings had a higher survival rate than in vitro rooted microcuttings. AMF inoculation did not improve the rooting rate in direct rooting. However, the Glomus hoi strain V98 caused severe rotting of microcuttings and thus lowered the rooting rate of cv. Hanna, AMF inoculation increased the mean shoot height of established plants, particularly inoculation with G. hoi V98, G. claroideum V43a or G. fistulosum V128. This effect, however, varied considerably in different host-fungus combinations. Some AMF strains, e.g. G. hoi V1O4, caused strong growth retardation. After the rooting and weaning stage, many uninoculated plants lapsed into arrest of growth. This phenomenon was less frequent in AMF inoculated plants. Optimal timing of AMF inoculation and nutritional level of rooting and weaning substrate are discussed.

  13. Evaluation of the hormonal state of columnar apple trees (Malus x domestica) based on high throughput gene expression studies.

    Science.gov (United States)

    Krost, Clemens; Petersen, Romina; Lokan, Stefanie; Brauksiepe, Bastienne; Braun, Peter; Schmidt, Erwin R

    2013-02-01

    The columnar phenotype of apple trees (Malus x domestica) is characterized by a compact growth habit with fruit spurs instead of lateral branches. These properties provide significant economic advantages by enabling high density plantings. The columnar growth results from the presence of a dominant allele of the gene Columnar (Co) located on chromosome 10 which can appear in a heterozygous (Co/co) or homozygous (Co/Co) state. Although two deep sequencing approaches could shed some light on the transcriptome of columnar shoot apical meristems (SAMs), the molecular mechanisms of columnar growth are not yet elaborated. Since the influence of phytohormones is believed to have a pivotal role in the establishment of the phenotype, we performed RNA-Seq experiments to study genes associated with hormone homeostasis and clearly affected by the presence of Co. Our results provide a molecular explanation for earlier findings on the hormonal state of columnar apple trees. Additionally, they allow hypotheses on how the columnar phenotype might develop. Furthermore, we show a statistically approved enrichment of differentially regulated genes on chromosome 10 in the course of validating RNA-Seq results using additional gene expression studies.

  14. In silico analysis of the polygalacturonase inhibiting protein 1 from apple, Malus domestica.

    Science.gov (United States)

    Matsaunyane, Lerato Bt; Oelofse, Dean; Dubery, Ian A

    2015-03-11

    The Malus domestica polygalacturonase inhibiting protein 1 (MdPGIP1) gene, encoding the M. domestica polygalacturonase inhibiting protein 1 (MdPGIP1), was isolated from the Granny Smith apple cultivar (GenBank accession no. DQ185063). The gene was used to transform tobacco and potato for enhanced resistance against fungal diseases. Analysis of the MdPGIP1 nucleotide sequence revealed that the gene comprises 993 nucleotides that encode a 330 amino acid polypeptide. In silico characterization of the MdPGIP1 polypeptide revealed domains typical of PGIP proteins, which include a 24 amino acid putative signal peptide, a potential cleavage site [Alanine-Leucine-Serine (ALS)] for the signal peptide, a 238 amino acid leucine-rich repeat (LRR) domain, a 46 amino acid N-terminal domain and a 22 amino acid C-terminal domain. The hydropathic evaluation of MdPGIP1 indicated a repetitive hydrophobic motif in the LRR domain and a hydrophilic surface area consistent with a globular protein. The typical consensus glycosylation sequence of Asn-X-Ser/Thr was identified in MdPGIP1, indicating potential N-linked glycosylation of MdPGIP1. The molecular mass of non-glycosylated MdPGIP1 was calculated as 36.615 kDa and the theoretical isoelectric point as 6.98. Furthermore, the secondary and tertiary structure of MdPGIP1 was modelled, and revealed that MdPGIP1 is a curved and elongated molecule that contains sheet B1, sheet B2 and 310-helices on its LRR domain. The overall properties of the MdPGIP1 protein is similar to that of the prototypical Phaseolus vulgaris PGIP 2 (PvPGIP2), and the detected differences supported its use in biotechnological applications as an inhibitor of targeted fungal polygalacturonases (PGs).

  15. Suppressing Sorbitol Synthesis Substantially Alters the Global Expression Profile of Stress Response Genes in Apple (Malus domestica) Leaves.

    Science.gov (United States)

    Wu, Ting; Wang, Yi; Zheng, Yi; Fei, Zhangjun; Dandekar, Abhaya M; Xu, Kenong; Han, Zhenhai; Cheng, Lailiang

    2015-09-01

    Sorbitol is a major product of photosynthesis in apple (Malus domestica) that is involved in carbohydrate metabolism and stress tolerance. However, little is known about how the global transcript levels in apple leaves respond to decreased sorbitol synthesis. In this study we used RNA sequencing (RNA-seq) profiling to characterize the transcriptome of leaves from transgenic lines of the apple cultivar 'Greensleeves' exhibiting suppressed expression of aldose-6-phosphate reductase (A6PR) to gain insights into sorbitol function and the consequences of decreased sorbitol synthesis on gene expression. We observed that, although the leaves of the low sorbitol transgenic lines accumulate higher levels of various primary metabolites, only very limited changes were found in the levels of transcripts associated with primary metabolism. We suggest that this is indicative of post-transcriptional and/or post-translational regulation of primary metabolite accumulation and central carbon metabolism. However, we identified significantly enriched gene ontology terms belonging to the 'stress related process' category in the antisense lines (P-value sorbitol plays a role in the responses of apple trees to abiotic and biotic stresses. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  16. A Malus crabapple chalcone synthase gene, McCHS, regulates red petal color and flavonoid biosynthesis.

    Directory of Open Access Journals (Sweden)

    Deqiang Tai

    Full Text Available Chalcone synthase is a key and often rate-limiting enzyme in the biosynthesis of anthocyanin pigments that accumulate in plant organs such as flowers and fruits, but the relationship between CHS expression and the petal coloration level in different cultivars is still unclear. In this study, three typical crabapple cultivars were chosen based on different petal colors and coloration patterns. The two extreme color cultivars, 'Royalty' and 'Flame', have dark red and white petals respectively, while the intermediate cultivar 'Radiant' has pink petals. We detected the flavoniods accumulation and the expression levels of McCHS during petals expansion process in different cultivars. The results showed McCHS have their special expression patterns in each tested cultivars, and is responsible for the red coloration and color variation in crabapple petals, especially for color fade process in 'Radiant'. Furthermore, tobacco plants constitutively expressing McCHS displayed a higher anthocyanins accumulation and a deeper red petal color compared with control untransformed lines. Moreover, the expression levels of several anthocyanin biosynthetic genes were higher in the transgenic McCHS overexpressing tobacco lines than in the control plants. A close relationship was observed between the expression of McCHS and the transcription factors McMYB4 and McMYB5 during petals development in different crabapple cultivars, suggesting that the expression of McCHS was regulated by these transcription factors. We conclude that the endogenous McCHS gene is a critical factor in the regulation of anthocyanin biosynthesis during petal coloration in Malus crabapple.

  17. Foliar application of amino acids modulates aroma components of 'FUJI' apple (malus domestica L.)

    International Nuclear Information System (INIS)

    Gou, W.; Zhang, L.; Chen, F.; Cui, Z.; Zhao, Y.; Zheng, P.; Tian, L.; Zhang, L.; Zhang, C.

    2015-01-01

    Volatile flavor compounds play a key role in determining the perception and acceptability as well as enhancing market competitiveness of apple (Malus domestica L.). In our study, we evaluated the effects of foliar-applied four different amino acids, i.e. leucine (Leu), isoleucine (Ile), valine (Val) and alanine (Ala), on aroma components and two key enzymes activities involved in aroma metabolism of Fuji apple. The total amount of aromatic components under Ala treatment was significantly higher than those under other treatments. There was a considerable increase in total aroma content, including hexanal, 2-methyl-butanol, nonanal, (E)-2-hexenal, methyleugenol, ethyl acetate, butanoic acid-pentyl ester, butanoic acid-hexyl ester, butyric acid ethyl ester, acetic acid-2-methyl-butyl ester, treated with spraying amino acids compared with the control. More specifically, hexanal, 2-methyl-butanol, methyleugenol and acetic acid-2-methyl-butyl ester exhibited a greater substantial increase of their contents than those of in other ingredients. However, butanoic acid-2-methyl-2-methyl butyl ester maintained a highest level among all aroma components regardless of different amino acids application. Furthermore, the activities of alcohol dehydrogenase (ADH) and alcohol acyltransferase (AAT) were much higher under Ala treatment than those under other treatments. We concluded that foliar-applied organic nitrogen (N), especially for Ala, can improve aroma metabolism and it could be used in production to enhance fruit quality on a commercial scale. (author)

  18. Future bloom and blossom frost risk for Malus domestica considering climate model and impact model uncertainties.

    Science.gov (United States)

    Hoffmann, Holger; Rath, Thomas

    2013-01-01

    The future bloom and risk of blossom frosts for Malus domestica were projected using regional climate realizations and phenological ( = impact) models. As climate impact projections are susceptible to uncertainties of climate and impact models and model concatenation, the significant horizon of the climate impact signal was analyzed by applying 7 impact models, including two new developments, on 13 climate realizations of the IPCC emission scenario A1B. Advancement of phenophases and a decrease in blossom frost risk for Lower Saxony (Germany) for early and late ripeners was determined by six out of seven phenological models. Single model/single grid point time series of bloom showed significant trends by 2021-2050 compared to 1971-2000, whereas the joint signal of all climate and impact models did not stabilize until 2043. Regarding blossom frost risk, joint projection variability exceeded the projected signal. Thus, blossom frost risk cannot be stated to be lower by the end of the 21st century despite a negative trend. As a consequence it is however unlikely to increase. Uncertainty of temperature, blooming date and blossom frost risk projection reached a minimum at 2078-2087. The projected phenophases advanced by 5.5 d K(-1), showing partial compensation of delayed fulfillment of the winter chill requirement and faster completion of the following forcing phase in spring. Finally, phenological model performance was improved by considering the length of day.

  19. Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

    Science.gov (United States)

    Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

    2016-01-01

    Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

  20. The effect of apple (Malus Domestica juice on the damage of mice liver cells due to paracetamol treatment

    Directory of Open Access Journals (Sweden)

    Anthony Hartanto

    2009-07-01

    Full Text Available The liver is an important organ for body metabolism process. Liver disease is one of serious health problems in developing countries including Indonesia. Liver damage is caused by viral infection, toxic agent exposure (medications, alcohol, hormonal disturbance, neoplasm and autoimmune diseases. The use of high dose paracetamol to reduce pain also leads to liver damage. Apple (Malus domestica juice is a natural anti oxidant agent. This laboratory experimental study was performed to discover the effect of giving apple juice on damaged cell regeneration due to the use of paracetamol. The study was performed in 21 male mice from Swiss-Webster strain that were divided into group I, II, and III. Group, I served as control while group II received 1 mg/ml paracetamol dose for 5 days and Group III received 1 mg/ml paracetamol for 5 days and 1 ml of apple juice on the 5th to 10th day. The observation of the mice liver cells was conducted using a light microscope with 400x magnification to get the number of necrotic liver cells per view field. The results of this study showed a difference in the number of necrotic liver cells between Group II and III. ANOVA statistical test ( = 0.05 concluded that apple juice significantly helps regeneration process in damaged liver cells caused by paracetamol.

  1. Evaluation of five protocols for DNA extraction from leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris.

    Science.gov (United States)

    Aubakirova, K; Omasheva, M; Ryabushkina, N; Tazhibaev, T; Kampitova, G; Galiakparov, N

    2014-02-27

    Leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris contain substantial amounts of secondary metabolites, which limit the high-quality DNA extraction performance. In this study, five extraction protocols were compared for their ability to produce good quality DNA from fresh and dried (with silica gel) leaves of these species. The modified protocol of Dellaporta et al., using polyvinylpyrrolidone to bind the phenolic compounds and a high molar concentration of potassium acetate to inhibit co-precipitation of polysaccharides with DNA, produced the best DNA quality for all species tested. DNA extracted by this method had a 1.77-1.96 A260/280 nm ratio and successful amplification of the 18S ribosomal DNA gene. DNA concentrations of dried leaves were lower than those obtained from fresh leaves, which was likely due to aspects of the drying procedure. All five methods for grapevine produced DNA of obvious better quality from green canes compared to leaves, due to the relatively low content of secondary metabolites in the former. For grapevine and apricot, three methods can be equally used to obtain DNA of good quality: the Doyle and Doyle modified method using CTAB and high concentration of NaCl, the Jobes et al. modified method, and the sodium dodecyl sulfate mini preparation method of Edwards et al. The protocol of Jobes et al. using LiCl for RNA removal showed the best results for most of the M. sieversii samples examined.

  2. Postglacial recolonization history of the European crabapple (Malus sylvestris Mill.), a wild contributor to the domesticated apple.

    Science.gov (United States)

    Cornille, A; Giraud, T; Bellard, C; Tellier, A; Le Cam, B; Smulders, M J M; Kleinschmit, J; Roldan-Ruiz, I; Gladieux, P

    2013-04-01

    Understanding the way in which the climatic oscillations of the Quaternary Period have shaped the distribution and genetic structure of extant tree species provides insight into the processes driving species diversification, distribution and survival. Deciphering the genetic consequences of past climatic change is also critical for the conservation and sustainable management of forest and tree genetic resources, a timely endeavour as the Earth heads into a period of fast climate change. We used a combination of genetic data and ecological niche models to investigate the historical patterns of biogeographic range expansion of a wild fruit tree, the European crabapple (Malus sylvestris), a wild contributor to the domesticated apple. Both climatic predictions for the last glacial maximum and analyses of microsatellite variation indicated that M. sylvestris experienced range contraction and fragmentation. Bayesian clustering analyses revealed a clear pattern of genetic structure, with one genetic cluster spanning a large area in Western Europe and two other genetic clusters with a more limited distribution range in Eastern Europe, one around the Carpathian Mountains and the other restricted to the Balkan Peninsula. Approximate Bayesian computation appeared to be a powerful technique for inferring the history of these clusters, supporting a scenario of simultaneous differentiation of three separate glacial refugia. Admixture between these three populations was found in their suture zones. A weak isolation by distance pattern was detected within each population, indicating a high extent of historical gene flow for the European crabapple. © 2013 Blackwell Publishing Ltd.

  3. 7 CFR 319.37-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...: mechanical transmission of the pest to an indicator plant for Dianthus, Malus, Prunus, Rubus, and Syringa..., Rubus, and Syringa; serology for Dianthus, Malus, Prunus, Pyrus, Rubus, and Syringa; electron microscopy for Dianthus and Prunus, and nucleic acid probes for Chaenomeles, Cydonia, Malus, and Pyrus. Inspector...

  4. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies.

    Science.gov (United States)

    Jung, Sook; Cestaro, Alessandro; Troggio, Michela; Main, Dorrie; Zheng, Ping; Cho, Ilhyung; Folta, Kevin M; Sosinski, Bryon; Abbott, Albert; Celton, Jean-Marc; Arús, Pere; Shulaev, Vladimir; Verde, Ignazio; Morgante, Michele; Rokhsar, Daniel; Velasco, Riccardo; Sargent, Daniel James

    2012-04-04

    Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA) algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  5. Genome-wide identification and expression analysis of the B-box gene family in the Apple (Malus domestica Borkh.) genome.

    Science.gov (United States)

    Liu, Xin; Li, Rong; Dai, Yaqing; Chen, Xuesen; Wang, Xiaoyun

    2018-04-01

    The B-box proteins (BBXs) are a family of zinc finger proteins containing one/two B-box domain(s). Compared with intensive studies of animal BBXs, investigations of the plant BBX family are limited, though some specific plant BBXs have been demonstrated to act as transcription factors in the regulation of flowering and photomorphogenesis. In this study, using a global search of the apple (Malus domestica Borkh.) genome, a total of 64 members of BBX (MdBBX) were identified. All the MdBBXs were divided into five groups based on the phylogenetic relationship, numbers of B-boxes contained and whether there was with an additional CCT domain. According to the characteristics of organ-specific expression, MdBBXs were divided into three groups based on the microarray information. An analysis of cis-acting elements showed that elements related to the stress response were prevalent in the promoter sequences of most MdBBXs. Twelve MdBBX members from different groups were randomly selected and exposed to abiotic stresses. Their expressions were up-regulated to some extent in the roots and leaves. Six among 12 MdBBXs were sensitive to osmotic pressure, salt, cold stress and exogenous abscisic acid treatment, with their expressions enhanced more than 20-fold. Our results suggested that MdBBXs may take part in response to abiotic stress.

  6. Metabolic variation and antioxidant potential of Malus prunifolia (wild apple) compared with high flavon-3-ol containing fruits (apple, grapes) and beverage (black tea).

    Science.gov (United States)

    Maria John, K M; Enkhtaivan, Gansukh; Kim, Ju Jin; Kim, Doo Hwan

    2014-11-15

    Secondary metabolic variation of wild apple (Malus prunifolia) was compared with fruits that contained high flavan-3-ol like grapes (GR), apple (App) and the beverage, black tea (BT). The polyphenol contents in wild apple was higher than in GR and App but less than BT. The identified phenolic acids (gallic, protocatechuic, chlorogenic, p-coumaric and ferulic acids) and flavonoids (quercetin and myricetin) indicate that wild apple was higher than that of App. Among all the samples, BT had highest antioxidant potential in terms of 2,2'-Azinobis (3-thylbenzothiazoline-6-sulfonic acid) diammonium salt (95.36%), metal chelating (45.36%) and phosphomolybdenum activity (95.8 mg/g) because of the high flavan-3-ol content. The gallic acid and epigallocatechin gallate were highly correlated with antioxidant potential and these metabolites levels are higher in wild apple than that of App. Wild apples being a non-commercial natural source, a detailed study of this plant will be helpful for the food additive and preservative industry. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Characterisation of microRNAs from apple (Malus domestica 'Royal Gala') vascular tissue and phloem sap.

    Science.gov (United States)

    Varkonyi-Gasic, Erika; Gould, Nick; Sandanayaka, Manoharie; Sutherland, Paul; MacDiarmid, Robin M

    2010-08-04

    Plant microRNAs (miRNAs) are a class of small, non-coding RNAs that play an important role in development and environmental responses. Hundreds of plant miRNAs have been identified to date, mainly from the model species for which there are available genome sequences. The current challenge is to characterise miRNAs from plant species with agricultural and horticultural importance, to aid our understanding of important regulatory mechanisms in crop species and enable improvement of crops and rootstocks. Based on the knowledge that many miRNAs occur in large gene families and are highly conserved among distantly related species, we analysed expression of twenty-one miRNA sequences in different tissues of apple (Malus x domestica 'Royal Gala'). We identified eighteen sequences that are expressed in at least one of the tissues tested. Some, but not all, miRNAs expressed in apple tissues including the phloem tissue were also detected in the phloem sap sample derived from the stylets of woolly apple aphids. Most of the miRNAs detected in apple phloem sap were also abundant in the phloem sap of herbaceous species. Potential targets for apple miRNAs were identified that encode putative proteins shown to be targets of corresponding miRNAs in a number of plant species. Expression patterns of potential targets were analysed and correlated with expression of corresponding miRNAs. This study validated tissue-specific expression of apple miRNAs that target genes responsible for plant growth, development, and stress response. A subset of characterised miRNAs was also present in the apple phloem translocation stream. A comparative analysis of phloem miRNAs in herbaceous species and woody perennials will aid our understanding of non-cell autonomous roles of miRNAs in plants.

  8. Genome-wide identification and expression analysis of MAPK and MAPKK gene family in Malus domestica.

    Science.gov (United States)

    Zhang, Shizhong; Xu, Ruirui; Luo, Xiaocui; Jiang, Zesheng; Shu, Huairui

    2013-12-01

    MAPK signal transduction modules play crucial roles in regulating many biological processes in plants, which are composed of three classes of hierarchically organized protein kinases, namely MAPKKKs, MAPKKs, and MAPKs. Although genome-wide analysis of this family has been carried out in some species, little is known about MAPK and MAPKK genes in apple (Malus domestica). In this study, a total of 26 putative apple MAPK genes (MdMPKs) and 9 putative apple MAPKK genes (MdMKKs) have been identified and located within the apple genome. Phylogenetic analysis revealed that MdMAPKs and MdMAPKKs could be divided into 4 subfamilies (groups A, B, C and D), respectively. The predicted MdMAPKs and MdMAPKKs were distributed across 13 out of 17 chromosomes with different densities. In addition, analysis of exon-intron junctions and of intron phase inside the predicted coding region of each candidate gene has revealed high levels of conservation within and between phylogenetic groups. According to the microarray and expressed sequence tag (EST) analysis, the different expression patterns indicate that they may play different roles during fruit development and rootstock-scion interaction process. Moreover, MAPK and MAPKK genes were performed expression profile analyses in different tissues (root, stem, leaf, flower and fruit), and all of the selected genes were expressed in at least one of the tissues tested, indicating that the MAPKs and MAPKKs are involved in various aspects of physiological and developmental processes of apple. To our knowledge, this is the first report of a genome-wide analysis of the apple MAPK and MAPKK gene family. This study provides valuable information for understanding the classification and putative functions of the MAPK signal in apple. © 2013.

  9. Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica) fruit.

    Science.gov (United States)

    Atkinson, Ross G; Sutherland, Paul W; Johnston, Sarah L; Gunaseelan, Kularajathevan; Hallett, Ian C; Mitra, Deepali; Brummell, David A; Schröder, Roswitha; Johnston, Jason W; Schaffer, Robert J

    2012-08-02

    While there is now a significant body of research correlating apple (Malus x domestica) fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1), there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in 'Royal Gala' apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. PG1-suppressed 'Royal Gala' apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. These findings confirm PG1's role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

  10. Transcription Profiles Reveal Sugar and Hormone Signaling Pathways Mediating Flower Induction in Apple (Malus domestica Borkh.).

    Science.gov (United States)

    Xing, Li-Bo; Zhang, Dong; Li, You-Mei; Shen, Ya-Wen; Zhao, Cai-Ping; Ma, Juan-Juan; An, Na; Han, Ming-Yu

    2015-10-01

    Flower induction in apple (Malus domestica Borkh.) is regulated by complex gene networks that involve multiple signal pathways to ensure flower bud formation in the next year, but the molecular determinants of apple flower induction are still unknown. In this research, transcriptomic profiles from differentiating buds allowed us to identify genes potentially involved in signaling pathways that mediate the regulatory mechanisms of flower induction. A hypothetical model for this regulatory mechanism was obtained by analysis of the available transcriptomic data, suggesting that sugar-, hormone- and flowering-related genes, as well as those involved in cell-cycle induction, participated in the apple flower induction process. Sugar levels and metabolism-related gene expression profiles revealed that sucrose is the initiation signal in flower induction. Complex hormone regulatory networks involved in cytokinin (CK), abscisic acid (ABA) and gibberellic acid pathways also induce apple flower formation. CK plays a key role in the regulation of cell formation and differentiation, and in affecting flowering-related gene expression levels during these processes. Meanwhile, ABA levels and ABA-related gene expression levels gradually increased, as did those of sugar metabolism-related genes, in developing buds, indicating that ABA signals regulate apple flower induction by participating in the sugar-mediated flowering pathway. Furthermore, changes in sugar and starch deposition levels in buds can be affected by ABA content and the expression of the genes involved in the ABA signaling pathway. Thus, multiple pathways, which are mainly mediated by crosstalk between sugar and hormone signals, regulate the molecular network involved in bud growth and flower induction in apple trees. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  11. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies

    Directory of Open Access Journals (Sweden)

    Jung Sook

    2012-04-01

    Full Text Available Abstract Background Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Results Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Conclusion Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  12. Genome-wide identification and analysis of the SBP-box family genes in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Li, Jun; Hou, Hongmin; Li, Xiaoqin; Xiang, Jiang; Yin, Xiangjing; Gao, Hua; Zheng, Yi; Bassett, Carole L; Wang, Xiping

    2013-09-01

    SQUAMOSA promoter binding protein (SBP)-box genes encode a family of plant-specific transcription factors and play many crucial roles in plant development. In this study, 27 SBP-box gene family members were identified in the apple (Malus × domestica Borkh.) genome, 15 of which were suggested to be putative targets of MdmiR156. Plant SBPs were classified into eight groups according to the phylogenetic analysis of SBP-domain proteins. Gene structure, gene chromosomal location and synteny analyses of MdSBP genes within the apple genome demonstrated that tandem and segmental duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of the SBP-box gene family in apple. Additionally, synteny analysis between apple and Arabidopsis indicated that several paired homologs of MdSBP and AtSPL genes were located in syntenic genomic regions. Tissue-specific expression analysis of MdSBP genes in apple demonstrated their diversified spatiotemporal expression patterns. Most MdmiR156-targeted MdSBP genes, which had relatively high transcript levels in stems, leaves, apical buds and some floral organs, exhibited a more differential expression pattern than most MdmiR156-nontargeted MdSBP genes. Finally, expression analysis of MdSBP genes in leaves upon various plant hormone treatments showed that many MdSBP genes were responsive to different plant hormones, indicating that MdSBP genes may be involved in responses to hormone signaling during stress or in apple development. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  13. Sodium-hydrogen exchanger inhibitory potential of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale.

    Science.gov (United States)

    Verma, Vivek; Singh, Nirmal; Jaggi, Amteshwar Singh

    2014-02-01

    The involvement of sodium-hydrogen exchangers (NHE) has been described in the pathophysiology of diseases including ischemic heart and brain diseases, cardiomyopathy, congestive heart failure, epilepsy, dementia, and neuropathic pain. Synthetic NHE inhibitors have not achieved much clinical success; therefore, plant-derived phytoconstituents may be explored as NHE inhibitors. In the present study, the NHE inhibitory potential of hydroalcoholic and alkaloidal fractions of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale was evaluated. The different concentrations of hydroalcoholic and alkaloidal extracts of the selected plants were evaluated for their NHE inhibitory activity in the platelets using the optical swelling assay. Among the hydroalcoholic extracts, the highest NHE inhibitory activity was shown by M. domestica (IC50=2.350 ± 0.132 μg/mL) followed by Musa × paradisiaca (IC50=7.967 ± 0.451 μg/mL), D. carota (IC50=37.667 ± 2.517 μg/mL), and S. officinale (IC50=249.330 ± 1.155 μg/mL). Among the alkaloidal fractions, the highest NHE inhibitory activity was shown by the alkaloidal fraction of Musa × paradisiacal (IC50=0.010 ± 0.001 μg/mL) followed by D. carota (IC50=0.024 ± 0.002 μg/mL), M. domestica (IC50=0.031 ± 0.005 μg/mL), and S. officinale (IC50=4.233 ± 0.379 μg/mL). The IC50 of alkaloidal fractions was comparable to the IC50 of synthetic NHE inhibitor, EIPA [5-(N-ethyl-N-isopropyl)amiloride] (IC50=0.033 ± 0.004 μg/mL). It may be concluded that the alkaloidal fractions of these plants possess potent NHE inhibitory activity and may be exploited for their therapeutic potential in NHE activation-related pathological complications.

  14. Shoot bending promotes flower bud formation by miRNA-mediated regulation in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Xing, Libo; Zhang, Dong; Zhao, Caiping; Li, Youmei; Ma, Juanjuan; An, Na; Han, Mingyu

    2016-02-01

    Flower induction in apple (Malus domestica Borkh.) trees plays an important life cycle role, but young trees produce fewer and inferior quality flower buds. Therefore, shoot bending has become an important cultural practice, significantly promoting the capacity to develop more flower buds during the growing seasons. Additionally, microRNAs (miRNAs) play essential roles in plant growth, flower induction and stress responses. In this study, we identified miRNAs potentially involved in the regulation of bud growth, and flower induction and development, as well as in the response to shoot bending. Of the 195 miRNAs identified, 137 were novel miRNAs. The miRNA expression profiles revealed that the expression levels of 68 and 27 known miRNAs were down-regulated and up-regulated, respectively, in response to shoot bending, and that the 31 differentially expressed novel miRNAs between them formed five major clusters. Additionally, a complex regulatory network associated with auxin, cytokinin, abscisic acid (ABA) and gibberellic acid (GA) plays important roles in cell division, bud growth and flower induction, in which related miRNAs and targets mediated regulation. Among them, miR396, 160, 393, and their targets associated with AUX, miR159, 319, 164, and their targets associated with ABA and GA, and flowering-related miRNAs and genes, regulate bud growth and flower bud formation in response to shoot bending. Meanwhile, the flowering genes had significantly higher expression levels during shoot bending, suggesting that they are involved in this regulatory process. This study provides a framework for the future analysis of miRNAs associated with multiple hormones and their roles in the regulation of bud growth, and flower induction and formation in response to shoot bending in apple trees. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  15. Involvement of plasma membrane peroxidases and oxylipin pathway in the recovery from phytoplasma disease in apple (Malus domestica).

    Science.gov (United States)

    Patui, Sonia; Bertolini, Alberto; Clincon, Luisa; Ermacora, Paolo; Braidot, Enrico; Vianello, Angelo; Zancani, Marco

    2013-06-01

    Apple trees (Malus domestica Borkh.) may be affected by apple proliferation (AP), caused by 'Candidatus Phytoplasma mali'. Some plants can spontaneously recover from the disease, which implies the disappearance of symptoms through a phenomenon known as recovery. In this article it is shown that NAD(P)H peroxidases of leaf plasma membrane-enriched fractions exhibited a higher activity in samples from both AP-diseased and recovered plants. In addition, an increase in endogenous SA was characteristic of the symptomatic plants, since its content increased in samples obtained from diseased apple trees. In agreement, phenylalanine ammonia lyase (PAL) activity, a key enzyme of the phenylpropanoid pathway, was increased too. Jasmonic acid (JA) increased only during recovery, in a phase subsequent to the pathological state, and in concomitance to a decline of salicylic acid (SA). Oxylipin pathway, responsible for JA synthesis, was not induced during the development of AP-disease, but it appeared to be stimulated when the recovery occurred. Accordingly, lipoxygenase (LOX) activity, detected in plasma membrane-enriched fractions, showed an increase in apple leaves obtained from recovered plants. This enhancement was paralleled by an increase of hydroperoxide lyase (HPL) activity, detected in leaf microsomes, albeit the latter enzyme was activated in either the disease or recovery conditions. Hence, a reciprocal antagonism between SA- and JA-pathways could be suggested as an effective mechanism by which apple plants react to phytoplasma invasions, thereby providing a suitable defense response leading to the establishment of the recovery phenomenon. Copyright © Physiologia Plantarum 2012.

  16. Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development

    Science.gov (United States)

    Schaeffer, Scott M.; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie

    2017-01-01

    Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids—chromoplasts—are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant ‘Granny Smith’, carotenoid-predominant ‘Golden Delicious’, and anthocyanin-predominant ‘Top Red Delicious’. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex biochemistry of plastids in perennial non-model systems. PMID:28698906

  17. Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica fruit

    Directory of Open Access Journals (Sweden)

    Atkinson Ross G

    2012-08-01

    Full Text Available Abstract Background While there is now a significant body of research correlating apple (Malus x domestica fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1, there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in ‘Royal Gala’ apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. Results PG1-suppressed ‘Royal Gala’ apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. Conclusions These findings confirm PG1’s role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

  18. Phytohormone Interaction Modulating Fruit Responses to Photooxidative and Heat Stress on Apple (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Carolina A. Torres

    2017-12-01

    Full Text Available Sun-related physiological disorders such as sun damage on apples (Malus domestica Borkh are caused by cumulative photooxidative and heat stress during their growing season triggering morphological, physiological, and biochemical changes in fruit tissues not only while it is on the tree but also after it has been harvested. The objective of the work was to establish the interaction of auxin (indole-3-acetic acid; IAA, abscisic acid (ABA, jasmonic acid (JA, salicylic acid (SA, and ethylene (ET and its precursor ACC (free and conjugated, MACC during development of sun-injury-related disorders pre- and post-harvest on apples. Peel tissue was extracted from fruit growing under different sun exposures (Non-exposed, NE; Exposed, EX and with sun injury symptoms (Moderate, Mod. Sampling was carried out every 15 days from 75 days after full bloom (DAFB until 120 days post-harvest in cold storage (1°C, > 90%RH. Concentrations of IAA, ABA, JA, SA, were determined using UHPLC mass spectrometry, and ET and ACC (free and conjugated MACC using gas chromatography. IAA was found not to be related directly to sun injury development, but it decreased 60% in sun exposed tissue, and during fruit development. ABA, JA, SA, and ethylene concentrations were significantly higher (P ≤ 0.05 in Mod tissue, but their concentration, except for ethylene, were not affected by sun exposure. ACC and MACC concentrations increased until 105 DAFB in all sun exposure categories. During post-harvest, ethylene climacteric peak was delayed on EX compared to Mod. ABA and SA concentrations remained stable throughout storage in both tissue. JA dramatically increased post-harvest in both EX and Mod tissue, and orchards, confirming its role in low temperature tolerance. The results suggest that ABA, JA, and SA together with ethylene are modulating some of the abiotic stress defense responses on sun-exposed fruit during photooxidative and heat stress on the tree.

  19. The distribution and impact of common copy-number variation in the genome of the domesticated apple, Malus x domestica Borkh.

    Science.gov (United States)

    Boocock, James; Chagné, David; Merriman, Tony R; Black, Michael A

    2015-10-23

    Copy number variation (CNV) is a common feature of eukaryotic genomes, and a growing body of evidence suggests that genes affected by CNV are enriched in processes that are associated with environmental responses. Here we use next generation sequence (NGS) data to detect copy-number variable regions (CNVRs) within the Malus x domestica genome, as well as to examine their distribution and impact. CNVRs were detected using NGS data derived from 30 accessions of M. x domestica analyzed using the read-depth method, as implemented in the CNVrd2 software. To improve the reliability of our results, we developed a quality control and analysis procedure that involved checking for organelle DNA, not repeat masking, and the determination of CNVR identity using a permutation testing procedure. Overall, we identified 876 CNVRs, which spanned 3.5 % of the apple genome. To verify that detected CNVRs were not artifacts, we analyzed the B- allele-frequencies (BAF) within a single nucleotide polymorphism (SNP) array dataset derived from a screening of 185 individual apple accessions and found the CNVRs were enriched for SNPs having aberrant BAFs (P apple scab. We present the first analysis and catalogue of CNVRs in the M. x domestica genome. The enrichment of the CNVRs with R gene models and their overlap with gene loci of agricultural significance draw attention to a form of unexplored genetic variation in apple. This research will underpin further investigation of the role that CNV plays within the apple genome.

  20. Dormancy alleviation by NO or HCN leading to decline of protein carbonylation levels in apple (Malus domestica Borkh.) embryos.

    Science.gov (United States)

    Krasuska, Urszula; Ciacka, Katarzyna; Dębska, Karolina; Bogatek, Renata; Gniazdowska, Agnieszka

    2014-08-15

    Deep dormancy of apple (Malus domestica Borkh.) embryos can be overcome by short-term pre-treatment with nitric oxide (NO) or hydrogen cyanide (HCN). Dormancy alleviation of embryos modulated by NO or HCN and the first step of germination depend on temporary increased production of reactive oxygen species (ROS). Direct oxidative attack on some amino acid residues or secondary reactions via reactive carbohydrates and lipids can lead to the formation of protein carbonyl derivatives. Protein carbonylation is a widely accepted covalent and irreversible modification resulting in inhibition or alteration of enzyme/protein activities. It also increases the susceptibility of proteins to proteolytic degradation. The aim of this work was to investigate protein carbonylation in germinating apple embryos, the dormancy of which was removed by pre-treatment with NO or HCN donors. It was performed using a quantitative spectrophotometric method, while patterns of carbonylated protein in embryo axes were analyzed by immunochemical techniques. The highest concentration of protein carbonyl groups was observed in dormant embryos. It declined in germinating embryos pre-treated with NO or HCN, suggesting elevated degradation of modified proteins during seedling formation. A decrease in the concentration of carbonylated proteins was accompanied by modification in proteolytic activity in germinating apple embryos. A strict correlation between the level of protein carbonyl groups and cotyledon growth and greening was detected. Moreover, direct in vitro carbonylation of BSA treated with NO or HCN donors was analyzed, showing action of both signaling molecules as protein oxidation agents. Copyright © 2014 Elsevier GmbH. All rights reserved.

  1. Apple (Malus domestica) MdERF2 negatively affects ethylene biosynthesis during fruit ripening by suppressing MdACS1 transcription.

    Science.gov (United States)

    Li, Tong; Jiang, Zhongyu; Zhang, Lichao; Tan, Dongmei; Wei, Yun; Yuan, Hui; Li, Tianlai; Wang, Aide

    2016-12-01

    Ripening in climacteric fruit requires the gaseous phytohormone ethylene. Although ethylene signaling has been well studied, knowledge of the transcriptional regulation of ethylene biosynthesis is still limited. Here we show that an apple (Malus domestica) ethylene response factor, MdERF2, negatively affects ethylene biosynthesis and fruit ripening by suppressing the transcription of MdACS1, a gene that is critical for biosynthesis of ripening-related ethylene. Expression of MdERF2 was suppressed by ethylene during ripening of apple fruit, and we observed that MdERF2 bound to the promoter of MdACS1 and directly suppressed its transcription. Moreover, MdERF2 suppressed the activity of the promoter of MdERF3, a transcription factor that we found to bind to the MdACS1 promoter, thereby increasing MdACS1 transcription. We determined that the MdERF2 and MdERF3 proteins directly interact, and this interaction suppresses the binding of MdERF3 to the MdACS1 promoter. Moreover, apple fruit with transiently downregulated MdERF2 expression showed higher ethylene production and faster ripening. Our results indicate that MdERF2 negatively affects ethylene biosynthesis and fruit ripening in apple by suppressing the transcription of MdACS1 via multiple mechanisms, thereby acting as an antagonist of positive ripening regulators. Our findings offer a deep understanding of the transcriptional regulation of ethylene biosynthesis during climacteric fruit ripening. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.

  2. A PR-4 gene identified from Malus domestica is involved in the defense responses against Botryosphaeria dothidea.

    Science.gov (United States)

    Bai, Suhua; Dong, Chaohua; Li, Baohua; Dai, Hongyi

    2013-01-01

    Pathogenesis-related protein-4 (PR-4) family is a group of proteins with a Barwin domain in C-terminus and generally thought to be involved in plant defense responses. However, their detailed roles are poorly understood in defense of apple plant against pathogenic infection. In the present study, a new PR-4 gene (designated as MdPR-4) was identified from Malus domestica, and its roles in defense responses of apple were investigated. The open reading frame of MdPR-4 gene is of 447 bp encoding a protein of 148 amino acids with a Barwin domain in C-terminus and a signal peptide of 26 amino acids in N-terminus. Sequence and structural analysis indicated that MdPR-4 protein belongs to class II of PR-4 family. The high-level expression of MdPR-4 was observed in flowers and leaves as revealed by quantitative real time PCR. The temporal expression analysis demonstrated that MdPR-4 expression could be up-regulated by Botryosphaeria dothidea infection and salicylic acid (SA) or methyl jasmonate (MeJA) treatment, but suppressed by diethyldithiocarbamic acid (DIECA). In vitro assays, recombinant MdPR-4 protein exhibited ribonuclease activity specific for single strand RNA and significant inhibition to hyphal growth of three apple pathogenic fungi B. dothidea, Valsa ceratosperma and Glomerella cingulata. Moreover, the inhibition was reduced by the presence of 5'-ADP. Taken all together, the results indicate that MdPR-4 protein is involved in the defense responses of apple against pathogenic attack by directly inhibiting hyphal growth, and the inhibition is correlated with its ribonuclease activity, where as MdPR-4 expression is regulated by both SA and JA signaling pathway. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  3. Genome-wide identification and analysis of the aldehyde dehydrogenase (ALDH) gene superfamily in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Li, Xiaoqin; Guo, Rongrong; Li, Jun; Singer, Stacy D; Zhang, Yucheng; Yin, Xiangjing; Zheng, Yi; Fan, Chonghui; Wang, Xiping

    2013-10-01

    Aldehyde dehydrogenases (ALDHs) represent a protein superfamily encoding NAD(P)(+)-dependent enzymes that oxidize a wide range of endogenous and exogenous aliphatic and aromatic aldehydes. In plants, they are involved in many biological processes and play a role in the response to environmental stress. In this study, a total of 39 ALDH genes from ten families were identified in the apple (Malus × domestica Borkh.) genome. Synteny analysis of the apple ALDH (MdALDH) genes indicated that segmental and tandem duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of these gene families in apple. Moreover, synteny analysis between apple and Arabidopsis demonstrated that several MdALDH genes were found in the corresponding syntenic blocks of Arabidopsis, suggesting that these genes appeared before the divergence of lineages that led to apple and Arabidopsis. In addition, phylogenetic analysis, as well as comparisons of exon-intron and protein structures, provided further insight into both their evolutionary relationships and their putative functions. Tissue-specific expression analysis of the MdALDH genes demonstrated diverse spatiotemporal expression patterns, while their expression profiles under abiotic stress and various hormone treatments indicated that many MdALDH genes were responsive to high salinity and drought, as well as different plant hormones. This genome-wide identification, as well as characterization of evolutionary relationships and expression profiles, of the apple MdALDH genes will not only be useful for the further analysis of ALDH genes and their roles in stress response, but may also aid in the future improvement of apple stress tolerance. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  4. DAYA HAMBAT JUS KULIT APEL MANALAGI (Malus sylvestris Mill. TERHADAP PERTUMBUHAN BAKTERI Staphylococcus aureus DAN Escherichia coli PENYEBAB MASTITIS PADA SAPI PERAH

    Directory of Open Access Journals (Sweden)

    Puguh Surjowardojo

    2016-08-01

    Full Text Available Apel Manalagi (Malus sylvestris Mill. sering dikonsumsi baik secara segar maupun diolah menjadi keripik apel. Pengolahan ini menghasilkan limbah berupa kulit. Kandungan kulit apel Manalagi berupa saponin, flavonoid, tannin, polifenol dan katekin yang dapat berperan sebagai antibakteri, kandungan ini dapat dimanfaatkan sebagai pengganti larutan teat dipping iodip untuk menghambat pertumbuhan bakteri Staphylococcus aureus dan Escherichia coli penyebab mastitis pada sapi perah. Tujuan penelitian ini untuk menentukan apakah jus kulit apel Manalagi dapat menghambat pertumbuhan Staphylococcus aureus dan Escherichia coli penyebab mastitis pada sapi perah serta untuk mengetahui konsentrasi yang lebih baik untuk menghambat pertumbuhan bakteri Staphylococcusaureus dan Escerichia coli. Penelitian ini dilakukan di Laboratorium dengan cara diffusi sumurandengan analisis yang digunakan adalah Rancangan Acak Lengkap (RAL kemudian dilanjutkan dengan menggunakan Uji Beda Nyata Terkecil (BNT. Hasil penelitian menunjukkan bahwa penggunaan juskulit apel Manalagi dengan konsentrasi 10%, 20% dan 30% dapat menghambat pertumbuhan bakteristaphylococcus aureus dan Escherichia coli secara signifikan (P<0,01 dengan hasil terbaik terhadapbakteri Staphylococcus aureus dengan menggunakan konsentrasi 30% sedangkan untuk bakteriEscherichia coli menggunakan konsentrasi 10%. Namun, penggunaan jus kulit apel Manalagi belumdapat mengimbangi iodip dalam menghambat bakteri Escherichia coli. Kesimpulan dari penelitian iniadalah jus kulit apel Manalagi dapat digunakan untuk larutan antiseptik alami untuk teat dipping padasapi perah. Kata kunci: Staphylococcus aureus, Eschericia coli, zona hambat bakteri, mastitis.

  5. Response of apple (malus domestica borkh.) cultivars grafted on two rootstocks under sub-humid temperate climate of azad jammu and kashmir

    International Nuclear Information System (INIS)

    Ahmed, M.J.; Gillani, G.M.; Kiani, F.A.

    2013-01-01

    Nine apple (Malus domestica Borkh.) cultivars grafted on two rootstocks were assessed on morphological and biochemical basis under sub-humid temperate region of Azad Jammu and Kashmir. Starking Delicious, Kala Kulu, Fuji, Red Chief, Royal Gala, Red Labnani, Red Delicious, Star Crimson and Sky Spur grafted on local Crab apple and MM.111 were studied for various growth characteristics. Red Chief exhibited maximum (415.8 cm) plant height on crab apple whereas, more flower (1866) tree-1, higher number (967.0) of fruit set tree/sup -1/, fruits matured (490.0) tree/sup -1/ and maximum (46.33 kg) weight of fruits tree/sup -1/ were recorded on MM.111. Minimum duration (5 days) of flowering was presented by Sky Spur on local crab apple while minimum (92.0) days for fruit maturation were required by Royal Gala on MM.111. Maximum (112.5 g) fruit weight, total soluble solids (13.95%), total sugars (10.9 %) and reducing sugars (7.94%) were recorded for Starking Delicious on MM.111. On the other hand more pH (3.51) and ascorbic acid (9.2 %) content were recorded for Kala Kulu on crab apple. Red Chief found to be high yielding cultivar on MM.111 than crab apple while total sugars, TSS and average fruit weight were better for Starking Delicious. It was concluded that performance of apple cultivars were variable on both rootstocks. However, MM.111 proved better than local crab apple under prevailing conditions. (author)

  6. INHIBITION OF Malus sylvestris Mill. PEELEXTRACT USING ETANOL SOLVENT ON THE GROWTH OF Streptococcus agalactiae AND Escherichia coli CAUSING MASTITIS

    Directory of Open Access Journals (Sweden)

    Kanzul Kamal Putra

    2017-03-01

    Full Text Available The purpose of this research was to find the resistibility of Manalagi apple peel extract, using etanol, to the growth of was to determine the antibacterial activity of Manalagi apple peel (Malus sylvestris Mill extract in various solvent using ethanol concentration against the growth of Streptococcus agalactiae and Escherichia coli bacteria that causing mastitis.The research methodwas experimental using Completely Randomized Design with 4 treatments and 6 replication. The treatments consisted of P1 (10%, P2 (20%, P3 (50% concentrations and P0 (10% iodips as the control. The variable measured was diameter of inhibition zone. The data were analyzed using ANOVA and continued by Duncan’s New Multiple Range Test (DMRT test if there was significantly difference result. The result of the inhibition zone of Manalagi apple peel extract using etanol in preventing the growth of Streptococcus agalactiae and Escherichia coli bacteria was different (P<0,01. In P2 (30% concentration, the extract resistibility to the growth of Streptococcus agalactiae bacteria was equivalent to P0 (iodips and in P3 (50% concentration, the extract resistibility to Escherichia coli bacteria was greater than P0 (iodips. Manalagi apple peel extract using etanol can be used as a natural antiseptic solution for teat dipping on dairy cows. The recommendation from the research was using extract Manalagi apple peel with etanol solvent concentration of 30% as a solution of teat dipping.   Keywords : Manalagi apple peel, Teat dipping, Mastitis, Streptococcus agalactiaeand Escherichia coli

  7. Development of FT-NIR Models for the Simultaneous Estimation of Chlorophyll and Nitrogen Content in Fresh Apple (Malus Domestica Leaves

    Directory of Open Access Journals (Sweden)

    Elena Tamburini

    2015-01-01

    Full Text Available Agricultural practices determine the level of food production and, to great extent, the state of the global environment. During the last decades, the indiscriminate recourse to fertilizers as well as the nitrogen losses from land application have been recognized as serious issues of modern agriculture, globally contributing to nitrate pollution. The development of a reliable Near-Infra-Red Spectroscopy (NIRS-based method, for the simultaneous monitoring of nitrogen and chlorophyll in fresh apple (Malus domestica leaves, was investigated on a set of 133 samples, with the aim of estimating the nutritional and physiological status of trees, in real time, cheaply and non-destructively. By means of a FT (Fourier Transform-NIR instrument, Partial Least Squares (PLS regression models were developed, spanning a concentration range of 0.577%–0.817% for the total Kjeldahl nitrogen (TKN content (R2 = 0.983; SEC = 0.012; SEP = 0.028, and of 1.534–2.372 mg/g for the total chlorophyll content (R2 = 0.941; SEC = 0.132; SEP = 0.162. Chlorophyll-a and chlorophyll-b contents were also evaluated (R2 = 0.913; SEC = 0.076; SEP = 0.101 and R2 = 0.899; SEC = 0.059; SEP = 0.101, respectively. All calibration models were validated by means of 47 independent samples. The NIR approach allows a rapid evaluation of the nitrogen and chlorophyll contents, and may represent a useful tool for determining nutritional and physiological status of plants, in order to allow a correction of nutrition programs during the season.

  8. Chilling-related cell damage of apple (Malus × domestica Borkh.) fruit cortical tissue impacts antioxidant, lipid and phenolic metabolism.

    Science.gov (United States)

    Leisso, Rachel S; Buchanan, David A; Lee, Jinwook; Mattheis, James P; Sater, Chris; Hanrahan, Ines; Watkins, Christopher B; Gapper, Nigel; Johnston, Jason W; Schaffer, Robert J; Hertog, Maarten L A T M; Nicolaï, Bart M; Rudell, David R

    2015-02-01

    'Soggy breakdown' (SB) is an internal flesh disorder of 'Honeycrisp' apple (Malus × domestica Borkh.) fruit that occurs during low temperature storage. The disorder is a chilling injury (CI) in which visible symptoms typically appear after several weeks of storage, but information about the underlying metabolism associated with its induction and development is lacking. The metabolic profile of flesh tissue from wholly healthy fruit and brown and healthy tissues from fruit with SB was characterized using gas chromatography-mass spectrometry (GC-MS) and liquid chromatograph-mass spectrometry (LC-MS). Partial least squares discriminant analysis (PLS-DA) and correlation networks revealed correlation among ester volatile compounds by composition and differences in phytosterol, phenolic and putative triacylglycerides (TAGs) metabolism among the tissues. anova-simultaneous component analysis (ASCA) was used to test the significance of metabolic changes linked with tissue health status. ASCA-significant components included antioxidant compounds, TAGs, and phytosterol conjugates. Relative to entirely healthy tissues, elevated metabolite levels in symptomatic tissue included γ-amino butyric acid, glycerol, sitosteryl (6'-O-palmitoyl) β-d-glucoside and sitosteryl (6'-O-stearate) β-d-glucoside, and TAGs containing combinations of 16:0, 18:3, 18:2 and 18:1 fatty acids. Reduced metabolite levels in SB tissue included 5-caffeoyl quinate, β-carotene, catechin, epicatechin, α-tocopherol, violaxanthin and sitosteryl β-d glucoside. Pathway analysis indicated aspects of primary metabolism differed according to tissue condition, although differences in metabolites involved were more subtle than those of some secondary metabolites. The results implicate oxidative stress and membrane disruption processes in SB development and constitute a diagnostic metabolic profile for the disorder. © 2014 Scandinavian Plant Physiology Society.

  9. Molecular cloning and functional analysis of a blue light receptor gene MdCRY2 from apple (Malus domestica).

    Science.gov (United States)

    Li, Yuan-Yuan; Mao, Ke; Zhao, Cheng; Zhao, Xian-Yan; Zhang, Rui-Fen; Zhang, Hua-Lei; Shu, Huai-Rui; Hao, Yu-Jin

    2013-04-01

    MdCRY2 was isolated from apple fruit skin, and its function was analyzed in MdCRY2 transgenic Arabidopsis. The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A (UV-A) light receptors involved in regulating various aspects of plant growth and development. Investigations of the structure and functions of cryptochromes in plants have largely focused on Arabidopsis (Arabidopsis thaliana), tomato (Solanum lycopersicum), pea (Pisum sativum), and rice (Oryza sativa). However, no data on the function of CRY2 are available in woody plants. In this study, we isolated a cryptochrome gene, MdCRY2, from apple (Malus domestica). The deduced amino acid sequences of MdCRY2 contain the conserved N-terminal photolyase-related domain and the flavin adenine dinucleotide (FAD) binding domain, as well as the C-terminal DQXVP-acidic-STAES (DAS) domain. Relationship analysis indicates that MdCRY2 shows the highest similarity to the strawberry FvCRY protein. The expression of MdCRY2 is induced by blue/UV-A light, which represents a 48-h circadian rhythm. To investigate the function of MdCRY2, we overexpressed the MdCRY2 gene in a cry2 mutant and wild type (WT) Arabidopsis, assessed the phenotypes of the resulting transgenic plants, and found that MdCRY2 functions to regulate hypocotyl elongation, root growth, flower initiation, and anthocyanin accumulation. Furthermore, we examined the interaction between MdCRY2 and AtCOP1 using a yeast two-hybrid assay and a bimolecular fluorescence complementation assay. These data provide functional evidence for a role of blue/UV-A light-induced MdCRY2 in controlling photomorphogenesis in apple.

  10. T3SS-dependent differential modulations of the jasmonic acid pathway in susceptible and resistant genotypes of Malus spp. challenged with Erwinia amylovora.

    Science.gov (United States)

    Dugé De Bernonville, Thomas; Gaucher, Matthieu; Flors, Victor; Gaillard, Sylvain; Paulin, Jean-Pierre; Dat, James F; Brisset, Marie-Noëlle

    2012-06-01

    Fire blight is a bacterial disease of Maloideae caused by Erwinia amylovora (Ea). This necrogenic enterobacterium uses a type III secretion system (T3SS) to inject type III effectors into the plant cells to cause disease on its susceptible hosts, including economically important crops like apple and pear. The expressions of marker genes of the salicylic acid (SA) and jasmonic acid (JA) defense regulation pathways were monitored by RT-qPCR in leaves of two apple genotypes, one susceptible and one resistant, challenged with a wild type strain, a T3SS-deficient strain or water. The transcriptional data taken together with hormone level measurements indicated that the SA pathway was similarly induced in both apple genotypes during infection by Ea. On the contrary, the data clearly showed a strong T3SS-dependent down-regulation of the JA pathway in leaves of the susceptible genotype but not in those of the resistant one. Accordingly, methyl-jasmonate treated susceptible plants displayed an increased resistance to Ea. Bacterial mutant analysis indicated that JA manipulation by Ea mainly relies on the type III effector DspA/E. Taken together, our data suggest that the T3SS-dependent down-regulation of the JA pathway is a critical step in the infection process of Malus spp. by Ea. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  11. Root-zone temperatures affect phenology of bud break, flower cluster development, shoot extension growth and gas exchange of 'Braeburn' (Malus domestica) apple trees.

    Science.gov (United States)

    Greer, Dennis H; Wünsche, Jens N; Norling, Cara L; Wiggins, Harry N

    2006-01-01

    We investigated the effects of root-zone temperature on bud break, flowering, shoot growth and gas exchange of potted mature apple (Malus domestica (Borkh.)) trees with undisturbed roots. Soil respiration was also determined. Potted 'Braeburn' apple trees on M.9 rootstock were grown for 70 days in a constant day/night temperature regime (25/18 degrees C) and one of three constant root-zone temperatures (7, 15 and 25 degrees C). Both the proportion and timing of bud break were significantly enhanced as root-zone temperature increased. Rate of floral cluster opening was also markedly increased with increasing root-zone temperature. Shoot length increased but shoot girth growth declined as root-zone temperatures increased. Soil respiration and leaf photosynthesis generally increased as root-zone temperatures increased. Results indicate that apple trees growing in regions where root zone temperatures are or = 15 degrees C. The effect of root-zone temperature on shoot performance may be mediated through the mobilization of root reserves, although the role of phytohormones cannot be discounted. Variation in leaf photosynthesis across the temperature treatments was inadequately explained by stomatal conductance. Given that root growth increases with increasing temperature, changes in sink activity induced by the root-zone temperature treatments provide a possible explanation for the non-stomatal effect on photosynthesis. Irrespective of underlying mechanisms, root-zone temperatures influence bud break and flowering in apple trees.

  12. Differentiation of mycoplasmalike organisms (MLOs) in European fruit trees by PCR using specific primers derived from the sequence of a chromosomal fragment of the apple proliferation MLO.

    Science.gov (United States)

    Jarausch, W; Saillard, C; Dosba, F; Bové, J M

    1994-01-01

    A 1.8-kb chromosomal DNA fragment of the mycoplasmalike organism (MLO) associated with apple proliferation was sequenced. Three putative open reading frames were observed on this fragment. The protein encoded by open reading frame 2 shows significant homologies with bacterial nitroreductases. From the nucleotide sequence four primer pairs for PCR were chosen to specifically amplify DNA from MLOs associated with European diseases of fruit trees. Primer pairs specific for (i) Malus-affecting MLOs, (ii) Malus- and Prunus-affecting MLOs, and (iii) Malus-, Prunus-, and Pyrus-affecting MLOs were obtained. Restriction enzyme analysis of the amplification products revealed restriction fragment length polymorphisms between Malus-, Prunus, and Pyrus-affecting MLOs as well as between different isolates of the apple proliferation MLO. No amplification with either primer pair could be obtained with DNA from 12 different MLOs experimentally maintained in periwinkle. Images PMID:7916180

  13. Polyphenolic Characterization and Antioxidant Activity of Malus domestica and Prunus domestica Cultivars from Costa Rica.

    Science.gov (United States)

    Navarro, Mirtha; Moreira, Ileana; Arnaez, Elizabeth; Quesada, Silvia; Azofeifa, Gabriela; Vargas, Felipe; Alvarado, Diego; Chen, Pei

    2018-01-30

    The phenolic composition of skin and flesh from Malus domestica apples (Anna cultivar) and Prunus domestica plums (satsuma cultivar) commercial cultivars in Costa Rica, was studied using Ultra Performance Liquid Chromatography coupled with High Resolution Mass Spectrometry (UPLC-DAD-ESI-MS) on enriched-phenolic extracts, with particular emphasis in proanthocyanidin and flavonoids characterization. A total of 52 compounds were identified, including 21 proanthocyanidins ([(+)-catechin and (-)-epicatechin]) flavan-3-ols monomers, five procyanidin B-type dimers and two procyanidin A-type dimers, five procyanidin B-type trimers and two procyanidin A-type trimers, as well as one procyanidin B-type tetramer, two procyanidin B-type pentamers, and two flavan-3-ol gallates); 15 flavonoids (kaempferol, quercetin and naringenin derivatives); nine phenolic acids (protochatechuic, caffeoylquinic, and hydroxycinnamic acid derivatives); five hydroxychalcones (phloretin and 3-hydroxyphloretin derivatives); and two isoprenoid glycosides (vomifoliol derivatives). These findings constitute the first report of such a high number and diversity of compounds in skins of one single plum cultivar and of the presence of proanthocyanidin pentamers in apple skins. Also, it is the first time that such a large number of glycosylated flavonoids and proanthocyanidins are reported in skins and flesh of a single plum cultivar. In addition, total phenolic content (TPC) was measured with high values observed for all samples, especially for fruits skins with a TPC of 619.6 and 640.3 mg gallic acid equivalents/g extract respectively for apple and plum. Antioxidant potential using 2,2-diphenyl-1-picrylhidrazyl (DPPH) and oxygen radical absorbance capacity (ORAC) methods were evaluated, with results showing also high values for all samples, especially again for fruit skins with IC 50 of 4.54 and 5.19 µg/mL (DPPH) and 16.8 and 14.6 mmol TE/g (ORAC) respectively for apple and plum, indicating the potential

  14. Genome-wide identification of genes involved in polyamine biosynthesis and the role of exogenous polyamines in Malus hupehensis Rehd. under alkaline stress.

    Science.gov (United States)

    Gong, Xiaoqing; Dou, Fangfang; Cheng, Xi; Zhou, Jing; Zou, Yangjun; Ma, Fengwang

    2018-08-30

    Polyamines (PAs) in plants are growth substrates with functions similar to phytohormones. Although they contribute to diverse processes, little is known about their role in stress responses, especially for perennial woody plants. We conducted a genome-wide investigation of 18 sequences involved in PA biosynthesis in the genome of apple (Malus domestica). Further analysis was performed to construct a phylogenetic tree, analyze their protein motifs and gene structures. In addition, we developed their expression profiles in response to stressed conditions. Both MDP0000171041 (MdSAMDC1) and MDP0000198590 (MdSPDS1) were induced by alkaline, salt, ABA, cold, and dehydration stress treatments, suggesting that these genes are the main contributors to activities of S-adenosylmethionine decarboxylase (EC 4.1.1.50) and spermidine synthase (EC 2.5.1.16) in apple. Changes in PA biosynthesis under stress conditions indicated that spermidine and spermine are more essential than putrescine for apple, especially when responding to alkaline or salt stress. When seedlings of M. hupehensis Rehd. were supplied with exogenous PAs, their leaves showed less chlorosis under alkaline stress when compared with untreated plants. This application also inhibited the decline in SPAD levels and reduced relative electrolyte leakage in those stressed seedlings, while increasing their concentration of active iron. These results suggest that the alteration in PA biosynthesis confers enhanced tolerance to alkaline stress in M. hupehensis Rehd. Copyright © 2018. Published by Elsevier B.V.

  15. Disease: H00192 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 1302742 (gene) ... AUTHORS ... Ichida K, Matsumura T, Sakuma R, Hosoya T, Nishino T ... ...AUTHORS ... Ichida K, Amaya Y, Kamatani N, Nishino T, Hosoya T, Sakai O ... TITLE ... Identification of two muta

  16. Promotion of flavonoid biosynthesis in leaves and calli of ornamental crabapple (Malus sp.) by high carbon to nitrogen ratios.

    Science.gov (United States)

    Wan, Huihua; Zhang, Jie; Song, Tingting; Tian, Ji; Yao, Yuncong

    2015-01-01

    Flavonoids are secondary metabolites that play important roles in plant physiology. Despite numerous studies examined the effects of available carbon (C) or nitrogen (N) on flavonoid biosynthesis, the mechanism of C/N interactive effects on flavonoid metabolism is still unclear. In this study, we analyzed the composition of flavonoids and the expression levels of flavonoid-related genes in leaves and calli of crabapple (Malus sp.) cultivars with different leaf colors grown on media with different C/N ratios. Our results show that high C/N ratios induce anthocyanin pigmentation in leaves of the ever-red cultivar 'Royalty' and the spring-red cultivar 'Prairifire,' as well as in three types of calli derived from the ever-green cultivar 'Spring Snow,' but not in the leaves of the ever-green cultivar 'Flame.' This phenomenon therefore correlated with anthocyanin content in these different samples. In addition, high C/N ratios in the growth media resulted in an increase in the concentration of flavones and flavonols in the leaves of the three crabapple cultivars. The transcript levels of the general flavonoid pathway genes [from chalcone synthase (CHS) to uridine diphosphat-glucose: flavonoid 3-O-glycosyltransferase (UFGT) and flavonol synthase (FLS)] increased in response to high C/N ratios, and this in turn was correlated with the concentration of anthocyanins, flavones and flavonols in the leaves and calli. Expression of the late flavonoid/anthocyanin biosynthetic genes, anthocyanidin synthase (ANS), UFGT and FLS in particular, was more strongly influenced by C/N ratios than other structural genes, and the increased expression of the structural genes under high C/N ratios coincided with a coordinated increase in transcript levels of a MYB transcription factor, MYB10. These results are likely to be useful for future generation of plants with an optimized flavonoid/anthocyanin content or desirable organ coloration.

  17. A gene expression analysis of cell wall biosynthetic genes in Malus × domestica infected by ‘Candidatus Phytoplasma mali’

    Science.gov (United States)

    Guerriero, Gea; Giorno, Filomena; Ciccotti, Anna Maria; Schmidt, Silvia; Baric, Sanja

    2016-01-01

    Apple proliferation (AP) represents a serious threat to several fruit-growing areas and is responsible for great economic losses. Several studies have highlighted the key role played by the cell wall in response to pathogen attack. The existence of a cell wall integrity signaling pathway which senses perturbations in the cell wall architecture upon abiotic/biotic stresses and activates specific defence responses has been widely demonstrated in plants. More recently a role played by cell wall-related genes has also been reported in plants infected by phytoplasmas. With the aim of shedding light on the cell wall response to AP disease in the economically relevant fruit-tree Malus × domestica Borkh., we investigated the expression of the cellulose (CesA) and callose synthase (CalS) genes in different organs (i.e., leaves, roots and branch phloem) of healthy and infected symptomatic outdoor-grown trees, sampled over the course of two time points (i.e., spring and autumn 2011), as well as in in vitro micropropagated control and infected plantlets. A strong up-regulation in the expression of cell wall biosynthetic genes was recorded in roots from infected trees. Secondary cell wall CesAs showed up-regulation in the phloem tissue from branches of infected plants, while either a down-regulation of some genes or no major changes were observed in the leaves. Micropropagated plantlets also showed an increase in cell wall-related genes and constitute a useful system for a general assessment of gene expression analysis upon phytoplasma infection. Finally, we also report the presence of several ‘knot’-like structures along the roots of infected apple trees and discuss the occurrence of this interesting phenotype in relation to the gene expression results and the modalities of phytoplasma diffusion. PMID:23086810

  18. Promotion of flavonoid biosynthesis in leaves and calli of ornamental crabapple (Malus spp. by high carbon to nitrogen ratios

    Directory of Open Access Journals (Sweden)

    Huihua eWan

    2015-09-01

    Full Text Available Flavonoids are secondary metabolites that play important roles in plant physiology. Despite numerous studies examined the effects of available carbon (C or nitrogen (N on flavonoid biosynthesis, the mechanism of C/N interactive effects on flavonoid metabolism is still unclear. In this study, we analyzed the composition of flavonoids and the expression levels of flavonoid-related genes in leaves and calli of crabapple (Malus spp. cultivars with different leaf colors grown on media with different C/N ratios. Our results show that high C/N ratios induce anthocyanin pigmentation in leaves of the ever-red cultivar ‘Royalty’ and the spring-red cultivar ‘Prairifire’, as well as in three types of calli derived from the ever-green cultivar ‘Spring Snow’, but not in the leaves of the ever-green cultivar ‘Flame’. This phenomenon therefore correlated with anthocyanin content in these different samples. In addition, high C/N ratios in the growth media resulted in an increase in the concentration of flavones and flavonols in the leaves of the three crabapple cultivars. The transcript levels of the general flavonoid pathway genes [from chalcone synthase (CHS to uridine diphosphate (UDP-glucose: flavonoid 3-O-glycosyltransferase (UFGT and flavonol synthase (FLS] increased in response to high C/N ratios, and this in turn was correlated with the concentration of anthocyanin, flavone and flavonol in the leaves and calli. Expression of the late flavonoid/anthocyanin biosynthetic genes, anthocyanidin synthase (ANS, UFGT and FLS in particular, was more strongly influenced by C/N ratios than other structural genes, and the increased expression of the structural genes under high C/N ratios coincided with a coordinated increase in transcript levels of a MYB transcription factor, MYB10. These results are likely to be useful for future generation of plants with an optimized flavonoid/anthocyanin content or desirable organ coloration.

  19. Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family.

    Science.gov (United States)

    Illa, Eudald; Sargent, Daniel J; Lopez Girona, Elena; Bushakra, Jill; Cestaro, Alessandro; Crowhurst, Ross; Pindo, Massimo; Cabrera, Antonio; van der Knaap, Esther; Iezzoni, Amy; Gardiner, Susan; Velasco, Riccardo; Arús, Pere; Chagné, David; Troggio, Michela

    2011-01-12

    Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

  20. Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family

    Directory of Open Access Journals (Sweden)

    Velasco Riccardo

    2011-01-01

    Full Text Available Abstract Background Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. Results We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. Conclusions A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

  1. Stemcell Information: SKIP000859 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available Progenitors Ameliorates Acute Kidney Injury in Mice.--Cell Therapy Using Human Induced Pluripotent Stem Cel...l-Derived Renal Progenitors Ameliorates Acute Kidney Injury in Mice. Okita K, Yamakawa T, Matsumura Y, Sato

  2. Stemcell Information: SKIP000860 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available l Progenitors Ameliorates Acute Kidney Injury in Mice.--Cell Therapy Using Human Induced Pluripotent Stem Ce...ll-Derived Renal Progenitors Ameliorates Acute Kidney Injury in Mice. Okita K, Yamakawa T, Matsumura Y, Sato

  3. Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development.

    Science.gov (United States)

    Schaeffer, Scott M; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie; Dhingra, Amit

    2017-10-01

    Comparative ultrastructural developmental time-course analysis has identified discrete stages at which the fruit plastids undergo structural and consequently functional transitions to facilitate subsequent development-guided understanding of the complex plastid biology. Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids-chromoplasts-are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant 'Granny Smith', carotenoid-predominant 'Golden Delicious', and anthocyanin-predominant 'Top Red Delicious'. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex

  4. Evaluation of SNP Data from the Malus Infinium Array Identifies Challenges for Genetic Analysis of Complex Genomes of Polyploid Origin.

    Directory of Open Access Journals (Sweden)

    Michela Troggio

    Full Text Available High throughput arrays for the simultaneous genotyping of thousands of single-nucleotide polymorphisms (SNPs have made the rapid genetic characterisation of plant genomes and the development of saturated linkage maps a realistic prospect for many plant species of agronomic importance. However, the correct calling of SNP genotypes in divergent polyploid genomes using array technology can be problematic due to paralogy, and to divergence in probe sequences causing changes in probe binding efficiencies. An Illumina Infinium II whole-genome genotyping array was recently developed for the cultivated apple and used to develop a molecular linkage map for an apple rootstock progeny (M432, but a large proportion of segregating SNPs were not mapped in the progeny, due to unexpected genotype clustering patterns. To investigate the causes of this unexpected clustering we performed BLAST analysis of all probe sequences against the 'Golden Delicious' genome sequence and discovered evidence for paralogous annealing sites and probe sequence divergence for a high proportion of probes contained on the array. Following visual re-evaluation of the genotyping data generated for 8,788 SNPs for the M432 progeny using the array, we manually re-scored genotypes at 818 loci and mapped a further 797 markers to the M432 linkage map. The newly mapped markers included the majority of those that could not be mapped previously, as well as loci that were previously scored as monomorphic, but which segregated due to divergence leading to heterozygosity in probe annealing sites. An evaluation of the 8,788 probes in a diverse collection of Malus germplasm showed that more than half the probes returned genotype clustering patterns that were difficult or impossible to interpret reliably, highlighting implications for the use of the array in genome-wide association studies.

  5. Description et modélisation de la croissance et du développement du pommier (Malus x domestica Borkh. I. Structure la plus probable de l'arbre jeune

    Directory of Open Access Journals (Sweden)

    Planchon V.

    2003-01-01

    Full Text Available Description and modelisation of growth and development of appletree (Malus x domestica Borkh.. I. Most probable structure of young tree. Based on the observation of all or, at least, a large number of shoots growing on unpruned apple trees, cv. Cox's Orange Pippin and Jonagold grafted on EM9, an original codification system has been conceived. It allows to locate and identify quickly and unequivocally any shoot or growth. From a comprehensive collection of such codified observations, the most probable structure of young one to five year old trees has been established, with the amount and characters of the different observed shoot types. Both varieties display very similar gross structures, despite minor differences in form, flowering mode and productivity. The development of the trees occurs in two phases. The first one builds up a frame composed by the trunk and several storied sets of branches. Flowering is rather strictly alternate during this phase. The second one consists in the reinforcement of the branches by axillary growth, but even more by sympodial branching due to increasing and repeated terminal flowering. This basic structure provides a reference to appreciate changes in tree development brought about by rootstock, fruit load or training practices.

  6. Development of an attract-and-kill strategy for Drosophila suzukii (Diptera: Drosophilidae): evaluation of attracticidal spheres under laboratory and field conditions

    Science.gov (United States)

    Drosophila suzukii Matsumura (Diptera: Drosophilidae) is an invasive, polyphagous fruit fly that attacks soft-skinned fruits. Originally from Asia, D. suzukii has successfully invaded the United States as well as European and South American countries. Currently, calendar-based insecticide applicat...

  7. Two pests overlap: Drosophila suzukii (Diptera: Drosophilidae) use of fruit exposed to Halyomorpha halys (Hemiptera: Pentatomidae)

    Science.gov (United States)

    Spotted wing drosophila, Drosophila suzukii (Matsumura) (Diptera: Drosophilidae), and brown marmorated stink bug, Halyomorpha halys (Stål) (Hemiptera: Pentatomidae) are global economic pests. Both pests may co-occur on small fruits, and we investigated whether fruit recently exposed to H. halys woul...

  8. Behavioral responses of Drosophila suzukii (Diptera: Drosophilidae) to visual stimuli under laboratory, semifield, and field conditions

    Science.gov (United States)

    Drosophila suzukii (Matsumura) (Diptera: Drosophilidae) is an invasive pest in the United States that attacks soft-skinned ripening fruit such as raspberries, blackberries, and blueberries. Little is known regarding specific cues D. suzukii utilizes to locate and select host fruit, and inconsistenc...

  9. Advanced Processing and Characterization Technologies. Fabrication and Characterization of Semiconductor Optoelectronic Devices and Integrated Circuits Held in Clearwater, Florida on 8-10 May 1991. American Vacuum Society Series 10

    Science.gov (United States)

    1992-07-01

    ichi Gonda, Osaka University, Co-Chair Yasuhiko Arakawa, University of Tokyo Hiroyoshi Matsumura, Hitachi Alan Miller, University of Central Florida...M.H.Meynadier, et al. Phys. Rev. Lett. 29(12), (1984), 7042. 84 Mesoscopic Size Fabrication Technology Yasuhiko Arakawa Research Center for Advanced

  10. Transformation of apple (Malus × domestica) using mutants of apple acetolactate synthase as a selectable marker and analysis of the T-DNA integration sites.

    Science.gov (United States)

    Yao, Jia-Long; Tomes, Sumathi; Gleave, Andrew P

    2013-05-01

    Apple acetolactate synthase mutants were generated by site-specific mutagenesis and successfully used as selection marker in tobacco and apple transformation. T-DNA/Apple genome junctions were analysed using genome-walking PCR and sequencing. An Agrobacterium-mediated genetic transformation system was developed for apple (Malus × domestica), using mutants of apple acetolactate synthase (ALS) as a selectable marker. Four apple ALS mutants were generated by site-specific mutagenesis and subsequently cloned under the transcriptional control of the CaMV 35S promoter and ocs 3' terminator, in a pART27-derived plant transformation vector. Three of the four mutations were found to confer resistance to the herbicide Glean(®), containing the active agent chlorsulfuron, in tobacco (Nicotiana tabacum) transformation. In apple transformation, leaf explants infected with Agrobacterium tumefaciens EHA105 containing one of the three ALS mutants resulted in the production of shoots on medium containing 2-8 μg L(-1) Glean(®), whilst uninfected wild-type explants failed to regenerate shoots or survive on medium containing 1 and 3 μg L(-1) Glean(®), respectively. Glean(®)-resistant, regenerated shoots were further multiplied and rooted on medium containing 10 μg L(-1) Glean(®). The T-DNA and apple genome-DNA junctions from eight rooted transgenic apple plants were analysed using genome-walking PCR amplification and sequencing. This analysis confirmed T-DNA integration into the apple genome, identified the genome integration sites and revealed the extent of any vector backbone integration, T-DNA rearrangements and deletions of apple genome DNA at the sites of integration.

  11. Variable isotopic compositions of host plant populations preclude assessment of aphid overwintering sites

    Science.gov (United States)

    Soybean aphid (Aphis glycines Matsumura) is a pest of soybean in the northern Midwest whose migratory patterns have been difficult to quantify. Improved knowledge of soybean aphid overwintering sites could facilitate the development of control efforts with exponential impacts on aphid densities on a...

  12. Susceptibility of Bunch Grape and Muscadine Cultivars to Berry Splitting and Spotted-Wing Drosophila Oviposition

    Science.gov (United States)

    One of the main disorders that widely reduces fruit quality and commercial value is fruit splitting. Fruit splitting is a physiological disorder that produces surface cracks that promotes disease and insect damage. Moreover, the spotted wing Drosophila (SWD), Drosophila suzukii (Matsumura), is a spe...

  13. Recent advances in the cryopreservation of shoot-derived germplasm of economically important fruit trees of Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis.

    Science.gov (United States)

    Benelli, Carla; De Carlo, Anna; Engelmann, Florent

    2013-01-01

    This paper presents the advances made over the last decade in cryopreservation of economically important vegetatively propagated fruit trees. Cryopreservation protocols have been established using both dormant buds sampled on field-grown plants and shoot tips sampled on in vitro plantlets. In the case of dormant buds, scions are partially dehydrated by storage at -5 °C, and then cooled slowly to -30 °C using low cooling rates (c.a. 1 °C/h) before immersion in liquid nitrogen. After slow rewarming and rehydration of samples, regrowth takes place either through grafting of buds on rootstocks or excision of apices and inoculation in vitro. In the case of shoot tips of in vitro plantlets, the cryopreservation techniques employed are the following: controlled rate cooling procedures involving slow prefreezing followed by immersion in liquid nitrogen or vitrification-based procedures including encapsulation-dehydration, vitrification, encapsulation-vitrification and droplet-vitrification. The current status of cryopreservation for a series of fruit tree species including Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis is presented. Routine application of cryopreservation for long-term germplasm storage in genebanks is currently limited to apple and pear, for which large cryopreserved collections have been established at NCGRP, Fort Collins (USA), using dormant buds and in vitro shoot tips, respectively. However, there are a growing number of examples of pilot scale testing experiments under way for different species in various countries. Progress in the further development and application of cryopreservation techniques will be made through a better understanding of the mechanisms involved in the induction of tolerance to dehydration and cryopreservation in frozen explants. Copyright © 2012 Elsevier Inc. All rights reserved.

  14. Asymmetric Information, Self-selection, and Pricing of Insurance Contracts

    DEFF Research Database (Denmark)

    Donnelly, Catherine; Englund, Martin Kristian; Nielsen, Jens Perch

    2014-01-01

    This article presents an optional bonus-malus contract based on a priori risk classification of the underlying insurance contract. By inducing self-selection, the purchase of the bonus-malus contract can be used as a screening device. This gives an even better pricing performance than both...... an experience rating scheme and a classical no-claims bonus system. An application to the Danish automobile insurance market is considered....

  15. 454-Pyrosequencing survey of microbiota in adult Spotted Wing Drosophila (SWD) corroborates a core microbiome and additional symbiotic and entomopathogenic bacterial associates

    Science.gov (United States)

    Complete surveys of insect endosymbionts including species of economic importance have until recently been hampered by a lack of high-throughput genetic assays. We used 454-pyrosequencing of the 16S rRNA gene amplicon of adult spotted wing Drosophila (SWD) Drosophila suzukii (Matsumura) from souther...

  16. Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

    Science.gov (United States)

    Wei, Menghan; Wang, Sanhong; Dong, Hui; Cai, Binhua; Tao, Jianmin

    2016-01-01

    As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and strawberry (Fragaria vesca) in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD) or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA]), while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA). Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR). Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

  17. Freezing pattern and frost killing temperature of apple (Malus domestica) wood under controlled conditions and in nature.

    Science.gov (United States)

    Pramsohler, Manuel; Hacker, Jürgen; Neuner, Gilbert

    2012-07-01

    The freezing pattern and frost killing temperatures of apple (Malus domestica Borkh.) xylem were determined by differential thermal analysis and infrared differential thermal analysis (IDTA). Results from detached or attached twigs in controlled freezing experiments and during natural field freezing of trees were compared. Non-lethal freezing of apoplastic water in apple xylem as monitored during natural winter frosts in the field occurred at -1.9 ± 0.4 °C and did not change seasonally. The pattern of whole tree freezing was variable and specific to the environmental conditions. On detached twigs high-temperature freezing exotherms (HTEs) occurred 2.8 K below the temperature observed under natural frosts in the field with a seasonal mean of -4.7 ± 0.5 °C. Microporous apple xylem showed freezing without a specific pattern within a few seconds in IDTA images during HTEs, which is in contrast to macroporous xylem where a 2D freezing pattern mirrors anatomical structures. The pith tissue always remained unfrozen. Increasing twig length increased ice nucleation temperature; for increased twig diameter the effect was not significant. In attached twigs frozen in field portable freezing chambers, HTEs were recorded at a similar mean temperature (-4.6 ± 1.0 °C) to those for detached twigs. Upon lethal intracellular freezing of apple xylem parenchyma cells (XPCs) low-temperature freezing exotherms (LTEs) can be recorded. Low-temperature freezing exotherms determined on detached twigs varied significantly between a winter minimum of -36.9 °C and a summer maximum -12.7 °C. Within the temperature range wherein LTEs were recorded by IDTA in summer (-12.7 ± 0.5 to -20.3 ± 1.1 °C) various tiny clearly separated discontinuous freezing events could be detected similar to that in other species with contrasting XPC anatomy. These freezing events appeared to be initially located in the primary and only later in the secondary xylem. During the LTE no

  18. Erythritol and Lufenuron detrimentally alter age structure of Wild Spotted Wing Drosophila (SWD) Drosophila suzukii (Diptera: Drosophilidae) populations in blueberry and blackberry

    Science.gov (United States)

    We report on the efficacy of 0.5 M (61,000 ppm) Erythritol (E) in Truvia Baking Blend®, 10 ppm Lufenuron (L), and their combination (LE) to reduce egg and larval densities of wild populations of spotted wing Drosophila, Drosophila suzukii (Matsumura) (SWD) infesting fields of rabbiteye blueberries (...

  19. Taxonomy of the Oriental leafhopper genus Favintiga Webb (Hemiptera: Cicadellidae: Deltocephalinae: Drabescini) with description of a new species from China.

    Science.gov (United States)

    Lu, Lin; Zhang, Yalin

    2018-01-12

    The Oriental leafhopper genus Favintiga Webb is reviewed. A checklist to the species is provided together with a key for their separation. The genus contains three species: F. camphorae (Matsumura), F. gracilipenis Shang Zhang and F. paragracilipenis sp. nov., the latter described here from the Jianfengling Mountains, Hainan, China.

  20. First foreign exploration for asian parasitoids of Drosophila suzukii

    Science.gov (United States)

    The invasive spotted wing drosophila, Drosophila suzukii Matsumura (Dipt.: Drosophilidae), is a native of East Asia and is now widely established in North America and Europe, where it is a serious pest of small and stone fruit crops. The lack of effective indigenous parasitoids of D. suzukii in the ...

  1. Effect of chemical ratios of a microbial-based feeding attractant on trap catch of spotted wing drosophila (Diptera: Drosophilidae)

    Science.gov (United States)

    Drosophila suzukii Matsumura (SWD) can be trapped with a feeding attractant based on wine and vinegar volatiles and consisting of acetic acid, ethanol, acetoin and methionol. Using that 4-component blend, we found that the catch of SWD increased with increases in the release rate of acetoin (from 0...

  2. Genetic evaluation of seed traits from intraspecific crossing of ...

    African Journals Online (AJOL)

    Citrullus lanatus (Thunb.) Matsumura and Nakai (Cucurbitaceae) is an important cucurbit crop worldwide. Global production of watermelon is about 90 million metric tonnes per annum, making it among the top five most consumed fresh fruits. The objective of this study was to evaluate seed variability in different segregating ...

  3. Teachers' Emotional Expression in Interaction with Students of Different Ages

    Science.gov (United States)

    Prosen, Simona; Vitulic, Helena Smrtnik; Škraban, Olga Poljšak

    2011-01-01

    Emotions are an integral part of "classroom life" and are experienced in teacher-student interactions quite often (Hosotani & Imai-Matsumura, 2011). The present study focuses on teachers' emotions in classrooms. Its purpose is to establish which emotions are expressed by teachers in their interactions with students, the triggering…

  4. Wild European apple (Malus sylvestris (L.) Mill.) population dynamics: insight from genetics and ecology in the Rhine Valley. Priorities for a future conservation programme.

    Science.gov (United States)

    Schnitzler, Annik; Arnold, Claire; Cornille, Amandine; Bachmann, Olivier; Schnitzler, Christophe

    2014-01-01

    The increasing fragmentation of forest habitats and the omnipresence of cultivars potentially threaten the genetic integrity of the European wild apple (Malus sylvestris (L.) Mill). However, the conservation status of this species remains unclear in Europe, other than in Belgium and the Czech Republic, where it has been declared an endangered species. The population density of M. sylvestris is higher in the forests of the upper Rhine Valley (France) than in most European forests, with an unbalanced age-structure, an overrepresentation of adults and a tendency to clump. We characterize here the ecology, age-structure and genetic diversity of wild apple populations in the Rhine Valley. We use these data to highlight links to the history of this species and to propose guidelines for future conservation strategies. In total, 255 individual wild apple trees from six forest stands (five floodplain forests and one forest growing in drier conditions) were analysed in the field, collected and genotyped on the basis of data for 15 microsatellite markers. Genetic analyses showed no escaped cultivars and few hybrids with the cultivated apple. Excluding the hybrids, the genetically "pure" populations displayed high levels of genetic diversity and a weak population structure. Age-structure and ecology studies of wild apple populations identified four categories that were not randomly distributed across the forests, reflecting the history of the Rhine forest over the last century. The Rhine wild apple populations, with their ecological strategies, high genetic diversity, and weak traces of crop-to-wild gene flow associated with the history of these floodplain forests, constitute candidate populations for inclusion in future conservation programmes for European wild apple.

  5. Wild European Apple (Malus sylvestris (L.) Mill.) Population Dynamics: Insight from Genetics and Ecology in the Rhine Valley. Priorities for a Future Conservation Programme

    Science.gov (United States)

    Schnitzler, Annik; Arnold, Claire; Cornille, Amandine; Bachmann, Olivier; Schnitzler, Christophe

    2014-01-01

    The increasing fragmentation of forest habitats and the omnipresence of cultivars potentially threaten the genetic integrity of the European wild apple (Malus sylvestris (L.) Mill). However, the conservation status of this species remains unclear in Europe, other than in Belgium and the Czech Republic, where it has been declared an endangered species. The population density of M. sylvestris is higher in the forests of the upper Rhine Valley (France) than in most European forests, with an unbalanced age-structure, an overrepresentation of adults and a tendency to clump. We characterize here the ecology, age-structure and genetic diversity of wild apple populations in the Rhine Valley. We use these data to highlight links to the history of this species and to propose guidelines for future conservation strategies. In total, 255 individual wild apple trees from six forest stands (five floodplain forests and one forest growing in drier conditions) were analysed in the field, collected and genotyped on the basis of data for 15 microsatellite markers. Genetic analyses showed no escaped cultivars and few hybrids with the cultivated apple. Excluding the hybrids, the genetically “pure” populations displayed high levels of genetic diversity and a weak population structure. Age-structure and ecology studies of wild apple populations identified four categories that were not randomly distributed across the forests, reflecting the history of the Rhine forest over the last century. The Rhine wild apple populations, with their ecological strategies, high genetic diversity, and weak traces of crop-to-wild gene flow associated with the history of these floodplain forests, constitute candidate populations for inclusion in future conservation programmes for European wild apple. PMID:24827575

  6. Mapping in an apple (Malus x domestica) F1 segregating population based on physical clustering of differentially expressed genes.

    Science.gov (United States)

    Jensen, Philip J; Fazio, Gennaro; Altman, Naomi; Praul, Craig; McNellis, Timothy W

    2014-04-04

    Apple tree breeding is slow and difficult due to long generation times, self-incompatibility, and complex genetics. The identification of molecular markers linked to traits of interest is a way to expedite the breeding process. In the present study, we aimed to identify genes whose steady-state transcript abundance was associated with inheritance of specific traits segregating in an apple (Malus × domestica) rootstock F1 breeding population, including resistance to powdery mildew (Podosphaera leucotricha) disease and woolly apple aphid (Eriosoma lanigerum). Transcription profiling was performed for 48 individual F1 apple trees from a cross of two highly heterozygous parents, using RNA isolated from healthy, actively-growing shoot tips and a custom apple DNA oligonucleotide microarray representing 26,000 unique transcripts. Genome-wide expression profiles were not clear indicators of powdery mildew or woolly apple aphid resistance phenotype. However, standard differential gene expression analysis between phenotypic groups of trees revealed relatively small sets of genes with trait-associated expression levels. For example, thirty genes were identified that were differentially expressed between trees resistant and susceptible to powdery mildew. Interestingly, the genes encoding twenty-four of these transcripts were physically clustered on chromosome 12. Similarly, seven genes were identified that were differentially expressed between trees resistant and susceptible to woolly apple aphid, and the genes encoding five of these transcripts were also clustered, this time on chromosome 17. In each case, the gene clusters were in the vicinity of previously identified major quantitative trait loci for the corresponding trait. Similar results were obtained for a series of molecular traits. Several of the differentially expressed genes were used to develop DNA polymorphism markers linked to powdery mildew disease and woolly apple aphid resistance. Gene expression profiling

  7. Development and validation of a 20K single nucleotide polymorphism (SNP) whole genome genotyping array for apple (Malus × domestica Borkh).

    Science.gov (United States)

    Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

    2014-01-01

    High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

  8. Development and validation of a 20K single nucleotide polymorphism (SNP whole genome genotyping array for apple (Malus × domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Luca Bianco

    Full Text Available High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus. A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs. Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

  9. Development and Validation of a 20K Single Nucleotide Polymorphism (SNP) Whole Genome Genotyping Array for Apple (Malus × domestica Borkh)

    Science.gov (United States)

    Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

    2014-01-01

    High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs. PMID:25303088

  10. Cold hardiness of winter-acclimated Drosophila suzukii (Diptera: Drosophilidae) adults

    Science.gov (United States)

    A.R. Stephens; M.K. Asplen; W.D. Hutchison; Robert C. Venette

    2015-01-01

    Drosophila suzukii Matsumura, often called spotted wing drosophila, is an exotic vinegar fly that is native to Southeast Asia and was first detected in the continental United States in 2008. Previous modeling studies have suggested that D. suzukii might not survive in portions of the northern United States or southern Canada...

  11. Protein (Viridiplantae): 130362 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Malus domestica MEDKLSIVAKSIAPSPIQELSHLARRCNAINLAEGFPDFPAPSHIKHAAISAIHSDFNQYRHVQGICDHLANIMKQMHGLDVNPLTDMA...ICCGQSEALAAAAFAIIDKGDEVILFDPCYETYEGCIKMAGGVSVYVPLDPPHWTLDPNRFINAFNERTKALVLNSPHNPTGK

  12. Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

    Directory of Open Access Journals (Sweden)

    Menghan Wei

    Full Text Available As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica, pear (Pyrus communis, peach (Prunus persica, plum (Prunus mume and strawberry (Fragaria vesca in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA], while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA. Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR. Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

  13. High miR156 Expression Is Required for Auxin-Induced Adventitious Root Formation via MxSPL26 Independent of PINs and ARFs in Malus xiaojinensis

    Directory of Open Access Journals (Sweden)

    Xiaozhao Xu

    2017-06-01

    Full Text Available Adventitious root formation is essential for the vegetative propagation of perennial woody plants. During the juvenile-to-adult phase change mediated by the microRNA156 (miR156, the adventitious rooting ability decreases dramatically in many species, including apple rootstocks. However, the mechanism underlying how miR156 affects adventitious root formation is unclear. In the present study, we showed that in the presence of the synthetic auxin indole-3-butyric acid (IBA, semi-lignified leafy cuttings from juvenile phase (Mx-J and rejuvenated (Mx-R Malus xiaojinensis trees exhibited significantly higher expression of miR156, PIN-FORMED1 (PIN1, PIN10, and rootless concerning crown and seminal roots-like (RTCS-like genes, thus resulting in higher adventitious rooting ability than those from adult phase (Mx-A trees. However, the expression of SQUAMOSA-PROMOTER BINDING PROTEIN-LIKE26 (SPL26 and some auxin response factor (ARF gene family members were substantially higher in Mx-A than in Mx-R cuttings. The expression of NbRTCS-like but not NbPINs and NbARFs varied with miR156 expression in tobacco (Nicotiana benthamiana plants transformed with 35S:MdMIR156a6 or 35S:MIM156 constructs. Overexpressing the miR156-resistant MxrSPL genes in tobacco confirmed the involvement of MxSPL20, MxSPL21&22, and MxSPL26 in adventitious root formation. Together, high expression of miR156 was necessary for auxin-induced adventitious root formation via MxSPL26, but independent of MxPINs and MxARFs expression in M. xiaojinensis leafy cuttings.

  14. The Poincaré series of a local Gorenstein ring of multiplicity up to 10 ...

    Indian Academy of Sciences (India)

    As a by-product we prove the rationality of PR for all local, Gorenstein rings of multiplicity at most ..... Due to the choice of α4,...,αn we have. ∑n i=4 αiβi,j ∈ M. Thus aaj ..... [Ma] Matsumura H, Commutative ring theory (Univ. Press: Cambridge) ...

  15. Techniques for cold hardiness research for apple rootstocks

    OpenAIRE

    Privé, Jean-Pierre

    2006-01-01

    Three reliable methods are explained for estimating different types of cold hardiness in Malus. They include: 1) a whole plant controlled freezing experiment for the assessment of low mid-winter injury, 2) electrical impedance spectroscopy (Z), for the estimation of multiple freeze-thaw cycling injury and 3) a controlled freezing protocol to facilitate the rapid screening of large populations of Malus seedlings. The aim of this manuscript is not the results of these three methods but rather t...

  16. Effects of location within the tree canopy on carbohydrates, organic acids, amino acids and phenolic compounds in the fruit peel and flesh from three apple (Malus × domestica) cultivars

    Science.gov (United States)

    Feng, Fengjuan; Li, Mingjun; Ma, Fengwang; Cheng, Lailiang

    2014-01-01

    Fruits from three cultivars of apple (Malus × domestica Borkh.)—‘McIntosh’, ‘Gala’ and ‘Mutsu’—were harvested from the exterior and interior of the tree canopy. Peel and flesh tissues were sampled separately to determine how the position of the fruit on the tree might affect the levels of the primary and secondary metabolites in the fruit. Fruit from the outer-canopy had a higher fresh weight and a higher soluble solids content compared with inner-canopy fruit. Both the flesh and peel of the outer-canopy fruit had higher concentrations of soluble sugars and sugar alcohols, but lower starch concentrations than the inner-canopy fruit. Canopy position did not significantly affect malic acid concentrations, except in the peel of ‘McIntosh’ and the flesh of ‘Mutsu’. Although levels of ascorbic and succinic acids were higher in the peel of the outer-canopy fruit, the responses of other organic acids to canopy position depended on tissue type and cultivar. Except for histidine, lysine, threonine and glycine, most amino acids accumulated at higher concentrations in the inner-canopy fruit. By contrast, levels of phenolic compounds from both the peel and flesh were significantly higher in the outer-canopy fruit. The significant effects of location within the canopy on both primary metabolites and secondary metabolites demonstrate the importance of light exposure on apple fruit quality. PMID:26504536

  17. Integrating Operational Energy Implications into System-Level Combat Effects Modeling: Assessing the Combat Effectiveness and Fuel Use of ABCT 2020 and Current ABCT

    Science.gov (United States)

    2015-01-01

    Endy M. Daehner, John Matsumura, Thomas J. Herbert , Jeremy R. Kurz, Keith Walters Integrating Operational Energy Implications into System-Level... George Guthridge, and Megan Corso for their clear guid- ance and assistance throughout the study. We also received valuable information and insights from...helped with processing modeling and simulation outputs. Laura Novacic and Donna Mead provided invaluable administrative assistance and help with

  18. Complete Genome Sequence of the Largest Known Flavi-Like Virus, Diaphorina citri flavi-like virus, a Novel Virus of the Asian Citrus Psyllid, Diaphorina citri.

    Science.gov (United States)

    Matsumura, Emilyn E; Nerva, Luca; Nigg, Jared C; Falk, Bryce W; Nouri, Shahideh

    2016-09-08

    A novel flavi-like virus tentatively named Diaphorina citri flavi-like virus (DcFLV) was identified in field populations of Diaphorina citri through small RNA and transcriptome sequencing followed by reverse transcription (RT)-PCR. We report here the complete nucleotide sequence and genome organization of DcFLV, the largest flavi-like virus identified to date. Copyright © 2016 Matsumura et al.

  19. Virus-induced gene silencing of the two squalene synthase isoforms of apple tree (Malus × domestica L.) negatively impacts phytosterol biosynthesis, plastid pigmentation and leaf growth.

    Science.gov (United States)

    Navarro Gallón, Sandra M; Elejalde-Palmett, Carolina; Daudu, Dimitri; Liesecke, Franziska; Jullien, Frédéric; Papon, Nicolas; Dugé de Bernonville, Thomas; Courdavault, Vincent; Lanoue, Arnaud; Oudin, Audrey; Glévarec, Gaëlle; Pichon, Olivier; Clastre, Marc; St-Pierre, Benoit; Atehortùa, Lucia; Yoshikawa, Nobuyuki; Giglioli-Guivarc'h, Nathalie; Besseau, Sébastien

    2017-07-01

    The use of a VIGS approach to silence the newly characterized apple tree SQS isoforms points out the biological function of phytosterols in plastid pigmentation and leaf development. Triterpenoids are beneficial health compounds highly accumulated in apple; however, their metabolic regulation is poorly understood. Squalene synthase (SQS) is a key branch point enzyme involved in both phytosterol and triterpene biosynthesis. In this study, two SQS isoforms were identified in apple tree genome. Both isoforms are located at the endoplasmic reticulum surface and were demonstrated to be functional SQS enzymes using an in vitro activity assay. MdSQS1 and MdSQS2 display specificities in their expression profiles with respect to plant organs and environmental constraints. This indicates a possible preferential involvement of each isoform in phytosterol and/or triterpene metabolic pathways as further argued using RNAseq meta-transcriptomic analyses. Finally, a virus-induced gene silencing (VIGS) approach was used to silence MdSQS1 and MdSQS2. The concomitant down-regulation of both MdSQS isoforms strongly affected phytosterol synthesis without alteration in triterpene accumulation, since triterpene-specific oxidosqualene synthases were found to be up-regulated to compensate metabolic flux reduction. Phytosterol deficiencies in silenced plants clearly disturbed chloroplast pigmentation and led to abnormal development impacting leaf division rather than elongation or differentiation. In conclusion, beyond the characterization of two SQS isoforms in apple tree, this work brings clues for a specific involvement of each isoform in phytosterol and triterpene pathways and emphasizes the biological function of phytosterols in development and chloroplast integrity. Our report also opens the door to metabolism studies in Malus domestica using the apple latent spherical virus-based VIGS method.

  20. Transcriptome analysis of an apple (Malus × domestica) yellow fruit somatic mutation identifies a gene network module highly associated with anthocyanin and epigenetic regulation.

    Science.gov (United States)

    El-Sharkawy, Islam; Liang, Dong; Xu, Kenong

    2015-12-01

    Using RNA-seq, this study analysed an apple (Malus×domestica) anthocyanin-deficient yellow-skin somatic mutant 'Blondee' (BLO) and its red-skin parent 'Kidd's D-8' (KID), the original name of 'Gala', to understand the molecular mechanisms underlying the mutation. A total of 3299 differentially expressed genes (DEGs) were identified between BLO and KID at four developmental stages and/or between two adjacent stages within BLO and/or KID. A weighted gene co-expression network analysis (WGCNA) of the DEGs uncovered a network module of 34 genes highly correlated (r=0.95, P=9.0×10(-13)) with anthocyanin contents. Although 12 of the 34 genes in the WGCNA module were characterized and known of roles in anthocyanin, the remainder 22 appear to be novel. Examining the expression of ten representative genes in the module in 14 diverse apples revealed that at least eight were significantly correlated with anthocyanin variation. MdMYB10 (MDP0000259614) and MdGST (MDP0000252292) were among the most suppressed module member genes in BLO despite being undistinguishable in their corresponding sequences between BLO and KID. Methylation assay of MdMYB10 and MdGST in fruit skin revealed that two regions (MR3 and MR7) in the MdMYB10 promoter exhibited remarkable differences between BLO and KID. In particular, methylation was high and progressively increased alongside fruit development in BLO while was correspondingly low and constant in KID. The methylation levels in both MR3 and MR7 were negatively correlated with anthocyanin content as well as the expression of MdMYB10 and MdGST. Clearly, the collective repression of the 34 genes explains the loss-of-colour in BLO while the methylation in MdMYB10 promoter is likely causal for the mutation. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  1. Genotyping-by-sequencing markers facilitate the identification of quantitative trait loci controlling resistance to Penicillium expansum in Malus sieversii.

    Directory of Open Access Journals (Sweden)

    John L Norelli

    Full Text Available Blue mold caused by Penicillium expansum is the most important postharvest disease of apple worldwide and results in significant financial losses. There are no defined sources of resistance to blue mold in domesticated apple. However, resistance has been described in wild Malus sieversii accessions, including plant introduction (PI613981. The objective of the present study was to identify the genetic loci controlling resistance to blue mold in this accession. We describe the first quantitative trait loci (QTL reported in the Rosaceae tribe Maleae conditioning resistance to P. expansum on genetic linkage group 3 (qM-Pe3.1 and linkage group 10 (qM-Pe10.1. These loci were identified in a M.× domestica 'Royal Gala' X M. sieversii PI613981 family (GMAL4593 based on blue mold lesion diameter seven days post-inoculation in mature, wounded apple fruit inoculated with P. expansum. Phenotypic analyses were conducted in 169 progeny over a four year period. PI613981 was the source of the resistance allele for qM-Pe3.1, a QTL with a major effect on blue mold resistance, accounting for 27.5% of the experimental variability. The QTL mapped from 67.3 to 74 cM on linkage group 3 of the GMAL4593 genetic linkage map. qM-Pe10.1 mapped from 73.6 to 81.8 cM on linkage group 10. It had less of an effect on resistance, accounting for 14% of the experimental variation. 'Royal Gala' was the primary contributor to the resistance effect of this QTL. However, resistance-associated alleles in both parents appeared to contribute to the least square mean blue mold lesion diameter in an additive manner at qM-Pe10.1. A GMAL4593 genetic linkage map composed of simple sequence repeats and 'Golden Delicious' single nucleotide polymorphism markers was able to detect qM-Pe10.1, but failed to detect qM-Pe3.1. The subsequent addition of genotyping-by-sequencing markers to the linkage map provided better coverage of the PI613981 genome on linkage group 3 and facilitated discovery of q

  2. evaluation of the antioxidant capacity of quercetin derived of natural extract from red onion ocañera (allilium strain l and red apple (pyrus malus l var. red delicius in palm oil refined industrial type continuous warm conditions

    Directory of Open Access Journals (Sweden)

    Golda Meyer Torres

    2010-05-01

    Full Text Available The research was based on the assessment of the quercetin antioxidant capacity existing in red apple (Pyrus malus L var. red delicious and ocañera red onion (Allilium cepa L. Then, antioxidant concentration was calculated by a standard curve of commercial quercetin (HPLC concentration ≥98% using spectrophotometry at 415 nm and dropped concentrations of 0.0955 mg/g in onion extract and 0.0144mg/g in apple extract. The antioxidant capacity of each extract was evaluated over industrial samples of industrial RDB (Refined, bleached and deodorized palm oil without antioxidant in order to observe the effect they had over peroxide creation. Actually, samples were treated in continuous heating for two, four and six hours and recording variables performance like acidity, iodine and peroxide index. Also, a sample of oil without antioxidant was evaluated adding pure commercial quercetin at 0.18 mg/g and a control sample of RBD palm oil added with commercial antioxidant (TBHQ, BHT. Finally, the outcome got by ANOVA analysis (Pvalue= 0.028, significance level of 5% on peroxide index formation calculated in mequivO2/kg highlighted the time of exposition than quercetin concentration in 0.0144 mg/g, hence a result alike the sample of oil added with commercial antioxidant.

  3. Comparative Toxicity of Selected Aviation Fuels as Measured by Insect Bioassay

    Science.gov (United States)

    1982-07-01

    Phillips and Stewart, 1974a, b; Atlas and Bartha , 1973; Zobell, 1969). General conclusions from these studies indicate that microorganisms contribute...R. BARTHA . 1973. Fate and effects of polluting petroleum in the marine environment. Residue Rev. 49:40-85. ATLAS , R. M., SCHOFIELD, E. A., MORELLI, F...BATTERTON. 1972. Ecological aspects of pesticide- microbial relationships. In: Environmental Toxicology of Pesticides. Matsumura, F., Boush, G. M., and T

  4. Putative resistance gene markers associated with quantitative trait loci for fire blight resistance in Malus ‘Robusta 5’ accessions

    Science.gov (United States)

    2012-01-01

    Background Breeding of fire blight resistant scions and rootstocks is a goal of several international apple breeding programs, as options are limited for management of this destructive disease caused by the bacterial pathogen Erwinia amylovora. A broad, large-effect quantitative trait locus (QTL) for fire blight resistance has been reported on linkage group 3 of Malus ‘Robusta 5’. In this study we identified markers derived from putative fire blight resistance genes associated with the QTL by integrating further genetic mapping studies with bioinformatics analysis of transcript profiling data and genome sequence databases. Results When several defined E.amylovora strains were used to inoculate three progenies from international breeding programs, all with ‘Robusta 5’ as a common parent, two distinct QTLs were detected on linkage group 3, where only one had previously been mapped. In the New Zealand ‘Malling 9’ X ‘Robusta 5’ population inoculated with E. amylovora ICMP11176, the proximal QTL co-located with SNP markers derived from a leucine-rich repeat, receptor-like protein ( MxdRLP1) and a closely linked class 3 peroxidase gene. While the QTL detected in the German ‘Idared’ X ‘Robusta 5’ population inoculated with E. amylovora strains Ea222_JKI or ICMP11176 was approximately 6 cM distal to this, directly below a SNP marker derived from a heat shock 90 family protein gene ( HSP90). In the US ‘Otawa3’ X ‘Robusta5’ population inoculated with E. amylovora strains Ea273 or E2002a, the position of the LOD score peak on linkage group 3 was dependent upon the pathogen strains used for inoculation. One of the five MxdRLP1 alleles identified in fire blight resistant and susceptible cultivars was genetically associated with resistance and used to develop a high resolution melting PCR marker. A resistance QTL detected on linkage group 7 of the US population co-located with another HSP90 gene-family member and a WRKY transcription factor

  5. The development and mapping of functional markers in Fragaria and their transferability and potential for mapping in other genera.

    Science.gov (United States)

    Sargent, D J; Rys, A; Nier, S; Simpson, D W; Tobutt, K R

    2007-01-01

    We have developed 46 primer pairs from exon sequences flanking polymorphic introns of 23 Fragaria gene sequences and one Malus sequence deposited in the EMBL database. Sequencing of a set of the PCR products amplified with the novel primer pairs in diploid Fragaria showed the products to be homologous to the sequences from which the primers were originally designed. By scoring the segregation of the 24 genes in two diploid Fragaria progenies FV x FN (F. vesca x F. nubicola F(2)) and 815 x 903BC (F. vesca x F. viridis BC(1)) 29 genetic loci at discrete positions on the seven linkage groups previously characterised could be mapped, bringing to 35 the total number of known function genes mapped in Fragaria. Twenty primer pairs, representing 14 genes, amplified a product of the expected size in both Malus and Prunus. To demonstrate the applicability of these gene-specific loci to comparative mapping in Rosaceae, five markers that displayed clear polymorphism between the parents of a Malus and a Prunus mapping population were selected. The markers were then scored and mapped in at least one of the two additional progenies.

  6. Functionalization of Semiconductor Nanomaterials for Optoelectronic Devices And Components

    Science.gov (United States)

    2015-03-04

    pristine single and multiwalled carbon nanotubes as different stacking layers in bulk heterojunction solar cells,” M. Alam Khan, Michio Matsumura and M. O...Phys. Lett. 102, 051904 (2013). http://dx.doi.org/10.1063/1.4789908 13. “Synthesis of iron pyrite nanocrystals utilizing trioctylphosphine oxide ...O. Manasreh, IEEE Electron Device Letters (Submitted). 20. “Characteristics of p-ZnO/n-GaN heterojunction photodetector,” Abla Al-Zouhbi, N. S

  7. Protein (Viridiplantae): 175805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 745:703 ... 171637:1864 ... 721813:1696 ... 3749:1696 ... 3750:1696 ... PREDICTED: cytochrome P450 87A3-like Malus domest...ica MWSLVGLSFLVSLVVIFITPWIXKWRYPKCNGALPPGSMGLPFIGETLSLIIPSYSHDLLPFIKKRVRRYGPIFRTS

  8. Protein (Viridiplantae): 175804 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 745:703 ... 171637:1864 ... 721813:1696 ... 3749:1696 ... 3750:1696 ... PREDICTED: cytochrome P450 87A3-like Malus domest...ica MWSLVGLSFLVSLVVIFITPWIXKWRYPKCNGALPPGSMGLPFIGETLSLIIPSYSHDLLPFIKKRVRRYGPIFRTS

  9. The diversity of polyprenol pattern in leaves of fruit trees belonging to Rosaceae and Cornaceae.

    Science.gov (United States)

    Wanke, M; Chojnacki, T; Swiezewska, E

    1998-01-01

    The polyprenol pattern in leaves of fruit trees belonging to the Rosaceae (genera: Prunus, Malus) and Cornaceae (genus: Cornus) families is presented. The content of polyprenyl acetates varied within plant species between 10-50 mg per gram of dry weight. In genus Prunus, Cornus and in representatives of species Malus domestica, a mixture of polyprenols composed of 18, 19, 20, 21 isoprene units was found. In six species of genus Prunus (sour-cherry): P. serrulata-spontanea, P. yedoensis, P. fruticosa. P. kurilensis, P. subhirtella and P. incisa the presence of a second polyprenol family, i.e. the group of prenologues consisting of prenol -35, -36, -37, etc. up to -42 was detected.

  10. Identification of host fruit volatiles from domestic apple (Malus domestica), native black hawthorn (Crataegus douglasii) and introduced ornamental hawthorn (C. monogyna) attractive to Rhagoletis pomonella flies from the western United States.

    Science.gov (United States)

    Cha, Dong H; Yee, Wee L; Goughnour, Robert B; Sim, Sheina B; Powell, Thomas H Q; Feder, Jeffrey L; Linn, Charles E

    2012-03-01

    The apple maggot fly, Rhagoletis pomonella, infests apple (Malus domestica) and hawthorn species (most notably the downy hawthorn, Crataegus mollis) in the eastern USA. Evidence suggests that the fly was introduced into the western USA sometime in the last 60 years. In addition to apple, R. pomonella also infests two species of hawthorns in the western USA as major hosts: the native black hawthorn (C. douglasii) and the introduced ornamental English hawthorn, C. monogyna. Apple and downy hawthorn-origin flies in the eastern USA use volatile blends emitted from the surface of their respective ripening fruit to find and discriminate among host trees. To test whether the same is true for western flies, we used coupled gas chromatography and electroantennographic detection (GC-EAD) and developed a 7-component apple fruit blend for western apple-origin flies, an 8-component black hawthorn fruit blend for flies infesting C. douglasii, and a 9-component ornamental hawthorn blend for flies from C. monogyna. Crataegus douglasii and C. monogyna-origin flies showed similar levels of upwind directed flight to their respective natal synthetic fruit blends in flight tunnel assays compared to whole fruit adsorbent extracts, indicating that the blends contain all the behaviorally relevant fruit volatiles to induce maximal response levels. The black and ornamental hawthorn blends shared four compounds in common including 3-methylbutan-1-ol, which appears to be a key volatile for R. pomonella populations in the eastern, southern, and western USA that show a preference for fruit from different Crataegus species. However, the blends also differed from one another and from domesticated apple in several respects that make it possible that western R. pomonella flies behaviorally discriminate among fruit volatiles and form ecologically differentiated host races, as is the case for eastern apple and hawthorn flies.

  11. Características de qualidade de cultivares de maçã: avaliação físico-química e sensorial de quinze cultivares Quality profile of 15 apple cultivars

    Directory of Open Access Journals (Sweden)

    Gilvan Wosiacki

    2004-09-01

    Full Text Available Neste trabalho são apresentados aspectos de qualidade de interesse industrial de 15 cultivares de maçãs. A análise sensorial das frutas in natura discriminou as amostras de Melrose, Fred Housh, M 51/90 e Malus 71/90 como capazes de promover o processo de compra e de instalação do hábito de consumo. A análise sensorial dos sucos de frutas discrimina apenas a cultivar comercial Belgolden como interessante. Os sucos feitos com as amostras de maçãs apresentaram uma variação de 12 a 16ºBRIX e o valor médio de ácido málico foi de 0,362g/100mL. Os teores de compostos fenólicos apresentaram uma média de 316mg/L e um desvio padrão de 70mg/L (C.V.= 22%. Os indicadores industriais são elevados demais para serem comparados com aqueles necessários, abaixo de 20/25; os valores médios encontrados neste conjunto de maçãs foram de 45 (índice BRIX/acidez e 40,2 (índice ART/acidez. As amostras codificadas foram categorizadas como amargas, com um grupo de doces-amargas (as comerciais Fred Housh, Marquesa, Sansa e Romu, e as experimentais M 51/90 e todas as Malus e outro de ácidas-amargas (as demais cultivares estudadas. As amostras mais interessantes para o processamento industrial de suco clarificado são a Belgolden, as Coop 25 e 26, a Melrose e a Malus 67/90. A Sansa desponta como portadora de maior teor de frutose e potencialmente como matéria-prima para a elaboração de bebidas com apelo funcional.The article shows some figures concerning industrial aplications of samples from apple cultivars. Sensorial evaluation of the apples in natura indicated Melrose, Fred Housh, M 51/90 and Malus 71/90 as able to satisfy the consumer. Sensorial evaluation of the apple juice shows only one interesting variety, Belgolden. The juices showed 12 to 16ºBRX and a mean value of malic acid of 0,362g/100mL. Total phenol compounds showed a mean of 316mg/l (C.V.= 22%. Ratios concerning total sugar or total soluble solids: malic acid were too high as

  12. Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

    Index Scriptorium Estoniae

    Häniläne,, pseud.

    2008-01-01

    Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

  13. The AINTEGUMENTA genes, MdANT1 and MdANT2, are associated with the regulation of cell production during fruit growth in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Dash, Madhumita; Malladi, Anish

    2012-06-25

    Fruit growth in apple (Malus × domestica Borkh.) is mediated by cell production and expansion. Genes involved in regulating these processes and thereby fruit growth, are not well characterized. We hypothesized that the apple homolog(s) of AINTEGUMENTA (ANT), an APETALA2-repeat containing transcription factor, regulates cell production during fruit growth in apple. Two ANT genes, MdANT1 and MdANT2, were isolated from apple and their expression was studied during multiple stages of fruit development. MdANT1 and MdANT2 expression was high during early fruit growth coincident with the period of cell production, rapidly declined during exit from cell production, and remained low during the rest of fruit development. The effects of increase in carbohydrate availability during fruit growth were characterized. Increase in carbohydrate availability enhanced fruit growth largely through an increase in cell production. Expression of MdANT1 and MdANT2 increased sharply by up to around 5-fold in response to an increase in carbohydrate availability. Expression of the ANT genes was compared across two apple genotypes, 'Gala' and 'Golden Delicious Smoothee' (GS), which differ in the extent of fruit growth, largely due to differences in cell production. In comparison to 'Gala', the larger fruit-size genotype, GS, displayed higher levels and a longer duration of MdANT1 and MdANT2 expression. Expression of the ANTs and cell cycle genes in the fruit core and cortex tissues isolated using laser capture microdissection was studied. During early fruit growth, expression of the MdANTs was higher within the cortex, the tissue that constitutes the majority of the fruit. Additionally, MdANT1 and MdANT2 expression was positively correlated with that of A- and B-type CYCLINS, B-type CYCLIN-DEPENDENT-KINASES (CDKBs) and MdDEL1. Multiple lines of evidence from this study suggest that MdANT1 and MdANT2 regulate cell production during fruit growth in apple. ANTs may coordinate the expression of

  14. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT90901 Malus x domestica Rosaceae ... Tensile testing of apple peels_Maximum force Maximum force..., one of the parameters measured during the tensile testing of apple peels. Highest force value

  15. Arabidopsis CDS blastp result: AK063995 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063995 001-124-E11 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehy...drogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...

  16. Arabidopsis CDS blastp result: AK101517 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101517 J033046H09 At5g51970.2 sorbitol dehydrogenase, putative / L-iditol 2-dehyd...rogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-162 ...

  17. Pollen flora of pakistan-lxxi. rosaceae

    International Nuclear Information System (INIS)

    Perveen, A.; Qaiser, M.

    2014-01-01

    Pollen morphology of 50 species representing 17 genera of the family Rosaceae i.e., Alchemilla, Argimonia, Cotoneaster, Crataegus, Duchesnea, Fragaria, Eriybotyra, Filipandula, Geum, Malus, Prunus, Potentilla, Pyrus , Rosa, Sibbaldia, Sorbaria and Sorbus has been studied from Pakistan by light and scanning electron microscope. Pollen grains are usually free, radially symmetrical, isopolar, prolate-spheroidal to subprolate or oblate-spheroidal rarely perprolate, tricolporate rarely tricolpate. Tectum mostly coarsely-finely striate, rarely striate-rugulate, scabrate or spinulose often reticulate. Rosaceae is more or less eurypalynous family. Significant variation is found in P/E ratio, shape and exine ornamentation and on the basis of these characters family has been divided into seven pollen types viz., Agrimonia eupatoria-type, Alchemilla ypsilotoma-type, Cotoneaster affinis-type, Fragaria nubicola-type, Geum roylei-type, Malus pumila-type, Potentilla pamirica-type. Pollen data is useful at specific and generic level. (author)

  18. Banking culture and collective responsibility: A memorandum to the UK Parliamentary Commission on Banking Standards

    NARCIS (Netherlands)

    N. Dorn (Nicholas)

    2013-01-01

    textabstractBasic assumptions • There is wide interest in connecting issues of (i) occupational culture, (ii) compliance/ misconduct, (iii) remuneration and (iv) clawback (the bonus/malus debate). • Individual-focussed measures (supervision, remuneration and measures in civil or criminal law) must

  19. Arabidopsis CDS blastp result: AK241265 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241265 J065132C02 At5g51970.2 68418.m06450 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

  20. Arabidopsis CDS blastp result: AK241265 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241265 J065132C02 At5g51970.1 68418.m06449 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

  1. Arabidopsis CDS blastp result: AK287708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287708 J065132C02 At5g51970.2 68418.m06450 sorbitol dehydrogenase, putative / L-i...ditol 2-dehydrogenase, putative similar to NAD-dependent sorbitol dehydrogenase from Malus x domestica [gi:4519539] 1e-15 ...

  2. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT90902 Malus x domestica Rosaceae ... Tensile testing of apple peels_Max force distance Max force... the x-axis corresponding to the maximum force value. 1 ... Chr15 30.7 4.41 ... 10.1093/jxb/erv366 26220084

  3. A comparative ultrastructural study of pit membranes with plasmodesmata associated thickenings in four angiosperm species

    NARCIS (Netherlands)

    Rabaey, D.; Lens, F.; Huysmans, S.; Smets, E.; Jansen, S.

    2008-01-01

    Recent micromorphological observations of angiosperm pit membranes have extended the number and range of taxa with pseudo-tori in tracheary elements. This study investigates at ultrastructural level (TEM) the development of pseudo-tori in the unrelated Malus yunnanensis, Ligustrum vulgare,

  4. In vitro seed germination and rootstock establishing for micrografting of Theobroma cacao L

    Science.gov (United States)

    Micrografting has been successfully implemented in several plant species of Acacia, Citrus, Eucalyptus, Havea, Malus, Olea, Opuntia, Prunus and other genera. This technique is employed for plant rejuvenation, true-to-type propagation, genetic improvement, recovery of virus-free plants, testing of po...

  5. Dicty_cDB: VFN613 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnments: (bits) Value ( P49349 ) RecName: Full=Farnesyl pyrophosphate synthetase; ... 182 1e-44 EU399544_1( EU399544 |pid:none) Ganod...erma lucidum farnesyl-diphosp... 178 1e-43 AY083165_1( AY083165 |pid:none) Malus x

  6. Phylogenetic relationships among Maloideae species

    Science.gov (United States)

    The Maloideae is a highly diverse sub-family of the Rosaceae containing several agronomically important species (Malus sp. and Pyrus sp.) and their wild relatives. Previous phylogenetic work within the group has revealed extensive intergeneric hybridization and polyploidization. In order to develop...

  7. Tissue location of resistance in apple to the rosy apple aphid established by electrical penetration graphs

    NARCIS (Netherlands)

    Marchetti, E.; Civolani, S.; Leis, M.; Chicca, M.; Tjallingii, W.F.; Pasqualini, E.; Baroni, P.

    2009-01-01

    A study of the constitutive resistance of the apple cultivar Florina, Malus domestica Borkh. (Rosaceae), to the rosy apple aphid, Dysaphis plantaginea (Passerini) (Homoptera Aphididae), was performed for the first time by the electrical penetration graph (DC-EPG) system, using the susceptible apple

  8. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96018 Malus x domestica Rosaceae ... phenotypic mean value of normalized difference... vegetation index phenotypic mean value of normalized difference vegetation index under the water stress (drought) condition 3 ... LG_06 ... 1 4.02 ... 10.1093/jxb/erv355 26208644

  9. Role of abscisic acid (aba) in modulating the responses of two apple rootstocks to drought stress

    International Nuclear Information System (INIS)

    Zhang, L.; Li, X.; Li, B.; Han, M.; Liu, F.; Zhang, L.; Zheng, P.

    2014-01-01

    Drought stress is considered as the main limiting factor for apple (Malus domestica L.) production in some semi-arid areas of China. In this study, we investigated the modulation role of abscisic acid (ABA) and fluridone (ABA synthesis inhibitor) on water relations and antioxidant enzyme system in 2-year-old seedlings of two apple rootstocks i.e. Malus sieversii (Ledeb.) Roem. (MS) and Malus hupehensis (Pamp.) Rehd. (MH). Drought stress induced ion leakage, accumulation of malondiadehyde (MDA) and decreases in leaf water potential and relative water content (RWC) in both rootstocks, which were significantly alleviated by exogenous ABA application. Drought stress also induced markedly increases in endogenous ABA content and activities of superoxide dismutase (SOD), peroxidase (POD), catalase (CAT), ascorbate peroxidase (APX), dehydroascorbate reductase (DHAR), monodehydroascorbate reductase (MDHAR), and glutathione reductase (GR), to a greater magnitude in MS as compared to MH rootstock. Concentration of 100 mol/L and 50 mol/L ABA had the most positive effects on drought-stressed rootstocks of MS and MH, respectively. Spraying optimum exogenous ABA contributed to enhancement in most of the above antioxidant enzymes activities but reduction in content of MDA and maintained the appropriate leaf water potential and RWC in both rootstocks. Pretreatment with fluridone aggravated ion leakage and the accumulation of MDA in two apple rootstocks under drought stress, which was overcome by exogenous ABA application to some extent. In conclusion, the endogenous ABA was probably involved in the regulation of two apple rootstocks in responses to drought stress. (author)

  10. Evolution of the population structure of Venturia inaequalis, the apple scab fungus, associated with the domestication of its host.

    Science.gov (United States)

    Gladieux, Pierre; Zhang, Xiu-Guo; Róldan-Ruiz, Isabel; Caffier, Valérie; Leroy, Thibault; Devaux, Martine; Van Glabeke, Sabine; Coart, Els; Le Cam, Bruno

    2010-02-01

    Evaluating the impact of plant domestication on the population structure of the associated pathogens provides an opportunity to increase our understanding of how and why diseases emerge. Here, we investigated the evolution of the population structure of the apple scab fungus Venturia inaequalis in response to the domestication of its host. Inferences were drawn from multilocus microsatellite data obtained from samples collected on (i) the Central Asian Malus sieversii, the main progenitor of apple, (ii) the European crabapple, Malus sylvestris, a secondary progenitor of apple, and (iii) the cultivated apple, Malus x domestica, in orchards from Europe and Central Asia. Using clustering methods, we identified three distinct populations: (i) a large European population on domesticated and wild apples, (ii) a large Central Asian population on domesticated and wild apples in urban and agricultural areas, and (iii) a more geographically restricted population in M. sieversii forests growing in the eastern mountains of Kazakhstan. Unique allele richness and divergence time estimates supported a host-tracking co-evolutionary scenario in which this latter population represents a relict of the ancestral populations from which current populations found in human-managed habitats were derived. Our analyses indicated that the domestication of apple induced a significant change in the genetic differentiation of populations of V. inaequalis in its centre of origin, but had little impact on its population dynamics and mating system. We discuss how the structure of the apple-based agrosystem may have restricted changes in the population structure of the fungus in response to the domestication of its host.

  11. Establishment of high effective regeneration and propagation ...

    African Journals Online (AJOL)

    In order to establish efficient regeneration system for ornamental tissue culture, we used Malus spp. 'Indian Magic as the experimental materials and investigated the effects of disinfection and antibrowning agents, culture mediums and hormones proportion on differentiation, multiplication, callus induction and rooting, and ...

  12. Genetic mapping of 14 avirulence genes in an EU-B04 x 1639 progeny of Venturia inaequalis

    NARCIS (Netherlands)

    Broggini, G.A.L.; Bus, V.G.M.; Parravicini, G.; Kumar, S.; Groenwold, R.; Gessler, C.

    2011-01-01

    Durable resistance to apple scab (Venturia inaequalis (Cke) Wint; anamorph Spilocaea pomi Fries) is one of the major goals of apple (Malus) breeding programs. Since current scab resistance breeding is heavily reliant on genes with gene-for-gene relationships, a good understanding of the genetic

  13. Modern actuarial risk theory: using R

    NARCIS (Netherlands)

    Kaas, R.; Goovaerts, M.; Dhaene, J.; Denuit, M.

    2008-01-01

    Modern Actuarial Risk Theory -- Using R contains what every actuary needs to know about non-life insurance mathematics. It starts with the standard material like utility theory, individual and collective model and basic ruin theory. Other topics are risk measures and premium principles, bonus-malus

  14. A review of apple anthracnose canker biology and management in cider apple orchards in the Maritime Pacific Northwest

    Science.gov (United States)

    Cider apple (Malus ×domestica Borkh.) is an emerging crop in western Washington and the Pacific Northwest (PNW) region, but a major obstacle to planting new orchards and orchard productivity is the widespread occurrence of apple anthracnose canker, caused by the fungal pathogen Neofabraea malicortic...

  15. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96020 Malus x domestica Rosaceae ... phenotypic mean value of visible atmospherical...ly resistant index phenotypic mean value of visible atmospherically resistant index under well water (irrigation) condition 3 ... LG_01 ... 12.749 4.08 ... 10.1093/jxb/erv355 26208644

  16. Eco-friendly approach towards green synthesis of zinc oxide nanocrystals and its potential applications.

    Science.gov (United States)

    Velmurugan, Palanivel; Park, Jung-Hee; Lee, Sang-Myeong; Yi, Young-Joo; Cho, Min; Jang, Jum-Suk; Myung, Hyun; Bang, Keuk-Soo; Oh, Byung-Taek

    2016-09-01

    In the present study, we investigated a novel green route for synthesis of zinc oxide (ZnO) nanocrystals using Prunus × yedoensis Matsumura leaf extract as a reducing agent without using any surfactant or external energy. Standard characterization studies were carried out to confirm the obtained product using UV-Vis spectra, SEM-EDS, FTIR, TEM, and XRD. In addition, the synthesized ZnO nanocrystals were coated onto fabric and leather samples to study their bacteriostatic effect against odor-causing bacteria Brevibacterium linens and Staphylococcus epidermidis. Zinc oxide nanocrystal-coated fabric and leather showed good activity against both bacteria.

  17. New records and updated checklist of Cicadomorpha (Hemiptera: Auchenorrhyncha) species from Greece.

    Science.gov (United States)

    Thanou, Zoi N; Afentoulis, Dimitrios G; Koufopoulou, Panagiota; Ampatzi, Argyro P; Lekkou, Sofia D; Koutsogiannopoulou, Αikaterini; Bravou, Anastasia A; Stamatakou, Georgia D; Voulgaraki, Konstantina N; Piperkas, Anastasios; Chaldaiou, Aikaterini; Kalaitzaki, Argyro P; Tsagkarakis, Antonios E

    2018-04-20

    Seventeen auchenorrhynchan species of the family Cicadellidae are recorded from Greece for the first time: Euscelidius variegatus (Kirschbaum 1858), Euscelis ohausi (Wagner 1939), Psammotettix notatus (Melichar 1896), Psammotettix striatus (Linnaeus 1758), Psammotettix sabulicola (Curtis 1837), Anzygina honiloa (Kirkaldy 1906), Arboridia versuta (Melichar 1897), Edwardsiana ishidae (Matsumura 1932), Edwardsiana tersa (Edwards 1914), Eupteryx decemnotata (Rey 1891), Eupteryx curtisii (Flor 1861), Eupteryx rostrata (Ribaut 1936), Frutioidia sanguinosa (Rey 1891), Zygina rosea (Flor 1861), Zygina suavis (Rey 1891), Zygina tiliae (Fallen 1806), Anaceratagallia frisia (Wagner 1939). Faunistic and distributional data notes are given for each species and a complete, updated species checklist for Greece is provided.

  18. An insight into the sequential, structural and phylogenetic properties ...

    Indian Academy of Sciences (India)

    Prakash

    composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.

  19. Interactive use of disease models using a smartphone

    NARCIS (Netherlands)

    Boshuizen, A.J.; Boshuizen, P.C.; Jong, de P.F.

    2015-01-01

    Fruit tree canker (Neonectria ditissima syn. Nectria galligena Bres.) is an important fungal disease in apple (Malus × domestica Borkh.). Leaf fall is the predominant infection period for this disease. However, in The Netherlands and Belgium, no historical data on leaf fall of apple are available.

  20. An atypical R2R3 MYB transcription factor increases cold hardiness by CBF-dependent and CBF-independent pathways in apple

    NARCIS (Netherlands)

    Xie, Yinpeng; Chen, Pengxiang; Yan, Yan; Bao, Chana; Li, Xuewei; Wang, Liping; Shen, Xiaoxia; Li, Haiyan; Liu, Xiaofang; Niu, Chundong; Zhu, Chen; Fang, Nan; Shao, Yun; Zhao, Tao; Yu, Jiantao; Zhu, Jianhua; Xu, Lingfei; Nocker, van Steven; Ma, Fengwang; Guan, Qingmei

    2018-01-01

    Apple (Malus × domestica) trees are vulnerable to freezing temperatures. However, there has been only limited success in developing cold-hardy cultivars. This lack of progress is due at least partly to lack of understanding of the molecular mechanisms of freezing tolerance in apple. In this study,

  1. Diaporthe species on Rosaceae with descriptions of D. pyracanthae sp. nov. and D. malorum sp. nov.

    NARCIS (Netherlands)

    Santos, L.; Phillips, A.J.L.; Crous, P.W.; Alves, A.

    2017-01-01

    The family Rosaceae includes a large number of species ranging from herbaceous (Fragaria) to ornamental plants (Rosa and Pyracantha) and fruit trees (Malus and Pyrus). Diaporthe species have been associated with twig canker, shoot blight, dieback, wood decay and fruit rot on members of the Rosaceae.

  2. First report of

    NARCIS (Netherlands)

    Wenneker, M.; Pham, K.T.K.; Boekhoudt, L.C.; Boer, de F.A.; Leeuwen, van P.J.; Hollinger, T.C.; Thomma, B.P.H.J.

    2017-01-01

    In the Netherlands, about 30% of the organic apple (Malus domestica Borkh.) production consists of apple scab resistant cultivars, such as Topaz and Santana. However, organic ‘Topaz’ apples show a high incidence of fungal rot after storage. Hot-water treatment (HWT) of freshly harvested apple

  3. The effects of paclobutrazol and daminozide on in vitro ...

    African Journals Online (AJOL)

    Administrator

    2011-06-06

    Jun 6, 2011 ... Key words: Malus spp., micropropagation, plant growth regulators, tissue culture. ... addition of growth retardants to a culture medium can reduce or ...... Hydroponic culture of Gladiolus tristis: Application of paclobutrazol for flowering and height control. 5 February. ISSN 1684–5315. Academic Journals. Afr.

  4. Towards durabale resistance to apple scab using cisgenes

    NARCIS (Netherlands)

    Joshi, S.G.

    2010-01-01

    Apple (Malus x domestica) is one of the important fruit crops of the world. It is mainly cultivated in temperate regions. Apple fruit contains many health beneficial compounds which may play an important role in reducing cancer cell proliferation and lowering the level of cholesterol.
    Apple

  5. Nr 17 - Private bill aiming at preparing transition towards a energy efficient system

    International Nuclear Information System (INIS)

    Bartolone, Claude

    2012-01-01

    This private bill indicates which new articles and which modifications are introduced in the French energy code to implement progressive energy tariffs and favour energy savings by households. These new articles define how a bonus-malus on household energy consumptions is determined. They also define accompanying measures

  6. Development and validation of the Axiom

    NARCIS (Netherlands)

    Bianco, Luca; Cestaro, Alessandro; Linsmith, Gareth; Muranty, Hélène; Denancé, Caroline; Théron, Anthony; Poncet, Charles; Micheletti, Diego; Kerschbamer, Emanuela; Pierro, Di Erica A.; Larger, Simone; Pindo, Massimo; De Weg, Van Eric; Davassi, Alessandro; Laurens, François; Velasco, Riccardo; Durel, Charles Eric; Troggio, Michela

    2016-01-01

    Cultivated apple (Malus × domestica Borkh.) is one of the most important fruit crops in temperate regions, and has great economic and cultural value. The apple genome is highly heterozygous and has undergone a recent duplication which, combined with a rapid linkage disequilibrium decay, makes it

  7. A xyloglucan from seeds of the native Brazilian species Hymenaea courbaril for micropropagation of Marubakaido and Jonagored apples.

    Science.gov (United States)

    Lima-Nishimura, N; Quoirin, M; Naddaf, Y G; Wilhelm, H M; Ribas, L L F; Sierakowski, M-R

    2003-01-01

    Xyloglucan was extracted from seeds of Hymenaea courbaril and mixed with agar to prepare a solid culture medium used for micropropagation of the Marubakaido apple rootstock (Malus prunifolia Borkh) and cv. Jonagored (Malus domestica). The performance on gels created from a blend of 0.4%agar and 0.2% xyloglucan (w/v) was compared with that on media gelled with a standard concentration 0.6% (w/v) of agar. The growth of shoots and the multiplication rate were higher on the modified culture medium than on the agar-gelled medium. The occurrence of hyperhydric shoots was lower on the modified medium. In the absence of auxin, shoot rooting reached 70% (Marubakaido) and 66% (Jonagored) on the agar-xyloglucan medium and 6.7% and 10.4%, respectively, on the agar medium. When 0.25 microM indole-3-butyric acid (IBA) was added to both media, the modified medium gave better results in terms of rooting percentage and quality of roots than the agar-gelled medium.

  8. Surfactant mediated extraction of total phenolic contents (TPC) and antioxidants from fruits juices.

    Science.gov (United States)

    Sharma, Shweta; Kori, Shivpoojan; Parmar, Ankush

    2015-10-15

    The aim of this study was to enhance the extraction of total phenolic contents (TPC) and antioxidants from fruit juices by the application of surfactants formulations instead of conventional solvents (methanol, ethanol and acetone). A variety of fruit infusions: apple red delicious (apple (rd)) (Malus domestica), Mcintosh apple (apple (i)) (Malus pumila), sweet lemon (Citrus limetta) and mango (Magnifera indica) were studied. Effect of water, organic solvents and five different aqueous surfactant formulations viz. SDS, Brij-35, Brij-58, Triton X-100 and Span-40 were explored for the extraction of TPC and determining the antioxidant activity (AA). The TPC and AA (%) were determined using Folin-Ciocalteu (FCA) and DPPH assay, respectively. The effect of surfactant type, concentration and common organic solvents on the extraction of TPC and AA (%) was studied using UV-visible spectrophotometric technique. Among all the extracting systems employed, Brij-58 showed the highest extraction efficiency. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Measures to reduce car-fleet consumption - Estimation of effects; Massnahmen zur Absenkung des Flottenverbrauchs. Abschaetzung der Wirkung

    Energy Technology Data Exchange (ETDEWEB)

    Iten, R.; Hammer, S.; Keller, M.; Schmidt, N. [Infras, Zuerich (Switzerland); Sammer, K.; Wuestenhagen, R. [Institut fuer Wirtschaft und Oekologie (IWOE-HSG), Universitaet St. Gallen, St. Gallen (Switzerland)

    2005-09-15

    This comprehensive report for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a study that estimated the effects of measures that were to be taken in order to reduce the fuel consumption of fleets of vehicles as part of the SwissEnergy programme. The research reported on aimed to estimate the effects of the Energy Label on energy consumption and research concerning the results to be expected from the introduction of a bonus-malus system. Questions reviewed include the effect of fuel consumption data on making decisions concerning which vehicle to purchase, the effects of the Energy Label on consumption, the awareness of other appropriate information sources, the possible effects of a bonus-malus system and how the effectiveness of the Energy Label could be improved. The answers and results obtained are reviewed and commented on. Finally, an overall appraisal of the situation is presented and recommendations for increasing the effectiveness of the Energy Label are made

  10. Measures to reduce car-fleet consumption - Estimation of effects

    International Nuclear Information System (INIS)

    Iten, R.; Hammer, S.; Keller, M.; Schmidt, N.; Sammer, K.; Wuestenhagen, R.

    2005-09-01

    This comprehensive report for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a study that estimated the effects of measures that were to be taken in order to reduce the fuel consumption of fleets of vehicles as part of the SwissEnergy programme. The research reported on aimed to estimate the effects of the Energy Label on energy consumption and research concerning the results to be expected from the introduction of a bonus-malus system. Questions reviewed include the effect of fuel consumption data on making decisions concerning which vehicle to purchase, the effects of the Energy Label on consumption, the awareness of other appropriate information sources, the possible effects of a bonus-malus system and how the effectiveness of the Energy Label could be improved. The answers and results obtained are reviewed and commented on. Finally, an overall appraisal of the situation is presented and recommendations for increasing the effectiveness of the Energy Label are made

  11. 75 FR 65213 - Removal of Varietal Restrictions on Apples From Japan

    Science.gov (United States)

    2010-10-22

    ...-0020] RIN 0579-AD08 Removal of Varietal Restrictions on Apples From Japan AGENCY: Animal and Plant... the importation of Fuji variety apples from Japan to allow all varieties of Malus domestica apples... that the risk associated with allowing other varieties of M. domestica apples from Japan into the...

  12. 75 FR 11071 - Removal of Varietal Restrictions on Apples from Japan

    Science.gov (United States)

    2010-03-10

    ... on Apples from Japan AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Proposed rule... Japan to allow all varieties of Malus domestica apples into the United States under the same conditions... apples from Japan to be imported into the United States while continuing to protect against the...

  13. First report of Apple necrotic mosaic virus infecting apple trees in Korea

    Science.gov (United States)

    In September 2016, two apple trees (Malus domestica Borkh) cv. Shinano Sweet showing bright cream spot and mosaic patterns on leaves were observed in Pocheon, South Korea. Mosaic symptoms are common on leaves of apple trees infected with Apple mosaic virus (ApMV). Symptomatic leaves were tested by e...

  14. Apple and quince peroxidase activity in response to essential oils ...

    African Journals Online (AJOL)

    Enzymatic browning arises by peroxidase in fruits. However, essential oils are recognized as natural antioxidant agents. So in this study, the effect of thyme, coriander and rosemary essential oils were evaluated on the reduction of peroxidase activity in apples (Malus domestica Mill. cv Golden delicious), (M. domestica Mill.

  15. Genetic analysis of wild apple resources in Shandong province ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... Apple (malus domestica Borkh.), which is a widely cultivated, important and economic fruit crop with nutritive and medicinal importance, has emerged as a model horticultural crop in this post-genomic era. Wild apple resources are important and they develop gradually in apple industry and genetic diversity.

  16. Potential hosts for Lambertella corni-maris and Phacidium lacerum within the family Rosaceae

    Science.gov (United States)

    Two fungi were described in 2015 and 2016 as pathogens of pome fruit in the Pacific Northwest USA: Lambertella corni-maris on apple (Malus domestica), and Phacidium lacerum (synonym, Ceuthospora pinastri) on apple and d’Anjou pear (Pyrus communis). We documented pathogenicity of L. corni-maris to d...

  17. Relative Susceptibility of Quince, Pear, and Apple Cultivars to Fire Blight Following Greenhouse Inoculation

    Science.gov (United States)

    Fire blight caused by Erwinia amylovora (EA) is one of the most serious diseases of plants in the family Rosaceae, and Quince (Cydonia oblonga Mill.) is considered one of the most susceptible host genera. Apple (Malus sp.) and pear (Pyrus sp.) cultivars ranging from most susceptible to most resistan...

  18. Apple mosaic virus

    Science.gov (United States)

    Apple mosaic virus (ApMV), a member of the ilarvirus group, naturally infects Betula, Aesculus, Humulus, and several crop genera in the family Rosaceae (Malus, Prunus, Rosa and Rubus). ApMV was first reported in Rubus in several blackberry and raspberry cultivars in the United States and subsequentl...

  19. Arabidopsis CDS blastp result: AK105400 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105400 001-123-C10 At1g14130.1 2-oxoglutarate-dependent dioxygenase, putative similar to adventitious root...ing related oxygenase ARRO-1 from Malus x domestica, gi|3492806; contains Pfam domain PF03171, 2OG-Fe(II) oxygenase superfamily 2e-66 ...

  20. Arabidopsis CDS blastp result: AK121520 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121520 J033028J23 At1g14130.1 2-oxoglutarate-dependent dioxygenase, putative similar to adventitious rooti...ng related oxygenase ARRO-1 from Malus x domestica, gi|3492806; contains Pfam domain PF03171, 2OG-Fe(II) oxygenase superfamily 2e-66 ...

  1. Targeted isolation and identification of bioactive compounds lowering cholesterol in the crude extracts of crabapples using UPLC-DAD-MS-SPE/NMR based on pharmacology-guided PLS-DA.

    Science.gov (United States)

    Wen, Chao; Wang, Dongshan; Li, Xing; Huang, Tao; Huang, Cheng; Hu, Kaifeng

    2018-02-20

    The anti-hyperlipidemic effects of crude crabapple extracts derived from Malus 'Red jade', Malus hupehensis (Pamp.) Rehd. and Malus prunifolia (Willd.) Borkh. were evaluated on high-fat diet induced obese (HF DIO) mice. The results revealed that some of these extracts could lower serum cholesterol levels in HF DIO mice. The same extracts were also parallelly analyzed by LC-MS in both positive and negative ionization modes. Based on the pharmacological results, 22 LC-MS variables were identified to be correlated with the anti-hyperlipidemic effects using partial least square discriminant analysis (PLS-DA) and independent samples t-test. Further, under the guidance of the bioactivity-correlated LC-MS signals, 10 compounds were targetedly isolated and enriched using UPLC-DAD-MS-SPE and identified/elucidated by NMR together with MS/MS as citric acid(1), p-coumaric acid(2), hyperoside(3), myricetin(4), naringenin(5), quercetin(6), kaempferol(7), gentiopicroside(8), ursolic acid(9) and 8-epiloganic acid(10). Among these 10 compounds, 6 compounds, hyperoside(3), myricetin(4), naringenin(5), quercetin(6), kaempferol(7) and ursolic acid(9), were individually studied and reported to indeed have effects on lowering the serum lipid levels. These results demonstrated the efficiency of this strategy for drug discovery. In contrast to traditional routes to discover bioactive compounds in the plant extracts, targeted isolation and identification of bioactive compounds in the crude plant extracts using UPLC-DAD-MS-SPE/NMR based on pharmacology-guided PLS-DA of LC-MS data brings forward a new efficient dereplicated approach to natural products research for drug discovery. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Auxin response factors (ARF) are transcription factors that regulate auxin responses in plants. Although the genomewide analysis of this family has been performed in some species, little is known regarding ARF genes in apple (Malus domestica). In this study, 31 putative apple ARF genes have been identified and located ...

  3. Genetic analysis of wild apple resources in Shandong province ...

    African Journals Online (AJOL)

    Apple (malus domestica Borkh.), which is a widely cultivated, important and economic fruit crop with nutritive and medicinal importance, has emerged as a model horticultural crop in this post-genomic era. Wild apple resources are important and they develop gradually in apple industry and genetic diversity. In this study, two ...

  4. First report of Sphaeropsis rot of apple caused by Sphaeropsis pyriputrescens in New York.

    Science.gov (United States)

    In March 2012, decayed ‘Empire’ apple fruit (Malus × domestica Borkh.) were sampled from apples stored in bins for 6 months under controlled atmosphere at a commercial packinghouse in Orleans County in New York State. The fruit were completely rotten, spongy to firm, and light brown. The incidence o...

  5. First report of Colletotrichum godetiae causing bitter rot on ‘Golden Delicious’ apples in the Netherlands

    NARCIS (Netherlands)

    Wenneker, M.; Pham, K.T.K.; Lemmers, M.E.C.; Boer, de F.A.; Lans, van der A.M.; Leeuwen, van P.J.; Hollinger, T.C.

    2016-01-01

    Apple (Malus domestica) is an important fruit crop in the Netherlands, with a total production of 418,000 tons in 2011. Symptoms of apple bitter rot were observed on ‘Golden Delicious’ apples in the Netherlands in July 2013 after 9 months of storage in a packing house at controlled atmosphere.

  6. First report of fusarium avenaceum causing wet core rot of ‘elstar’ apples in the Netherlands

    NARCIS (Netherlands)

    Wenneker, M.; Pham, K.T.K.; Lemmers, M.E.C.; Boer, de Fred; Lans, van der Arie; Leeuwen, van Paul; Hollinger, T.C.; Thomma, B.P.H.J.

    2016-01-01

    Apple (Malus domestica) is an important fruit crop in the Netherlands. ‘Elstar’, the main cultivar, occupies 40% of the apple production area. Symptoms of apple wet core rot were observed on Elstar in January to March 2013 after 4 to 6 months’ storage in different packing houses at controlled

  7. Differences in acidity of apples are probably mainly caused by a malic acid transporter gene on LG16

    NARCIS (Netherlands)

    Khan, S.A.; Beekwilder, J.; Schaart, J.G.; Mumm, R.; Soriano, J.M.; Jacobsen, E.; Schouten, H.J.

    2013-01-01

    Acidity has profound effects on the taste of apples (Malus × domestica). Malic acid is the predominant organic acid in apples. Differences in malic acid content are caused by differences in accumulation of malic acid in the vacuole. This accumulation may be caused by a gene that is responsible for

  8. 21 CFR 145.110 - Canned applesauce.

    Science.gov (United States)

    2010-04-01

    ... ingredients. The following safe and suitable optional ingredients may be used: (i) Water. (ii) Apple juice... apples (Malus domestica Borkhausen), which may or may not be peeled and cored, and which may have added thereto one or more of the optional ingredients specified in paragraph (a)(2) of this section. The apple...

  9. INTERACTIONS BETWEEN SOIL TEMPERATURE AND PLANT GROWTH STAGE ON NITROGEN UPTAKE AND AMINO ACID CONTENT OF APPLE NURSERY STOCK DURING EARLY SPRING GROWTH

    Science.gov (United States)

    In the spring, nitrogen (N) uptake by apple roots is known to be delayed about three weeks after bud break. We used one-year-old 'Fuji' (Malus domestica Borkh) on M26 bare-root apple trees to determine whether timing of N uptake in the spring is dependant solely on the growth st...

  10. New insight into the history of domesticated apple: secondary contribution of the European wild apple to the genome of cultivated varieties.

    Directory of Open Access Journals (Sweden)

    Amandine Cornille

    Full Text Available The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica, on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species.

  11. New Insight into the History of Domesticated Apple: Secondary Contribution of the European Wild Apple to the Genome of Cultivated Varieties

    Science.gov (United States)

    Cornille, Amandine; Gladieux, Pierre; Smulders, Marinus J. M.; Roldán-Ruiz, Isabel; Laurens, François; Le Cam, Bruno; Nersesyan, Anush; Clavel, Joanne; Olonova, Marina; Feugey, Laurence; Gabrielyan, Ivan; Zhang, Xiu-Guo; Tenaillon, Maud I.; Giraud, Tatiana

    2012-01-01

    The apple is the most common and culturally important fruit crop of temperate areas. The elucidation of its origin and domestication history is therefore of great interest. The wild Central Asian species Malus sieversii has previously been identified as the main contributor to the genome of the cultivated apple (Malus domestica), on the basis of morphological, molecular, and historical evidence. The possible contribution of other wild species present along the Silk Route running from Asia to Western Europe remains a matter of debate, particularly with respect to the contribution of the European wild apple. We used microsatellite markers and an unprecedented large sampling of five Malus species throughout Eurasia (839 accessions from China to Spain) to show that multiple species have contributed to the genetic makeup of domesticated apples. The wild European crabapple M. sylvestris, in particular, was a major secondary contributor. Bidirectional gene flow between the domesticated apple and the European crabapple resulted in the current M. domestica being genetically more closely related to this species than to its Central Asian progenitor, M. sieversii. We found no evidence of a domestication bottleneck or clonal population structure in apples, despite the use of vegetative propagation by grafting. We show that the evolution of domesticated apples occurred over a long time period and involved more than one wild species. Our results support the view that self-incompatibility, a long lifespan, and cultural practices such as selection from open-pollinated seeds have facilitated introgression from wild relatives and the maintenance of genetic variation during domestication. This combination of processes may account for the diversification of several long-lived perennial crops, yielding domestication patterns different from those observed for annual species. PMID:22589740

  12. Wild apple growth and climate change in southeast Kazakhstan

    Science.gov (United States)

    Irina P. Panyushkina; Nurjan S. Mukhamadiev; Ann M. Lynch; Nursagim A. Ashikbaev; Alexis H. Arizpe; Christopher D. O' Connor; Danyar Abjanbaev; Gulnaz Z. Mengdbayeva; Abay O. Sagitov

    2017-01-01

    Wild populations of Malus sieversii [Ldb.] M. Roem are valued genetic and watershed resources in Inner Eurasia. These populations are located in a region that has experienced rapid and on-going climatic change over the past several decades. We assess relationships between climate variables and wild apple radial growth with dendroclimatological techniques to understand...

  13. [The in vitro action of plants on Vibrio cholerae].

    Science.gov (United States)

    Guevara, J M; Chumpitaz, J; Valencia, E

    1994-01-01

    Natural products of several plants, according to the geographic location, are used by Peruvian people in the popular treatment of diarrhea, with good success. When cholerae cases appeared in Peru, we were interested to know the "in vitro" effect against Vibrio cholerae 01, of these useful plants to treat diarrhea. The following plants were tested: Cichorium intybus, Althaea officinalis, Psorela glandulosa, Geranium maculatum, Punica granatum, Malus sativa, Cydonia oblonga, Chenopodium ambrosoides, Krameria triandria, Tea chinensis, Daucus carota, Persea gratissima, Psidium guayaba and Lippia dulcis. Decoction or infusion of the plants were used in the "in vitro" experiments. The following plants showed no "in vitro" effect against V. cholerae: Cichorium intybus, Althaea officinalis, Psorela glandulosa, Geranium maculatum, Chenopodium ambrosoides, Krameria triandria, Psidium guayaba, Lippia dulcis and Daucus carota. Decoction of Malus sativa and Cydenia oblonga showed bactericidal effect for their acidity and stone avocado (Persea gratissima) a late bactericidal effect. Tea infusión and the decoction of Punica granatum peel, showed the best bactericidal effect and we suggest to use them as to stop cholera spreading.

  14. Purification and characterisation of relevant natural and recombinant apple allergens

    NARCIS (Netherlands)

    Oberhuber, Christina; Ma, Yan; Marsh, Justin; Rigby, Neil; Smole, Ursula; Radauer, Christian; Alessandri, Stefano; Briza, Peter; Zuidmeer, Laurian; Maderegger, Bernhard; Himly, Martin; Sancho, Ana I.; van Ree, Ronald; Knulst, André; Ebner, Christof; Shewry, Peter; Mills, E. N. Clare; Wellner, Klaus; Breiteneder, Heimo; Hoffmann-Sommergruber, Karin; Bublin, Merima

    2008-01-01

    Apple (Malus domestica) is the most widely cultivated fruit crop in Europe and frequently causes allergic reactions with a variable degree of severity. So far, four apple allergens Mal d 1, Mal d 2, Mal d 3 and Mal d 4 have been identified. Mal d 1, a Bet v 1 related allergen, and Mal d 4, apple

  15. Prospects of fatty acid profile and bioactive composition from lipid seeds for the discrimination of apple varieties with the application of chemometrics

    Energy Technology Data Exchange (ETDEWEB)

    Arain, S.; Sherazzi, S. T. H.; Bhanger, M. I.; Memon, N.; Mahesar, S. A.; Rajput, M. T.

    2012-11-01

    The extracted oils from four apple seed varieties (Royal Gala, Red Delicious, Pyrus Malus and Golden Delicious) from Pakistan were investigated for their fatty acid profiles and lipid biactives by GC-MS. The oil contents in the seeds of the apple varieties ranged from 26.8-28.7%. The results revealed that linoleic acid (40.5-49.6%) was the main fatty acid in the Royal Gala, Red Delicious and Pyrus Malus seeds, and oleic acid (38.7-45.5%) was the main fatty acid in the Golden Delicious seeds. Palmitic acid (6.1-7.4%) and stearic acid (2.0-3.1%) were the dominant saturated fatty acids, besides the small amount of palmitoleic, heptadecanoic, linolenic, archidic, eicosanoic, and behenic acids. Sterols, tocopherols, hydrocarbons and some other minor components were also identified from the unsaponifiable lipid fraction. The variation among the results of both fatty acids and lipid bio actives for the four different varieties was assessed by principal component analysis, discriminant analysis and cluster analyses. The results conclude that both oil fractions could be applied as a useful tool to discriminate among the apple seed varieties. (Author) 42 refs.

  16. Chemical constituents of gold-red apple and their α-glucosidase inhibitory activities.

    Science.gov (United States)

    He, Qian-Qian; Yang, Liu; Zhang, Jia-Yu; Ma, Jian-Nan; Ma, Chao-Mei

    2014-10-01

    Ten compounds were isolated and purified from the peels of gold-red apple (Malus domestica) for the 1st time. The identified compounds are 3β, 20β-dihydroxyursan-28-oic acid (1), 2α-hydroxyoleanolic acid (2), euscaphic acid (3), 3-O-p-coumaroyl tormentic acid (4), ursolic acid (5), 2α-hydroxyursolic acid (6), oleanolic acid (7), betulinic acid (8), linolic acid (9), and α-linolenic acid (10). Their structures were determined by interpreting their nuclear magnetic resonance and mass spectrometry (MS) spectra, and by comparison with literature data. Compound 1 is new, and compound 2 is herein reported for the 1st time for the genus Malus. α-Glucosidase inhibition assay revealed 6 of the triterpenoid isolates as remarkable α-glucosidase inhibitors, with betulinic acid showing the strongest inhibition (IC50 = 15.19 μM). Ultra-performance liquid chromatography-electrospray ionization MS analysis of the fruit peels, pomace, flesh, and juice revealed that the peels and pomace contained high levels of triterpenes, suggesting that wastes from the fruit juice industry could serve as rich sources of bioactive triterpenes. © 2014 Institute of Food Technologists®

  17. Pest risk analysis for Conogethes punctiferalis (Yellow peach moth or castor capsule borer)

    OpenAIRE

    Food and Environment Research Agency

    2012-01-01

    This is a highly polyphagous pest, the larvae boring into fruit, seeds and stems of plants in many different families. Economic hosts grown in the UK include Allium cepa (onion), Malus (apple), Prunus (plum, cherry), Pyrus (pear), Vitis vinifera (grape vine), and Zea mays (maize). Other recorded hosts include Castanea (chestnut), Citrus, Curcuma longa (tumeric), Durio zibethinus (durian), Elettaria cardamomum (cardamom), Helianthus annuus (sunflower), Punica granatum (po...

  18. Stemcell Information: SKIP000863 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available nese Japanese -- No hiPSC Generation from Peripheral Blood by using non-T medium. 末梢血由来iPS細胞。|T細胞の増殖には関与しない培...a 沖田 圭介 Center for iPS Cell Research and Application, Kyoto University 京都大学iPS細胞研究所 ... Information Only Cen...ter for iPS Cell Research and Application, Kyoto University 京都大学iPS細胞研究所 ... 231...93063 10.1002/stem.1293 An efficient nonviral method to generate integration-free human-induced pluripotent stem cell...s from cord blood and peripheral blood cells. Okita K, Yamakawa T, Matsumura Y, Sato Y, Amano N, Wa

  19. Stemcell Information: SKIP000862 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available nese Japanese -- No hiPSC Generation from Peripheral Blood by using non-T medium. 末梢血由来iPS細胞。|T細胞の増殖には関与しない培...suke Okita 沖田 圭介 Center for iPS Cell Research and Application, Kyoto University 京都大学iPS細胞研究所 ... Information... Only Center for iPS Cell Research and Application, Kyoto University 京都大学iPS細胞研究所... ... 23193063 10.1002/stem.1293 An efficient nonviral method to generate integration-free human-induced pluripotent stem cell...s from cord blood and peripheral blood cells. Okita K, Yamakawa T, Matsumura Y, Sato Y, Am

  20. Effects of various insecticides on the development of the egg parasitoid Trichogramma dendrolimi (Hymenoptera: Trichogrammatidae).

    Science.gov (United States)

    Takada, Y; Kawamura, S; Tanaka, T

    2001-12-01

    The toxicity of six insecticides, acephate, methomyl, ethofenprox, cartap, chlorfluazuron, and Bacillus thuringiensis (Bt) was tested on different developmental stages of the egg parasitoid, Trichogramma dendrolimi (Matsumura). Each of the insecticides tested showed different degrees of toxicity to the parasitoid, Ethofenprox showed the highest toxicity and cartap showed relatively higher toxicity compared with the other insecticides. The development of the parasitoids treated with these two insecticides was normal, similar to that of the control group. Only the emergence of adult wasps from host eggs was disturbed. Emergence of the host, Mamestra brassicae larva was reduced following treatment with ethofenprox, cartap and methomyl. However, adult female wasps, which emerged from host eggs treated with the insecticides had the ability to oviposit normally.

  1. Parasitic macrofungi (Basidiomycetes on fruit shrubs and trees in the Tarnów town (S Poland

    Directory of Open Access Journals (Sweden)

    Marcin Piątek

    2014-08-01

    Full Text Available Results of 6 years of research carried out in the Tarnów town, southern Poland, are presented. Total number of 27 species of Basidiomycetes were recorded on 7 species of fruit shrubs and trees. Some of them were found on hosts new for Poland, on Malus domestica - Abortiporus biennis, Ganoderma australe, Meripilus giganteus, Stereum hirsutum and Volvariella bombycina; on Juglans regia - Ganoderma applanalum and Hineola auricula-judae.

  2. The Balance of Expression of Dihydroflavonol 4-reductase and Flavonol Synthase Regulates Flavonoid Biosynthesis and Red Foliage Coloration in Crabapples.

    Science.gov (United States)

    Tian, Ji; Han, Zhen-yun; Zhang, Jie; Hu, YuJing; Song, Tingting; Yao, Yuncong

    2015-07-20

    Red leaf color is an attractive trait of Malus families, including crabapple (Malus spp.); however, little is known about the molecular mechanisms that regulate the coloration. Dihydroflavonols are intermediates in the production of both colored anthocyanins and colorless flavonols, and this current study focused on the gene expression balance involved in the relative accumulation of these compounds in crabapple leaves. Levels of anthocyanins and the transcript abundances of the anthocyanin biosynthetic gene, dihydroflavonol 4-reductase (McDFR) and the flavonol biosynthetic gene, flavonol synthase (McFLS), were assessed during the leaf development in two crabapple cultivars, 'Royalty' and 'Flame'. The concentrations of anthocyanins and flavonols correlated with leaf color and we propose that the expression of McDFR and McFLS influences their accumulation. Further studies showed that overexpression of McDFR, or silencing of McFLS, increased anthocyanin production, resulting in red-leaf and red fruit peel phenotypes. Conversely, elevated flavonol production and green phenotypes in crabapple leaves and apple peel were observed when McFLS was overexpressed or McDFR was silenced. These results suggest that the relative activities of McDFR and McFLS are important determinants of the red color of crabapple leaves, via the regulation of the metabolic fate of substrates that these enzymes have in common.

  3. Designing incentive schemes for promoting energy-efficient appliances: A new methodology and a case study for Spain

    International Nuclear Information System (INIS)

    Galarraga, Ibon; Abadie, Luis M.; Kallbekken, Steffen

    2016-01-01

    The energy-efficiency gap has been high on research and policy agendas for several decades. Incentive schemes such as subsidies, taxes and bonus-malus schemes are widely used to promote energy-efficient appliances. Most research, however, considers instruments in isolation, and only rarely in the context of political constraints on instrument use, or for alternative policy goals. This paper presents a methodology for the optimal design of incentive schemes based on the minimisation of Dead Weight Loss for different policy goals and policy restrictions. The use of the methodology is illustrated by designing optimal combinations of taxes and subsidies in Spain for three types of appliance: dishwashers, refrigerators and washing machines. The optimal policies are designed subject to different policy goals such as achieving a fixed reduction in emissions or a certain increased market share for efficient appliances, and for policy constraints such as budget neutrality. The methodology developed here can also be used to evaluate past and current incentive schemes. - Highlights: • A new methodology for the optimal design of incentive schemes is presented. • This is done minimising the Dead Weight Loss for different goals and restrictions. • Efficient bonus malus schemes can be designed with this method.

  4. Patterns of low temperature induced accumulation of dehydrins in Rosaceae crops-Evidence for post-translational modification in apple.

    Science.gov (United States)

    Haimi, Perttu; Vinskienė, Jurgita; Stepulaitienė, Inga; Baniulis, Danas; Stanienė, Gražina; Šikšnianienė, Jūratė Bronė; Rugienius, Rytis

    2017-11-01

    Important crop plants of Rosaceae family are often damaged during winter due to the lack of acclimation and cold hardiness. One of the cellular responses of plants to cold stress is the accumulation of dehydrin proteins. We studied the expression of dehydrins in several Rosaceae species during low temperature treatment in vitro. Microshoots of Pyrus communis, Malus×domestica, Fragaria vesca, Fragaria×ananassa, Prunus cerasus and Prunus avium cultivars were grown in low temperature conditions. Genotype -specific accumulation of dehydrins was detected by immunoblot analysis of the extracted proteins. Untargeted difference gel electrophoresis of Malus x domestica microshoots revealed an extensive accumulation of three dehydrins. In a protein phosphatase assay, MdDHN2 and MdDHN4, but not MdDHN6 proteins were found to be extensively phosphorylated. In terms of the amount of protein synthesized, dehydrins are a major protein-level adaptation mechanism to low temperature in M. x domestica. In addition to dehydrins, the induction of proteins involved in the response for oxidative stress were observed. Additionally, a Xero2 -like dehydrin of F. vesca was detected by difference gel electrophoresis and identified by nano LC-MS/MS. Copyright © 2017 Elsevier GmbH. All rights reserved.

  5. Crop-to-wild gene flow and its fitness consequences for a wild fruit tree: Towards a comprehensive conservation strategy of the wild apple in Europe.

    Science.gov (United States)

    Feurtey, Alice; Cornille, Amandine; Shykoff, Jacqui A; Snirc, Alodie; Giraud, Tatiana

    2017-02-01

    Crop-to-wild gene flow can reduce the fitness and genetic integrity of wild species. Malus sylvestris , the European crab-apple fruit tree in particular, is threatened by the disappearance of its habitat and by gene flow from its domesticated relative , Malus domestica . With the aims of evaluating threats for M. sylvestris and of formulating recommendations for its conservation, we studied here, using microsatellite markers and growth experiments: (i) hybridization rates in seeds and trees from a French forest and in seeds used for replanting crab apples in agrosystems and in forests, (ii) the impact of the level of M. domestica ancestry on individual tree fitness and (iii) pollen dispersal abilities in relation to crop-to-wild gene flow. We found substantial contemporary crop-to-wild gene flow in crab-apple tree populations and superior fitness of hybrids compared to wild seeds and seedlings. Using paternity analyses, we showed that pollen dispersal could occur up to 4 km and decreased with tree density. The seed network furnishing the wild apple reintroduction agroforestry programmes was found to suffer from poor genetic diversity, introgressions and species misidentification. Overall, our findings indicate supported threats for the European wild apple steering us to provide precise recommendations for its conservation.

  6. Asignación de primas en el seguro del automóvil utilizando el Análisis en ComponentesPrincipales Funcionales = Premium allocation in the car insurance by using Functional Principal Component Analysis.

    Directory of Open Access Journals (Sweden)

    Herranz Peinado, C. Patricia

    2007-01-01

    Full Text Available El estudio de las primas de riesgo en el seguro del automóvil es de suma importancia, debido a la gran competitividad existente en el mercado asegurador. En este artículo se pretende proponer un sistema de bonificación-penalización de las primas de riesgo utilizando el Análisis Funcional en Componentes Principales. En concreto, se realiza un estudio empírico con los datos reales de una compañía aseguradora con cobertura nacional. Aplicando el sistema propuesto de bonificación-penalización a los perfiles de comportamiento de los asegurados, se obtienen las primas de riesgo para cada uno de los perfiles considerados y tramos de edad. = The study of the premium risk in the car insurance is really important because the insurance market is very competitive. In this article we show a bonus-malus method of risk premiums. To do this, we use the Functional Principal Component Analysis. More precisely, we explain an empirical study with the real data of an insurance company. By applying the bonus-malus method that we have given, we are able to obtain the premium risk for different profiles and age ranges.

  7. Aceitação e preferência de frutos para oviposição em duas populações de Ceratitis capitata (Diptera, Tephritidae)

    OpenAIRE

    Joachim-Bravo,Iara Sordi; Silva-Neto,Alberto Moreira da

    2004-01-01

    The influence of four host fruits, orange (Citrus sinensis L.), papaya (Carica papaya L.), mango (Mangifera indica L.) and apple (Malus domestica Borkh) on oviposition behavior of Ceratitis capitata (Wiedemann, 1824) was evaluated. Experiments were carried out on two C. capitata laboratory-reared populations: one with artificial diet for 10 years with periodic introduction of wild flies and other reared with artificial diet for 20 years without wild flies introduction. In acceptance experimen...

  8. Acceptance and preference of fruits for oviposition in two Ceratitis capitata (Diptera, Tephritidae) populations

    OpenAIRE

    Joachim-Bravo, Iara Sordi; Silva-Neto, Alberto Moreira da

    2004-01-01

    The influence of four host fruits, orange (Citrus sinensis L.), papaya (Carica papaya L.), mango (Mangifera indica L.) and apple (Malus domestica Borkh) on oviposition behavior of Ceratitis capitata (Wiedemann, 1824) was evaluated. Experiments were carried out on two C. capitata laboratory-reared populations: one with artificial diet for 10 years with periodic introduction of wild flies and other reared with artificial diet for 20 years without wild flies introduction. In acceptance experimen...

  9. Free amino nitrogen concentration correlates to total yeast assimilable nitrogen concentration in apple juice

    OpenAIRE

    Boudreau, Thomas F.; Peck, Gregory M.; O'Keefe, Sean F.; Stewart, Amanda C.

    2017-01-01

    Abstract Yeast assimilable nitrogen (YAN) is essential for yeast growth and metabolism during apple (Malus x domestica Borkh.) cider fermentation. YAN concentration and composition can impact cider fermentation kinetics and the formation of volatile aroma compounds by yeast. The YAN concentration and composition of apples grown in Virginia, USA over the course of two seasons was determined through analysis of both free amino nitrogen (FAN) and ammonium ion concentration. FAN was the largest f...

  10. Oviposition efficacy of Drosophila suzukii (Diptera: Drosophilidae) on different cultivars of blueberry.

    Science.gov (United States)

    Kinjo, Hirotoshi; Kunimi, Yasuhisa; Ban, Takuya; Nakai, Madoka

    2013-08-01

    Drosophila suzukii (Matsumura) is an important pest of thin-skinned fruits including blueberry, raspberry, strawberry, and cherry. Blueberry was introduced into Japan in the 1950s, and severe economic losses attributable to D. suzukii were first reported in 2002. The objective of this study was to elucidate whether oviposition behavior varies among blueberry cultivars having different firmness of fruit. Fruit firmness in 12 cultivars of highbush blueberry (Vaccinium corymbosum L.) and rabbiteye blueberry (Vaccinium virgatum Aiton) was determined using a rheometer. More eggs tended to be laid in berries of cultivars possessing softer fruits than in those having firmer fruits. Choice tests, where one female was allowed to oviposit on blueberry fruits with different firmness, showed that softer fruits were more vulnerable to D. suzukii females than firmer fruits.

  11. Data in support of antioxidant activities of the non-extractable fraction of dried persimmon (Diospyros kaki Thunb.

    Directory of Open Access Journals (Sweden)

    Yoko Matsumura

    2016-09-01

    Full Text Available This data article is related to the research article entitled, “Antioxidant potential in non-extractable fraction of dried persimmon (Diospyros kaki Thunb.” (Matsumura et al., 2016 [1]. We investigated antioxidant activities of the non-extractable fraction of dried persimmon fruits in vitro and in vivo. We evaluated both extracted fraction and non-extractable fraction, and reported that non-extractable fraction may possess significantly antioxidant potential in vivo on the basis of the oxygen radical absorbance capacity (ORAC. We showed our experimental raw data about antioxidant capacity of dried persimmon, plasma triglycerides (TG and HDL-cholesterol (HDL-C, and this data article might contribute to evaluate real antioxidant capacity of other fruits and vegetables. Keywords: Persimmon, Antioxidant activity, Oxygen radical absorbance capacity (ORAC, Model of the gastrointestinal tract

  12. Genetic mapping of 14 avirulence genes in an EU-B04 × 1639 progeny of Venturia inaequalis.

    Science.gov (United States)

    Broggini, Giovanni A L; Bus, Vincent G M; Parravicini, Gabriella; Kumar, Satish; Groenwold, Remmelt; Gessler, Cesare

    2011-02-01

    Durable resistance to apple scab (Venturia inaequalis (Cke) Wint; anamorph Spilocaea pomi Fries) is one of the major goals of apple (Malus) breeding programs. Since current scab resistance breeding is heavily reliant on genes with gene-for-gene relationships, a good understanding of the genetic basis of host-pathogen interactions needs to be developed for this strategy to be successful. While the genomic organization of apple scab resistance genes has been studied extensively, little is known about the avirulence genes in the pathogen. The progeny of a cross of European V. inaequalis race (1) isolate EU-B04 and race (1,2,8,9) isolate 1639 was used to generate a genetic map based on microsatellite and AFLP markers, and investigated for inheritance of avirulence traits on 20 Malus accessions representing 17 scab resistance genes. The accessions comprised scab differential hosts (0), (1), (2), (8), and (9), and hosts carrying known as well as not previously reported secondary resistance genes, including some identified in crosses that have resistant accessions 'Geneva', 'Dolgo', Malus baccata jackii, M. micromalus, or 'Antonovka' in their pedigree. The latter genes appear to be narrow spectrum genes that showed gene-for-gene relationships as a segregation ratio of Avr:avr=1:1 was observed on 12 accessions, while a ratio of 3:1 was observed on five accessions and a ratio of 7:1 on one host. All progenies were shown to be pathogenic, as all of them were able to infect hosts (0) and (1). A genetic map consisting of 15 major linkage groups (LGs) and spanning 972cM was generated with the aid of 156 markers. The map position of 12 avirulence traits was determined: eight avirulence genes mapped into two separate clusters (1: AvrVdg2, AvrVv1, AvrVu1, AvrVrjrd; and 2: AvrVu2, AvrVh3.2, AvrVs1, AvrVu4), while four avirulence genes (AvrRvi8, AvrVv2, AvrVt57 and AvrVsv) mapped to different LGs. AvrRvi2 and AvrRvi9 also are genetically linked, but showed an interaction with Avr

  13. Temperaturas efetivas para a dormência da macieira(Malus domestica Borkh Effective temperatures for apple tree dormancy (Malus domestica Borkh

    Directory of Open Access Journals (Sweden)

    Gilberto Luiz Putti

    2003-08-01

    Full Text Available As cultivares de macieira exigem diferentes requerimentos em frio, ou seja, o total de horas abaixo de um limite de temperatura do ar, porém são poucas as informações sobre quais temperaturas são mais eficientes para superar a dormência. As cultivares de macieira Condesa, Baronesa, Daiane, Imperatriz, Fuji e Gala foram estudadas quanto à quantidade de frio e as temperaturas do ar para a indução da brotação. O delineamento experimental foi o inteiramente casualizado, no esquema fatorial, com seis cultivares, cinco níveis de unidades de frio ( 300; 600; 900; 1200 e 1500 UF e três temperaturas do ar ( 5; 10 e 15ºC. O tempo médio para brotação foi menor quando as cultivares foram submetidas a 1.500 unidades de frio, independentemente da temperatura. A temperatura efetiva para acumular frio varia com a cultivar, podendo chegar até 15ºC para cultivares de menor exigência em frio.Apple tree cultivars demand several requirements in cold but there's a little of information about what temperatures are the most efficient. Apple tree cultivars Condesa, Baronesa, Daiane, Imperatriz, Fuji and Gala were studied on quantity of cold and different temperatures for shooting inducement. Experimental delineation was full casualized on the factorial system, with six cultivars, five levels of cold unities and three temperatures. Average time for shooting was minor when the cultivars were exposed to 1,500 cold unities independently of the temperature. Effective temperature in order to accumulate cold ranges according to the cultivar, and it is able reaching until 15ºC in case of cultivar of lower demand in cold.

  14. Towards durabale resistance to apple scab using cisgenes

    OpenAIRE

    Joshi, S.G.

    2010-01-01

    Apple (Malus x domestica) is one of the important fruit crops of the world. It is mainly cultivated in temperate regions. Apple fruit contains many health beneficial compounds which may play an important role in reducing cancer cell proliferation and lowering the level of cholesterol. Apple production can suffer from several pests and diseases and among them scab is very important. Apple scab is a fungal disease caused by Venturia inaequalis. The pathogen is a facultative saprophyte that gro...

  15. Transcriptomic events associated with internal browning of apple during postharvest storage

    OpenAIRE

    Mellidou, Ifigeneia; Buts, Kim; Hatoum, Darwish; Ho, Quang Tri; Johnston, Jason W; Watkins, Christopher B; Schaffer, Robert J; Gapper, Nigel E; Giovannoni, Jim J; Rudell, David R; Hertog, Maarten LATM; Nicolai, Bart M

    2014-01-01

    Background Postharvest ripening of apple (Malus x domestica) can be slowed down by low temperatures, and a combination of low O2 and high CO2 levels. While this maintains the quality of most fruit, occasionally storage disorders such as flesh browning can occur. This study aimed to explore changes in the apple transcriptome associated with a flesh browning disorder related to controlled atmosphere storage using RNA-sequencing techniques. Samples from a browning-susceptible cultivar (‘Braeburn...

  16. Ionic gelation of low-esterification degree pectins from immature thinned apples

    OpenAIRE

    Rascón-Chu, Agustín; Martínez-López, Ana-Luisa; Carvajal-Millán, Elizabeth; Martínez-Robinson, Karla G.; Campa-Mada, Alma C.

    2016-01-01

    Fruit thinning is a regular practice in apple (Malus x domestica Borkh.) orchards to increase fruit size and to promote blooming. This practice generates immature, small (10 to 40 mm diameter) fruits, which are occasionally used as cattle feed. The use of thinned apples for pectin extraction could increase orchards profitability and promote development of new transformation processes. Pectin is a polysaccharide located on the cell wall of plant tissues. Commercial pectins are extracted from d...

  17. Advances in Apple Transformation Technology to Confer Resistance to Fungal Diseases in Apple Crops: A Chilean Perspective Avances de la Tecnología de Transformación del Manzano para Conferir Resistencia a Enfermedades Fungosas en su Cultivo: Una Perspectiva Chilena

    Directory of Open Access Journals (Sweden)

    Víctor Polanco

    2010-06-01

    Full Text Available Apple (Malus domestica Borkh. is one of the most consumed fruit in the world. Genetic transformation is a key process to sustain this demand by permitting the potential enhancement of existing cultivars as well as the development of new cultivars resistant to pests, diseases, and storage problems that occur in the major production areas. This review summarizes the advances of genetic engineering applied to the development of resistant apple cultivars to fungus disease, with particular attention in the generation of apples resistant to Venturia inaequalis (Cooke G.Winter, the main phytosanitary problem that affects apple crops in Chile.La manzana (Malus domestica Borkh. es una de las frutas más consumidas en el mundo. La transformación genética es un proceso clave para sustentar esta demanda, permitiendo el mejoramiento potencial de los cultivares existentes, así como el desarrollo de nuevas variedades resistentes a plagas, enfermedades y problemas de almacenamiento que se originan en las zonas de producción más importantes. Esta revisión resume los avances de la ingeniería genética aplicada al desarrollo de variedades de manzana resistentes a enfermedades fungosas, con especial atención en la generación de manzanas resistentes a Venturia inaequalis (Cooke G.Winter, el principal problema fitosanitario que afecta a los cultivos de manzana en Chile.

  18. Genetical metabolomics in apples (Malus x domestica Borkh)

    NARCIS (Netherlands)

    Khan, S.A.

    2012-01-01

    The aim of this thesis was finding genes that control the production of potentially health beneficial metabolites in apple fruits. The approach was genetic mapping of secondary metabolites such as phenolic compounds in an F1 progeny, leading to the detection of genetic loci that controlled these

  19. A distinct species, Dodona formosana, detected in the Dodona eugenes species complex: clarification of the taxonomic status of the Punch butterfly in Taiwan

    Science.gov (United States)

    Wu, Li-Wei; Lin, Wen-Jie; Hsu, Yu-Feng

    2018-01-01

    Abstract The Tailed Punch, Dodona eugenes, is widely distributed in East Asia with seven subspecies currently recognized. However, two of them, namely ssp. formosana and ssp. esakii found in Taiwan, are hard to distinguish from each other due to ambiguous diagnostic characters. In this study, their taxonomic status is clarified by comparing genitalia characters and phylogenetic relationships based on mitochondrial sequences, COI and COII (total 2211 bps). Our results show that there is no reliable feature to separate these two subspecies. Surprisingly we found that Dodona in Taiwan is more closely related to the Orange Punch, D. egeon, than to other subspecies of D. eugenes. Therefore, the following nomenclatural changes are proposed: Dodona eugenes formosana is revised to specific status as Dodona formosana Matsumura, 1919, stat. rev, and ssp. esakii is sunk to a junior synonym of Dodona formosana syn. n. PMID:29674868

  20. A distinct species, Dodona formosana, detected in the Dodona eugenes species complex: clarification of the taxonomic status of the Punch butterfly in Taiwan

    Directory of Open Access Journals (Sweden)

    Li-Wei Wu

    2018-02-01

    Full Text Available The Tailed Punch, Dodona eugenes, is widely distributed in East Asia with seven subspecies currently recognized. However, two of them, namely ssp. formosana and ssp. esakii found in Taiwan, are hard to distinguish from each other due to ambiguous diagnostic characters. In this study, their taxonomic status is clarified by comparing genitalia characters and phylogenetic relationships based on mitochondrial sequences, COI and COII (total 2211 bps. Our results show that there is no reliable feature to separate these two subspecies. Surprisingly we found that Dodona in Taiwan is more closely related to the Orange Punch, D. egeon, than to other subspecies of D. eugenes. Therefore, the following nomenclatural changes are proposed: Dodona eugenes formosana is revised to specific status as Dodona formosana Matsumura, 1919, stat. rev, and ssp. esakii is sunk to a junior synonym of Dodona formosana syn. n.

  1. Transcriptome changes in apple peel tissues during CO2 injury?symptom development under controlled atmosphere storage regimens

    OpenAIRE

    Johnson, Franklin T; Zhu, Yanmin

    2015-01-01

    Apple (Malus ? domestica Borkh.) is one of the most widely cultivated tree crops, and fruit storability is vital to the profitability of the apple fruit industry. Fruit of many apple cultivars can be stored for an extended period due to the introduction of advanced storage technologies, such as controlled atmosphere (CA) and 1-methylcyclopropane (1-MCP). However, CA storage can cause external CO2 injury for some apple cultivars. The molecular changes associated with the development of CO2 inj...

  2. QTL analysis of soft scald in two apple populations

    OpenAIRE

    McClure, Kendra A; Gardner, Kyle M; Toivonen, Peter MA; Hampson, Cheryl R; Song, Jun; Forney, Charles F; DeLong, John; Rajcan, Istvan; Myles, Sean

    2016-01-01

    The apple (Malus?domestica Borkh.) is one of the world?s most widely grown and valuable fruit crops. With demand for apples year round, storability has emerged as an important consideration for apple breeding programs. Soft scald is a cold storage-related disorder that results in sunken, darkened tissue on the fruit surface. Apple breeders are keen to generate new cultivars that do not suffer from soft scald and can thus be marketed year round. Traditional breeding approaches are protracted a...

  3. Development of a protocol that allows safe consumption of the hypoallergenic apple cultivar Santana

    OpenAIRE

    Maas, van der, M.P.; Schenk, M.F.

    2009-01-01

    The apple (Malus ×domestica) cultivar Santana was shown to have a low allergenicity in a previously reported clinical trial. A protocol was developed to validate these results outside a clinical setting and to market the Santana as a hypoallergenic apple for large-scale consumption. This protocol was designed to ensure safe consumption of the Santana by consumers suffering from apple allergy. We tested the protocol in a pilot in 100 supermarket stores and evaluated in an internet-based survey...

  4. Ensuring sustained user quality in buildings. Success contracting with functional tendering of the building services equipment guarantees quality for 15 years; Nutzerqualitaet in Gebaeuden dauerhaft sicherstellen. Erfolgscontracting mit funktionaler Ausschreibung ermoeglicht eine 15-jaehrige Garantie auf die Gebaeudetechnik

    Energy Technology Data Exchange (ETDEWEB)

    Milles, Uwe

    2012-07-01

    Until now, buildings regularly require more energy and provide less user quality in practice than was to be expected from the installed technology during the planning. That has structural reasons. The naerco research project has investigated this aspect and developed the success contracting concept: pre-defined energy and quality parameters are contracted out as part of a function-based tender. A contractor guarantees their realisation for 15 years. The contractual process also includes continual control of the agreed values and a bonus-malus system.

  5. Models in Insurance: Paradigms, Puzzles, Communications and Revolutions.

    Science.gov (United States)

    1980-06-01

    80.7] G. Buoro, G. Pavesi and G. Zucchiatti, "Osservazioni sul Sistema di Calcolo del Margine di Solvabiliti," 71-80. [80.8] J. Calcanis and A...Vegas, "Un Ensayo sobre la Concepci6n Sistema aplicada a la Empresa de Seguros," 443-462. [80.41] K. H. Wolff, "Zur numerischen Berechnung der... Teoria della Credibilit&," Giornale dell’ Istituto degli Attuari, 27, 219-231 (1964). (D51 N. De Pril, "The Efficiency of a Bonus-Malus System," AB, 10

  6. Desarrollo de alimentos tipo snack de bajo contenido graso a partir de discos de manzana verde

    OpenAIRE

    Tavera Quiroz, María José

    2015-01-01

    Esta investigación se basó en el desarrollo de productos tipo snack bajos en grasa a partir de manzana verde Granny Smith (Malus domestica). Se desarrollaron snacks a partir de manzanas verdes estudiando diferentes alternativas de cocción (fritado, horneado o su combinación) con el objetivo de obtener productos con menor contenido graso que los tradicionales pero con las propiedades que los consumidores valoran en los mismos, como el color y la textura crocante. Para ello se analizó...

  7. Costos y rendimientos de producción de tres néctares de manzana (pyrusmalusl) variedades Anna, Pensilvania y Winter

    OpenAIRE

    Darío Alberto Pinto Medina; Yesenia Fernández Vargas; Efrain Martinez Quintero

    2016-01-01

    La agroindustria en Colombia se muestra como una alternativa para dar aprovechamiento eficiente a materias primas de origen agropecuario, especialmente aquellas que por parámetros de calidad, no salen al mercado y generan cuantiosas pérdidas a agricultores y ganaderos; esta investigación se basó principalmente en el aprovechamiento de la manzana (Pyrus malus L), se elaboró néctar con tres variedades producidas en el departamento de Boyacá, Colombia: Pensilvania, Anna y Winter y se evaluaron l...

  8. Harvest Date Influences Superficial Scald Development in Granny Smith Apples During Long Term Storage

    OpenAIRE

    ERKAN, Mustafa; PEKMEZCİ, Mustafa

    2014-01-01

    The effects of harvest dates on superficial scald development and postharvest quality in 'Granny Smith' apples (Malus domestica Borkh.) were investigated. Apples were harvested at 15-day intervals during 2 consecutive years (2000-2001) and stored at 0 °C with 90% relative humidity for 8 months. At the end of the 8 - month storage period plus an additional 1 week at 20 °C the percentage of superficial scald was lower (24.4%) in late harvested (November 15) apples than in ap...

  9. Columnar apple tree named 'Moonlight'

    OpenAIRE

    Tupý, J. (Jaroslav); Louda, O. (Otto); Zima, J. (Jan)

    2010-01-01

    A new and distinct Malus domestica (Borkh.) apple tree variety is provided which exhibits a columnar tree type, weakly vigorous compact growth, predominant bearing on spurs and V.sub.f-resistance against scab. The new variety yields late maturing, medium-sized, globose-conical to conical fruits having good storage quality. The fruit color is yellow-green to yellow with a partial red to orange blush. The fruits have a yellow-colored firm flesh that is crisp and juicy with a good sweet/sour bal...

  10. Bioinformatics Evaluation of Plant Chlorophyllase, the Key Enzyme in Chlorophyll Degradation

    Directory of Open Access Journals (Sweden)

    Ebrahim Sharafi

    2017-06-01

    Full Text Available Background and Objective: Chlorophyllase catalyzes the hydrolysis of chlorophylls to chlorophyllide and phytol. Recently, several applications including removal of chlorophylls from vegetable oils, use in laundry detergents and production of chlorophyllides have been described for chlorophyllase. However, there is little information about the biochemical characteristics of chlorophyllases.Material and Methods: 35 chlorophyllase protein sequences were obtained from the National Centre for Biotechnology Information database. All of the sequences were analyzed using bioinformatics tools for their conserved domain, phylogenetic relationships and biochemical characteristics.Results and Conclusion: The overall domain architecture of chlorophyllases consisted of the esterases/lipases superfamily domain over their full length and the alpha/beta hydrolase family domain over the middle part of their sequences. Plant chlorophyllases could be classified into 4 clades. Molecular weight and pI of the chlorophyllases ranged 32.65-37.77 kDa and 4.80-8.97, respectively. The most stable chlorophyllase is probably obtained from Malus domestica. Chlorophyllases form Solanum pennellii, Triticum aestivum, Triticum urartu, Arabidopsis lyrata, Pachira macrocarpa, Prunus mume and Malus domestica were predicted to be soluble upon overexpression in Escherichia coli, Beta vulgaris and Chenopodium album chlorophyllases were predicted to form no disulfide bond. Chlorophyllases from Jatropha curcas, Amborella trichopod, Setaria italica, Piper betle, Triticum urartu and Arabidopsis thaliana were predicted to be in non-N-glycosylated form.Conflict of interest: The authors declare no conflict of interest.

  11. A case of traumatic intracranial vertebral artery injury presenting with life-threatening symptoms

    Directory of Open Access Journals (Sweden)

    Kishi S

    2012-04-01

    Full Text Available Seiji Kishi1, Kenji Kanaji2, Toshio Doi1, Tadashi Matsumura21Department of Nephrology, Tokushima University Hospital, Kuramoto-cho Tokushima, 2Department of General Internal Medicine, Rakuwakai Otowa Hospital, Otowachinji-cho Yamashina-ku Kyoto, JapanAbstract: Traumatic intracranial vertebral artery injury is a relatively rare but potentially fatal disease. We present a case of a 63-year-old man who presented with sudden onset of loss of consciousness after hitting his head. After immediate resuscitation, he showed quadriplegia and absence of spontaneous breathing. Brain and cervical spine magnetic resonance imaging revealed an atlantoaxial subluxation, fractured C2 odontoid process, left vertebral artery occlusion, and bilateral extensive ischemia in the medulla oblongata and high cervical spinal cord. Digital subtraction angiography demonstrated left vertebral artery dissection just below the level of vertebral body C2.Keywords: vertebral artery dissection, brainstem infarction, bilateral spinal cord infarction, neck trauma

  12. Measuring and modelling the water use of fruit tree orchards in the Western Cape province of South Africa

    CSIR Research Space (South Africa)

    Gush, Mark B

    2012-10-01

    Full Text Available There is increasing competition among the various sectors of the South African economy for limited water resources, and irrigated agriculture is estimated to use approximately 60% of available surface water (NWRS2, 2012). With a 90% dependence on irrigation... ?Cripps Pink? (?Pink Lady?) apple (Malus domestica) orchard in the Koue Bokkeveld region near Ceres (S33? 12? 03.57?; E19? 20? 15.06?), and an eight- year old ?Alpine? nectarine (Prunus persica) orchard near Wolseley (S33? 25? 0.59? and E19? 14? 44...

  13. The ability of fruit and vegetable enzyme system to hydrolyse ester bonds

    Directory of Open Access Journals (Sweden)

    Agnieszka Mironowicz

    2014-01-01

    Full Text Available The pulp of potato tubers (Solanum tuberosum, topinambur (Helianthus tuberosus and apples (Malus silvestris can hydrolyse totally, or almost totally, ester bonds in phenyl, α- and β-naphthyl, benzyl and cinnamyl acetates. In methyl 4-acetoxy-3-metoxybenzoate and methyl 2,5-diacetoxybenzoate as well as testosterone propionate and 16,17-acetonide of 21-acetoxy-6-fluoro-16α,17β,21-trihydroxy-4-pregnen-3,20-dione, the hydrolysis is selective towards the substrate and the bioreagent. In contrast, ethyl benzoate and cinnamate are resistant to hydrolysis.

  14. Bill project introducing a progressive price fixing of energy - Nr 150

    International Nuclear Information System (INIS)

    Brottes, Francois; Le Roux, Bruno

    2012-01-01

    This bill project aims at speeding up energy transition by inciting households to reduce their consumption, and at accompanying the unavoidable increase of energy prices. It introduces a rather complex process to establish the energy tariff, and notably a bonus-malus principle. The objective is to incite households to better insulate their main housing. It also takes social tariffs into account, defines institutions and representative for energy regulation, proposes the implementation of a public service for housing energy performance, and addresses the issue of energy supply in winter to households in precarious situation

  15. Fire blight resistance in wild accessions of Malus sieversii

    Science.gov (United States)

    Fire blight (Erwinia amylovora) is a devastating bacterial disease in apple that results in severe economic losses. Epidemics are becoming more common as susceptible cultivars and rootstocks are being planted, and control is becoming more difficult as antibiotic-resistant strains develop. Resistan...

  16. Conservação da maçã (Malus domestica Borkh. cv. Braeburn Storage in controlled atmosphere of 'Braeburn' (Malus domestica, Borkh. apples

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2000-04-01

    Full Text Available O experimento foi desenvolvido com o objetivo de avaliar o efeito da temperatura e de diferentes regimes de armazenamento em atmosfera controlada (AC sobre as qualidades físico-químicas e ocorrência de distúrbios fisiológicos da maçã cv. Braeburn. O delineamento experimental foi o inteiramente casualizado, com duas repetições e a unidade experimental composta por 40 frutos. Os frutos foram armazenados nas seguintes condições de AC: na temperatura de 1ºC com 1,5kPaO2/ 4,0kPaCO2, 1,5kPaO2/3,0kPaCO2, 1,0kPaO2/1,0kPaCO2, 1,0kPaO2/2,0kPaCO2, 1,0kPaO2/3,0kPaCO2 e em armazenamento refrigerado (AR e na temperatura de 0ºC com 1,0kPaO2/3,0kPaCO2 e em AR. A umidade relativa foi mantida a 96%. As análises laboratoriais foram realizadas aos oito meses de armazenamento, na abertura das câmaras e após sete dias de exposição à temperatura ambiente (±31ºC. Logo após a retirada dos frutos da câmara, não se observaram diferenças significativas na firmeza de polpa, acidez titulável e teor de sólidos solúveis totais (SST entre as condições de AC. Contudo, após sete dias de exposição à temperatura ambiente, o tratamento com 1,0kPaO2/3,0kPaCO2, na temperatura de 0ºC, manteve a firmeza de polpa, acidez titulável e o teor de SST mais elevados, além de não exibir degenerescência senescente. O armazenamento em AC com 4,0kPa de CO2 e o armazenamento refrigerado causaram degenerescência senescente. Já a degenerescência com cortiça foi induzida pelo uso de 3,0 e 4,0kPa de CO2, associado com 1,5kPa de O2. As podridões foram significativamente maiores em AR do que em AC, sendo mais freqüente em baixa concentração de CO2 (1kPa. A incidência de rachaduras e escaldadura foi insignificante e não foi associada a nenhuma condição de armazenamento. No armazenamento refrigerado, os frutos apresentaram qualidade insatisfatória para a comercialização e consumo após oito meses de armazenamento.The experiment was carried out with the objective of evaluating the effect of the temperature and of different controlled atmosphere (CA storage regimes on the fruit qualities, and occurrence of physiological disorders of 'Braeburn' apples. The experimental design was the completely randomized with two replication. Fruits were stored in cold storage at 0 and 1ºC and in the following CA conditions: at temperature of 1ºC with 1,5kPaO2/4,0KkPaCO2, 1,5kPaO2/3,0kPaCO2, 1,0kPaO2/ 1,0kPaCO2, 1,0kPaO2/2,0kPaCO2, 1,0kPaO2/3,0kPaCO2 and at temperature of 0ºC with 1,0kPaO2/3,0kPaCO2. The relative humidity was maintained around 96%. The evaluation was done after eight months of storage, at the opening of the chambers and after seven days shelf life (31ºC. At chambers openning, there was no significant difference in the flesh firmness, titratable acidity and total soluble solids (TSS among the CA conditions. However, after seven days in shelf life, the treatment with 1,0kPaO2/3,0kPaCO2 in the temperature of 0ºC maintained higher flesh firmness, titratable acidity and TSS, and did not exhibiting flesh breakdown. The CA storage, with 4,0kPa CO2 and cold storage caused flesh breakdown. Already the cork breakdown, was induced by 3,0 and 4,0kPa of CO2 associated with 1,5kPa of O2. The occurrence of rot was significantly higher in cold storage than in CA and more frequent al low CO2 (1kPa. The incidence of mealiness and scald could not be associated with any storage condition. Cold storage fruits presented unsatisfactory quality for marketing and consumption after 8 months of storage.

  17. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape.

    Science.gov (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi

    2011-10-01

    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  18. Review of the clavatus group of the lanternfly genus Pyrops (Hemiptera: Fulgoromorpha: Fulgoridae

    Directory of Open Access Journals (Sweden)

    Jérôme Constant

    2017-03-01

    Full Text Available The clavatus group of Pyrops Spinola, 1839 is reviewed and redefined. The new combination Pyrops atroalbus (Distant, 1918 comb. nov. is proposed, as atroalbus is reinstated as a full species from status of subspecies of Pyrops watanabei (Matsumura, 1913. Pyrops nigripennis (Chou & Wang, 1985 and Pyrops clavatus mizunumai (Sato & Nagai, 1994 are proposed as junior synonyms of P. clavatus (Westwood, 1839. The Philippine species P. polillensis (Baker, 1925 is removed from the group and not attributed to any of the currently defined species groups. Hence, the clavatus group is restricted to continental Southeast Asia and Taiwan and contains three species: P. atroalbus comb. nov., P. clavatus and P. watanabei. A key to the species of the group and illustrations of the male genitalia are provided. The intraspecific colour variation in the group is discussed and illustrated. The genus Pyrops is removed from the subfamily Fulgorinae and not attributed to any of the currently defined subfamilies of Fulgoridae.

  19. The invasive spotted-wing Drosophila (Diptera, Drosophilidae has been found in the city of São Paulo (Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Ribeiro Vilela

    2014-12-01

    Full Text Available The invasive spotted-wing Drosophila (Diptera, Drosophilidae has been found in the city of São Paulo (Brazil. Drosophila suzukii (Matsumura, 1931, the cherry fly or spotted-wing Drosophila, a pest species from the Oriental and southeastern Palaearctic regions belonging to the melanogaster group, invaded the Nearctic and western countries of the Palaearctic regions late last decade (2008 and, more recently (2013, the southern Brazilian states of Rio Grande do Sul and Santa Catarina. Early in 2014 it was reared from blueberries produced in São Joaquim, state of Santa Catarina, that were bought at a São Paulo city grocery store. Despite being a cold-adapted species, after having arrived to the southeastern state of São Paulo, this invasive fly will probably expand its territory to other Brazilian states and South American countries through trade of cultivated soft skin small fruits, such as blueberries and strawberries, as well as naturally through the use of small wild fruits as breeding sites.

  20. Cisgenic Rvi6 scab-resistant apple lines show no differences in Rvi6 transcription when compared with conventionally bred cultivars.

    Science.gov (United States)

    Chizzali, Cornelia; Gusberti, Michele; Schouten, Henk J; Gessler, Cesare; Broggini, Giovanni A L

    2016-03-01

    The expression of the apple scab resistance gene Rvi6 in different apple cultivars and lines is not modulated by biotic or abiotic factors. All commercially important apple cultivars are susceptible to Venturia inaequalis, the causal organism of apple scab. A limited number of apple cultivars were bred to express the resistance gene Vf from the wild apple genotype Malus floribunda 821. Positional cloning of the Vf locus allowed the identification of the Rvi6 (formerly HcrVf2) scab resistance gene that was subsequently used to generate cisgenic apple lines. It is important to understand and compare how this resistance gene is transcribed and modulated during infection in conventionally bred cultivars and in cisgenic lines. The aim of this work was to study the transcription pattern of Rvi6 in three classically bred apple cultivars and six lines of 'Gala' genetically modified to express Rvi6. Rvi6 transcription was analyzed at two time points using quantitative real-time PCR (RT-qPCR) following inoculation with V. inaequalis conidia or water. Rvi6 transcription was assessed in relation to five reference genes. β-Actin, RNAPol, and UBC were the most suited to performing RT-qPCR experiments on Malus × domestica. Inoculation with V. inaequalis conidia under conditions conducive to scab infection failed to produce any significant changes to the transcription level of Rvi6. Rvi6 expression levels were inconsistent in response to external treatments in the different apple cultivars, and transgenic, intragenic or cisgenic lines.

  1. Apple hypanthium firmness: New insights from comparative proteomics

    KAUST Repository

    Marondedze, Claudius

    2012-06-26

    Fruit firmness constitutes an important textural property and is one of the key parameters for estimating ripening and shelf life, which has a major impact on commercialization. In order to decipher the mechanisms related to firmness of apples (Malus × domestica Borkh.), two-dimensional gel electrophoresis (2-DE) was used to compare the total proteome of high and low firmness phenotypes from apple hypanthia of a \\'Golden Delicious\\' × \\'Dietrich\\' population. A total of 36 differentially regulated protein spots were positively identified by matrix assisted laser desorption/ionization-time of flight (MALDI-TOF) mass spectrometry (MS) and then validated against the Malus expressed sequence tags (EST) database. The findings of this study indicated a lower expression of ethylene biosynthesis related proteins in the high firmness phenotype, which could be linked to the slowing down of the ripening and softening processes. The reduced accumulation of proteins involved in ethylene biosynthesis juxtaposed to the upregulation of a transposase and a GTP-binding protein in the high firmness phenotype. The results also showed higher expression of cytoskeleton proteins in the high firmness phenotype compared to the low firmness phenotype, which play a role in maintaining cell structure and possibly fruit integrity. Finally, a number of proteins involved in detoxification and defense were expressed in fruit hypanthium. This proteomic study provides a contribution towards a better understanding of regulatory networks involved in fruit hypanthium firmness and/or softening, which could be instrumental in the development of improved fruit quality. © 2012 Springer Science+Business Media, LLC.

  2. Multifunctional oxidosqualene cyclases and cytochrome P450 involved in the biosynthesis of apple fruit triterpenic acids.

    Science.gov (United States)

    Andre, Christelle M; Legay, Sylvain; Deleruelle, Amélie; Nieuwenhuizen, Niels; Punter, Matthew; Brendolise, Cyril; Cooney, Janine M; Lateur, Marc; Hausman, Jean-François; Larondelle, Yvan; Laing, William A

    2016-09-01

    Apple (Malus × domestica) accumulates bioactive ursane-, oleanane-, and lupane-type triterpenes in its fruit cuticle, but their biosynthetic pathway is still poorly understood. We used a homology-based approach to identify and functionally characterize two new oxidosqualene cyclases (MdOSC4 and MdOSC5) and one cytochrome P450 (CYP716A175). The gene expression patterns of these enzymes and of previously described oxidosqualene cyclases were further studied in 20 apple cultivars with contrasting triterpene profiles. MdOSC4 encodes a multifunctional oxidosqualene cyclase producing an oleanane-type triterpene, putatively identified as germanicol, as well as β-amyrin and lupeol, in the proportion 82 : 14 : 4. MdOSC5 cyclizes 2,3-oxidosqualene into lupeol and β-amyrin at a ratio of 95 : 5. CYP716A175 catalyses the C-28 oxidation of α-amyrin, β-amyrin, lupeol and germanicol, producing ursolic acid, oleanolic acid, betulinic acid, and putatively morolic acid. The gene expression of MdOSC1 was linked to the concentrations of ursolic and oleanolic acid, whereas the expression of MdOSC5 was correlated with the concentrations of betulinic acid and its caffeate derivatives. Two new multifuntional triterpene synthases as well as a multifunctional triterpene C-28 oxidase were identified in Malus × domestica. This study also suggests that MdOSC1 and MdOSC5 are key genes in apple fruit triterpene biosynthesis. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  3. Recovering a hidden polarization by ghost polarimetry.

    Science.gov (United States)

    Janassek, Patrick; Blumenstein, Sébastien; Elsäßer, Wolfgang

    2018-02-15

    By exploiting polarization correlations of light from a broadband fiber-based amplified spontaneous emission source we succeed in reconstructing a hidden polarization in a ghost polarimetry experiment in close analogy to ghost imaging and ghost spectroscopy. Thereby, an original linear polarization state in the object arm of a Mach-Zehnder interferometer configuration which has been camouflaged by a subsequent depolarizer is recovered by correlating it with light from a reference beam. The variation of a linear polarizer placed inside the reference beam results in a Malus law type second-order intensity correlation with high contrast, thus measuring a ghost polarigram.

  4. Determination of trace elements in the seeds of fruits using instrumental neutron activation analysis (INAA) in Arak, I.R. Iran

    International Nuclear Information System (INIS)

    Pourimani Reza; Meighani Elham; Fathivand Aliasghar

    2018-01-01

    In this study, four fruit's seed samples as Punica granatum L., Citrus medica var. limonum, Malus domestica L. and Citrus vulgaris Risso were prepared from Arak's markets. They were analyzed using instrumental neutron activation method (INAA). In this method, Tehran research reactor as a neutron source and relative INAA method has been used as the analysis method and to record gamma ray spectrum, the high purity germanium detector was used. Pomegranate seeds had the highest number of essential elements. Apple seeds and sour orange seeds contain the highest levels of Mg and K, Respectively. (author)

  5. Nr 150 - Private bill introducing a progressive energy tariff

    International Nuclear Information System (INIS)

    Brottes, Francois; Le Roux, Bruno

    2012-01-01

    This document presents a private bill which, by introducing a progressive energy tariff, aims at speeding up energy transition (by inciting households to reduce their consumption, notably by insulating their housing), and at addressing the ineluctable issue of energy price increase. This private bill notably applies a bonus-malus concept by defining an energy consumption threshold which is to be determined by means of several parameters related to climate, housing occupancy, heating mode. This raises several issues concerning for example housing insulation of rented housing. All these aspects lead to a rather complex process to define and implement such a progressive pricing approach

  6. Polyphenol profiles of French cider apple varieties (Malus domestica sp.).

    Science.gov (United States)

    Sanoner, P; Guyot, S; Marnet, N; Molle, D; Drilleau, J P

    1999-12-01

    The cortex of 14 French apple varieties (12 cider and 2 juice varieties), one English cider variety, and one dessert apple (i.e., Golden Delicious) were studied for their polyphenol composition. Total polyphenols were assayed by the Folin-Ciocalteu method, and the precise polyphenolic composition (monomeric catechins, proanthocyanidins, hydroxycinnamic acids, and dihydrochalcones) was obtained by HPLC following thiolysis. ESI-MS and ESI-MS/MS analyses showed that chlorogenic acid and p-coumaroylquinic acid were methylated under the conditions of thiolysis. Depending on the variety, the global polyphenol concentration varied from 1 to 7 g per kilogram of fresh cortex. Cider varieties globally showed a higher polyphenol concentration than the dessert apple Golden Delicious, bitter varieties being the more concentrated. The proportion of the polyphenol classes varied greatly from one cultivar to another. For all varieties, procyanidins were always the predominant class. They were mainly constituted of (-)-epicatechin units with a small proportion of (+)-catechin as a terminal unit. The average degree of polymerization ranged between 4.2 and 7.5 depending upon the variety with an exception for the sharp varieties Guillevic and Avrolles which showed significant concentrations of procyanidins with DPn of 40 and 50, respectively.

  7. An automatic on-line 2,2-diphenyl-1-picrylhydrazyl-high performance liquid chromatography method for high-throughput screening of antioxidants from natural products.

    Science.gov (United States)

    Lu, Yanzhen; Wu, Nan; Fang, Yingtong; Shaheen, Nusrat; Wei, Yun

    2017-10-27

    Many natural products are rich in antioxidants which play an important role in preventing or postponing a variety of diseases, such as cardiovascular and inflammatory disease, diabetes as well as breast cancer. In this paper, an automatic on-line 2,2-diphenyl-1-picrylhydrazyl-high performance liquid chromatography (DPPH-HPLC) method was established for antioxidants screening with nine standards including organic acids (4-hydroxyphenylacetic acid, p-coumaric acid, ferulic acid, and benzoic acid), alkaloids (coptisine and berberine), and flavonoids (quercitrin, astragalin, and quercetin). The optimal concentration of DPPH was determined, and six potential antioxidants including 4-hydroxyphenylacetic acid, p-coumaric acid, ferulic acid, quercitrin, astragalin, and quercetin, and three non-antioxidants including benzoic acid, coptisine, and berberine, were successfully screened out and validated by conventional DPPH radical scavenging activity assay. The established method has been applied to the crude samples of Saccharum officinarum rinds, Coptis chinensis powders, and Malus pumila leaves, consecutively. Two potential antioxidant compounds from Saccharum officinarum rinds and five potential antioxidant compounds from Malus pumila eaves were rapidly screened out. Then these seven potential antioxidants were purified and identified as p-coumaric acid, ferulic acid, phloridzin, isoquercitrin, quercetin-3-xyloside, quercetin-3-arabinoside, and quercetin-3-rhamnoside using countercurrent chromatography combined with mass spectrometry and their antioxidant activities were further evaluated by conventional DPPH radical scavenging assay. The activity result was in accordance with that of the established method. This established method is cheap and automatic, and could be used as an efficient tool for high-throughput antioxidant screening from various complex natural products. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Fine-tuning of the flavonoid and monolignol pathways during apple early fruit development.

    Science.gov (United States)

    Baldi, Paolo; Moser, Mirko; Brilli, Matteo; Vrhovsek, Urska; Pindo, Massimo; Si-Ammour, Azeddine

    2017-05-01

    A coordinated regulation of different branches of the flavonoid pathway was highlighted that may contribute to elucidate the role of this important class of compounds during the early stages of apple fruit development. Apple (Malus × domestica Borkh.) is an economically important fruit appreciated for its organoleptic characteristics and its benefits for human health. The first stages after fruit set represent a very important and still poorly characterized developmental process. To enable the profiling of genes involved in apple early fruit development, we combined the suppression subtractive hybridization (SSH) protocol to next-generation sequencing. We identified and characterized genes induced and repressed during fruit development in the apple cultivar 'Golden Delicious'. Our results showed an opposite regulation of genes coding for enzymes belonging to flavonoid and monolignol pathways, with a strong induction of the former and a simultaneous repression of the latter. Two isoforms of phenylalanine ammonia-lyase and 4-coumarate:CoA ligase, key enzymes located at the branching point between flavonoid and monolignol pathways, showed opposite expression patterns during the period in analysis, suggesting a possible regulation mechanism. A targeted metabolomic analysis supported the SSH results and revealed an accumulation of the monomers catechin and epicatechin as well as several forms of procyanidin oligomers in apple fruitlets starting early after anthesis, together with a decreased production of other classes of flavonoids such as some flavonols and the dihydrochalcone phlorizin. Moreover, gene expression and metabolites accumulation of 'Golden Delicious' were compared to a wild apple genotype of Manchurian crabapple (Malus mandshurica (Maxim.) Kom.). Significant differences in both gene expression and metabolites accumulation were found between the two genotypes.

  9. Obelų selekcinių numerių biologinių savybių tyrimas

    OpenAIRE

    Gelvonauskienė, Dalia; Sasnauskas, Audrius; Gelvonauskis, Bronislovas; Šikšnianienė, Jūratė Bronė; Šabajevienė, Gintarė; Duchovskis, Pavelas

    2006-01-01

    2000–2006 m. Lietuvos sodininkystės ir daržininkystės institute tirtos šešiolikos selekcinių numerių obelų (Malus domestica Borkh.) biologinės savybės. Įvertinta vaismedžių su M.26 poskiepiu (4 x 2,5 m) fenologija, žiedų ir ūglių pašalimas, vaismedžių augumas, atsparumas rauplėms (Venturia inaequalis (Cke) Wint.), filostiktozei (Phyllosticta mali Pr. at Del.), vėžiui (Nectria galligena Bres.) bei fotosintezės pigmentų kiekis lapuose. Nustatyta, kad anksčiausiai žydėti baigia Nr. 19646, o ...

  10. Evaluation of Polyphenol Content and Antioxidant Properties of some Fruit Seeds

    Directory of Open Access Journals (Sweden)

    Liana Claudia Salanţă

    2015-11-01

    Full Text Available A diversity of secondary plant metabolite with an antioxidant character are present in the vegetal extracts, such as: tocopherols, carotenoids, phenolic acids, flavonoids, etc. These compounds intervene in the cellular defense mechanisms against the free radicals and oxidative stress, as they possess anticancer and anti mutation effect. The aim of this work was to study the antioxidant capacity and polyphenol content of methanolic extracts obtained from seeds of fruits: Vitis vinifera, Malus domestica and Citrullus lanatus. Grape seeds have a high content of antioxidants and polyphenols compounds, due to this, it is recommended their used in obtaining functional food with benefit on the human body.

  11. A new method to evaluate the weed-suppressing effect of mulches

    DEFF Research Database (Denmark)

    Arentoft, B. W.; Ali, A.; Streibig, Jens Carl

    2013-01-01

    To suppress weeds in an apple (Malus sp.) orchard, we placed spruce (Picea spp.) bark mulch and cocoa (Theobroma cacao) husk mulch for 3 months in thicknesses of 0, 2.5, 5, 10 and 15 cm. To assess the development of weed cover, an innovative use of log-logistic dose–response models was applied...... (ED50 and ED90) differed significantly within and between mulch types. In all except one instance, the cocoa mulch was superior in suppressing weeds. This method was useful for the evaluation, but further research is needed to give a more general conclusion about the suppression ability of the two...

  12. Determinación de la vida útil de frutas inmersas en dos tipos de geles a T° ambiente en períodos estacionales

    OpenAIRE

    León Chumbiauca, Etelvina Carmen

    2015-01-01

    La determinación de la vida útil de frutas inmersas en dos tipos de geles a T° ambiente en periodos estacionales, se llevó a cabo en el Laboratorio de Química Orgánica-Chucuito los frutos en estado verde: manzana, Pyrus malus y plátanos Musa sapientum se adquirieron en el mercado del Callao. Se evaluaron las características organolépticas de acuerdo a las Normas Técnicas Peruana NTP 011.002, 2014 y NTP 011.005, 2014, y las características físico químicas de: PH con Peachímetro digital, °Brix ...

  13. Lock-in of a Chiral Soliton Lattice by Itinerant Electrons

    Science.gov (United States)

    Okumura, Shun; Kato, Yasuyuki; Motome, Yukitoshi

    2018-03-01

    Chiral magnets often show intriguing magnetic and transport properties associated with their peculiar spin textures. A typical example is a chiral soliton lattice, which is found in monoaxial chiral magnets, such as CrNb3S6 and Yb(Ni1-xCux)3Al9 in an external magnetic field perpendicular to the chiral axis. Here, we theoretically investigate the electronic and magnetic properties in the chiral soliton lattice by a minimal itinerant electron model. Using variational calculations, we find that the period of the chiral soliton lattice can be locked at particular values dictated by the Fermi wave number, in stark contrast to spin-only models. We discuss this behavior caused by the spin-charge coupling as a possible mechanism for the lock-in discovered in Yb(Ni1-xCux)3Al9 [T. Matsumura et al., https://doi.org/10.7566/JPSJ.86.124702" xlink:type="simple">J. Phys. Soc. Jpn. 86, 124702 (2017)]. We also show that the same mechanism leads to the spontaneous formation of the chiral soliton lattice even in the absence of the magnetic field.

  14. Genome-Wide Analysis of the AP2/ERF Family in Eucalyptus grandis: An Intriguing Over-Representation of Stress-Responsive DREB1/CBF Genes

    Science.gov (United States)

    SanClemente, H.; Mounet, F.; Dunand, C.; Marque, G.; Marque, C.; Teulières, C.

    2015-01-01

    Background The AP2/ERF family includes a large number of developmentally and physiologically important transcription factors sharing an AP2 DNA-binding domain. Among them DREB1/CBF and DREB2 factors are known as master regulators respectively of cold and heat/osmotic stress responses. Experimental Approaches The manual annotation of AP2/ERF family from Eucalyptus grandis, Malus, Populus and Vitis genomes allowed a complete phylogenetic study for comparing the structure of this family in woody species and the model Arabidopsis thaliana. Expression profiles of the whole groups of EgrDREB1 and EgrDREB2 were investigated through RNAseq database survey and RT-qPCR analyses. Results The structure and the size of the AP2/ERF family show a global conservation for the plant species under comparison. In addition to an expansion of the ERF subfamily, the tree genomes mainly differ with respect to the group representation within the subfamilies. With regard to the E. grandis DREB subfamily, an obvious feature is the presence of 17 DREB1/CBF genes, the maximum reported to date for dicotyledons. In contrast, only six DREB2 have been identified, which is similar to the other plants species under study, except for Malus. All the DREB1/CBF and DREB2 genes from E. grandis are expressed in at least one condition and all are heat-responsive. Regulation by cold and drought depends on the genes but is not specific of one group; DREB1/CBF group is more cold-inducible than DREB2 which is mainly drought responsive. Conclusion These features suggest that the dramatic expansion of the DREB1/CBF group might be related to the adaptation of this evergreen tree to climate changes when it expanded in Australia. PMID:25849589

  15. Genome-wide analysis of the AP2/ERF family in Eucalyptus grandis: an intriguing over-representation of stress-responsive DREB1/CBF genes.

    Directory of Open Access Journals (Sweden)

    P B Cao

    Full Text Available The AP2/ERF family includes a large number of developmentally and physiologically important transcription factors sharing an AP2 DNA-binding domain. Among them DREB1/CBF and DREB2 factors are known as master regulators respectively of cold and heat/osmotic stress responses.The manual annotation of AP2/ERF family from Eucalyptus grandis, Malus, Populus and Vitis genomes allowed a complete phylogenetic study for comparing the structure of this family in woody species and the model Arabidopsis thaliana. Expression profiles of the whole groups of EgrDREB1 and EgrDREB2 were investigated through RNAseq database survey and RT-qPCR analyses.The structure and the size of the AP2/ERF family show a global conservation for the plant species under comparison. In addition to an expansion of the ERF subfamily, the tree genomes mainly differ with respect to the group representation within the subfamilies. With regard to the E. grandis DREB subfamily, an obvious feature is the presence of 17 DREB1/CBF genes, the maximum reported to date for dicotyledons. In contrast, only six DREB2 have been identified, which is similar to the other plants species under study, except for Malus. All the DREB1/CBF and DREB2 genes from E. grandis are expressed in at least one condition and all are heat-responsive. Regulation by cold and drought depends on the genes but is not specific of one group; DREB1/CBF group is more cold-inducible than DREB2 which is mainly drought responsive.These features suggest that the dramatic expansion of the DREB1/CBF group might be related to the adaptation of this evergreen tree to climate changes when it expanded in Australia.

  16. Synteny conservation between two distantly-related Rosaceae genomes: Prunus (the stone fruits and Fragaria (the strawberry

    Directory of Open Access Journals (Sweden)

    Sargent Daniel J

    2008-06-01

    Full Text Available Abstract Background The Rosaceae encompass a large number of economically-important diploid and polyploid fruit and ornamental species in many different genera. The basic chromosome numbers of these genera are x = 7, 8 and 9 and all have compact and relatively similar genome sizes. Comparative mapping between distantly-related genera has been performed to a limited extent in the Rosaceae including a comparison between Malus (subfamily Maloideae and Prunus (subfamily Prunoideae; however no data has been published to date comparing Malus or Prunus to a member of the subfamily Rosoideae. In this paper we compare the genome of Fragaria, a member of the Rosoideae, to Prunus, a member of the Prunoideae. Results The diploid genomes of Prunus (2n = 2x = 16 and Fragaria (2n = 2x = 14 were compared through the mapping of 71 anchor markers – 40 restriction fragment length polymorphisms (RFLPs, 29 indels or single nucleotide polymorphisms (SNPs derived from expressed sequence tags (ESTs and two simple-sequence repeats (SSRs – on the reference maps of both genera. These markers provided good coverage of the Prunus (78% and Fragaria (78% genomes, with maximum gaps and average densities of 22 cM and 7.3 cM/marker in Prunus and 32 cM and 8.0 cM/marker in Fragaria. Conclusion Our results indicate a clear pattern of synteny, with most markers of each chromosome of one of these species mapping to one or two chromosomes of the other. A large number of rearrangements (36, most of which produced by inversions (27 and the rest (9 by translocations or fission/fusion events could also be inferred. We have provided the first framework for the comparison of the position of genes or DNA sequences of these two economically valuable and yet distantly-related genera of the Rosaceae.

  17. McWRI1, a transcription factor of the AP2/SHEN family, regulates the biosynthesis of the cuticular waxes on the apple fruit surface under low temperature

    Science.gov (United States)

    Ji, Qianlong; Zhang, Kezhong; Yang, Mingfeng

    2017-01-01

    Cuticular waxes of plant and organ surfaces play an important role in protecting plants from biotic and abiotic stress and extending the freshness, storage time and shelf life in the post-harvest agricultural products. WRI1, a transcription factor of AP2/SHEN families, had been found to trigger the related genes taking part in the biosynthesis of seed oil in many plants. But whether WRI1 is involved in the biosynthesis of the cuticular waxes on the Malus fruits surface has been unclear. We investigated the changes of wax composition and structure, the related genes and WRI1 expression on Malus asiatica Nakai and sieversii fruits with the low temperature treatments, found that low temperature induced the up-regulated expression of McWRI1, which promoted gene expression of McKCS, McLACs and McWAX in very-long-chain fatty acid biosynthesis pathway, resulting in the accumulation of alkanes component and alteration of wax structure on the fruit surface. Corresponding results were verified in McWRI1 silenced by VIGS, and WRI1 silenced down-regulated the related genes on two kinds of fruits, it caused the diversity alteration in content of some alkanes, fatty acid and ester component in two kinds of fruits. We further conducted Y1H assay to find that McWRI1 transcription factor activated the promoter of McKCS, McLAC and McWAX to regulate their expression. These results demonstrated that McWRI1 is involved in regulating the genes related synthesis of very long chain fatty acid on surface of apple fruits in storage process, providing a highlight for improvement of the modified atmosphere storage of apple fruits. PMID:29073205

  18. Genome Wide Identification and Characterization of Apple bHLH Transcription Factors and Expression Analysis in Response to Drought and Salt Stress.

    Science.gov (United States)

    Mao, Ke; Dong, Qinglong; Li, Chao; Liu, Changhai; Ma, Fengwang

    2017-01-01

    The bHLH (basic helix-loop-helix) transcription factor family is the second largest in plants. It occurs in all three eukaryotic kingdoms, and plays important roles in regulating growth and development. However, family members have not previously been studied in apple. Here, we identified 188 MdbHLH proteins in apple "Golden Delicious" ( Malus × domestica Borkh.), which could be classified into 18 groups. We also investigated the gene structures and 12 conserved motifs in these MdbHLH s. Coupled with expression analysis and protein interaction network prediction, we identified several genes that might be responsible for abiotic stress responses. This study provides insight and rich resources for subsequent investigations of such proteins in apple.

  19. Cytotoxicity and antimicrobial activities of green synthesized silver nanoparticles.

    Science.gov (United States)

    Lokina, S; Stephen, A; Kaviyarasan, V; Arulvasu, C; Narayanan, V

    2014-04-09

    Bio-inspired silver nanoparticles are synthesized using Malus domestica (apple) extract. Polyphenols present in the apple extract act as a reducing and capping agent to produce the silver nanoparticles. UV-Visible analysis shows the surface plasmon resonance (SPR) absorption at 420 nm. The FTIR analysis was used to identify the functional groups responsible for the bio-reduction of silver ion. The XRD and HRTEM images confirm the formation of silver nanoparticles. The minimal inhibitory concentration (MIC) of silver nanoparticles was recorded against most of the bacteria and fungus. Further, MCF-7 human breast adenocarcinoma cancer cell line was employed to observe the efficacy of cancer cell killing. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  20. An experiment to detect apples infested by the peach fruit moth, Carposina sasakii matsumura (Lepidoptera: Carposinidae), using near-infrared spectroscopy

    International Nuclear Information System (INIS)

    Toyoshima, S.; Nakamoto, Y.; Takanashi, M.; Masuda, T.

    2006-01-01

    The potential of near-infrared spectroscopy to detect apples ('Fuji' cultivar) infested by the peach fruit moth, Carposina sasakii, was evaluated using a prevalent NIR device. A calibration equation was developed using both the NIR spectra and injury levels of the infested fruits. The equation predicted the injury levels of fruits using a simple correlation coefficient of 0.8868 and a standard error of prediction of 0.3688. At the level of estimates to discard ca 90% of infested fruits, 90.15% of the infested fruits and 39.24% of the uninfested fruits were excluded from the samples. Although its accuracy was not sufficient, the present NIR device has the potential to identify internally infested fruits

  1. Solar UV light regulates flavonoid metabolism in apple (Malus x domestica).

    Science.gov (United States)

    Henry-Kirk, Rebecca A; Plunkett, Blue; Hall, Miriam; McGhie, Tony; Allan, Andrew C; Wargent, Jason J; Espley, Richard V

    2018-03-01

    Ultraviolet-B light (UV-B) is one environmental signal perceived by plants that affects the flavonoid pathway and influences the levels of anthocyanins, flavonols, and proanthocyanidins. To understand the mechanisms underlying UV exposure, apple trees were grown under spectral filters that altered transmission of solar UV light. Fruit analysis showed that UV induced changes in physiology, metabolism, and gene expression levels during development over a season. These changes were sustained after storage. Under low UV, ripening was delayed, fruit size decreased, and anthocyanin and flavonols were reduced. Expression analysis showed changes in response to UV light levels for genes in the regulation and biosynthesis of anthocyanin and flavonols. Transcription of flavonol synthase (FLS), ELONGATED HYPOCOTYL 5 (HY5), MYB10, and MYB22 were down-regulated throughout fruit development under reduced UV. Functional testing showed that the FLS promoter was activated by HY5, and this response was enhanced by the presence of MYB22. The MYB22 promoter can also be activated by the anthocyanin regulator, MYB10. As ambient levels of UV light vary around the globe, this study has implications for future crop production, the quality of which can be determined by the response to UV. © 2018 John Wiley & Sons Ltd.

  2. Effect of gamma irradiation on storability of apples (Malus Domestica L.)

    International Nuclear Information System (INIS)

    Al-Bachir, M.

    2000-01-01

    The aim of this study was to investigate the effect of gamma irradiation on storability of the two main apple varieties, Golden Delicious and Starking, in Syria. The experiments were performed in 1995 and 1996. Fruits were irradiated with 0, 0.5, 1.0 and 1,5 kGy. Irradiated and unirradiated fruits were stored at 1 to 2 Centigrade and 80 to 90% Rh. Weight loss and spoilage due to physiological disorders and fungal diseases were evaluated throughout the different storage periods. firmness, coloration and Ph values were estimated immediately after irradiation. The results showed that, in both varieties, gamma irradiation increased the weight loss after 45 days of storage in apples gathered in 1995 but not in the 1996 season. After 180 days of storage, gamma irradiation had different effects on weight loss depending on the growing year and variety, and increased fungal spoilage. Application of gamma irradiation prevented the growth of Aspergillus niger and the formation of skin scald in 'Golden Delicious' fruits. Immediately after treatment, gamma irradiation increased the softening of fruits, changed their color from green to yellow and decreased the Ph value of the juice. (author)

  3. Effect of gamma irradiation on storability of apples (Malus domestica L.)

    Energy Technology Data Exchange (ETDEWEB)

    Al-Bachir, M [Atomic Energy Commission (AECS), Dept. of Radiation Agriculture, Damascus (Syrian Arab Republic)

    1997-12-01

    The effects of gamma irradiation on storability of two main apple varieties in Syria, Golden Delicious and Starking, were investigated. Fruits were irradiated with 0, 0.5, 1, and 1.5 kGy and combined irradiation with 1 kGy after packaging the fruits with polyethylene or paper bags. Irradiated and unirradiated fruits were stored at 1 to 2 C deg and 80 to 90% Rh. Weight loss and spoilage were evaluated throughout the different storage periods. Firmness, coloration and pH values were estimated immediately after irradiation. The results showed that in both varieties, gamma irradiation increased the weight loss after 45 days of storage in the 1995, but not in the 1996 season. After 180 days of storage gamma irradiation had different effects on weight loss depending on the season and variety, and increased the fungal spoilage. Application of gamma irradiation prevented the growth of Aspergillus niger and the formation of skin scald in Golden Delicious fruits. Immediately after treatment, gamma irradiation increased the softening of fruits, changed their colour from green to yellow and decreased the pH value of the juice. Combined treatments decreased the rate of weight loss and skin scald in Golden Delicious fruits and increased the fungal spoilage. (author)

  4. Application of Freezing and Thawing in Apple (Malus domestica) Juice Extraction.

    Science.gov (United States)

    Nadulski, Rafał; Kobus, Zbigniew; Wilczyński, Kamil; Zawiślak, Kazimierz; Grochowicz, Józef; Guz, Tomasz

    2016-09-28

    The paper presents the results of the research on the impact of enzymatic liquefaction, freezing and thawing on the efficiency of juice pressure extraction from apple pulp and quality of the obtained juices. The research was conducted using three types of pretreatment prior the pressing: crushing and enzymatic liquefaction in temperature of 25 °C, crushing and enzymatic liquefaction in temperature of 45 °C and crushing followed by freezing and thawing of the pulp. The study included three varieties of apples. The juice was obtained using a laboratory basket press. It was determined that the pretreatment of the pulp as well as the varietal characteristics of the fruits have a significant impact on the efficiency of the pressure extraction process. The enzymatic treatment of the pulp, irrespective of the temperature at which it was conducted, significantly increased the efficiency of the process. No effect of the temperature (25 or 45 °C) of enzymatic treatment on the efficiency of the pressure extraction process was found. Pretreatment of the pulp based on freezing and thawing contributes to the increase of efficiency of pressing in the case of two apple cultivars, that is, Idared and Red Delicious. It was showed that total phenolic content, antioxidant activity, the soluble solids content and juice acidity (pH) depend on the pretreatment of the pulp and the varietal characteristics of apples. Following the application of pretreatment of the pulp, an increase was observed in the content of polyphenols and in the antioxidant activity of the juices obtained. © 2016 Institute of Food Technologists®

  5. Genes and quality trait loci (QTLs) associated with firmness in Malus ...

    African Journals Online (AJOL)

    ctm

    2013-03-06

    Mar 6, 2013 ... Fruit firmness is affected by the inheritance of alleles at multiple loci and their possible interactions ... influences the sensory perception of fruits by consumers. (Harker et al. ..... direct comparisons between studies are difficult.

  6. Fractional composition of water in leaves of apple varieties (Malus Mill

    Directory of Open Access Journals (Sweden)

    А. М. Галашева

    2013-02-01

    Full Text Available In connection to the climate changing and draught frequency increasing in the spring-summer period the fractional composition of water (combined and uncombined water in leaves of apple from May to August 2011, 2012 were studies. Combined and uncombined waters have different functionality for the life of plants. An uncombined water in leaves determines intensity of physiologic processes while the combined is responsible for plants resistance to unfavorable conditions. The fractional composition of water was studied in apple leaves of varieties bred by All-Russian Research Institute for Fruit Crop Breeding of RAAS, Bolotovskoye, Irmus, Orlik, Orlovim, Orlovskoye Polosatoye, Sinap Orlovskiy, Yubiliar in comparision to widespread varieties – Antonovka, Melba and Welsi. The study established that the varieties examined were well-adapted to drought in May, at the beginning of summer, as well as at the end of August and in September. At the beginning of July and in June higher indices of drought resistance were registered for Orlovim and Yubiliar, with the highest indices of combined water content. The completion of shoots growth and development of leaves system in all apple varieties was associated with increase of combined water amount in the leaves in August. In September, the number of combined water remained higher that suggested high adaptivity of the varieties being studied. The highest content of combined water in autumn was registered for Sinap Orlovskiy, Antonovka, Boltovskoie, Irmus.

  7. Effect of gala apples (Malus domestica Borkh on lipidemia of hyperlipidemic rats Efeito da maçã gala (Malus domestica Borkh na lipidemia de ratos hipercolesterolêmicos

    Directory of Open Access Journals (Sweden)

    Jocelem Mastrodi Salgado

    2008-06-01

    Full Text Available A healthy life style and a balanced diet, associated with a high fruit and vegetable intake, are linked to good health and the prevention of diseases. Apples contain bioactive compounds that help in the prevention and control of hyperlipidemia. One of the Public Health concerns in Brazil is to reduce cardiovascular diseases. Therefore, the objective of this work was to analyze the chemical composition of Gala apples and to study the effect of their consumption on weight gain, food intake, serum levels of total cholesterol, HDL-C, LDL-C, triglycerides, hepatic cholesterol and fecal cholesterol in male albino Wistar rats fed a hypercholesterolemic diet. Six animals were utilized for each treatment (control, 5, 15 and 25% apple diet, during 30 and 60 days. This study showed that one apple (200 g can provide 14.5% of recommended total fiber and 55% of recommended vitamin C, besides supplying considerable quantities of phenolic compounds (0.38 g.100 g-1 and tannins (0.16 g.100 g-1. All animals showed a non-significant reduction in their weight gain and food intake with an increase in the concentration of apple in the diets. At the end of 30 days, all of the diets provided a significant reduction in the levels of triglycerides compared to the control group. The 15 and 25% apple diets showed significant reductions in the serum levels of total cholesterol and LDL-C and an increase in the level of fecal cholesterol in relation to the control group. The 25% apple diet provided a significant reduction in the hepatic cholesterol levels compared to the control group. After 60 days, the serum levels of total cholesterol, LDL-C, HDL-C and triglycerides in rats fed with 5, 15 and 25% apple diets were similar to the control group. This probably happened due to a revertion of the process. These results show the importance of Gala apples in the control of hyperlipidemia in rats. A diet rich in vegetables and fruits, including apples, associated to a healthy life style, over time, could prevent or reduce the risk of heart disease.Um estilo de vida saudável e uma dieta balanceada, associados com uma alta ingestão de frutas e vegetais estão ligados também à boa saúde e a prevenção de doenças. Maçãs contêm compostos bioativos que ajudam à prevenção e controle da hiperlipidemia. Uma das preocupações da Saúde Pública no Brasil é reduzir as doenças cardiovasculares. Assim, o objetivo deste trabalho foi analisar a composição química da maçã Gala e estudar o efeito do seu consumo no ganho de peso, comida ingerida, níveis sanguíneos de colesterol total, HDL-C, LDL-C, triglicérides, colesterol hepático e colesterol fecal em ratos albinos Wistar, alimentados com uma dieta hipercolesterolêmica. Foram utilizados seis animais para cada tratamento (controle, 5, 15, e 25% dieta de maçã, durante 30 e 60 dias. Este estudo mostrou que uma maçã (200 g pode contribuir com 14,5% do total de fibras e 55% da vitamina C recomendados, além de suprir consideráveis quantidades de produtos fenólicos (0,38 g .100 g-1 e taninos (0,16 g .100 g-1. Todos os animais mostraram uma redução não significativa no ganho de peso e ingestão de comida com o aumento na quantidade de maçã na sua dieta. Ao final de 30 dias, todas as dietas resultaram em uma redução significativa de triglicérides comparados ao grupo controle. As dietas de 15 e 25% mostraram redução significativa nos níveis séricos de colesterol total e LDL-C e um aumento nos níveis fecais de colesterol em relação ao grupo controle. A dieta de 25% de maçã resultou em uma significativa redução dos níveis de colesterol hepático comparados com o grupo controle. Depois de 60 dias, os níveis séricos de colesterol total, LDL-C, HDL-C e triglicérides em ratos alimentados com 5, 15 e 25% de dieta de maçã eram similares ao grupo controle. Isto, provavelmente foi devido a uma reversão do processo. Estes resultados mostram a importância da maçã Gala no controle da hiperlipidemia em ratos. A dieta rica em vegetais e frutas, incluindo maçãs, e associada a um estilo de vida saudável, com o tempo pode prevenir e reduzir o risco de doenças cardíacas.

  8. A simple and rapid method for isolation of high quality genomic DNA from fruit trees and conifers using PVP.

    Science.gov (United States)

    Kim, C S; Lee, C H; Shin, J S; Chung, Y S; Hyung, N I

    1997-03-01

    Because DNA degradation is mediated by secondary plant products such as phenolic terpenoids, the isolation of high quality DNA from plants containing a high content of polyphenolics has been a difficult problem. We demonstrate an easy extraction process by modifying several existing ones. Using this process we have found it possible to isolate DNAs from four fruit trees, grape (Vitis spp.), apple (Malus spp.), pear (Pyrus spp.) and persimmon (Diospyros spp.) and four species of conifer, Pinus densiflora, Pinus koraiensis,Taxus cuspidata and Juniperus chinensis within a few hours. Compared with the existing method, we have isolated high quality intact DNAs (260/280 = 1.8-2.0) routinely yielding 250-500 ng/microl (total 7.5-15 microg DNA from four to five tissue discs).

  9. Eriophyoid mites (Acari: Trombidiformes: Eriophyoidea) of Rosales trees in Iran: two new species and three new records.

    Science.gov (United States)

    Lotfollahi, Parisa; Irani-Nejad, Karim Haddad; De Lillo, Enrico

    2014-09-11

    This paper describes two new species of Eriophyoidea associated with trees belonging to the order Rosales in the south-western portion of East Azerbaijan province, Iran, collected during a survey in 2011: Aceria lobolinguae n. sp. on Elaeagnus angustifolia L. (Elaeagnaceae) and Rhinophytoptus nemalobos n. sp. on Prunus domestica L. (Rosaceae). Additionally, Phyllocoptes abaenus Keifer on Prunus armeniaca L. (Rosaceae), Aculus fockeui (Nalepa & Trouessart) on Prunus amygdalus Stokes and Malus domestica Borkh. (Rosaceae), and Aceria mori (Keifer) on Morus alba L. (Moraceae) were collected and are new records for the mite fauna of Iran. New locality records and host plant data are provided for Eriophyes similis (Nalepa), Eriophyes pyri (Pagenstecher) and Calepitrimerus baileyi (Keifer) which are eriophyoid species previously known from Iran. 

  10. Host range of Phytophthora parsiana: a new high temperature pathogen of woody plants

    Directory of Open Access Journals (Sweden)

    Somieh HAJEBRAHIMI

    2011-05-01

    Full Text Available Normal 0 14 false false false IT ZH-TW X-NONE MicrosoftInternetExplorer4 Among several Phytophthora spp. reported previously from Pistacia vera in Iran, a high temperature species recently identified as P. parsiana (formerly known as high temperature P. cryptogea is becoming important in woody plants, including P. vera. The host range of this newly recognised species, including both annual and perennial plants, is reported here. The pathogen infected 4–5 month-old glasshouse grown seedlings of P. vera, Ficus carica, Malus pumila and Prunus dulcis, and detached stems of 23 woody plants collected during dormant and growing seasons. Nineteen field and vegetable crops and 17 weed species were not infected by  P. parsiana in these pathogenicity assays.

  11. Reduction of motor fuel consumption - Which recipes does the state have at its disposal?; Absenkung des Treibstoffverbrauchs: Welche Rezepte hat der Staat?

    Energy Technology Data Exchange (ETDEWEB)

    Volken, T.

    2008-07-01

    This presentation made at the Swiss 2008 research conference on traffic by Thomas Volken from the Energy Policy Section of the Swiss Federal Office of Energy SFOE takes a look at how motor-fuel consumption can be reduced. First of all, the present situation with regard to heating oil and motor fuels is examined and the gap between actual CO{sub 2} emissions from motor fuels and the target aimed for is discussed. Various legal and economical measures available are examined as are the promotion of technical innovation and motivational measures. The federal energy efficiency action plan and bonus/malus schemes are discussed and the environment label for cars is examined. Further, the situation in the European Union is discussed.

  12. Flowers visited by honey bee in southern Finland

    Directory of Open Access Journals (Sweden)

    Markku Käpylä

    1979-01-01

    Full Text Available A list of nectar and pollen sources of honeybee (Apis mellifera L. in southern Finland based on 44 500 flower records is presented. Only the common wild and cultivated species are included, 139 species altogether. The flowering times are shown with an accuracy of two weeks. The most important food sources during spring (April—May are Salix spp., and Tussilago farfara: during early summer (late May and June Salix spp., Taraxacum officinale, Acer platanoides, Vaccinium vitis-idaea, Barbarea vulgaris, Ribes spp., Malus domestica, Sorbus aucuparia, and Geranium sylvaticum; during mid-summer Trifolium repens, T. hybridum, Rubus idaeus, Tilia cordata, Epilobium angustifolium, and Cirsium arvense; during late summer and early autumn Calluna vulgaris, Arctium tomentosum, Sonchus arvensis and Leontodon autumnalis.

  13. COMPORTAMENTO DA CULTIVAR DE MACIEIRA FUJI (Malus domestica, Borkh. SOBRE TRÊS DIFERENTES PORTA-ENXERTOS BEHAVIOUR OF THE APPLE CULTIVAR FUJI (Malus domestica, Borkh. ONTO THREE DIFFERENT ROOTSTOCKS

    Directory of Open Access Journals (Sweden)

    FREDERICO DENARDI

    2001-12-01

    Full Text Available Verifica-se, a nível mundial, uma forte tendência para o plantio da macieira em alta densidade de cultivo. Neste sistema de plantio, são utilizados porta-enxertos de pequeno porte, conhecidos como anões. O mais utilizado é o M-9, em virtude do forte controle sobre o porte da copa, da precocidade de produção, da alta produtividade e da boa qualidade dos frutos que induz à copa. No Sul do Brasil, por questões de tradição internacional, facilidade de obtenção e do menor custo de investimento no plantio, até recentemente, têm sido plantados porta-enxertos de vigor médio, como o MM-106, o M-7 e o MM-111, para plantios de média densidade. O primeiro é atualmente pouco usado devido à alta suscetibilidade à podridão-do-colo (Phytophthora cactorum. O objetivo deste trabalho foi comparar o desempenho do anão M-9, do semi-anão M-7 e do semivigoroso MM-111 no controle do vigor da copa, na precocidade de produção, na produtividade e no tamanho dos frutos da cv. de macieira Fuji. O experimento foi conduzido em blocos ao acaso, com 4 repetições de 3 plantas por parcela. Como copa, foi utilizada a cv. Fuji, polinizada pela cv. Gala. O experimento foi implantado em 1996, em Fraiburgo-SC, principal pólo produtor de maçãs do País. O espaçamento de cultivo foi de 2,0 m por 5,0 m. O experimento foi conduzido por 4 anos, avaliando-se a precocidade (n0 de gemas de flor/cm² de área transversal do caule, produção (kg/planta, produtividade (t/ha, peso médio dos frutos (g e distribuição dos frutos por categoria de tamanho (%. Os resultados obtidos indicaram que o M-9 foi o mais precoce, produzindo, no terceiro ano, 1,94 vez mais gemas de flor que o M-7 e 2,70 vezes mais que o MM-111. Em termos de produção, no terceiro ano, o M-9 produziu 2,53 vezes mais que o M-7 e 2,70 vezes mais que o MM-111. No quarto ano, o M-9 produziu 1,28 vez mais que o M-7 e 1,26 vez mais que o MM-111. O peso médio dos frutos foi de 159,2 g, 135,5 g e 131,2 g, para o M-9, o M-7 e o MM-111, respectivamente. Em termos de distribuição por categoria de tamanho, o M-9 produziu 90,8% de frutos maiores que 62 mm, o M-7 produziu 79,5% e o MM-111, 70,9%, indicando que o M-9, além de mais precoce e mais produtivo, também produz frutos de maior calibre.There is a worldwide tendency for planting apples at high density system onto the so called dwarf apple rootstocks, which have a strong effect on controlling the vigor of the trees. The most used is the M-9 due to its efficiency on vigor control, precocity of flowering, high productivity and also good fruit quality it induces to the scion varieties. In South of Brazil more vigorous rootstocks, as MM-106, M-7 and MM-111, have been widely used because worldwide tradition, lower initial cost as they require less trees/ha, and their facility of propagation The objective of this work was to compare the dwarf M-9 with the semi-dwarf M-7 and the semi-vigorous MM-111 concerned to vigor control, precocity of flowering, productivity and fruit quality of the apple cultivar Fuji. The statistical design was on completely randomized blocks, with 4 replications of three trees on each plot. The main cultivar was Fuji, pollinated by cv. Gala. The experiment was established in 1996 in Fraiburgo, the main apple producer area in the country. The layout of planting was 2,0 m within row by 5,0 m between rows. The study was carried out for four years. The parameters evaluated were precocity (n0 of flower buds per cm² of trunk cross sectional area, production (kg/tree, productivity (t/ha, fruit weigh (g and distribution of fruit size (%. The results obtained on the 3rd season showed that M-9 was the most precocious, producing 1.94 times more flower buds per cm² of trunk cross sectional area than on M-7 and 2.7 times more than on MM-111. Concerned to production on 3rd season, M-9 produced 2.5 times more than M-7 and 2.7 times more than MM-111. On the 4th season M-9 produced 1.28 times more than M-7 and 1.26 times more than MM-111 (Table 2. The fruit weight was 159,2 g, 135,5 g and 131,2 g for M-9, M-7 and MM-111, respectively. In terms of distribution of fruit weight, M-9 produced 90,8% of fruits In the class > 62 mm, against 79,5% on M-7 and 70,9% on MM-111, showing that M-9 is not only the most precocious, but it is also the most productive and produces fruits of larger size than M-7 and MM-111.

  14. An exponential growth model with decreasing r captures bottom-up effects on the population growth of Aphis glycines Matsumura (Hemiptera: Aphididae)

    NARCIS (Netherlands)

    Costamagna, A.C.; Werf, van der W.; Bianchi, F.J.J.A.; Landis, D.A.

    2007-01-01

    1 There is ample evidence that the life history and population dynamics of aphids are closely linked to plant phenology. Based on life table studies, it has been proposed that the growth of aphid populations could be modeled with an exponential growth model, with r decreasing linearly with time.

  15. A new species of Lysiphlebus Förster 1862 (Hymenoptera: Braconidae, Aphidiinae) attacking soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae) from China

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Rakhshani, E.; Tomanović, Ž.; Hoelmer, K.; Kavallieratos, N. G.; Yu, J.; Wang, M.; Heimpel, G. E.

    2010-01-01

    Roč. 19, č. 1 (2010), s. 179-186 ISSN 1070-9428 Grant - others:Ministry of Science and Technological Developments of the Republic of Serbia(SR) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Lysiphlebus orientalis sp. n. * aphid parasitoids * Glycine max Subject RIV: EG - Zoology Impact factor: 0.500, year: 2010

  16. Impact of insecticides on non-target arthropods in watermelon cropImpacto de inseticidas em artrópodes não-alvo associados à cultura da melancia

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2012-10-01

    Full Text Available Watermelon Citrullus lunatus (Thunberg, Matsumura & Nakai is an ecosystem having a variety of arthropods, each one playing a specific role. Although some of them are considered pest to crops, some others are responsible for soil aeration, nutrient release and predation of pest species and are, therefore, considered beneficial to crops. The intensive farming practiced for watermelon cultivation in Brazil is based on the use of tiamethoxam and deltamethrin, which may not only kill target but also nontarget organisms such as beneficial arthropods. Research data regarding the influence of insecticides on arthropods in watermelon cropping is scarce. This study aimed to evaluate the effect of the insecticides deltamethrin and thiamethoxam on soil surface and watermelon canopy arthropod community. The study was carried out in the State of Tocantins, Brazil. Although the application of thiamethoxam and deltamethrin was efficient in controlling populations of Aphis gossypii (Glover, as we expected, they negatively affected non-target arthropods such as detritivores insects in the canopy and soil surface. Ecological implications of the impact of such pesticides on beneficial arthropod species are discussed.A cultura da melancia Citrullus lunatus (Thunberg, Matsumura & Nakai abriga uma grande diversidade de artrópodes, cada um desempenhando um papel específico. Apesar de alguns desses artrópodes serem considerados pragas, outros são responsáveis pela aeração do solo, liberação de nutrientes e predação das espécies-praga, sendo, dessa forma, considerados benéficos às culturas. A agricultura intensiva praticada no Brasil para o cultivo da melancia é baseada no uso dos inseticidas como tiamethoxam e deltametrina, que pode não só matar as pragas, mas também organismos não-alvo. Pesquisas relacionadas à influência de inseticidas sobre artrópodes benéficos na cultura da melancia são escassas. Este estudo foi realizado com o objetivo de

  17. Genetic resources of autochthonous fruit species and varieties

    Directory of Open Access Journals (Sweden)

    Keserović Zoran

    2017-01-01

    Full Text Available The paper describes the plentitude of genetic resources of indigenous varieties of fruit species and their importance for further development of fruit growing, especially from the aspect of breeding new varieties resistant to pathogens and abiotic stress conditions (frost, drought, sunburns, etc.. Economic significance and importance in the human nutrition, as a raw or processed fruitage, were stated as well. Based on the unique biodiversity, the Balkan Peninsula can be considered as a secondary center of divergence for a large number of fruit species, such as Malus x domestica, Malus sylvestris, Pyrus communis, Prunus cerasifera, P. persica, P. armeniaca, P. fruticosa, P. amygdalus, P. nana, Juglans regia, Corilus colurna, Corilus avellana, Castanea sativa, Fragaria vesca, Cornus mas. The old indigenous and domesticated varieties and natural populations of fruit species on the Balkan Peninsula have never been the subject of comprehensive research work on their collecting and studying. Serbia has no national scientific institution that takes care of genetic resources. Nowadays, the issue of preserving genetic resources is of great importance because, due to the intensification and modernization of plant production, many local populations have disappeared or are reduced to a small number of biotypes. The varieties with huge genetic and breeding value have disappeared forever without any possibility of their return. By importing high quality fruit varieties, we imported many diseases and various pests as well. New varieties intended for intensive cultivation require the application of expensive growing technologies. The systematic scientific work on the study of wild fruit species and autochthonous varieties is of the great interest for fruit science and practice in the future. The establishment of in situ collections with the aim to preserve valuable genetic material is mandatory. In the following period, indigenous and domesticated varieties

  18. Estudos histológicos preliminares da microenxertia de plantas micropropagadas de macieira Preliminaries histological studies from the micrografting of tissue cultured apple

    Directory of Open Access Journals (Sweden)

    Monita Fiori de Abreu

    2003-04-01

    Full Text Available A fruticultura moderna necessita implantar tecnologias que possibilitem a produção de frutos de alta qualidade, com custos cada vez menores. A micropropagação associada à microenxertia possibilita altas taxas de multiplicação de plantas com alta qualidade fitossanitária, além de possibilitar a realização de estudos sobre compatibilidade de enxertia em diferentes clones. O presente trabalho tem como objetivo estudar o processo de soldadura entre genótipos de macieira (Malus domestica. Borkh multiplicadas in vitro após a microenxertia. Esta técnica foi realizada em fenda simples, sob condições assépticas. Os estudos histológicos foram realizados através de cortes longitudinais seriados de segmentos de 8 mm do ponto de enxertia. O processo de soldadura foi caracterizado pelo desenvolvimento de tecido meristemático, originando células parenquimáticas na interface do microenxerto, com a proliferação do tecido cambial da cultivar copa. Isso possibilita a ligação do sistema vascular da copa com o do porta-enxerto, resultando na sobrevivência do microenxerto.The modern fruitculture needs to introduce techniques that allow a less expensive production of high quality fruits. The micropropagation associate to micrografting provides high average of plant multiplication and disease free material. In addition it provides studies of grafting compatibilities. The present work aim to study the process of the micrografting union of tissue cultured apple (Malus domestica. Borkh. The scions were cleft-grafted on the rootstocks, under aseptic conditions. For histological studies specimens were trimmed down to 4mm above and below the graft union (longitudinal cuts. The graft union development resulted in the generation of meristem tissue, originating parenchymatous cells at the graft interface, and a cambial tissue proliferation from the scion. This procedure allows the vascular system connection between the scion and the rootstock

  19. Viabilidade do pólen e desenvolvimento do tubo polínico em macieira (Malus spp. Germination of pollen and the development of pollen tubes in apple (Malus spp.

    Directory of Open Access Journals (Sweden)

    Adriana Cibele de Mesquita Dantas

    2005-12-01

    Full Text Available No presente trabalho, estudaram-se características associadas à germinação in vitro e ao desenvolvimento in vivo do tubo polínico em seis variedades-copa e de porta-enxertos de macieira como subsídios para o estabelecimento de programas de melhoramento genético. Utilizou-se de pólen de seis cultivares de macieira inoculado em meio de cultura com ágar (10 g.L-1 em água destilada, combinados com concentrações de sacarose (0; 10; 20; 30; 40 e 50% e ácido bórico (0 e 40 mg.L-1. Para o estudo do desenvolvimento do tubo polínico, realizou-se coleta das flores em quatro períodos (6; 12; 24 e 48 horas após as polinizações em M9 x Marubakaido e a autofecundação em M9, sendo os tubos polínicos analisados em coloração de azul de anilina acidificada/carmim acético e em fluorescência. A sacarose, em concentrações entre 15% a 25%, pode ser empregada com sucesso para a germinação in vitro de grãos de pólen da macieira. O ácido bórico não teve efeito positivo para esta característica. Na ausência do ácido bórico e na presença de 15% de sacarose, observaram-se os maiores percentuais de germinação: Fuji (51,1%, Imperatriz (31,7%, M.9 (20,8%, Catarina (19,2%, Gala (13,7% e Marubakaido (6,1%. Quanto ao desenvolvimento do tubo polínico, com 12 horas da polinização, iniciou-se a germinação no pólen, no estigma, no cruzamento M.9 x Marubakaido, e após 24 horas da polinização observou-se 83% de germinação. As técnicas de coloração com azul de anilina acidificada com carmim acético e de visualização em fluorescência foram eficientes na visualização e coloração dos grãos de pólen e do desenvolvimento dos tubos polínicos.In the present work it was studied features associated to the germination of pollen and the development of pollen tubes in six apple varieties as subsidies for the establishment of genetic improvement programs. Pollen grains were inoculated in culture medium with distilled water, agar (10 g. L-1, combined with sucrose at 0, 10, 20, 30, 40 and 50% and boric acid at 0 and 40 mg. L-1. For the study of pollen tubes development flowers were collected at 6, 12, 24 and 48 hours after antesis in M.9 x Marubakaido and in the self-pollinated M.9, being the pollen tubes analyzed in staining with blue aniline with acetic carmim and in fluorescence. Sucrose in concentrations ranging from 15% to 25% can successfully be used for the in vitro germination of pollen grains. Boric acid was not effective in promoting in vitro germination of pollen grains. In the absence of boric acid and in the presence of 15% of sucrose it was observed the largest germination rates: Fuji (51.1%, Imperatriz (31.7%, M.9 (20.8%, Catarina (19.2%, Gala (13.7%, and Marubakaido (6.1%. In the crossing M.9 x Marubakaido after 12 hours of pollination the pollen germination began in the stigma and after 24hrs it was observed 83% of germination. The techniques employed were efficient in the visualization and coloration of the pollen grains and of development of tube pollen.

  20. The regulation of seasonal flowering in the Rosaceae.

    Science.gov (United States)

    Kurokura, Takeshi; Mimida, Naozumi; Battey, Nicholas H; Hytönen, Timo

    2013-11-01

    Molecular mechanisms regulating the flowering process have been extensively studied in model annual plants; in perennials, however, understanding of the molecular mechanisms controlling flowering has just started to emerge. Here we review the current state of flowering research in perennial plants of the rose family (Rosaceae), which is one of the most economically important families of horticultural plants. Strawberry (Fragaria spp.), raspberry (Rubus spp.), rose (Rosa spp.), and apple (Malus spp.) are used to illustrate how photoperiod and temperature control seasonal flowering in rosaceous crops. We highlight recent molecular studies which have revealed homologues of terminal flower1 (TFL1) to be major regulators of both the juvenile to adult, and the vegetative to reproductive transitions in various rosaceous species. Additionally, recent advances in understanding of the regulation of TFL1 are discussed.

  1. Lichens of fruit trees in the selected locations in Podlaskie Voivodeship [North-Eastern Poland

    Directory of Open Access Journals (Sweden)

    Matwiejuk Anna

    2017-12-01

    Full Text Available The aim of this paper is to present the diversity of the lichen species on fruit trees (Malus sp., Pyrus sp., Prunus sp. and Cerasus sp. growing in orchards in selected villages and towns in the Podlaskie Voivodeship. Fifty-six species of lichens were found. These were dominated by common lichens found on the bark of trees growing in built-up areas with prevailing heliophilous and nitrophilous species of the genera Physcia and Phaeophyscia. A richer lichen biota is characteristic of apple trees (52 species and pear trees (36. Lichens of the apple trees constitute 78% of the biota of this phorophyte growing in the fruit orchards in Poland. Of the recorded species, only two (Ramalina farinacea, Usnea hirta are covered by partial protection in Poland.

  2. Breeding Potential in Danish Apple Cultivar

    DEFF Research Database (Denmark)

    Larsen, Bjarne

    The diversity in plant genetic resources is a prerequisite for genetic improvement of cultivated crop species. Lack of in-depth characterization and evaluation of gene bank accessions is a major obstacle for their potential utilization. The Danish apple (Malus domestica L.) gene bank collection...... understanding of the link between phenotypes and the underlying gene-tic background which is crucial in plant breeding. We found a considerable genetic diversity in the collection and no genetic structure. We exposed a high number of accessions in admix and revealed several putative cultivar parentages, never......, including several rare alleles. Using historical gene bank records, including aroma volatile analysis, sugar and acid data and other fruit- and tree character records, we established genotype-phenotype relationships, performing a genome-wide association study. A number of SNP markers are presented that can...

  3. Sublethal and hormesis effects of imidacloprid on the soybean aphid Aphis glycines.

    Science.gov (United States)

    Qu, Yanyan; Xiao, Da; Li, Jinyu; Chen, Zhou; Biondi, Antonio; Desneux, Nicolas; Gao, Xiwu; Song, Dunlun

    2015-04-01

    The soybean aphid, Aphis glycines Matsumura, is a major pest in soybean crop. Current management of this pest relies mainly on insecticides applications, and the neonicotinoid imidacloprid has been proposed as an effective insecticide to control A. glycines in soybean field. Imidacloprid at lethal concentrations not only exerts acute toxicity to A. glycines, but also cause various biological changes when aphids are chronically exposed to lower concentrations. In this study, we assessed the effects of a low-lethal (0.20 mg L(-1)) and two sublethal (0.05 and 0.10 mg L(-1)) imidacloprid concentrations on various A. glycines life history traits. Aphid exposure to 0.20 mg L(-1) imidacloprid caused slower juvenile development, shorter reproductive period, and reduced adult longevity, fecundity and total lifespan. Stimulatory effects, i.e. hormesis, on reproduction and immature development duration were observed in aphids exposed to the lower sublethal imidacloprid concentrations. Consequently, the net reproduction rate (R 0) was significantly higher than in the control aphids. These findings stress the importance of the actual imidacloprid concentration in its toxicological properties on A. glycines. Therefore, our results would be useful for assessing the overall effects of imidacloprid on A. glycines and for optimizing integrated pest management programs targeting this pest.

  4. Short communication: Laboratory approach to the use of sulphur and kaolin as preventive control against Drosophila suzukii

    Energy Technology Data Exchange (ETDEWEB)

    Pérez-Guerrero, S.; Molina, J.M.

    2016-11-01

    Drosophila suzukii (Matsumura, 1931) is an invasive pest from South East Asia that was detected for the first time in Southern Europe in 2008. This species can damage a wide range of soft-skinned fruits crops affecting ripening fruits and causing important economic losses. Since the exclusive use of chemical insecticides for controlling D. suzukii may prompt the appearance of resistance and environmental pollution, alternative methods compatible with sustainable management are required. In this study, commercial formulations of powdered sulphur and kaolin were tested as a preventive method applied to blueberry fruits under laboratory conditions. In no-choice assay, powdered sulphur had a significant effect on oviposition and adult emergency with reductions of 76% and 77%, respectively. In addition, sulphur displayed a significant toxicity on males and lethal effect with over 40% adult mortality seven days after exposure. The choice assay confirmed and improved the powdered sulphur effects, with reductions of 98% and 96% in oviposition and adult emergence, respectively. In contrast, kaolin produced no significant reduction in infestation and adult mortality during no-choice and choice assays. These outcomes suggest that preventive use of powdered sulphur could be considered for sustainable control of D. suzukii in some berry crops. (Author)

  5. Genetic origin and dispersal of the invasive soybean aphid inferred from population genetic analysis and approximate Bayesian computation.

    Science.gov (United States)

    Fang, Fang; Chen, Jing; Jiang, Li-Yun; Qu, Yan-Hua; Qiao, Ge-Xia

    2018-01-09

    Biological invasion is considered one of the most important global environmental problems. Knowledge of the source and dispersal routes of invasion could facilitate the eradication and control of invasive species. Soybean aphid, Aphis glycines Matsumura, is one of the most destructive soybean pests. For effective management of this pest, we conducted genetic analyses and approximate Bayesian computation (ABC) analysis to determine the origins and dispersal of the aphid species, as well as the source of its invasion in the USA, using eight microsatellite loci and the mitochondrial cytochrome c oxidase subunit I (COI) gene. We were able to identify a significant isolation by distance (IBD) pattern and three genetic lineages in the microsatellite data but not in the mtDNA dataset. The genetic structure showed that the USA population has the closest relationship with those from Korea and Japan, indicating that the two latter populations might be the sources of the invasion to the USA. Both population genetic analyses and ABC showed that the northeastern populations in China were the possible sources of the further spread of A. glycines to Indonesia. The dispersal history of this aphid can provide useful information for pest management strategies and can further help predict areas at risk of invasion. This article is protected by copyright. All rights reserved.

  6. A pilot study of acotiamide hydrochloride hydrate in patients with detrusor underactivity

    Directory of Open Access Journals (Sweden)

    Sugimoto K

    2015-05-01

    Full Text Available Koichi Sugimoto,1 Takahiro Akiyama,2 Nobutaka Shimizu,3 Naoki Matsumura,1 Taiji Hayashi,1 Tsukasa Nishioka,1 Hirotsugu Uemura3 1Department of Urology, Sakai Hospital, Kinki University Faculty of Medicine, Sakai, Osaka, Japan; 2Department of Urology, Sakai-Onshinkai Hospital, Sakai, Osaka, Japan; 3Department of Urology, Kinki University Faculty of Medicine, Osaka-Sayama, Osaka, Japan Aim: To investigate the clinical efficacy of acotiamide hydrochloride hydrate in patients with detrusor underactivity. Methods: We measured the post-void residual urinary volume in 19 patients with underactive bladders. All these patients had been under treatment with distigmine bromide and were prescribed acotiamide hydrochloride hydrate at a dose of 100 mg three times daily for 2 weeks. Results: Compared with the post-void residual urinary volume value at baseline (161.4±90.0 mL a statistically significant reduction was observed at the end of treatment (116.3±63.1 mL (P=0.006. The drug was generally well tolerated by the majority of patients. Conclusion: Maybe, acotiamide hydrochloride hydrate showed clinical efficacy in patients with underactive bladders and may, therefore, be used alternatively in patients who do not respond sufficiently to distigmine bromide. Keywords: acotiamide hydrochloride hydrate, distigmine bromide, underactive bladder, detrusor underactive

  7. Short communication: Laboratory approach to the use of sulphur and kaolin as preventive control against Drosophila suzukii

    Directory of Open Access Journals (Sweden)

    Sergio Pérez-Guerrero

    2016-06-01

    Full Text Available Drosophila suzukii (Matsumura, 1931 is an invasive pest from South East Asia that was detected for the first time in Southern Europe in 2008. This species can damage a wide range of soft-skinned fruits crops affecting ripening fruits and causing important economic losses. Since the exclusive use of chemical insecticides for controlling D. suzukii may prompt the appearance of resistance and environmental pollution, alternative methods compatible with sustainable management are required. In this study, commercial formulations of powdered sulphur and kaolin were tested as a preventive method applied to blueberry fruits under laboratory conditions. In no-choice assay, powdered sulphur had a significant effect on oviposition and adult emergency with reductions of 76% and 77%, respectively. In addition, sulphur displayed a significant toxicity on males and lethal effect with over 40% adult mortality seven days after exposure. The choice assay confirmed and improved the powdered sulphur effects, with reductions of 98% and 96% in oviposition and adult emergence, respectively. In contrast, kaolin produced no significant reduction in infestation and adult mortality during no-choice and choice assays. These outcomes suggest that preventive use of powdered sulphur could be considered for sustainable control of D. suzukii in some berry crops.

  8. Teachers’ Emotional Expression in Interaction with Students of Different Ages

    Directory of Open Access Journals (Sweden)

    Simona Prosen

    2011-01-01

    Full Text Available Emotions are an integral part of “classroom life” and are experienced in teacher-student interactions quite often (Hosotani & Imai-Matsumura, 2011. The present study focuses on teachers’ emotions in classrooms. Its purpose is to establish which emotions are expressed by teachers in their interactions with students, the triggering situations of the two most frequent emotions, and their level of intensity and suitability. Teachers’ emotions were observed by students of primary education during their practical experience work, in grades one to five. They used a scheme constructed for observing different aspects of emotions. The observations of 108 teachers in 93 primary schools from various Slovenian regions were gathered. The results show that primary school teachers express various pleasant and unpleasant emotions, with unpleasant emotions prevailing. The average frequency of teachers’ emotion expression decreased from grade one to five. Anger was the most frequently expressed emotion (N = 261, followed by joy (N = 151. Teachers’ anger and joy were triggered in different situations: anger predominantly when students lacked discipline and joy predominantly in situations of students’ academic achievement. The intensity of expressed anger and joy was moderate in all five grades, while the assessed suitability of these two emotions was high.

  9. Insect growth regulator effects of azadirachtin and neem oil on survivorship, development and fecundity of Aphis glycines (Homoptera: Aphididae) and its predator, Harmonia axyridis (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Kraiss, Heidi; Cullen, Eileen M

    2008-06-01

    Aphis glycines Matsumura, an invasive insect pest in North American soybeans, is fed upon by a key biological control agent, Harmonia axyridis Pallas. Although biological control is preferentially relied upon to suppress insect pests in organic agriculture, approved insecticides, such as neem, are periodically utilized to reduce damaging pest populations. The authors evaluated direct spray treatments of two neem formulations, azadirachtin and neem seed oil, under controlled conditions for effects on survivorship, development time and fecundity in A. glycines and H. axyridis. Both azadirachtin and neem seed oil significantly increased aphid nymphal mortality (80 and 77% respectively) while significantly increasing development time of those surviving to adulthood. First-instar H. axyridis survival to adulthood was also significantly reduced by both neem formulations, while only azadirachtin reduced third-instar survivorship. Azadirachtin increased H. axyridis development time to adult when applied to both instars, while neem oil only increased time to adult when applied to first instar. Neither neem formulation affected the fecundity of either insect. Results are discussed within the context of future laboratory and field studies aimed at clarifying if neem-derived insecticides can be effectively integrated with biological control for soybean aphid management in organic soybeans. Copyright (c) 2008 Society of Chemical Industry.

  10. Effect of freezing and processing technologies on the antioxidant capacity of fruit pulp and jelly

    Directory of Open Access Journals (Sweden)

    Cristine Maso Jeusti Bof

    2012-02-01

    Full Text Available The effect of freezing and processing technology on the antioxidant capacity of grape (Vitis vinifera, apple (Malus domestica, strawberry (Fragaria x Anassa, pear (Pyrus communis L., guava (Psidium guajava L., and fig (Ficus carica L. was evaluated for 90 days. Under a storage temperature of -15 º C, there was no significant difference in the antioxidant capacity of grape and fig pulp, and a higher antioxidant capacity was found for guava pulp (27 µmol/g. While the technological processing did not affect the antioxidant capacity of pear and apple jellies, all other jellies studied showed a reduced antioxidant capacity. The processing reduced the antioxidant capacity of grapes in 45%. Among the fruit products, the highest antioxidant activities were found for guava pulp and jelly (27 and 25 µmol/g, respectively, followed by grape pulp (22 µmol/g.

  11. Regional somatic embryogenesis from in vitro apple leaf and artificial seed of apple

    International Nuclear Information System (INIS)

    Da Kedong; Li Yazhi; Shu Huairui; Wang Bin

    1998-01-01

    First three open leaves of in vitro apple (Malus domastica Borkh.) shoots were used as explants. Each leaf was divided into three regions (upper, middle and lower) from tip to base and each region was composed of two sub-regions (leaf and right) along the main vain. Every explant was pricked with a dissector at the center of one sub-region before inoculated on MS + BA 1 mg/L + NAA 4 mg/L + 2,4-D 0.5 mg/L medium and incubated in darkness for 7 days, then transferred to MS + BA 1 mg/L medium. 85% of the explants regenerated somatic embryos directly around the prick after 40 days. The embryos were encapsulated in 4% sodium alginate and 2% CaCl 2 as artificial seeds, which could germinate and grow into plantlets under aseptic condition

  12. Effects of apple (Malus x domestica) rootstocks on scion performance and hormone concentration

    Science.gov (United States)

    Rootstocks can influence the productivity and profitability of an orchard in a very significant way. Dwarfing rootstocks had a large impact in making possible the high-density orchards that have been planted during the last 15 years. However, there is a serious threat to high-density apple orchards,...

  13. Dynamic changes in proteins during apple (Malus x domestica) fruit ripening and storage

    OpenAIRE

    Shi, Yun; Jiang, Li; Zhang, Li; Kang, Ruoyi; Yu, Zhifang

    2014-01-01

    A proteomic study, using two-dimensional polyacrylamide gel electrophoresis and matrix-assisted laser desorption/ionization time-of-flight/time-of-flight, was conducted in apple fruit (cv. ‘Golden Delicious’) starting at 10 days prior to harvest through 50 days in storage. Total protein was extracted using a phenol/sodium dodecyl sulfate protocol. More than 400 protein spots were detected in each gel and 55 differentially expressed proteins (p

  14. Transcriptomic signatures in seeds of apple (Malus domestica L. Borkh) during fruitlet abscission.

    Science.gov (United States)

    Ferrero, Sergio; Carretero-Paulet, Lorenzo; Mendes, Marta Adelina; Botton, Alessandro; Eccher, Giulia; Masiero, Simona; Colombo, Lucia

    2015-01-01

    Abscission is the regulated process of detachment of an organ from a plant. In apple the abscission of fruits occurs during their early development to control the fruit load depending on the nutritional state of the plant. In order to control production and obtain fruits with optimal market qualities, the horticultural procedure of thinning is performed to further reduce the number of fruitlets. In this study we have conducted a transcriptomic profiling of seeds from two different types of fruitlets, according to size and position in the fruit cluster. Transcriptomic profiles of central and lateral fruit seeds were obtained by RNAseq. Comparative analysis was performed by the functional categorization of differentially expressed genes by means of Gene Ontology (GO) annotation of the apple genome. Our results revealed the overexpression of genes involved in responses to stress, hormone biosynthesis and also the response and/or transport of auxin and ethylene. A smaller set of genes, mainly related to ion transport and homeostasis, were found to be down-regulated. The transcriptome characterization described in this manuscript contributes to unravelling the molecular mechanisms and pathways involved in the physiological abscission of apple fruits and suggests a role for seeds in this process.

  15. Genes and quality trait loci (QTLs) associated with firmness in Malus x domestica

    KAUST Repository

    Marondedze, Claudius

    2013-03-31

    Fruit firmness, a quality quantitative trait, has long been established as a key textural property and one of the essential parameters for estimating ripening and shelf life of apples. Loss of firmness, also referred to as fruit softening, is undesirable in apples and represents a serious problem for growers in many countries. This results in the reduction of apple shelf life and in turn influences its commercialization. Low firmness impacts negatively on the sensory values of juiciness, crunchiness and crispness. Fruit firmness is affected by the inheritance of alleles at multiple loci and their possible interactions with the environment. Identification of these loci is key for the determination of genetic candidate markers that can be implemented in marker assisted selection and breeding for trees and/or cultivars that can yield firmer fruits with economic value. In turn, this technique can help reduce the time needed to evaluate plants and new cultivars could become available faster. This review provides an overview of quantitative trait loci (QTL), including additional putative QTLs that we have identified, and genes associated with firmness and their importance to biotechnology, the breeding industry and eventually the consumers.

  16. Genes and quality trait loci (QTLs) associated with firmness in Malus x domestica

    KAUST Repository

    Marondedze, Claudius; Thomas, Ludivine

    2013-01-01

    , crunchiness and crispness. Fruit firmness is affected by the inheritance of alleles at multiple loci and their possible interactions with the environment. Identification of these loci is key for the determination of genetic candidate markers that can

  17. Pemanfaatan buah apel (Malus sylvestris Mill. lewat matang sebagai substrat nata de apple

    Directory of Open Access Journals (Sweden)

    Achmad Gazali

    2017-08-01

    Full Text Available Malang and Batu are territories for the apel production in Indonesia. overripe and rejected apples become trash only. So, it’s needed to make a solution for raising value. The reseach was conducted in Mei-Juli 2016, having an object to utilize the overripe apel for making substrates of nata de apple. Apples were gotten from malang apple shop. Samples were washed and mixed with water until 50%:50% of ratio (cider A, after that, filtering cider with a gause. Cider was deluted by watering again until achieving 75%:25% (cider B and 87,5%:12,5% (cider C of ratio. All ciders were heated to avoid a bacteria contaminant. 100ml each of cider is put into specific bottles and added with 10-20 ml of Gluconobacter xylinus. The ciders were incubated at room temperature. The result of this study showed that the growth of nata de apple on cider A (1.27 ± 0,9cm is thicker than B (1.27 ± 0,9cm and nata on cider B was thicker than C (0.13 ± 0,1 cm. The nata weight was 66.7gr for A, 43gr for B and 4.2gr for C. The residual liquid fermentation test showed that the total acid 0.4 mg/ml for A, 0.3 mg/ml for B and 0.1 mg/ml for C. The sugar reduction degree was 17,15 mg/ml of 32.4 mg/ml for A, 8 mg/ml of 26.4 mg/ml for B, and no sugar reduction of 6.3 mg/ml for C. It could be concluded that the cider A resulting the best subrate of nata de apple..

  18. Variability of the polyphenolic composition of cider apple (Malus domestica) fruits and juices.

    Science.gov (United States)

    Guyot, Sylvain; Marnet, Nathalie; Sanoner, Philippe; Drilleau, Jean-François

    2003-10-08

    Five French cider apple varieties were compared on the basis of their detailed polyphenol profile in the cortex and in the juices. Among the factors studied, variety was the most important variability factor in fruits, whereas polyphenol profiles showed an overall stability from one year to another, and a limited decrease of polyphenol concentration was observed during the starch regression period of fruit maturation. In juices, procyanidins remained the preponderant polyphenol class with concentrations up to 2.4 g/L even in centrifuged juices. Compared to the fruits, the average degree of polymerization of procyanidins was significantly reduced in the juice. Centrifugation of the crude juice had only minor effects on the polyphenol composition. For one variety, highly polymerized procyanidins with average degrees of polymerization of 25 were shown to be soluble in the centrifuged juice at a concentration of close to 1.2 g/L. Oxygenation of the juices during processing resulted in a significant decrease of all classes of native polyphenols. Catechins and procyanidins were particularly affected by oxidation, whereas caffeoylquinic acid was partly preserved. The transfer of polyphenols after pressing was maximal for dihydrochalcones and minimal for procyanidins with extraction yield values close to 80 and 30%, respectively.

  19. Effect of gamma irradiation on bitter pit of apple fruits (Malus Domestica Borkh)

    International Nuclear Information System (INIS)

    Al-Bachir, M.; Farah, S.

    2000-12-01

    Tow varieties of apple fruits Golden and Starking were irradiated with 0, 0.5, 1.0, 1.5 kGy and with 0, 1.0, 1.5 kGy respectively. Irradiated and unirradiated fruits were stored at 1 to 2 centigrade and relative humidity of 80 to 90%. Fruit quality (firmness, skin thickness and bitter pit) and juice characteristics (moisture, ash, carbohydrates, organic acids, Ph, and viscosity), were determined during storage periods (0, 3 and 6 months). The used doses of gamma irradiation significantly decreased the percentage and intensity of bitter pit. Irradiated fruits were softer immediately after irradiation and through storage periods, there were no differences in firmness between irradiated and unirradiated fruits. Gamma irradiation increased the thickness of skin in Golden fruits and decreased it in Starking. Juice production from both varieties immediately after irradiation was not affected by gamma irradiation. However the juice produced from irradiated fruits had higher organic acids (citric and malic acids), viscosity and Ph values than the control. (author)

  20. RNA-Seq analysis reveals candidate genes for ontogenic resistance in Malus-Venturia pathosystem.

    Directory of Open Access Journals (Sweden)

    Michele Gusberti

    Full Text Available Ontogenic scab resistance in apple leaves and fruits is a horizontal resistance against the plant pathogen Venturia inaequalis and is expressed as a decrease in disease symptoms and incidence with the ageing of the leaves. Several studies at the biochemical level tried to unveil the nature of this resistance; however, no conclusive results were reported. We decided therefore to investigate the genetic origin of this phenomenon by performing a full quantitative transcriptome sequencing and comparison of young (susceptible and old (ontogenic resistant leaves, infected or not with the pathogen. Two time points at 72 and 96 hours post-inoculation were chosen for RNA sampling and sequencing. Comparison between the different conditions (young and old leaves, inoculated or not should allow the identification of differentially expressed genes which may represent different induced plant defence reactions leading to ontogenic resistance or may be the cause of a constitutive (uninoculated with the pathogen shift toward resistance in old leaves. Differentially expressed genes were then characterised for their function by homology to A. thaliana and other plant genes, particularly looking for genes involved in pathways already suspected of appertaining to ontogenic resistance in apple or other hosts, or to plant defence mechanisms in general. IN THIS WORK, FIVE CANDIDATE GENES PUTATIVELY INVOLVED IN THE ONTOGENIC RESISTANCE OF APPLE WERE IDENTIFIED: a gene encoding an "enhanced disease susceptibility 1 protein" was found to be down-regulated in both uninoculated and inoculated old leaves at 96 hpi, while the other four genes encoding proteins (metallothionein3-like protein, lipoxygenase, lipid transfer protein, and a peroxidase 3 were found to be constitutively up-regulated in inoculated and uninoculated old leaves. The modulation of the five candidate genes has been validated using the real-time quantitative PCR. Thus, ontogenic resistance may be the result of the corresponding up- and down-regulation of these genes.

  1. Development and characterisation of 140 new microsatellites in apple (Malus x domestica Borkh.)

    NARCIS (Netherlands)

    Liebhard, R.; Gianfranceschi, L.; Koller, B.; Ryder, C.D.; Tarchini, R.; Weg, van de W.E.; Gessler, C.

    2002-01-01

    The availability of suitable genetic markers is essential to efficiently select and breed apple varieties of high quality and with multiple disease resistances. Microsatellites (simple sequence repeats, SSR) are very useful in this respect since they are codominant, highly polymorphic, abundant and

  2. Efeito de substratos porosos no enraizamento in vitro do porta-enxerto de macieira M-9 (Malus pumilla Effect of porous substrates in vitro rooting of M-9 apple rootstock (Malus pumilla

    Directory of Open Access Journals (Sweden)

    Renato Luíz Vieira

    2007-04-01

    Full Text Available O presente trabalho foi conduzido com o objetivo de avaliar os efeitos de substratos no enraizamento in vitro do porta-enxerto de macieira M-9. Foram testados três substratos: ágar, vermiculita (nº 2, granulometria média e cinza vegetal, como suporte físico no enraizamento das miniestacas. Para os tratamento com vermiculita e cinza vegetal, meio nutritivo MS, reduzido à metade da concentração, foi adicionado em frascos de vidro de 250 mL contendo 15 g dos respectivos substratos. Brotações de 2,5 a 3,0 cm de comprimento, com dois pares de folhas, foram transferidas para os frascos, os quais foram mantidos durante 35 dias em sala de crescimento com temperatura de 25 ±1,5ºC, fotoperíodo de 16 horas e intensidade luminosa de 75 µmol.m-2.s-1. As maiores percentagens de enraizamento (88,4 e 87,9% foram observadas nos tratamentos com vermiculita e cinza vegetal, respectivamente. Após a avaliação do enraizamento, as plantas foram transferidas para bandejas de isopor alveoladas com 128 células e mantidas por 40 dias em casa de vegetação. A maior taxa de sobrevivência de plantas aclimatizadas (93,5% foi obtida com as miniestacas produzidas em meio contendo vermiculita.the present work was carried out with the objective to evaluate the effect of substrates in the rooting in vitro of the M-9 apple rootstock. Three substrates were tested: ágar, vermiculite (number 2, medium granulometry and vegetal ash as physical support in the rooting of the shoots. For the treatment with vermiculite and vegetal ash, MS medium nutritive, with half of the concentration, was added in glass bottles of 250 mL with 15g of respective substrates. The shoots of 2,5 to 3,0 cm of length and two pair of leaves had been transferred to the bottles. After the inoculation the bottles were kept during 35 days in a growing chamber, at 25 ±1ºC, for a 16 hour photoperiod with light intensity of 75 µmol.m-2.s-1. The higher percentages of rooting (88,4 and 87,9% were observed for the treatments with vermiculite and vegetal ash, respectively. The number of roots per shoot was not affected by the applied treatments. After the evaluation of the rooting, the plants were transferred to a greenhouse for 40 days, in isopor alveolated containers with 128 cells. For the survival of the acclimatized plants the best treatment was vermiculite (93,5%.

  3. Effect of ant attendance by Monomorium minimum (Buckley) (Hymenoptera: Formicidae) on predation and parasitism of the soybean aphid Aphis glycines Matsumura (Hemiptera: Aphididae).

    Science.gov (United States)

    Herbert, John J; Horn, David J

    2008-10-01

    Ant attendance is known to affect the population dynamics of aphids and may increase or decrease aphid populations through stimulation, predation, or protection. In this study, we performed a series of laboratory experiments to examine the effects of ant attendance on populations of the soybean aphid Aphis glycines. Aphid colonies were exposed to the predators Harmonia axyridis (Coccinellidae) and Orius insidiosus (Anthocoridae) and a parasitoid Aphidius colemani (Aphidiidae) in the presence and absence of attending Monomorium minimum (Formicidae). We also tested for direct effects of ant attendance in the absence of natural enemies. Ants attending soybean aphid populations were observed harassing or killing O. insidiosus and H. axyridis. Attendance interfered with both predator species, resulting in reduced predation and an increase in aphid numbers up to 10-fold in the presence of ants. Ants were not observed directly interfering with the parasitoid A. colemani, but the number of parasitized aphids was higher in aphid colonies that were left unattended by ants.

  4. Molecular evolution of Adh and LEAFY and the phylogenetic utility of their introns in Pyrus (Rosaceae).

    Science.gov (United States)

    Zheng, Xiaoyan; Hu, Chunyun; Spooner, David; Liu, Jing; Cao, Jiashu; Teng, Yuanwen

    2011-09-14

    The genus Pyrus belongs to the tribe Pyreae (the former subfamily Maloideae) of the family Rosaceae, and includes one of the most important commercial fruit crops, pear. The phylogeny of Pyrus has not been definitively reconstructed. In our previous efforts, the internal transcribed spacer region (ITS) revealed a poorly resolved phylogeny due to non-concerted evolution of nrDNA arrays. Therefore, introns of low copy nuclear genes (LCNG) are explored here for improved resolution. However, paralogs and lineage sorting are still two challenges for applying LCNGs in phylogenetic studies, and at least two independent nuclear loci should be compared. In this work the second intron of LEAFY and the alcohol dehydrogenase gene (Adh) were selected to investigate their molecular evolution and phylogenetic utility. DNA sequence analyses revealed a complex ortholog and paralog structure of Adh genes in Pyrus and Malus, the pears and apples. Comparisons between sequences from RT-PCR and genomic PCR indicate that some Adh homologs are putatively nonfunctional. A partial region of Adh1 was sequenced for 18 Pyrus species and three subparalogs representing Adh1-1 were identified. These led to poorly resolved phylogenies due to low sequence divergence and the inclusion of putative recombinants. For the second intron of LEAFY, multiple inparalogs were discovered for both LFY1int2 and LFY2int2. LFY1int2 is inadequate for phylogenetic analysis due to lineage sorting of two inparalogs. LFY2int2-N, however, showed a relatively high sequence divergence and led to the best-resolved phylogeny. This study documents the coexistence of outparalogs and inparalogs, and lineage sorting of these paralogs and orthologous copies. It reveals putative recombinants that can lead to incorrect phylogenetic inferences, and presents an improved phylogenetic resolution of Pyrus using LFY2int2-N. Our study represents the first phylogenetic analyses based on LCNGs in Pyrus. Ancient and recent duplications lead

  5. Molecular evolution of Adh and LEAFY and the phylogenetic utility of their introns in Pyrus (Rosaceae

    Directory of Open Access Journals (Sweden)

    Cao Jiashu

    2011-09-01

    Full Text Available Abstract Background The genus Pyrus belongs to the tribe Pyreae (the former subfamily Maloideae of the family Rosaceae, and includes one of the most important commercial fruit crops, pear. The phylogeny of Pyrus has not been definitively reconstructed. In our previous efforts, the internal transcribed spacer region (ITS revealed a poorly resolved phylogeny due to non-concerted evolution of nrDNA arrays. Therefore, introns of low copy nuclear genes (LCNG are explored here for improved resolution. However, paralogs and lineage sorting are still two challenges for applying LCNGs in phylogenetic studies, and at least two independent nuclear loci should be compared. In this work the second intron of LEAFY and the alcohol dehydrogenase gene (Adh were selected to investigate their molecular evolution and phylogenetic utility. Results DNA sequence analyses revealed a complex ortholog and paralog structure of Adh genes in Pyrus and Malus, the pears and apples. Comparisons between sequences from RT-PCR and genomic PCR indicate that some Adh homologs are putatively nonfunctional. A partial region of Adh1 was sequenced for 18 Pyrus species and three subparalogs representing Adh1-1 were identified. These led to poorly resolved phylogenies due to low sequence divergence and the inclusion of putative recombinants. For the second intron of LEAFY, multiple inparalogs were discovered for both LFY1int2 and LFY2int2. LFY1int2 is inadequate for phylogenetic analysis due to lineage sorting of two inparalogs. LFY2int2-N, however, showed a relatively high sequence divergence and led to the best-resolved phylogeny. This study documents the coexistence of outparalogs and inparalogs, and lineage sorting of these paralogs and orthologous copies. It reveals putative recombinants that can lead to incorrect phylogenetic inferences, and presents an improved phylogenetic resolution of Pyrus using LFY2int2-N. Conclusions Our study represents the first phylogenetic analyses based

  6. First report of Elsinoe leaf and fruit spot and Elsinoe pyri on apple in Denmark

    DEFF Research Database (Denmark)

    Glazowska, Sylwia Emilia; Schiller, Michaela; Lund, Ole Søgaard

    2013-01-01

    . The associated pathogen has not previously been identi- fied, but symptoms are identical to those described for el- sinoe leaf and fruit spot (ELFS) caused by the ascomycete, Elsinoe pyri (Scheper et al., 2013). In 2012, DNA from fruit skin of apples was purified from two cultivars, Pigeon fra Juellinge...... (Scheper et al., 2013) were recovered by inoculating Topaz- spot infected fruit skin onto potato dextrose agar. Sequenc- ing of the ITS1-5.8S-ITS2 region revealed two identical 628 bp sequences (GenBank KC928079, KC928080) with 99% sequence identity to the previously published sequences of E. pyri. Our......An apple disease, known as “Topaz spot” in northern Europe (Trapman and Jansonius, 2008) has since year 2000 become widespread in Danish organic apple orchards (Malus domestica). Characteristic symptoms are small spots (black on fruits, brown on leaves) having a silvery-grey cen- tre...

  7. The environmental plasticity of diverse body color caused by extremely long photoperiods and high temperature in Saccharosydne procerus (Homoptera: Delphacidae

    Directory of Open Access Journals (Sweden)

    Haichen Yin

    2016-09-01

    Full Text Available Melanization reflects not only body color variation but also environmental plasticity. It is a strategy that helps insects adapt to environmental change. Different color morphs may have distinct life history traits, e.g., development time, growth rate, and body weight. The green slender planthopper Saccharosydne procerus (Matsumura is the main pest of water bamboo (Zizania latifolia. This insect has two color morphs. The present study explored the influence of photoperiod and its interaction with temperature in nymph stage on adult melanism. Additionally, the longevity, fecundity, mating rate, and hatching rate of S. procerus were examined to determine whether the fitness of the insect was influenced by melanism under different temperature and photoperiod. The results showed that a greater number of melanic morphs occurred if the photoperiod was extremely long. A two-factor ANOVA showed that temperature and photoperiod both have a significant influence on melanism. The percentages of variation explained by these factors were 45.53% and 48.71%, respectively. Moreover, melanic morphs had greater advantages than non-melanic morphs under an environmental regime of high temperatures and a long photoperiod, whereas non-melanic morphs were better adapted to cold temperatures and a short photoperiod. These results cannot be explained by the thermal melanism hypothesis. Thus, it may be unavailable to seek to explain melanism in terms of only one hypothesis.

  8. The influence of Lasius neoniger (Hymenoptera: Formicidae) on population growth and biomass of Aphis glycines (Hemiptera: Aphididae) in soybeans.

    Science.gov (United States)

    Schwartzberg, Ezra G; Johnson, D W; Brown, G C

    2010-12-01

    In the United States, the soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), are often tended by the aphid-tending ant, Lasius neoniger Emery (Hymenoptera: Formicidae). In this study, we examined the effects of tending by ants on the density and biomass of soybean aphids on soybeans in Kentucky. We performed cage studies that limited access by ants and/or natural enemies. We used a split-plot design with natural enemy access as the main plot and ant attendance as the sub plot. We found that natural enemy access negatively affected aphid population density in the presence of tending ants, seen as a three- to four-fold increase in aphid density when natural enemies were excluded. In addition, we found that ant tending positively affected aphid biomass, both when natural enemies were given access to aphids or when natural enemies were excluded, seen by a two-fold increase in aphid biomass when ants tended aphids, both in the presence or absence of natural enemies. Biomass accumulation is seen as an important measurement for assessing aphid performance, and we argue that aphid-tending by ants can have an influence on natural field populations of soybean aphids. Agronomic practices that affect ant abundance in soybeans may influence the performance and hence pest outbreaks for this economically important pest. © 2010 Entomological Society of America

  9. Quantifying host potentials: indexing postharvest fresh fruits for spotted wing Drosophila, Drosophila suzukii.

    Directory of Open Access Journals (Sweden)

    David E Bellamy

    Full Text Available Novel methodology is presented for indexing the relative potential of hosts to function as resources. A Host Potential Index (HPI was developed as a practical framework to express relative host potential based on combining results from one or more independent studies, such as those examining host selection, utilization, and physiological development of the organism resourcing the host. Several aspects of the HPI are addressed including: 1 model derivation; 2 influence of experimental design on establishing host rankings for a study type (no choice, two-choice, and multiple-choice; and, 3 variable selection and weighting associated with combining multiple studies. To demonstrate application of the HPI, results from the interactions of spotted wing drosophila (SWD, Drosophila suzukii Matsumura (Diptera: Drosophilidae, with seven "reported" hosts (blackberries, blueberries, sweet cherries, table grapes, peaches, raspberries, and strawberries in a postharvest scenario were analyzed. Four aspects of SWD-host interaction were examined: attraction to host volatiles; population-level oviposition performance; individual-level oviposition performance; and key developmental factors. Application of HPI methodology indicated that raspberries ( (meanHPIvaried  = 301.9±8.39; rank 1 of 7 have the greatest potential to serve as a postharvest host for SWD relative to the other fruit hosts, with grapes ( (meanHPIvaried  = 232.4±3.21; rank 7 of 7 having the least potential.

  10. Tècniques de maneig de pomera (Malus domestica Borkhausen) en agricultura ecològica

    OpenAIRE

    Alins Valls, Georgina

    2009-01-01

    En la darrera dècada, la superfície en agricultura ecològica a Europa ha experimentat unfort augment, però la producció de fruita dolça encara no arriba a l'1% de la producció totaldegut a les dificultats tècniques que comporta. La producció de pomes en agricultura ecològica planteja tota una sèrie de reptes com l'elecció de la varietat, el control de plagues, malalties i flora arvense i l'aclarida, entre altres. El treball realitzat en aquesta tesi ha tingut com a objectiu incrementar el con...

  11. Effect of root application of 6-benzylamine purine on auxin transport in Malus domestica

    International Nuclear Information System (INIS)

    Stutte, G.

    1987-01-01

    The effect of 6-benzylamine purine (BA) on movement of napthalene acetic acid (NAA) applied to the shoot was investigated. Three-month-old York apple seedlings in sand culture were placed under mercury halide lamps (285 μmol m -2 s -1 ) at 22 0 C for 24 hours; then 13.8, 27.5 or 55 μMol of BA was applied as a soil drench. [ 14 C]-NAA was injected into the shoot at petiole base of 4th mature leaf. After 24 hours plants were harvested and movement of label acropetally to new shoot growth and basipetally to old shoot growth or roots determined. Seventeen (S.E. 3.3) percent of applied label was recovered away from application site. In controls, 67% of 14 C that moved was recovered from new shoot growth, 9% in roots and 24% in old shoot tissue. The 13.8 μMol treatment resulted in 37% of label being recovered in root tissue and 48% in new growth. The 27.5 and 55 μMol applications increased the amount recovered in old shoot tissue but did not increase labelling of root tissues

  12. Polyphenol oxidase activity and antioxidant properties of Yomra apple (Malus communis L.) from Turkey.

    Science.gov (United States)

    Can, Zehra; Dincer, Barbaros; Sahin, Huseyin; Baltas, Nimet; Yildiz, Oktay; Kolayli, Sevgi

    2014-12-01

    In this study, firstly, antioxidant and polyphenol oxidase (PPO) properties of Yomra apple were investigated. Seventeen phenolic constituents were measured by reverse phase-high-performance liquid chromatography (RP-HPLC). Total phenolic compounds (TPCs), ferric reducing antioxidant power (FRAP) and 2, 2-diphenyl-1-picrylhydrazyl radical (DPPH) scavenging activities were performed to measure antioxidant capacity. Some kinetic parameters (Km, Vmax), and inhibition behaviors against five different substrates were measured in the crude extract. Catechin and chlorogenic acid were found as the major components in the methanolic extract, while ferulic acid, caffeic acid, p-hydroxybenzoic acid, quercetin and p-coumaric acid were small quantities. Km values ranged from 0.70 to 10.10 mM in the substrates, and also 3-(4-hydroxyphenyl) propanoic acid (HPPA) and L-DOPA showed the highest affinity. The inhibition constant of Ki were ranged from 0.05 to 14.90 mM against sodium metabisulphite, ascorbic acid, sodium azide and benzoic acid, while ascorbic acid and sodium metabisulphite were the best inhibitors.

  13. Physiological and phenotypic variations between columnar and standard apple (Malus x domestica Borkh.) trees

    DEFF Research Database (Denmark)

    Talwara, Susheela

    Columnar apple trees have very determined growth habit, short internodes, nearly absent branching and can be planted densely in the orchards to obtain higher yields. Such tree architecture provides a possibility for automation and mechanization in agriculture and hence lowering the labour cost wh...... the variations between columnar and standard apple trees. This knowledge provides a better insight on the production abilities of the columnar apple trees which may be useful for future crop improvement strategies.......Columnar apple trees have very determined growth habit, short internodes, nearly absent branching and can be planted densely in the orchards to obtain higher yields. Such tree architecture provides a possibility for automation and mechanization in agriculture and hence lowering the labour cost...... on the physiological and phenotypic characteristics of the columnar apple trees were made by comparing them with the standard traditionally grown non-columnar apple trees. Data from the leaves morphological and anatomical studies and from various physiological investigations have been assembled to compare...

  14. Quebra da dormência da maciera (Malus domestica Borkh em São Joaquim-SC

    Directory of Open Access Journals (Sweden)

    IUCHI VERA LÚCIA

    2002-01-01

    Full Text Available A macieira é uma fruteira de clima temperado que se caracteriza pelo fenômeno de dormência das gemas, necessitando de determinado número de horas de frio (< 7,2ºC para abertura de gemas. No Brasil, São Joaquim-SC, é o local que apresenta as melhores condições climáticas para o cultivo desta espécie. Entretanto, não é correto afirmar que sempre apresenta horas de frio suficientes para satisfazer as exigências das cultivares. Foram desenvolvidos experimentos no ano 1998 e 1999, em microclimas específicos, que vão de 900 a 1400 metros de altitude, no município de São Joaquim -- SC, permitindo afirmar que apenas para a cultivar Gala, nos locais mais altos, acima de 1300 m, em anos acima de 2.300 unidades de frio, é dispensada a superação de dormência artificial.

  15. Efficient sampling to determine distribution of fruit quality and yield in a commercial apple orchard

    DEFF Research Database (Denmark)

    Martinez Vega, Mabel Virginia; Wulfsohn, D.; Zamora, I.

    2012-01-01

    In situ assessment of fruit quality and yield can provide critical data for marketing and for logistical planning of the harvest, as well as for site-specific management. Our objective was to develop and validate efficient field sampling procedures for this purpose. We used the previously reported...... ‘fractionator’ tree sampling procedure and supporting handheld software (Gardi et al., 2007; Wulfsohn et al., 2012) to obtain representative samples of fruit from a 7.6-ha apple orchard (Malus ×domestica ‘Fuji Raku Raku’) in central Chile. The resulting sample consisted of 70 fruit on 56 branch segments...... of yield. Estimated marketable yield was 295.8±50.2 t. Field and packinghouse records indicated that of 348.2 t sent to packing (52.4 t or 15% higher than our estimate), 263.0 t was packed for export (32.8 t less or -12% error compared to our estimate). The estimated distribution of caliber compared very...

  16. Efficient sampling to determine the distribution of fruit quality and yield in a commercial apple orchard

    DEFF Research Database (Denmark)

    Martinez, M.; Wulfsohn, Dvora-Laio; Zamora, I.

    2012-01-01

    In situ assessment of fruit quality and yield can provide critical data for marketing and for logistical planning of the harvest, as well as for site-specific management. Our objective was to develop and validate efficient field sampling procedures for this purpose. We used the previously reported...... 'fractionator' tree sampling procedure and supporting handheld software (Gardi et al., 2007; Wulfsohn et al., 2012) to obtain representative samples of fruit from a 7.6-ha apple orchard (Malus ×domestica 'Fuji Raku Raku') in central Chile. The resulting sample consisted of 70 fruit on 56 branch segments...... of yield. Estimated marketable yield was 295.8±50.2 t. Field and packinghouse records indicated that of 348.2 t sent to packing (52.4 t or 15% higher than our estimate), 263.0 t was packed for export (32.8 t less or -12% error compared to our estimate). The estimated distribution of caliber compared very...

  17. Uptake of [2-14C]abscisic acid and distribution of 14C in apple embryos

    International Nuclear Information System (INIS)

    Barthe, P.; Bulard, C.

    1981-01-01

    Pyrus malus L. var. Golden delicious embryos were incubated with (+-)-[2- 14 C] abscisic acid (ABA). After incubations of various durations, the radioactivity was measured in whole embryos, cotyledons, and embryonic axes. With either 48-h or 16-d incubation periods, the uptake of [ 14 C] ABA depended upon the mode of culture used. The lowest values corresponded to the absorption by the embryonic axis, the highest to the absorption by the distal parts of the two cotyledons. The cotyledons accumulated the main part of the radioactivity under all conditions. Dormant and almost completely after-ripened embryos cultivated for 4 d showed no significant differences in the radioactivity uptake for identical modes of culture. There was a linear relationship between exogenous ABA concentrations (0.5 to 3.10 -5 M) and ABA uptake for embryos cultivated for 4 d with the distal parts of the cotyledons immersed in the medium. (orig.) [de

  18. Uptake of (2-/sup 14/C)abscisic acid and distribution of /sup 14/C in apple embryos

    Energy Technology Data Exchange (ETDEWEB)

    Barthe, P.; Bulard, C.

    1981-01-01

    Pyrus malus L. var. Golden delicious embryos were incubated with (+-)-(2-/sup 14/C) abscisic acid (ABA). After incubations of various durations, the radioactivity was measured in whole embryos, cotyledons, and embryonic axes. With either 48-h or 16-d incubation periods, the uptake of (/sup 14/C) ABA depended upon the mode of culture used. The lowest values corresponded to the absorption by the embryonic axis, the highest to the absorption by the distal parts of the two cotyledons. The cotyledons accumulated the main part of the radioactivity under all conditions. Dormant and almost completely after-ripened embryos cultivated for 4 d showed no significant differences in the radioactivity uptake for identical modes of culture. There was a linear relationship between exogenous ABA concentrations (0.5 to 3.10/sup -5/ M) and ABA uptake for embryos cultivated for 4 d with the distal parts of the cotyledons immersed in the medium.

  19. BAC-end sequence-based SNPs and Bin mapping for rapid integration of physical and genetic maps in apple.

    Science.gov (United States)

    Han, Yuepeng; Chagné, David; Gasic, Ksenija; Rikkerink, Erik H A; Beever, Jonathan E; Gardiner, Susan E; Korban, Schuyler S

    2009-03-01

    A genome-wide BAC physical map of the apple, Malus x domestica Borkh., has been recently developed. Here, we report on integrating the physical and genetic maps of the apple using a SNP-based approach in conjunction with bin mapping. Briefly, BAC clones located at ends of BAC contigs were selected, and sequenced at both ends. The BAC end sequences (BESs) were used to identify candidate SNPs. Subsequently, these candidate SNPs were genetically mapped using a bin mapping strategy for the purpose of mapping the physical onto the genetic map. Using this approach, 52 (23%) out of 228 BESs tested were successfully exploited to develop SNPs. These SNPs anchored 51 contigs, spanning approximately 37 Mb in cumulative physical length, onto 14 linkage groups. The reliability of the integration of the physical and genetic maps using this SNP-based strategy is described, and the results confirm the feasibility of this approach to construct an integrated physical and genetic maps for apple.

  20. PODER CALORÍFICO Y MATERIAL INORGÁNICO EN LA CORTEZA DE SEIS ÁRBOLES FRUTALES

    Directory of Open Access Journals (Sweden)

    Ricardo Martínez-Pérez

    2012-01-01

    Full Text Available El poder calorífico y el contenido de sustancias minerales (cenizas se determinaron en la corteza de seis especies arbóreas frutales (Annona cherimola Mill., Citrus aurantifolia Swingle, Malus domestica Borkh., Psidium guajava L., Prunus dulcis [Mill.] D. A. Webb y Tamarindus indica L.. Las cenizas obtenidas fueron analizadas mediante rayos X. Los valores encontrados de poder calorífico variaron de 3,453.49 kcal•kg-1 en T. indica a 4,076.10 kcal•kg-1 en P. guajava. En el caso de las cenizas, los resultados fluctuaron de 5.76 % en P. guajava a 21.93 % en T. indica. Se observó que un contenido mayor de minerales en las cortezas tiende a disminuir su poder calorífico. Los elementos químicos comunes en las muestras analizadas fueron calcio, potasio, magnesio, fósforo y azufre. No se detectaron metales pesados en las muestras de la corteza.

  1. Instruments for reducing the specific fuel consumption of cars; Instrumente zur Absenkung des spezifischen Treibstoffverbrauchs von Personenwagen

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, S.; Maibach, M. [Infras, Zuerich (Switzerland); Marti, P. [Metron, Brugg (Switzerland)

    2001-07-01

    This report for the Swiss Federal Office of Energy (SFOE) presents three possible courses of action that are to be taken to reduce the specific fuel consumption of private cars. The report first examines existing targets and the degree to which they have been met up to now, whereby the situation both in Switzerland and in the European Union is looked at. The report makes a suggestion for a future target scenario and elaborates three possible ways to met these targets: regulations on fuel-consumption, a bonus/malus system and tradable certificates. For each of the proposed instruments, the report examines implementation variants and discusses the means for their implementation. The report presents the best models for each of the implementation-variants on the basis of comparisons and the results of evaluations of their effects. For these chosen variants, the authors present comparisons of their effect on fuel consumption in graphical form and recommend tradable certificates as the best instrument.

  2. Accumulation of Rutin and Betulinic Acid and Expression of Phenylpropanoid and Triterpenoid Biosynthetic Genes in Mulberry (Morus alba L.).

    Science.gov (United States)

    Zhao, Shicheng; Park, Chang Ha; Li, Xiaohua; Kim, Yeon Bok; Yang, Jingli; Sung, Gyoo Byung; Park, Nam Il; Kim, Soonok; Park, Sang Un

    2015-09-30

    Mulberry (Morus alba L.) is used in traditional Chinese medicine and is the sole food source of the silkworm. Here, 21 cDNAs encoding phenylpropanoid biosynthetic genes and 21 cDNAs encoding triterpene biosynthetic genes were isolated from mulberry. The expression levels of genes involved in these biosynthetic pathways and the accumulation of rutin, betulin, and betulinic acid, important secondary metabolites, were investigated in different plant organs. Most phenylpropanoid and triterpene biosynthetic genes were highly expressed in leaves and/or fruit, and most genes were downregulated during fruit ripening. The accumulation of rutin was more than fivefold higher in leaves than in other organs, and higher levels of betulin and betulinic acid were found in roots and leaves than in fruit. By comparing the contents of these compounds with gene expression levels, we speculate that MaUGT78D1 and MaLUS play important regulatory roles in the rutin and betulin biosynthetic pathways.

  3. Free amino nitrogen concentration correlates to total yeast assimilable nitrogen concentration in apple juice.

    Science.gov (United States)

    Boudreau, Thomas F; Peck, Gregory M; O'Keefe, Sean F; Stewart, Amanda C

    2018-01-01

    Yeast assimilable nitrogen (YAN) is essential for yeast growth and metabolism during apple ( Malus x domestica Borkh.) cider fermentation. YAN concentration and composition can impact cider fermentation kinetics and the formation of volatile aroma compounds by yeast. The YAN concentration and composition of apples grown in Virginia, USA over the course of two seasons was determined through analysis of both free amino nitrogen (FAN) and ammonium ion concentration. FAN was the largest fraction of YAN, with a mean value of 51 mg N L -1 FAN compared to 9 mg N L -1 ammonium. Observed YAN values ranged from nine to 249 mg N L -1 , with a mean value of 59 mg N L -1 . Ninety-four percent of all samples analyzed in this study contained yeast to fully utilize all of the fermentable sugars. FAN concentration was correlated with total YAN concentration, but ammonium concentration was not. Likewise, there was no correlation between FAN and ammonium concentration.

  4. Instruments for reducing the specific fuel consumption of cars

    International Nuclear Information System (INIS)

    Hammer, S.; Maibach, M.; Marti, P.

    2001-01-01

    This report for the Swiss Federal Office of Energy (SFOE) presents three possible courses of action that are to be taken to reduce the specific fuel consumption of private cars. The report first examines existing targets and the degree to which they have been met up to now, whereby the situation both in Switzerland and in the European Union is looked at. The report makes a suggestion for a future target scenario and elaborates three possible ways to met these targets: regulations on fuel-consumption, a bonus/malus system and tradable certificates. For each of the proposed instruments, the report examines implementation variants and discusses the means for their implementation. The report presents the best models for each of the implementation-variants on the basis of comparisons and the results of evaluations of their effects. For these chosen variants, the authors present comparisons of their effect on fuel consumption in graphical form and recommend tradable certificates as the best instrument

  5. Report on the behalf of the Commission of Economic Affairs on the bill project, adopted by the National Assembly after an accelerated procedure, and aiming at preparing the transition towards an energy-efficient system - Nr 70

    International Nuclear Information System (INIS)

    Courteau, Roland

    2012-01-01

    This report notably addresses the issues present in a bill project and concerning the introduction of a progressive energy pricing with the implementation of a bonus-malus principle in energy tariffs as well as some measures related to social tariffs. After having evoked this progressive pricing which aims at promoting a more moderate use of energy, the author refers to international examples (California, Italy, Minnesota, Japan, Quebec, South Korea, Belgium and Germany). He outlines that such a progressive pricing incites a reduction of energy consumption. He discusses the required accompanying policies: struggle against energy precariousness and promotion of energy performance. Other accompanying measures are presented and discussed which notably concerns wind farm implantation. Then, the report contains the text proposed to the Senate, the opinion of the Commission, a list of hearings, and a table comparing the present situation, the content of the bill project, the text adopted by the National Assembly, and the text issued by the Commission

  6. Sistema radicular de porta-enxertos micropropagados de macieira colonizados com fungos micorrízicos arbusculares Root architecture of apple rootstocks inoculated with arbuscular mycorrhizal fungi

    Directory of Open Access Journals (Sweden)

    Lucir Maria Locatelli

    2002-09-01

    Full Text Available A arquitetura do sistema radicular tem implicações na capacidade da planta de obter nutrientes e água do solo; aspecto, este, não muito considerado nos estudos de desenvolvimento vegetal. O objetivo deste trabalho foi avaliar o comportamento do sistema radicular de dois porta-enxertos micropropagados de macieira (Malus spp., em razão da associação micorrízica. Foram utilizados um porta-enxerto vigoroso e com grande capacidade de enraizamento (Marubakaido e outro ananicante e com sistema radicular pouco desenvolvido (M.9. As plantas oriundas de micropropagação foram transferidas para substrato à base de solo, a fim de serem enraizadas ex vitro. Antes ou após o enraizamento, inoculou-se uma mistura de três isolados de fungos micorrízicos arbusculares ou um filtrado com a biota não-micorrízica do inoculante. Aos 51 e 81 dias, avaliaram-se o número e o comprimento de eixos radiculares e das raízes de ordem 1, 2, 3 e 4. A inoculação micorrízica antes do enraizamento aumentou o número e o comprimento de raízes do porta-enxerto Marubakaido, porém, o portaenxerto M.9 teve o número e o comprimento de raízes diminuído quando a inoculação micorrízica ocorreu antes da fase de enraizamento.Root architecture is scarcely considered in plant physiology studies, despite its great importance to plant growth and development. In order to evaluate the behavior of the root systems of two varieties of apple (Malus spp. rootstock when subjected to mycorrhizal association. Two apple rootstocks were tested: Marubakaido, which is vigorous and roots easily, and M.9, which is dwarfing and poorly rooted. The micropropagated plantlets were transferred to a soil-based substrate and received AMF inoculum, or its non-mycorrhizal biota, before and after a 21-day rooting and weaning period. After 51 and 81 days, the number and length of root axes and of first-, second-, third- and fourth- order roots were evaluated. AMF inoculation before weaning and

  7. Studying Plant–Insect Interactions with Solid Phase Microextraction: Screening for Airborne Volatile Emissions Response of Soybeans to the Soybean Aphid, Aphis glycines Matsumura (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Lingshuang Cai

    2015-05-01

    Full Text Available Insects trigger plants to release volatile compounds that mediate the interaction with both pest and beneficial insects. Soybean aphids (Aphis glycines induces soybean (Glycine max leaves to produce volatiles that attract predators of the aphid. In this research, we describe the use of solid-phase microextraction (SPME for extraction of volatiles from A. glycines-infested plant. Objectives were to (1 determine if SPME can be used to collect soybean plant volatiles and to (2 use headspace SPME-GC-MS approach to screen compounds associated with A. glycines-infested soybeans, grown in the laboratory and in the field, to identify previously known and potentially novel chemical markers of infestation. A total of 62 plant volatiles were identified, representing 10 chemical classes. 39 compounds had not been found in previous studies of soybean volatile emissions. 3-hexen-1-ol, dimethyl nonatriene, indole, caryophyllene, benzaldehyde, linalool, methyl salicylate (MeSA, benzene ethanol, and farnesene were considered herbivore-induced plant volatiles (HIPVs. For reproductive field-grown soybeans, three compounds were emitted in greater abundance from leaves infested with A. glycines, cis-3-hexen-1-ol acetate, MeSA and farnesene. In summary, SPME can detect the emission of HIPVs from plants infested with insect herbivores.

  8. Characterization of the MLO gene family in Rosaceae and gene expression analysis in Malus domestica.

    Science.gov (United States)

    Pessina, Stefano; Pavan, Stefano; Catalano, Domenico; Gallotta, Alessandra; Visser, Richard G F; Bai, Yuling; Malnoy, Mickael; Schouten, Henk J

    2014-07-22

    Powdery mildew (PM) is a major fungal disease of thousands of plant species, including many cultivated Rosaceae. PM pathogenesis is associated with up-regulation of MLO genes during early stages of infection, causing down-regulation of plant defense pathways. Specific members of the MLO gene family act as PM-susceptibility genes, as their loss-of-function mutations grant durable and broad-spectrum resistance. We carried out a genome-wide characterization of the MLO gene family in apple, peach and strawberry, and we isolated apricot MLO homologs through a PCR-approach. Evolutionary relationships between MLO homologs were studied and syntenic blocks constructed. Homologs that are candidates for being PM susceptibility genes were inferred by phylogenetic relationships with functionally characterized MLO genes and, in apple, by monitoring their expression following inoculation with the PM causal pathogen Podosphaera leucotricha. Genomic tools available for Rosaceae were exploited in order to characterize the MLO gene family. Candidate MLO susceptibility genes were identified. In follow-up studies it can be investigated whether silencing or a loss-of-function mutations in one or more of these candidate genes leads to PM resistance.

  9. Characterization of the MLO gene family in Rosaceae and gene expression analysis in Malus domestica

    NARCIS (Netherlands)

    Pessina, S.; Pavan, S.N.C.; Catalano, D.; Gallotta, A.; Visser, R.G.F.; Bai, Y.; Malnoy, M.; Schouten, H.J.

    2014-01-01

    Background Powdery mildew (PM) is a major fungal disease of thousands of plant species, including many cultivated Rosaceae. PM pathogenesis is associated with up-regulation of MLO genes during early stages of infection, causing down-regulation of plant defense pathways. Specific members of the MLO

  10. TREE CANOPY PRUNING DOES NOT REGULATE BIENNIAL BEARING IN ”ELSTAR” APPLE (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Nikola Pavičić

    2004-12-01

    Full Text Available Four alternative pruning strategies (A– 25 generative buds, B– 50 generative buds, C– 75 generative buds and D–100 generative buds per tree for Elstar apple cultivar and their possible impact on improvement in productivity were examined in 1999 and 2000. Year was significant factor for all traits, except yield. The pruning strategy is significant for number of fruits per flower cluster and fruit mass. Interaction year and pruning strategy is significant only for number of fruits per flower cluster. Fruit mass was larger for pruning strategy A compared to the pruning strategies C and D. Yield efficiency and biennial bearing index were not affected by pruning strategies. The biennial bearing index variance was the lowest for the pruning strategy B. Trunk cross sectional area (TCSA had negative impact on fruit mass in pruning strategy C. Correlation between the flower and crop density was positive in pruning strategy A. Flower density was in positive correlation with yield in pruning strategy C. The research shows that tree pruning alone will not result in adequate yield regulation in ‘Elstar’ apple.

  11. Changes in quality of apple (Malus domestica) cultivars due to γ-irradiation and storage conditions

    International Nuclear Information System (INIS)

    Hussain, P.R.; Dar, M.A.; Meena, R.S.; Wani, A.M.; Mir, M.A.; Shafi, F.

    2008-01-01

    Ambri, Golden Delicious and Royal Delicious apple varieties were γ-irradiated (0.1-0.5 kGy) and stored under ambient (15 ±2 degC, 80%RH) and refrigerated (3±1 degC, 90%RH) conditions. They were evaluated periodically for firmness, total soluble solids, acidity, juice yield, physiological loss in weight, overall acceptability and yeast and mold counts. The γ-irradiation doses of 0.2, 0.3 and 0.5 kGy proved beneficial in maintaining the overall quality of all the 3 varieties of apple under both the storage conditions. γ-irradiation significantly reduced the yeast and mold counts of apples under storage. (author)

  12. Localization of candidate allergen genes on the apple (Malus domestica) genome and their putative allergenicity

    NARCIS (Netherlands)

    Gao Zhongshan,

    2005-01-01

    Apple is generally considered as a healthy food, but 2-3% European people can not eat this fruit because it provokes allergy reaction. Four classes of apple allergen genes have been identified, they are Mal d 1, Mal d 2, Mal d 3 and Mal d 4 . This thesis focuses on the genomic characterization of

  13. Pupation Behavior and Predation on Drosophila suzukii (Diptera: Drosophilidae) Pupae in Maine Wild Blueberry Fields.

    Science.gov (United States)

    Ballman, Elissa S; Collins, Judith A; Drummond, Francis A

    2017-12-05

    Drosophila suzukii (Matsumura; Diptera: Drosophilidae) is an invasive vinegar fly and pest of soft fruits in North America, including wild blueberries (Vaccinium angustifolium Aiton) in Maine. Despite its presence in the continental United States for 9 yr, little is known about its natural enemy complex. Here we report the results of a 3-yr study designed to identify naturally-occurring predators in Maine's wild blueberry fields. Experiments were conducted to determine pupation site and pupation depth to understand D. suzukii's predation vulnerability. Predation rates in the field of fully-exposed, caged, and buried pupae were measured. Pitfall traps were deployed to identify the potential predator assemblage, and laboratory experiments were conducted to determine how many pupae were consumed by commonly occurring ground beetle species (Carabidae) and field crickets (Gryllus pennsylvanicus Burmeister). The most commonly collected predators were ants, ground beetles, harvestmen, and field crickets. Significantly more pupae were found to occur in the soil compared to blueberry fruit, with most pupae in the top 0.5 cm layer of soil. Pupal predation rates in the field were high, with higher rates of predation on exposed pupae compared to buried pupae. Laboratory studies revealed that ground beetles and field crickets are likely predators of D. suzukii pupae. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  14. Soybean Aphid Infestation Induces Changes in Fatty Acid Metabolism in Soybean.

    Directory of Open Access Journals (Sweden)

    Charles Kanobe

    Full Text Available The soybean aphid (Aphis glycines Matsumura is one of the most important insect pests of soybeans in the North-central region of the US. It has been hypothesized that aphids avoid effective defenses by inhibition of jasmonate-regulated plant responses. Given the role fatty acids play in jasmonate-induced plant defenses, we analyzed the fatty acid profile of soybean leaves and seeds from aphid-infested plants. Aphid infestation reduced levels of polyunsaturated fatty acids in leaves with a concomitant increase in palmitic acid. In seeds, a reduction in polyunsaturated fatty acids was associated with an increase in stearic acid and oleic acid. Soybean plants challenged with the brown stem rot fungus or with soybean cyst nematodes did not present changes in fatty acid levels in leaves or seeds, indicating that the changes induced by aphids are not a general response to pests. One of the polyunsaturated fatty acids, linolenic acid, is the precursor of jasmonate; thus, these changes in fatty acid metabolism may be examples of "metabolic hijacking" by the aphid to avoid the induction of effective defenses. Based on the changes in fatty acid levels observed in seeds and leaves, we hypothesize that aphids potentially induce interference in the fatty acid desaturation pathway, likely reducing FAD2 and FAD6 activity that leads to a reduction in polyunsaturated fatty acids. Our data support the idea that aphids block jasmonate-dependent defenses by reduction of the hormone precursor.

  15. Use of Early Ripening Cultivars to Avoid Infestation and Mass Trapping to Manage Drosophila suzukii (Diptera: Drosophilidae) in Vaccinium corymbosum (Ericales: Ericaceae).

    Science.gov (United States)

    Hampton, Emily; Koski, Carissa; Barsoian, Olivia; Faubert, Heather; Cowles, Richard S; Alm, Steven R

    2014-10-01

    Use of early ripening highbush blueberry cultivars to avoid infestation and mass trapping were evaluated for managing spotted wing drosophila, Drosophila suzukii (Matsumura). Fourteen highbush blueberry cultivars were sampled for spotted wing drosophila infestation. Most 'Earliblue', 'Bluetta', and 'Collins' fruit were harvested before spotted wing drosophila oviposition commenced, and so escaped injury. Most fruit from 'Bluejay', 'Blueray', and 'Bluehaven' were also harvested before the first week of August, after which spotted wing drosophila activity led to high levels of blueberry infestation. In a separate experiment, damage to cultivars was related to the week in which fruit were harvested, with greater damage to fruit observed as the season progressed. Attractant traps placed within blueberry bushes increased nearby berry infestation by 5%, irrespective of cultivar and harvest date. The significant linear reduction in infestation with increasing distance from the attractant trap suggests that traps are influencing fly behavior to at least 5.5 m. Insecticides applied to the exterior of traps, compared with untreated traps, revealed that only 10-30% of flies visiting traps enter the traps and drown. Low trap efficiency may jeopardize surrounding fruits by increasing local spotted wing drosophila activity. To protect crops, traps for mass trapping should be placed in a perimeter outside fruit fields and insecticides need to be applied to the surface of traps or on nearby fruit to function as an attract-and-kill strategy. © 2014 Entomological Society of America.

  16. Visualized study on specific points on demand curves and flow patterns in a single-side heated narrow rectangular channel

    International Nuclear Information System (INIS)

    Wang Junfeng; Huang Yanping; Wang Yanlin

    2011-01-01

    Highlights: → Specific points on the demand curve and flow patterns are visually studied. → Bubbly, churn, and annular flows were observed. → Onset of flow instability and bubbly-churn transition occurs at the same time. → The evolution of specific points and flow pattern transitions were examined. - Abstract: A simultaneous visualization and measurement study on some specific points on demand curves, such as onset of nucleate boiling (ONB), onset of significant void (OSV), onset of flow instability (OFI), and two-phase flow patterns in a single-side heated narrow rectangular channel, having a width of 40 mm and a gap of 3 mm, was carried out. New experimental approaches were adopted to identify OSV and OFI in a narrow rectangular channel. Under experimental conditions, the ONB could be predicted well by the Sato and Matsumura model. The OSV model of Bowring can reasonably predict the OSV if the single-side heated condition is considered. The OFI was close to the saturated boiling point and could be described accurately by Kennedy's correlation. The two-phase flow patterns observed in this experiment could be classified into bubbly, churn, and annular flow. Slug flow was never observed. The OFI always occurred when the bubbles at the channel exit began to coalesce, which corresponded to the beginning of the bubbly-churn transition in flow patterns. Finally, the evolution of specific points and flow pattern transitions were examined in a single-side heated narrow rectangular channel.

  17. Phenotypic Plasticity of HSP70s Gene Expression during Diapause: Signs of Evolutionary Responses to Cold Stress among Soybean Pod Borer Populations (Leguminivora glycinivorella) in Northeast of China

    Science.gov (United States)

    Han, Lanlan; Fan, Dong; Zhao, Kuijun

    2014-01-01

    The soybean pod borer (Leguminivora glycinivorella Matsumura) successfully survives the winter because of its high expression of 70-kDa heat shock proteins (HSP70s) during its overwintering diapause. The amount of HSP70s is different under different environmental stresses. In this study, inducible heat shock protein 70 and its constitutive heat shock cognate 70 were cloned by RT-PCR and RACE. These genes were named Lg-hsp70 and Lg-hsc70, respectively. Gene transcription and protein expression after cold stress treatment (5°C to −5°C) were analyzed by western blotting and by qRT-PCR for four populations that were sampled in the northeast region of China, including Shenyang, Gongzhuling, Harbin and Heihe, when the soybean pod borer was in diapause. As the cold shock temperature decreased, the levels of Lg-HSP70s were significantly up-regulated. The amount of cold-induced Lg-HSP70s was highest in the southernmost population (Shenyang, 41°50′N) and lowest in the northernmost population (Heihe, 50°22′N). These results support the hypothesis that the soybean pod borer in the northeast region of China displays phenotypic plasticity, and the accumulation of Lg-HSP70s is a strategy for overcoming environmental stress. These results also suggest that the induction of HSP70 synthesis, which is a complex physiological adaptation, can evolve quickly and inherit stability. PMID:25330365

  18. Variable Isotopic Compositions of Host Plant Populations Preclude Assessment of Aphid Overwintering Sites

    Directory of Open Access Journals (Sweden)

    Michael S. Crossley

    2017-12-01

    Full Text Available Soybean aphid (Aphis glycines Matsumura is a pest of soybean in the northern Midwest whose migratory patterns have been difficult to quantify. Improved knowledge of soybean aphid overwintering sites could facilitate the development of control efforts with exponential impacts on aphid densities on a regional scale. In this preliminary study, we explored the utility of variation in stable isotopes of carbon and nitrogen to distinguish soybean aphid overwintering origins. We compared variation in bulk 13C and 15N content in buckthorn (Rhamnus cathartica L. and soybean aphids in Wisconsin, among known overwintering locations in the northern Midwest. Specifically, we looked for associations between buckthorn and environmental variables that could aid in identifying overwintering habitats. We detected significant evidence of correlation between the bulk 13C and 15N signals of soybean aphids and buckthorn, despite high variability in stable isotope composition within and among buckthorn plants. Further, the 15N signal in buckthorn varied predictably with soil composition. However, lack of sufficient differentiation of geographic areas along axes of isotopic and environmental variation appears to preclude the use of carbon and nitrogen isotopic signals as effective predictors of likely aphid overwintering sites. These preliminary data suggest the need for future work that can further account for variability in 13C and 15N within/among buckthorn plants, and that explores the utility of other stable isotopes in assessing likely aphid overwintering sites.

  19. Expression of the double-stranded RNA of the soybean pod borer Leguminivora glycinivorella (Lepidoptera: Tortricidae) ribosomal protein P0 gene enhances the resistance of transgenic soybean plants.

    Science.gov (United States)

    Meng, Fanli; Li, Yang; Zang, Zhenyuan; Li, Na; Ran, Ruixue; Cao, Yingxue; Li, Tianyu; Zhou, Quan; Li, Wenbin

    2017-12-01

    The soybean pod borer [SPB; Leguminivora glycinivorella (Matsumura) (Lepidoptera: Tortricidae)] is the most important soybean pest in northeastern Asia. Silencing genes using plant-mediated RNA-interference is a promising strategy for controlling SPB infestations. The ribosomal protein P0 is important for protein translation and DNA repair in the SPB. Thus, transferring P0 double-stranded RNA (dsRNA) into plants may help prevent SPB-induced damage. We investigated the effects of SpbP0 dsRNA injections and SpbP0 dsRNA-expressing transgenic soybean plants on the SPB. Larval mortality rates were greater for SpbP0 dsRNA-injected larvae (96%) than for the control larvae (31%) at 14 days after injections. Transgenic T 2 soybean plants expressing SpbP0 dsRNA sustained less damage from SPB larvae than control plants. In addition, the expression level of the SpbP0 gene decreased and the mortality rate increased when SPB larvae were fed on T 3 transgenic soybean pods. Moreover, the surviving larvae were deformed and exhibited inhibited growth. Silencing SpbP0 expression is lethal to the SPB. Transgenic soybean plants expressing SpbP0 dsRNA are more resistant to the SPB than wild-type plants. Thus, SpbP0 dsRNA-expressing transgenic plants may be useful for controlling insect pests. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  20. Myrtaceae Plant Essential Oils and their β-Triketone Components as Insecticides against Drosophila suzukii

    Directory of Open Access Journals (Sweden)

    Chung Gyoo Park

    2017-06-01

    Full Text Available Spotted wing drosophila (SWD, Drosophila suzukii (Matsumura, Diptera: Drosophilidae is recognized as an economically important pest in North America and Europe as well as in Asia. Assessments were made for fumigant and contact toxicities of six Myrtaceae plant essential oils (EOs and their components to find new alternative types of insecticides active against SWD. Among the EOs tested, Leptospermum citratum EO, consisting mainly of geranial and neral, exhibited effective fumigant activity. Median lethal dose (LD50; mg/L values of L. citratum were 2.39 and 3.24 for males and females, respectively. All tested EOs except Kunzea ambigua EO exhibited effective contact toxicity. LD50 (µg/fly values for contact toxicity of manuka and kanuka were 0.60 and 0.71, respectively, for males and 1.10 and 1.23, respectively, for females. The LD50 values of the other 3 EOs-L. citratum, allspice and clove bud were 2.11–3.31 and 3.53–5.22 for males and females, respectively. The non-polar fraction of manuka and kanuka did not show significant contact toxicity, whereas the polar and triketone fractions, composed of flavesone, isoleptospermone and leptospermone, exhibited efficient activity with the LD50 values of 0.13–0.37 and 0.22–0.57 µg/fly for males and females, respectively. Our results indicate that Myrtaceae plant EOs and their triketone components can be used as alternatives to conventional insecticides.

  1. Morfogênese in vitro de brotos de macieira (Malus domestica Borkh. a partir de fragmentos delgados de folhas In vitro morphogenesis of shoots of apple tree (Malus domestica Borkh. Starting from thin fragments of leaves

    Directory of Open Access Journals (Sweden)

    Alan Cristiano Erig

    2005-06-01

    Full Text Available O pré-requisito para se obter sucesso na transformação genética de plantas, e também para a multiplicação rápida do genótipo modificado pela micropropagação, é um protocolo de regeneração eficiente. Objetivou-se com este trabalho estudar a expressão do potencial morfogenético de fragmentos delgados de folhas de macieira e otimizar um protocolo de regeneração visando futuros trabalhos de transformação genética. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema fatorial 3 x 2 x 6, com três cultivares de macieira (Galaxy, Maxigala e Mastergala, dois tipos de explantes (fragmentos finos de folhas cortados no sentido transversal e longitudinal, e seis concentrações de thidiazuron (TDZ no meio de cultura (0; 4,54; 9,08; 13,62; 18,16 e 22,7 µM, totalizando 36 tratamentos. Os sais e vitaminas do meio MS foram acrescidos de mio-inositol (100 mg.L-1, sacarose (30 g.L-1, ágar (6 g.L-1 e adicionados de 1,6 µM ácido naftalenoacético (ANA. Foram utilizados frascos com capacidade para 150 mL com 6 mL de meio de cultura. Os explantes foram obtidos de plantas cultivadas in vitro, em fase de multiplicação, 45 dias após a repicagem, e se constituíram de finos fragmentos da parte mediana de folhas, cortados no sentido transversal (comprimento de 8 a 10 mm ou longitudinal (comprimento de 10 a 12 mm, ambos com largura aproximada de 1 mm. A porcentagem de regeneração, a intensidade de formação de calo e o número de brotos por explante foram avaliados aos 45 dias de cultivo. A partir dos resultados obtidos concluiu-se que a expressão do potencial morfogenético dos fragmentos delgados de folhas cortados no sentido transversal é maior do que o daqueles cortados no sentido longitudinal, e o seu cultivo em meio de cultura com 4,54 µM de TDZ, propicia, simultaneamente, elevada porcentagem de regeneração, maior número de brotos e menor intensidade de calo.The prerequisite to obtain success in the plants genetic transformation, and also for the fast multiplication of the modified genotype through the micropropagation, it is a efficient regeneration protocol. The objective of this work was to study the expression of the morphogenetic potential of thin fragments of apple tree leaves, and to optimize a regeneration protocol seeking futures works of genetic transformation. The completely randomized experimental design was used, in factorial outline 3 x 2 x 6, with three cultivate of apple tree (Galaxy, Maxigala and Mastergala, two explants types (thin fragments of leaves cut in the transversal and longitudinal direction, and six concentrations of thidiazuron (TDZ in the culture medium (0; 4.54; 9.08; 13.62; 18.16 and 22.7 µM, totaling 36 treatments. The MS medium salts and vitamins were added of myo-inositol (100 mg.L-1, sucrose (30 g.L-1, agar (6 g.L-1 and 1.6 µM naphthaleneacetic acid (NAA. Flasks with capacity for 150 mL with 6 mL of culture medium were used. The explants were obtained of plants in vitro cultivated, in multiplication phase, 45 days after the inoculation, and they were constituted of fine fragments of the medium part of leaves, cut in the tranversal direction (length from 8 to 10 mm or longitudinal (length from 10 to 12 mm, both with approximate width of 1 mm. The regeneration percentage, the intensity of callus formation and the number of shoots formed by explant were evaluated by the 45 days of cultivation. Starting from the obtained results it was ended that the expression of the morphogenetic potential of the thin fragments of leaf cut in the transversal direction is higher than those cut in the longitudinal direction, and its cultivation in culture medium with 4.54 µM of TDZ, propitiates, simultaneously, high regeneration percentage, great number of shoots formation and smaller callus intensity.

  2. Assessing the value and pest management window provided by neonicotinoid seed treatments for management of soybean aphid (Aphis glycines Matsumura) in the Upper Midwestern United States.

    Science.gov (United States)

    Krupke, Christian H; Alford, Adam M; Cullen, Eileen M; Hodgson, Erin W; Knodel, Janet J; McCornack, Brian; Potter, Bruce D; Spigler, Madeline I; Tilmon, Kelley; Welch, Kelton

    2017-10-01

    A 2-year, multi-state study was conducted to assess the benefits of using soybean seed treated with the neonicotinoid thiamethoxam to manage soybean aphid in the upper Midwestern USA and compare this approach with an integrated pest management (IPM) approach that included monitoring soybean aphids and treating with foliar-applied insecticide only when the economic threshold was reached. Concentrations of thiamethoxam in soybean foliage were also quantified throughout the growing season to estimate the pest management window afforded by insecticidal seed treatments. Both the IPM treatment and thiamethoxam-treated seed resulted in significant reductions in cumulative aphid days when soybean aphid populations reached threshold levels. However, only the IPM treatment resulted in significant yield increases. Analysis of soybean foliage from thiamethoxam-treated seeds indicated that tissue concentrations of thiamethoxam were statistically similar to plants grown from untreated seeds beginning at the V2 growth stage, indicating that the period of pest suppression for soybean aphid is likely to be relatively short. These data demonstrate that an IPM approach, combining scouting and foliar-applied insecticide where necessary, remains the best option for treatment of soybean aphids, both in terms of protecting the yield potential of the crop and of break-even probability for producers. Furthermore, we found that thiamethoxam concentrations in foliage are unlikely to effectively manage soybean aphids for most of the pests' activity period across the region. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  3. Gamma radiation and thermal treatment effects on the conservation of natural apple (Malus domestica) juice, cv. gala; Efeito da radiacao gama e do tratamento termico na conservacao do suco natural de maca (Malus domestica), cv. gala

    Energy Technology Data Exchange (ETDEWEB)

    Blumer, Lucimara

    1995-12-01

    This work studies the apple juice preservation without chemicals. The samples were exposed to the following treatments: heating (control, 60{sup 0} C/20 min and 80{sup 0} C/20 min); irradiation (control; 2, 4 and 6 kGy); heating plus irradiation. The quality control was carried out by physical and chemical analyses (soluble solids; titratable acidity, pH, ascorbic acid and color), microbiological and sensorial analyses. The samples were stored at refrigeration temperature (5 {+-} 3{sup 0} C) for 180 days. The results showed few variations in the soluble solids, acidity, pH and ascorbic acid for all treatments. However, the 6 kGy dose kept the chemical characteristics of the juice, providing a clear juice, with better appearance and microorganisms free. (author). 24 refs., 11 figs., 12 tabs.

  4. MicroRNAs in fruit trees: discovery, diversity and future research directions.

    Science.gov (United States)

    Solofoharivelo, M C; van der Walt, A P; Stephan, D; Burger, J T; Murray, S L

    2014-09-01

    Since the first description of microRNAs (miRNAs) 20 years ago, the number of miRNAs identified in different eukaryotic organisms has exploded, largely due to the recent advances in DNA sequencing technologies. Functional studies, mostly from model species, have revealed that miRNAs are major post-transcriptional regulators of gene expression in eukaryotes. In plants, they are implicated in fundamental biological processes, from plant development and morphogenesis, to regulation of plant pathogen and abiotic stress responses. Although a substantial number of miRNAs have been identified in fruit trees to date, their functions remain largely uncharacterised. The present review aims to summarise the progress made in miRNA research in fruit trees, focusing specifically on the economically important species Prunus persica, Malus domestica, Citrus spp, and Vitis vinifera. We also discuss future miRNA research prospects in these plants and highlight potential applications of miRNAs in the on-going improvement of fruit trees. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  5. 'Scarlett Spur Red Delicious' apple volatile production accompanying physiological disorder development during low pO2 controlled atmosphere storage.

    Science.gov (United States)

    Lumpkin, Christie; Fellman, John K; Rudell, David R; Mattheis, James

    2014-02-19

    Apple (Malus domestica Borkh.) fruit volatile production is regulated by a variety of factors including low oxygen storage conditions. This study examined the impact of low pO2 controlled atmospheres on 'Scarlett Spur Red Delicious' apple volatile production and disorder development. Accumulation of apple volatile compounds was characterized during long-term cold storage at 0.5 °C in air or low pO2 (0.3, 0.8, or 1.5 kPa) with 1 kPa CO2. Volatile accumulation differed quantitatively with pO2 as acetaldehyde, ethanol, and ethyl ester accumulation increased with decreased pO2 during the first weeks in storage. Differences in volatile accumulation among atmospheres were evident through 6 months. The rate of ethanol accumulation increased with decreased pO2 and could potentially be used to monitor low O2 stress. Incidence of low oxygen disorders after 9 months was highest in fruit held at the lowest pO2. The sesquiterpene α-farnesene was not detected throughout the storage period.

  6. Assessing plant response to ambient ozone: growth of young apple trees in open-top chambers and corresponding ambient air plots

    International Nuclear Information System (INIS)

    Manning, W.J.; Cooley, D.R.; Tuttle, A.F.; Frenkel, M.A.; Bergweiler, C.J.

    2004-01-01

    Open-top chambers (OTCs) and corresponding ambient air plots (AA) were used to assess the impact of ambient ozone on growth of newly planted apple trees at the Montague Field research center in Amherst, MA. Two-year-old apple trees (Malus domestica Borkh 'Rogers Red McIntosh') were planted in the ground in circular plots. Four of the plots were enclosed with OTCs where incoming air was charcoal-filtered (CF); four were enclosed with OTCs where incoming air was not charcoal-filtered (NF) and four were not enclosed, allowing access to ambient air conditions (AA). Conditions in both CF and NF OTCs resulted in increased tree growth and changed incidence of disease and arthropod pests, compared to trees in AA. As a result, we were not able to use the OTC method to assess the impact of ambient ozone on growth of young apple trees in Amherst, MA. - Capsule: Conditions in charcoal-filtered and non-filtered open-top chambers affected apple tree growth equally and prevented assessment of ambient ozone effects

  7. Traditional knowledge of wild edible plants of Iğdır Province (East Anatolia, Turkey

    Directory of Open Access Journals (Sweden)

    Ernaz Altundağ Çakır

    2017-12-01

    Full Text Available Iğdır Province is situated in the Eastern Anatolian Region of Turkey. Wild edible plants and their utilization methods have not been previously documented there. This study was conducted during an ethnobotanical survey of Iğdır Province from 2007 to 2012, in the period from May to October, when plants were in their flowering and fruiting periods. There were 210 interviews carried out in 78 villages. This study provides information about 154 wild plant taxa belonging to 27 families that have been used as foodstuffs, spices, or hot drinks. Seventeen wild edible plants were recorded for the first time during this study. Eight endemic species were reported as used for their edibility, and new local names for plants were also recorded. The cultural importance index was calculated for each taxon. The most culturally important species are Mentha longifolia, Falcaria vulgaris, Polygonum aviculare, Rosa canina, Crataegus azarolus, Capsella bursa-pastoris, and Malus sylvestris. This study presents the richest heritage in terms of the diversity of wild edible plants ever recorded in Turkey.

  8. Divergence of the bZIP Gene Family in Strawberry, Peach, and Apple Suggests Multiple Modes of Gene Evolution after Duplication

    Directory of Open Access Journals (Sweden)

    Xiao-Long Wang

    2015-01-01

    Full Text Available The basic leucine zipper (bZIP transcription factors are the most diverse members of dimerizing transcription factors. In the present study, 50, 116, and 47 bZIP genes were identified in Malus domestica (apple, Prunus persica (peach, and Fragaria vesca (strawberry, respectively. Species-specific duplication was the main contributor to the large number of bZIPs observed in apple. After WGD in apple genome, orthologous bZIP genes corresponding to strawberry on duplicated regions in apple genome were retained. However, in peach ancestor, these syntenic regions were quickly lost or deleted. Maybe the positive selection contributed to the expansion of clade S to adapt to the development and environment stresses. In addition, purifying selection was mainly responsible for bZIP sequence-specific DNA binding. The analysis of orthologous pairs between chromosomes indicates that these orthologs derived from one gene duplication located on one of the nine ancient chromosomes in the Rosaceae. The comparative analysis of bZIP genes in three species provides information on the evolutionary fate of bZIP genes in apple and peach after they diverged from strawberry.

  9. Genome-wide identification and comparative analysis of the cation proton antiporters family in pear and four other Rosaceae species.

    Science.gov (United States)

    Zhou, Hongsheng; Qi, Kaijie; Liu, Xing; Yin, Hao; Wang, Peng; Chen, Jianqing; Wu, Juyou; Zhang, Shaoling

    2016-08-01

    The monovalent cation proton antiporters (CPAs) play essential roles in plant nutrition, development, and signal transduction by regulating ion and pH homeostasis of the cell. The CPAs of plants include the Na(+)/H(+) exchanger, K(+) efflux antiporter, and cation/H(+) exchanger families. However, currently, little is known about the CPA genes in Rosaceae species. In this study, 220 CPA genes were identified from five Rosaceae species (Pyrus bretschneideri, Malus domestica, Prunus persica, Fragaria vesca, and Prunus mume), and 53 of which came from P. bretschneideri. Phylogenetic, structure, collinearity, and gene expression analyses were conducted on the entire CPA genes of pear. Gene expression data showed that 35 and 37 CPA genes were expressed in pear fruit and pollen tubes, respectively. The transcript analysis of some CPA genes under abiotic stress conditions revealed that CPAs may play an important role in pollen tubes growth. The results presented here will be useful in improving understanding of the complexity of the CPA gene family and will promote functional characterization in future studies.

  10. Effects of bagging materials and CaCl2 spray on fruit calcium concentration in fruit-bagged apple trees

    International Nuclear Information System (INIS)

    Yim, Y.J.; Choi, J.S.; Kim, S.B.

    1989-01-01

    This experiment was carried out to investigate the effects of bagging materials and CaCl 2 spray on fruit Ca concentration in fruit-bagged apple trees (Malus domestica Borkh.). No difference was noted in fruit Ca concentration among bagging materials during the growing season. And also, there was no difference in fruit Ca concentration between bagged and non-bagged fruits. The fruit flesh Ca concentration of bagged fruits was significantly lower than that of non-bagged fruits in the same tree, which 0.5 % CaCl 2 was sprayed 5 times in the late growing season. The radioactivity of 45 Ca was highest in the sprayed shoot leaves and bark, while only a trace amount was detected in the fruit and shoot proximate to the treated shoot 3 weeks after 3 times application of 45 CaCl 2 (5 micro Ci/ml). As a result, it is confirmed that the Ca once accumulated in a specific part is hardly retranslocated. Therefore, it is concluded that Ca foliar spray to the fruit-bagged tree has no influence on Ca concentration in the fruit

  11. Simultaneous determination of glucose, fructose, sucrose and sorbitol in the leaf and fruit peel of different apple cultivars by the HPLC-RI optimized method.

    Science.gov (United States)

    Filip, Miuţa; Vlassa, Mihaela; Coman, Virginia; Halmagyi, Adela

    2016-05-15

    A high performance liquid chromatography method with refractive index detection (HPLC-RI), for simultaneous determination of glucose, fructose, sucrose and sorbitol in leaf and/or apple peel samples from nine apple (Malus domestica Borkh.) cultivars and rootstocks, originating from a germplasm collection, has been developed and validated. Box-Behnken design of response surface methodology was applied for the method optimization. The Carbosep Coregel 87H3 column was used under the optimum conditions predicted: mobile phase of H2SO4 0.005 mol L(-1) solution, flow rate of 0.3 mL min(-1) and column temperature of 35°C. The method was validated for linearity (R(2)>0.99), limits of detection (2.67-4.83 μg mL(-1)) and quantification (8.9-16.1 μg mL(-1)), precision (%RSD<5.05) and recovery (93.94-103.06%) and satisfactory results obtained. The sugars content varied across micropropagated plants in vitro, plants regenerated after cryostorage, growing trees in vivo, and fruit peel. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Ethnobotanical review of wild edible plants of Slovakia

    Directory of Open Access Journals (Sweden)

    Łukasz Łuczaj

    2012-11-01

    Full Text Available This paper is an ethnobotanical review of wild edible plants gathered for consumption from the 19th century to the present day, within the present borders of Slovakia. Twenty-four sources (mainly ethnographic documenting the culinary use of wild plants were analysed. The use of 106 species (over 3% of the Slovak flora has been recorded. Nowadays most of them are no longer used, or used rarely, apart from a few species of wild fruits. The most frequently used plants include the fruits of Rubus idaeus, Fragaria spp., Rubus subgenus Rubus, Vaccinium myrtillus, V. vitis-idaea, Fagus sylvatica, Corylus avellana, Prunus spinosa, Pyrus spp., Malus spp., Crataegus spp. and the leaves of Urtica dioica, Rumex acetosa, Chenopodiaceae species, Cardamine amara, Glechoma spp., Taraxacum spp. and Oxalis acetosella. The most commonly used wild food taxa are nearly identical to those used in Poland, and the same negative association of wild vegetables with famine exists in Slovakia, resulting in their near complete disappearance from the present-day diet.

  13. Vegetation and checklist of Inaccessible Island, central South Atlantic Ocean, with notes on Nightingale Island

    Directory of Open Access Journals (Sweden)

    J. P. Roux

    1992-10-01

    Full Text Available The physiography and climate of Inaccessible and Nightingale Islands are briefly discussed. The vegetation and the major plant associations are described. Notes are given on the ecology and distribution of each taxon. Taxa newly recorded for Inaccessible Island include Agrostis goughensis, A.holgateana, A. wacei, Calamagrostis deschampsiiformis, Carex thouarsii var.  recurvata, Conyza albida, Elaphoglossum campylolepium and  Uncinia meridensis. One species, C.  albida, is alien to the Tristan group. Two native ferns Asplenium platybasis var.  subnudum and Blechnum australe were found on Nightingale Island for the first time, and the presence of introduced Malus domestica orchards was recorded. Two unidentified taxa were found that may represent new species:  Elaphoglossum sp. at Inaccessible Island and Apium sp. at both Inaccessible and Nightingale Islands. The total number of vascular plant species recorded at Inaccessible and Nightingale Islands now stands at 98 and 43, respectively, of which 26 (28% and seven (16% are introduced species. Only Airiplex plebeja and two species of Cotula occur at Nightingale Island but are absent from Inaccessible Island.

  14. Dermal insecticide residues from birds inhabiting an orchard

    Science.gov (United States)

    Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.

    2007-01-01

    The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.

  15. Biological relevance of volatile organic compounds emitted during the pathogenic interactions between apple plants and Erwinia amylovora.

    Science.gov (United States)

    Cellini, Antonio; Buriani, Giampaolo; Rocchi, Lorenzo; Rondelli, Elena; Savioli, Stefano; Rodriguez Estrada, Maria T; Cristescu, Simona M; Costa, Guglielmo; Spinelli, Francesco

    2018-01-01

    Volatile organic compounds emitted during the infection of apple (Malus pumila var. domestica) plants by Erwinia amylovora or Pseudomonas syringae pv. syringae were studied by gas chromatography-mass spectrometry and proton transfer reaction-mass spectrometry, and used to treat uninfected plants. Infected plants showed a disease-specific emission of volatile organic compounds, including several bio-active compounds, such as hexenal isomers and 2,3-butanediol. Leaf growth promotion and a higher resistance to the pathogen, expressed as a lower bacterial growth and migration in plant tissues, were detected in plants exposed to volatile compounds from E. amylovora-infected plants. Transcriptional analysis revealed the activation of salicylic acid synthesis and signal transduction in healthy plants exposed to volatiles produced by E. amylovora-infected neighbour plants. In contrast, in the same plants, salicylic acid-dependent responses were repressed after infection, whereas oxylipin metabolism was activated. These results clarify some metabolic and ecological aspects of the pathogenic adaptation of E. amylovora to its host. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  16. Re-analysis of RNA-Sequencing Data on Apple Stem Grooving Virus infected Apple reveals more significant differentially expressed genes

    Directory of Open Access Journals (Sweden)

    Bipin Balan

    2017-12-01

    Full Text Available RNA sequencing (RNA-Seq technology has enabled the researchers to investigate the host global gene expression changes in plant-virus interactions which helped to understand the molecular basis of virus diseases. The re-analysis of RNA-Seq studies using most updated genome version and the available best analysis pipeline will produce most accurate results. In this study, we re-analysed the Apple stem grooving virus (ASGV infected apple shoots in comparison with that of virus-free in vitro shoots [1] using the most updated Malus x domestica genome downloaded from Phytozome database. The re-analysis was done by using HISAT2 software and Cufflinks program was used to mine the differentially expressed genes. We found that ~20% more reads was mapped to the latest genome using the updated pipeline, which proved the significance of such re-analysis. The comparison of the updated results with that of previous was done. In addition, we performed protein-protein interaction (PPI to investigate the proteins affected by ASGV infection.

  17. Gamma irradiation as a phytosanitary treatment for fresh pome fruits produced in Patagonia

    Science.gov (United States)

    Pérez, J.; Lires, C.; Horak, C.; Pawlak, E.; Docters, A.; Kairiyama, E.

    2009-07-01

    Argentina produces 1.8 million tons/year of apples ( Malus domestica L.) and pears ( Pyrus communis L.) in the Patagonia region. Cydia pomonella, codling moth, and Grapholita molesta, Oriental fruit moth, ( Lepidoptera: Tortricidae) are quarantine pests in pome fruits. Irradiation is a promising phytosanitary treatment because a dose of 200 Gy completely prevents pest adult emergence. A pilot irradiation process of commercially packaged 'Red Delicious' apples and 'Packham's Triumph' pears was performed in an irradiation facility with a Cobalt 60 source. Quality analyses were carried out at 0, 2, 4, 6 and 8 months of storage (1 °C, RH 99%) to evaluate fruit tolerance at 200, 400 and 800 Gy. Irradiation at 200 and 400 Gy had no undesirable effects on fruit quality (pulp firmness, external colour, soluble solids content (SSC), titratable acidity (TA) and sensory evaluations). Irradiation of 'Red Delicious' apples and 'Packham's Triumph' pears can be applied as a commercial quarantine treatment with a minimum absorbed dose of 200 Gy (to control codling moth and Oriental fruit moth) and <800 Gy (according to quality results).

  18. Effect of temperature and cultivar on polyphenol retention and mass transfer during osmotic dehydration of apples.

    Science.gov (United States)

    Devic, Emilie; Guyot, Sylvain; Daudin, Jean-Dominique; Bonazzi, Catherine

    2010-01-13

    Several cultivars of apples (Malus domestica) were chosen for their variable concentrations and compositions in phenolic compounds. Cubed samples (1 cm3) were subjected to osmotic dehydration, and the effect of temperature was studied at 45 and 60 degrees C. Water loss, sucrose impregnation, and the evolution of some natural components of the product were followed to quantify mass transfer. Ascorbic acid and polyphenols were quantified by HPLC for several osmotic dehydration times and regardless of the quantity of impregnated sugar. Changes in antioxidant components differed as a function of the nature of molecules. Their concentrations decreased in line with temperature, and few differences were observed between cultivars. Processing at a lower temperature (45 degrees C) caused a total loss in ascorbic acid but allowed the retention of between 74 and 85% of initial polyphenols, depending on the cultivar. Cultivars containing highly polymerized procyanidins (such as Guillevic) experienced less loss. Hydroxycinnamic acids and monomeric catechins displayed the most marked changes. Leaching with water into the soaking solution was the principal mechanism retained to explain these losses.

  19. Cuticle of 'Gala' and 'Galaxy' apples cultivars under different environmental conditions

    Directory of Open Access Journals (Sweden)

    Magda Andréia Tessmer

    2012-10-01

    Full Text Available This study aimed to analyze the cuticle thickness and pattern of epicuticular wax deposition in 'Gala' and 'Galaxy' apple cultivars (Malus domestica Borkh, from three Brazilian producing areas: Vacaria (RS, Fraiburgo (SC and São Joaquim (SC with altitudes of 971, 1,048 and 1,353m, respectively. Harvested fruit were kept under two storage conditions: regular atmosphere (RA (0 ºC and 90% RH and controlled atmosphere (CA (1.5% O2, 2.5% CO2, 0ºC and 90% RH. Cuticle thickness measurements were made using LM and the deposition pattern of epicuticular wax observed with a SEM. Altitude among the apple producing areas was not a factor in deposition pattern of waxes between the cultivars but at higher altitudes, the cuticle was thicker in both the cultivars. In the freshly-harvested fruits, waxes deposition in the form of platelets and the mechanism of “tear and repair” were observed. Severity of microcracks in the cuticle was more evident on the fruits from CA.

  20. Report made on the behalf of the Commission of economic affairs, in a new reading, on the bill project, rejected by the Senate, aiming at preparing a transition towards an energy 'sober' system - N. 579

    International Nuclear Information System (INIS)

    Brottes, Francois

    2013-01-01

    This report proposes a second reading which aims at defining the legal framework associated with the French energy conservation policy. This bill project introduces a 'bonus-malus' approach which aims at identifying housings which must be renewed in priority in order to reduce their energy consumption. The first objective of this bill project is to provide households with a responsibility tool regarding their consumption: a basic energy volume will be assigned to each household, calculated with respect to the energy type, household composition and geographical location. It should be possible then to warn users when they are in an over-consumption situation, and to help them to take corrective actions. The other objectives are to struggle against energy 'precariousness', to prevent energy price increase, to improve the regime of capacity guarantee obligations, to strengthen consumer protection, to ease the development of renewable energies, and to create the modalities of a progressive water tariffing. The document reports the discussion and comments of the bill project articles. It also proposes a comparison of the content of the successive versions

  1. Analysis of Chemical Constituents Changing in Physical Process and Nutritional Components of Malus halliana Koehne Tea

    Directory of Open Access Journals (Sweden)

    Zhenhua Yin

    2017-01-01

    Full Text Available This study aimed to establish a HPLC method for simultaneous determination of the changing of quercitrin, 3-hydroxyphloridzin, and phloridzin in physical process of M. halliana tea. Meanwhile, the nutritional compositions were determined, using anthrone-sulfuric acid colorimetry and direct titration determination of total sugar and reducing sugar, respectively, in order to provide theoretical basis for quality control and tea production. The results showed that the regression equations for quercitrin, 3-hydroxyphloridzin, and phloridzin were linear in the range of 0.0972–12.15 μg (r=0.999 8, 0.0932~11.65 μg (r=0.999 1, and 0.9~112.5 μg (r=0.999 6, respectively. The average recoveries ranged from 98.19% to 99.35%. The contents of crude protein and the crude fat were measured by spectrophotometric detection and soxhlet extraction detection, respectively. The contents of total sugar, reducing sugar, the fat, and protein were 6.8 g/100 g, 8.5 mg/100 g, 2.399 g/100 g, and 4.362 g/100 g, respectively, in M. halliana tea.

  2. Identification of SFBB-containing canonical and noncanonical SCF complexes in pollen of apple (Malus × domestica).

    Science.gov (United States)

    Minamikawa, Mai F; Koyano, Ruriko; Kikuchi, Shinji; Koba, Takato; Sassa, Hidenori

    2014-01-01

    Gametophytic self-incompatibility (GSI) of Rosaceae, Solanaceae and Plantaginaceae is controlled by a single polymorphic S locus. The S locus contains at least two genes, S-RNase and F-box protein encoding gene SLF/SFB/SFBB that control pistil and pollen specificity, respectively. Generally, the F-box protein forms an E3 ligase complex, SCF complex with Skp1, Cullin1 (CUL1) and Rbx1, however, in Petunia inflata, SBP1 (S-RNase binding protein1) was reported to play the role of Skp1 and Rbx1, and form an SCFSLF-like complex for ubiquitination of non-self S-RNases. On the other hand, in Petunia hybrida and Petunia inflata of Solanaceae, Prunus avium and Pyrus bretschneideri of Rosaceae, SSK1 (SLF-interacting Skp1-like protein1) is considered to form the SCFSLF/SFB complex. Here, we isolated pollen-expressed apple homologs of SSK1 and CUL1, and named MdSSK1, MdCUL1A and MdCUL1B. MdSSK1 was preferentially expressed in pollen, but weakly in other organs analyzed, while, MdCUL1A and MdCUL1B were almost equally expressed in all the organs analyzed. MdSSK1 transcript abundance was significantly (>100 times) higher than that of MdSBP1. In vitro binding assays showed that MdSSK1 and MdSBP1 interacted with MdSFBB1-S9 and MdCUL1, and MdSFBB1-S9 interacted more strongly with MdSSK1 than with MdSBP1. The results suggest that both MdSSK1-containing SCFSFBB1 and MdSBP1-containing SCFSFBB1-like complexes function in pollen of apple, and the former plays a major role.

  3. Transcriptomic analysis of molecular responses in Malus domestica 'M26' roots affected by apple replant disease.

    Science.gov (United States)

    Weiß, Stefan; Bartsch, Melanie; Winkelmann, Traud

    2017-06-01

    Gene expression studies in roots of apple replant disease affected plants suggested defense reactions towards biotic stress to occur which did not lead to adequate responses to the biotic stressors. Apple replant disease (ARD) leads to growth inhibition and fruit yield reduction in replanted populations and results in economic losses for tree nurseries and fruit producers. The etiology is not well understood on a molecular level and causal agents show a great diversity indicating that no definitive cause, which applies to the majority of cases, has been found out yet. Hence, it is pivotal to gain a better understanding of the molecular and physiological reactions of the plant when affected by ARD and later to overcome the disease, for example by developing tolerant rootstocks. For the first time, gene expression was investigated in roots of ARD affected plants employing massive analysis of cDNA ends (MACE) and RT-qPCR. In reaction to ARD, genes in secondary metabolite production as well as plant defense, regulatory and signaling genes were upregulated whereas for several genes involved in primary metabolism lower expression was detected. For internal verification of MACE data, candidate genes were tested via RT-qPCR and a strong positive correlation between both datasets was observed. Comparison of apple 'M26' roots cultivated in ARD soil or γ-irradiated ARD soil suggests that typical defense reactions towards biotic stress take place in ARD affected plants but they did not allow responding to the biotic stressors attack adequately, leading to the observed growth depressions in ARD variants.

  4. Study of the optimal production process and application of apple fruit (malus domestica (l.) borkh) fermentation

    International Nuclear Information System (INIS)

    Zhang, J.; Shao, W.; Ziang, R.

    2015-01-01

    In orchard production, fruit abscission is common due to insect damage, disease, crop thinning and natural dropping. However, the utilization of these discarded plant resources has received little research attention. In this study, we used apple fruit from such plant resources, mainly young and mature dropped fruit, as materials and mixed them with a fermentation agent, brown sugar and water. The effects of the proportion of fermentation agent and the fermentation conditions (O2, temperature, fermenting time and fruit crushing degree) were studied using an orthogonal experimental design. We discovered a novel fermented fertilizer, apple fruit fermentation nutrient solution (AFF), for which the optimal fermentation formula and conditions were comminuted young apples: fermentation agent: brown sugar: water weight ratio of 5:0.1:1:4 and 45 days of aerobic fermentation. Analysis of the fermentation solutions showed that the supernatant obtained using these optimized parameters had the highest mineral element content among the fermentation formulas and conditions studied. The results of a spraying experiment with 200-, 500- and 800-fold dilutions showed that AFF significantly promoted the net photosynthetic rate, leaf area and thickness, specific leaf weight, and chlorophyll and mineral element content in the leaves of young apple trees relative to the control treatment. The effects of 200-fold diluted AFF on the photosynthetic rate, the developmental quality and mineral element contents were greater than those of the 500- and 800-fold dilutions. The results of the spraying of adult trees with 200-fold diluted AFF compared to a water control demonstrated that AFF significantly enhanced the average weight of a single fruit, the shape index, hardness, content of soluble solids, titratable acid content, vitamin C content, and aroma compound content of the fruit of the adult trees. This evidence suggests that the AFF obtained using the optimal production process could effectively improve the vegetative growth and fruit quality of apple trees. (author)

  5. Comprehensive QTL mapping survey dissects the complex fruit texture physiology in apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Longhi, Sara; Moretto, Marco; Viola, Roberto; Velasco, Riccardo; Costa, Fabrizio

    2012-02-01

    Fruit ripening is a complex physiological process in plants whereby cell wall programmed changes occur mainly to promote seed dispersal. Cell wall modification also directly regulates the textural properties, a fundamental aspect of fruit quality. In this study, two full-sib populations of apple, with 'Fuji' as the common maternal parent, crossed with 'Delearly' and 'Pink Lady', were used to understand the control of fruit texture by QTL mapping and in silico gene mining. Texture was dissected with a novel high resolution phenomics strategy, simultaneously profiling both mechanical and acoustic fruit texture components. In 'Fuji × Delearly' nine linkage groups were associated with QTLs accounting from 15.6% to 49% of the total variance, and a highly significant QTL cluster for both textural components was mapped on chromosome 10 and co-located with Md-PG1, a polygalacturonase gene that, in apple, is known to be involved in cell wall metabolism processes. In addition, other candidate genes related to Md-NOR and Md-RIN transcription factors, Md-Pel (pectate lyase), and Md-ACS1 were mapped within statistical intervals. In 'Fuji × Pink Lady', a smaller set of linkage groups associated with the QTLs identified for fruit texture (15.9-34.6% variance) was observed. The analysis of the phenotypic variance over a two-dimensional PCA plot highlighted a transgressive segregation for this progeny, revealing two QTL sets distinctively related to both mechanical and acoustic texture components. The mining of the apple genome allowed the discovery of the gene inventory underlying each QTL, and functional profile assessment unravelled specific gene expression patterns of these candidate genes.

  6. Leaf micro-environment influence the altered foliar phenotype of columnar apple (Malus x domestica Borkh.) trees

    DEFF Research Database (Denmark)

    Talwara, Susheela; Grout, Brian William Wilson; Toldam-Andersen, Torben Bo

    2015-01-01

    in the phenotype of the leaves in the leaf clusters that subtend the fruits of CATs, compared to their standard counterparts. This initial investigation considers standard and columnar trees at different levels of genetic relatedness and records significant increases in leaf area, leaf mass per unit area......Columnar apple trees (CATs) have radically-altered architecture (significantly shorter internodes and lateral branches) when compared to standard apple trees, attributed to a mutation of the Co gene involved in apical dominance. These changes in architecture have been associated with changes......, chlorophyll content and competitive shading in the fruiting leaf clusters of columnar cultivars. Additionally, significant increases in intercepted light have been shown to be associated with the columnar structure, and carbon fixation is also increased. We propose that leaf micro-environment of columnar...

  7. Dynamic Transcription profiles of Qinguan apple (Malus × domestica leaves in response to Marssonina coronaria inoculation

    Directory of Open Access Journals (Sweden)

    Junke eZhang

    2015-10-01

    Full Text Available Marssonina apple blotch, caused by the fungus Marssonina coronaria, is one of the most destructive apple diseases in China and East Asia. A better understanding of the plant’s response to fungi during pathogenesis is urgently needed to improve plant resistance and to breed resistant cultivars. To address this, the transcriptomes of ‘Qinguan’ (a cultivar with high resistance to M. coronaria apple leaves were sequenced at 12, 24, 48 and 72 hours post-inoculation (hpi with Marssonina coronaria. The comparative results showed that a total of 1956 genes were differentially expressed between the inoculated and control samples at the 4 time points. Gene ontology (GO term enrichment analysis of differentially expressed genes (DEGs revealed changes in cellular component, secondary metabolism including chalcone isomerase activity, phytoalexin biosynthetic process, anthocyanin-containing compound biosynthetic process, lignin biosynthetic process, positive regulation of flavonoid biosynthetic process; and molecular functions or biological processes related to the defense response, biotic stimulus response, wounding response and fungus response. Kyoto Encyclopedia of Genes and Genomes (KEGG pathway analysis showed that DEGs were significantly enriched in flavonoid biosynthesis, vitamin B6 metabolism, phenylpropanoid biosynthesis, and the stilbenoid, diarylheptanoid and gingerol biosynthesis pathways. Furthermore, the importance of changes in cellular components and partial polyphenol compounds when encountering M. coronaria are discussed.

  8. Impact of shelf life on content of primary and secondary metabolites in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Veberic, Robert; Schmitzer, Valentina; Petkovsek, Maja M; Stampar, Franci

    2010-01-01

    In this study, we evaluated the changes in apple fruit quality during shelf life. After a month of cold storage, apples of cultivars "Jonagold" and "Golden Delicious" were exposed to ambient temperatures for 21 d, with subsequent sampling every 3 or 4 d. Fruit firmness, changes in amounts of sugars, malic acid, and phenolics were observed during shelf life. Chemical analyses were done with HPLC-PDA system. An interchange between various sugars was noticed, but in general, the sum of sugars remained at the same level. The content of malic acid remained stable or dropped, resulting in sweeter fruit. Levels of phenolics were more constant in the pulp of both cultivars analyzed, while in the peel, the changes were more pronounced. In the pulp, a peak in the content of hydroxycinnamic acids and flavanols was noticed on the 2nd or 3rd sampling and afterwards, the amounts remained constant. In the peel an initial decrease of all analyzed phenolic groups was observed in both cultivars, however it was more pronounced in "Jonagold." It can be concluded that changes in primary and secondary metabolites are not the main reason for the lower quality of fruit exposed to ambient temperatures. On the other hand, fruit firmness might be the limiting factor for shelf life duration. © 2010 Institute of Food Technologists®

  9. Evaluation of a Non-Destructive Impact Sensor to Determine On-Line Fruit Firmness Evaluación de un Sensor de Impacto No-Destructivo para la Determinación de la Firmeza de Frutos en Líneas de Manipulación

    Directory of Open Access Journals (Sweden)

    Ian Homer

    2010-03-01

    Full Text Available A non-destructive impact sensor to measure on-line fruit firmness was evaluated. This sensor is an adaptation of a static model used in the laboratory to measure fruit quality and was installed in an experimental fruit packing line with a commercial sizer chain. The firmness index is related to the acceleration-time curve supplied by an accelerometer attached to an impacting arm. The main objective of this study was to evaluate sensor performance and sources of variation. We made classification trials on three fruits: peaches (Prunus persica (L. Batsch, apples (Malus domestica Borkh., and pears (Pyrus communis L., as well as working trials, such as placing the fruit, orientation, and others. The sensor works correctly at a speed of 7 fruits s-1 (0.63 m s-1 and allows fruit classification at three levels of firmness using specific software. Good discrimination was obtained only for soft peaches. There were variations in results between different fruits and different parts of the same fruit mainly due to the non-uniformity of fruit shape and lack of ripeness homogeneity of each one.Se evaluó un sensor de impacto no destructivo para medir firmeza de frutas en líneas de manipulación. Este sensor es una adaptación de la versión estática utilizada en algunos laboratorios de calidad de frutas, el cual fue modificado e instalado en una línea experimental de manipulación de fruta que contaba con un calibrador comercial. La firmeza de los frutos está relacionada con la curva de aceleración-tiempo que suministra un acelerómetro unido a un brazo que impacta la fruta. El objetivo del presente trabajo fue evaluar funcionamiento y fuentes de variación del sensor. Para ello se realizaron ensayos de clasificación con duraznos (Prunus persica (L. Batsch, manzanas (Malus domestica Borkh., y peras (Pyrus communis L., y ensayos de funcionamiento como pruebas de posicionamiento del fruto, orientación, entre otras. El sensor funciona correctamente a una

  10. Phytosanitary irradiation of peach fruit moth (Lepidoptera: Carposinidae) in apple fruits

    Science.gov (United States)

    Zhan, Guoping; Li, Baishu; Gao, Meixu; Liu, Bo; Wang, Yuejin; Liu, Tao; Ren, Lili

    2014-10-01

    Peach fruit moth, Carposina sasakii Matsumura, is a serious pest of many pome and stone fruits and presents a quarantine problem in some export markets. It is widely distributed in pome fruit production areas in China, Japan, Korea, North Korea and the Far Eastern Federal District of Russia. In this investigation, gamma radiation dose-response tests were conducted with late eggs (5-d-old) and various larval stages, followed by large-scale confirmatory tests on the most tolerant stage in fruit, the fifth instar. The dose-response tests, with the target radiation dose of 20 (late eggs), 40, 60, 80, 100, 120, 140, and 160 Gy (late fifth instars in vitro) respectively applied to all stages, showed that the tolerance to radiation increased with increasing age and developmental stage. The fifth instar (most advanced instar in fruits) was determined to be the most tolerant stage requiring an estimated minimum absorbed dose of 208.6 Gy (95% CI: 195.0, 226.5 Gy) to prevent adult emergence at 99.9968% efficacy (95% confidence level). In the confirmatory tests, irradiation was applied to 30,850 late fifth instars in apple fruits with a target dose of 200 Gy (171.6-227.8 Gy measured), but only 4 deformed adults emerged that died 2 d afterwards without laying eggs. A dose of 228 Gy may be recommended as a phytosanitary irradiation treatment under ambient atmosphere for the control of peach fruit moth on all commodities with an efficacy of 99.9902% at 95% confidence level.

  11. Effect of Chemical Ratios of a Microbial-Based Feeding Attractant on Trap Catch of Drosophila suzukii (Diptera: Drosophilidae).

    Science.gov (United States)

    Cha, Dong H; Landolt, Peter J; Adams, Todd B

    2017-08-01

    Drosophila suzukii Matsumura, spotted wing drosophila, can be trapped with a feeding attractant based on wine and vinegar volatiles and consisting of acetic acid, ethanol, acetoin, and methionol. Using that four-component blend, we found that the catch of spotted wing drosophila increased with increases in the release rate of acetoin (from 0.5 mg/d to 34 mg/d) from polyethylene sachet dispensers, and with increases in the concentrations of acetic acid (from 0.25% to 4%) or ethanol (from 0.08% to 2%) when dispensed in the trap drowning solution. However, we saw no increase in spotted wing drosophila trapped with increase of the methionol release rate from 0.4 mg/d to 4.9 mg/d or from 0.19 mg/d to 0.8 mg/d, from sachets. A new formulation based on optimized amounts of these four chemicals yielded a doubling of spotted wing drosophila trapped compared to a previously reported formulation. Further field testing confirmed that the simultaneous increases in the release rate of acetoin from a dispenser and the amount of acetic acid in the trap drowning solution provided the increased spotted wing drosophila trap response to the new formulation. These findings provide a practical means to improve the power of this lure to detect and monitor D. suzukii. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by US Government employees and is in the public domain in the US.

  12. The Endosymbiont Arsenophonus Is Widespread in Soybean Aphid, Aphis glycines, but Does Not Provide Protection from Parasitoids or a Fungal Pathogen

    Science.gov (United States)

    Wulff, Jason A.; Buckman, Karrie A.; Wu, Kongming; Heimpel, George E.; White, Jennifer A.

    2013-01-01

    Aphids commonly harbor bacterial facultative symbionts that have a variety of effects upon their aphid hosts, including defense against hymenopteran parasitoids and fungal pathogens. The soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), is infected with the symbiont Arsenophonus sp., which has an unknown role in its aphid host. Our research goals were to document the infection frequency and diversity of the symbiont in field-collected soybean aphids, and to determine whether Arsenophonus is defending soybean aphid against natural enemies. We performed diagnostic PCR and sequenced four Arsenophonus genes in soybean aphids from their native and introduced range to estimate infection frequency and genetic diversity, and found that Arsenophonus infection is highly prevalent and genetically uniform. To evaluate the defensive role of Arsenophonus, we cured two aphid genotypes of their natural Arsenophonus infection through ampicillin microinjection, resulting in infected and uninfected isolines within the same genetic background. These isolines were subjected to parasitoid assays using a recently introduced biological control agent, Binodoxys communis [Braconidae], a naturally recruited parasitoid, Aphelinus certus [Aphelinidae], and a commercially available biological control agent, Aphidius colemani [Braconidae]. We also assayed the effect of the common aphid fungal pathogen, Pandora neoaphidis (Remaudiere & Hennebert) Humber (Entomophthorales: Entomophthoraceae), on the same aphid isolines. We did not find differences in successful parasitism for any of the parasitoid species, nor did we find differences in P. neoaphidis infection between our treatments. Our conclusion is that Arsenophonus does not defend its soybean aphid host against these major parasitoid and fungal natural enemies. PMID:23614027

  13. Integrating temperature-dependent life table data into a matrix projection model for Drosophila suzukii population estimation.

    Directory of Open Access Journals (Sweden)

    Nik G Wiman

    Full Text Available Temperature-dependent fecundity and survival data was integrated into a matrix population model to describe relative Drosophila suzukii Matsumura (Diptera: Drosophilidae population increase and age structure based on environmental conditions. This novel modification of the classic Leslie matrix population model is presented as a way to examine how insect populations interact with the environment, and has application as a predictor of population density. For D. suzukii, we examined model implications for pest pressure on crops. As case studies, we examined model predictions in three small fruit production regions in the United States (US and one in Italy. These production regions have distinctly different climates. In general, patterns of adult D. suzukii trap activity broadly mimicked seasonal population levels predicted by the model using only temperature data. Age structure of estimated populations suggest that trap and fruit infestation data are of limited value and are insufficient for model validation. Thus, we suggest alternative experiments for validation. The model is advantageous in that it provides stage-specific population estimation, which can potentially guide management strategies and provide unique opportunities to simulate stage-specific management effects such as insecticide applications or the effect of biological control on a specific life-stage. The two factors that drive initiation of the model are suitable temperatures (biofix and availability of a suitable host medium (fruit. Although there are many factors affecting population dynamics of D. suzukii in the field, temperature-dependent survival and reproduction are believed to be the main drivers for D. suzukii populations.

  14. Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.

    Science.gov (United States)

    Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E

    2009-10-01

    Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.

  15. The response of natural enemies to selective insecticides applied to soybean.

    Science.gov (United States)

    Varenhorst, A J; O'Neal, M E

    2012-12-01

    Natural enemies of the invasive pest Aphis glycines Matsumura can prevent its establishment and population growth. However, current A. glycines management practices include the application of broad-spectrum insecticides that affect pests and natural enemies that are present in the field at the time of application. An alternative is the use of selective insecticides that affect the targeted pest species, although having a reduced impact on the natural enemies. We tested the effects of esfenvalerate, spirotetramat, imidacloprid, and a combination of spirotetramat and imidacloprid on the natural enemies in soybean during the 2009 and 2010 field season. The natural enemy community that was tested differed significantly between 2009 and 2010 (F = 87.41; df = 1, 598; P natural enemy in 2009 was Harmonia axyridis (Pallas) (56.0%) and in 2010 was Orius insidiosus (Say) (41.0%). During 2009, the abundance of natural enemies did not vary between the broad-spectrum and selective insecticides; however, the abundance of natural enemies was reduced by all insecticide treatments when compared with the untreated control. In 2010, the selective insecticide imidacloprid had more natural enemies than the broad-spectrum insecticide. Although we did not observe a difference in the abundance of the total natural enemy community in 2009, we did observe more H. axyridis in plots treated with spirotetramat. In 2010, we observed more O. insidiosus in plots treated with imidacloprid. We suggest a couple of mechanisms to explain how the varying insecticides have different impacts on separate components of the natural enemy community.

  16. Methyl salicylate attracts natural enemies and reduces populations of soybean aphids (Hemiptera: Aphididae) in soybean agroecosystems.

    Science.gov (United States)

    Mallinger, Rachel E; Hogg, David B; Gratton, Claudio

    2011-02-01

    Methyl salicylate, an herbivore-induced plant volatile, has been shown to attract natural enemies and affect herbivore behavior. In this study, methyl salicylate was examined for its attractiveness to natural enemies of the soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), and for its direct effects on soybean aphid population growth rates. Methyl salicylate lures were deployed in plots within organic soybean [Glycine max (L.) Merr.] fields. Sticky card traps adjacent to and 1.5 m from the lure measured the relative abundance of natural enemies, and soybean aphid populations were monitored within treated and untreated plots. In addition, exclusion cage studies were conducted to determine methyl salicylate's effect on soybean aphid population growth rates in the absence of natural enemies. Significantly greater numbers of syrphid flies (Diptera: Syrphidae) and green lacewings (Neuroptera: Chrysopidae) were caught on traps adjacent to the methyl salicylate lure, but no differences in abundance were found at traps 1.5 m from the lure. Furthermore, abundance of soybean aphids was significantly lower in methyl salicylate-treated plots. In exclusion cage studies, soybean aphid numbers were significantly reduced on treated soybean plants when all plants were open to natural enemies. When plants were caged, however, soybean aphid numbers and population growth rates did not differ between treated and untreated plants suggesting no effect of methyl salicylate on soybean aphid reproduction and implicating the role of natural enemies in depressing aphid populations. Although aphid populations were reduced locally around methyl salicylate lures, larger scale studies are needed to assess the technology at the whole-field scale.

  17. Evaluation of the {sup 14}C-prochloraz residue levels in irradiated mangoes (Mangifera indica) and apples (Malus domestica).; Avaliacao dos niveis de residuos de {sup 14}C-prochloraz em mangas (Mangigera indica) irradiadas e em macas (Malus domestica)

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Maria Aparecida

    1998-07-01

    The Brazilian crops mangoes and apples has expanding in the last years. However, tropical fruits crops are susceptible to infection that harms the crop yield. The control of these diseases is made through fungicides such as prochloraz which possesses protecting eradicating action by controlling anthracnose in mangoes and scabies in apples. Agrochemicals are of great importance in the agriculture considering the of relationship cost/benefit. However they may cause a series of problems in the ecosystem, being the levels of agrochemicals residues in fruits one of these factors. The aim of this work was to evaluate the prochloraz levels in mangoes treated in both stages of pre and post harvest, and in apples treated in the pre harvest. In the treatment of the mangoes, the interaction, fungicide with the gamma radiation with dose of 1,0 kGy, was used to induce prochloraz degradation. Treated post harvest mangoes were stored, at 12 deg C during 21 days. The results showed that the prochloraz did not present reduction in the residual levels of the mangoes after 21 day storage, that is the safe period established by the Brazilian legislation on agrochemicals, in treated mangoes. The refrigerated storage (12 deg C) and the gamma radiation also did not contribute to the degradation of the fungicide in mangoes. In average the concentration of the fungicide prochloraz in the peels (bar X = 1,64 mug/g) was higher than in the mangoes pulp (bar x = 0,06 mug/g), which allows the consumption of this fruit, since the peel is always discarded. The degradation product, formed in peels of mangoes in fruits treated in the pre and post harvest was the metabolite BIS 44596; for mangoes treated in the pre-post harvest the metabolite formed was the BIS 445186. Both metabolites were found in very low levels, confirming that occurs degradation of the fungicide in mangoes. In apples treated with the prochloraz, reduction of 500/0 in the levels. (author)

  18. Superação in vitro da dormência de embriões do porta-enxerto de macieira M9 (Malus pumilla Mill. Suppression of in vitro dormancy in embryos of rootstock of apple M9 (Malus pumilla Mill.

    Directory of Open Access Journals (Sweden)

    ADRIANA CIBELE DE MESQUITA DANTAS

    2002-04-01

    Full Text Available A dormência em sementes de macieira é um dos fatores limitantes para o avanço nos programas de melhoramento genético nesta espécie. Assim, o presente estudo objetivou estudar a germinação in vitro de embriões dormentes do porta-enxerto de macieira M9, oriundos da EE São Joaquim da EPAGRI/SC. Os embriões foram excisados de sementes maduras e inoculados em meio basal MS, adicionado de sacarose (30 g.L-1, ágar (6 g.L-1, água de coco (15%, caseína hidrolisada (CH (500 mg.L-1, AIA (0 e 14 µM; AG3 (0 e 1,5 µM, Kin (5 µM, 2-iP (12 µM; BAP (4 µM. As culturas foram mantidas no escuro por 10 dias e transferidas para sala de crescimento sob regime de luz de 16 horas, temperatura de 25 ± 2°C e 40 µmol de radiação luminosa. A maior percentagem de germinação (75% foi obtida em meio MS suplementado com CH (500 mg.L-1, AIA (14 µM, AG3 (1,5 µM e Kin (5 µM. Quando a Kin foi substituída por BAP (4µM, observou-se a formação de calo, sobre o qual se originaram gemas e brotações, cujos valores médios foram de 2,3 brotos por embrião e 12,3 gemas por brotação. Em relação ao comprimento das brotações, não houve diferença significativa entre os tratamentos. A maior percentagem de indução de calos ocorreu em meio de cultura suplementado com AIA, Kin e 2-iP. O meio de cultura MS/2 suplementado com CH e água de coco e isento de fitorreguladores, resultou em 25% de germinação. Já, o número de raízes foi maior no meio de cultura MS suplementado com AIA (14 µM, AG3 (1,5 µM e CH. O comprimento médio das raízes (4,0 cm não foi afetado por nenhum tratamento em particular. Desta forma, esta técnica é uma alternativa eficiente ao uso de tratamentos de frio para a superação da dormência.The embryo dormancy in apple is a limiting factor in breeding programs with this species. Thus the present work was carried out in order to study the in vitro germination of M9 apple dormant embryos, originated from the Experimental Station of São Joaquim (EPAGRI/SC. The embryos, excised from mature seeds were inoculated in the basal culture medium MS supplemented with of sucrose (30 g.L-1, coconut water (15%, casein hydrolysate (CH (500 mg.L-1, AIA (0 and 14 µM; GA3 (0 and 1.5 µM; and three citokinins sources: (Kin (5 µM; 2iP (12 µM and BAP (4 µM. The culture medium was gellified with agar (6 g.L-1. The cultures were maintained in the dark during 10 days, then transferred to growth room under 16 hours of light period, 25 ± 2°C, temperature, and 19 µE.m-2.s-1 of luminous radiation. The results showed that the highest value for embryo germination (75% was obtained in MS culture medium supplemented with CH, AIA (14 µM, GA3 (1.5 µM, and Kin (5 µM. When, in this treatment the Kin was replaced by BAP (4 µM, it was observed the callus induction and the subsequent proliferation of buds and shoots, reaching values of 2.3 shoots/embryos and 12.3 buds/shoot. The length of shoots was 4 cm, without statistical differences between the different treatments. The highest percentage of callus induction occurred in culture medium supplemented with AIA, Kin, and 2-iP. The culture medium MS half strength supplemented with CH, coconut water and free of growth regulators resulted in values of 25% of germination. The root number was highest in the culture medium supplemented with AIA (14 µM, GA3 (1.5 µM, and CH. The average root length (4.0 was not affected by any particular treatment. Thus, this technique is an efficient alternative to the cool treatments for dormancy suppression.

  19. MhYTP1 and MhYTP2 from Apple Confer Tolerance to Multiple Abiotic Stresses in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Na Wang

    2017-08-01

    Full Text Available The first YTH domain-containing RNA binding protein (YTP was found in rat, where it was related to oxidative stress. Unlike characterizations in yeast and animals, functions of plant YTPs are less clear. Malus hupehensis (Pamp. Rehd. YTP1 and YTP2 (MhYTP1 and MhYTP2 are known to be active in leaf senescence and fruit ripening. However, no research has been published about their roles in stress responses. Here, we investigate the stress-related functions of MhYTP1 and MhYTP2 in Arabidopsis thaliana. Both of the two genes participated in salicylic acid (SA, jasmonic acid (JA, and abscisic acid (ABA signaling and play roles in plant responses to oxidative stress, chilling, high temperature, high salinity, and mannitol induced physiological drought stress. Moreover, MhYTP1 plays leading roles in SA and ABA signaling, and MhYTP2 plays leading roles in JA signaling and oxidative stress responses. These results will fill a gap in our knowledge about plant YTPs and stress responses and provide a foundation for future attempts to improve stress tolerance in apple.

  20. Molecular mechanism of the S-RNase-based gametophytic self-incompatibility in fruit trees of Rosaceae.

    Science.gov (United States)

    Sassa, Hidenori

    2016-01-01

    Self-incompatibility (SI) is a major obstacle for stable fruit production in fruit trees of Rosaceae. SI of Rosaceae is controlled by the S locus on which at least two genes, pistil S and pollen S, are located. The product of the pistil S gene is a polymorphic and extracellular ribonuclease, called S-RNase, while that of the pollen S gene is a protein containing the F-box motif, SFB (S haplotype-specific F-box protein)/SFBB (S locus F-box brothers). Recent studies suggested that SI of Rosaceae includes two different systems, i.e., Prunus of tribe Amygdaleae exhibits a self-recognition system in which its SFB recognizes self-S-RNase, while tribe Pyreae (Pyrus and Malus) shows a non-self-recognition system in which many SFBB proteins are involved in SI, each recognizing subset of non-self-S-RNases. Further biochemical and biological characterization of the S locus genes, as well as other genes required for SI not located at the S locus, will help our understanding of the molecular mechanisms, origin, and evolution of SI of Rosaceae, and may provide the basis for breeding of self-compatible fruit tree cultivars.

  1. Phenological monitoring of fruit trees in the Czech republic

    Science.gov (United States)

    Hajkova, L.; Striz, M.; Nekovar, J.

    2010-09-01

    Phenological observations at CHMI has a long tradition. Aside from several short-term series in 18th and 19th century the general phenology network has been started in 1923.In 1987 the network has been divided into tree observation types (field crops, fruit trees and wild plants) with separate methodology instructions. The period 1991 - 2010 has been selected. We have statistically evaluated results of fruit trees phenophase onset (bud burst - BBCH07, inflorescence emergence - BBCH57, beginning of flowering - BBCH61, end of flowering - BBCH69) in above mentioned period (apple, pear, cherry, morello, apricot). The second step has been evaluation of interval duration with meteorological characteristics (air temperature, sunshine duration, number of days with precipitation above 1 mm).In selected period 1991 - 2009 were observed subsequent average phenophase onset: BBCH 07 - 25th March, BBCH 57 - 14th April, BBCH61 - 26th April, BBCH69 - 12th May (Malus domestica Borkh. - species Idared). Prunus armeniaca L. - species Velkopavlovická shows these results in period 1991 - 2009: BBCH07 - 27th March, BBCH57 - 5th April, BBCH61 - 7th April, BBCH69 - 19th April.

  2. Dihydrochalcone Compounds Isolated from Crabapple Leaves Showed Anticancer Effects on Human Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Xiaoxiao Qin

    2015-11-01

    Full Text Available Seven dihydrochalcone compounds were isolated from the leaves of Malus crabapples, cv. “Radiant”, and their chemical structures were elucidated by UV, IR, ESI-MS, 1H-NMR and 13C-NMR analyses. These compounds, which include trilobatin (A1, phloretin (A2, 3-hydroxyphloretin (A3, phloretin rutinoside (A4, phlorizin (A5, 6′′-O-coumaroyl-4′-O-glucopyranosylphloretin (A6, and 3′′′-methoxy-6′′-O-feruloy-4′-O-glucopyranosyl-phloretin (A7, all belong to the phloretin class and its derivatives. Compounds A6 and A7 are two new rare dihydrochalcone compounds. The results of a MTT cancer cell growth inhibition assay demonstrated that phloretin and these derivatives showed significant positive anticancer activities against several human cancer cell lines, including the A549 human lung cancer cell line, Bel 7402 liver cancer cell line, HepG2 human ileocecal cancer cell line, and HT-29 human colon cancer cell line. A7 had significant effects on all cancer cell lines, suggesting potential applications for phloretin and its derivatives. Adding a methoxyl group to phloretin dramatically increases phloretin’s anticancer activity.

  3. A sampling approach for predicting the eating quality of apples using visible–near infrared spectroscopy

    DEFF Research Database (Denmark)

    Vega, Mabel V Martínez; Sharifzadeh, Sara; Wulfsohn, Dvoralai

    2013-01-01

    BACKGROUND Visible–near infrared spectroscopy remains a method of increasing interest as a fast alternative for the evaluation of fruit quality. The success of the method is assumed to be achieved by using large sets of samples to produce robust calibration models. In this study we used represent......BACKGROUND Visible–near infrared spectroscopy remains a method of increasing interest as a fast alternative for the evaluation of fruit quality. The success of the method is assumed to be achieved by using large sets of samples to produce robust calibration models. In this study we used...... representative samples of an early and a late season apple cultivar to evaluate model robustness (in terms of prediction ability and error) on the soluble solids content (SSC) and acidity prediction, in the wavelength range 400–1100 nm. RESULTS A total of 196 middle–early season and 219 late season apples (Malus...... training and test sets (‘smooth fractionator’, by date of measurement after harvest and random). Using the ‘smooth fractionator’ sampling method, fewer spectral bands (26) and elastic net resulted in improved performance for SSC models of ‘Aroma’ apples, with a coefficient of variation CVSSC = 13...

  4. Oriented Growth of α-MnO₂ Nanorods Using Natural Extracts from Grape Stems and Apple Peels.

    Science.gov (United States)

    Sanchez-Botero, Lina; Herrera, Adriana P; Hinestroza, Juan P

    2017-05-22

    We report on the synthesis of alpha manganese dioxide (α-MnO₂) nanorods using natural extracts from Vitis vinifera grape stems and Malus domestica 'Cortland' apple peels. We used a two-step method to produce highly crystalline α-MnO₂ nanorods: (1) reduction of KMnO₄ in the presence of natural extracts to initiate the nucleation process; and (2) a thermal treatment to enable further solid-state growth of the nuclei. Transmission electron microscopy (TEM) and field emission scanning electron microscopy (FESEM) images provided direct evidence of the morphology of the nanorods and these images were used to propose nucleation and growth mechanisms. We found that the α-MnO₂ nanorods synthesized using natural extracts exhibit structural and magnetic properties similar to those of nanoparticles synthesized via traditional chemical routes. Furthermore, Fourier transform infrared (FTIR) shows that the particle growth of the α-MnO₂ nanorods appears to be controlled by the presence of natural capping agents during the thermal treatment. We also evaluated the catalytic activity of the nanorods in the degradation of aqueous solutions of indigo carmine dye, highlighting the potential use of these materials to clean dye-polluted water.

  5. MdCOP1 Ubiquitin E3 Ligases Interact with MdMYB1 to Regulate Light-Induced Anthocyanin Biosynthesis and Red Fruit Coloration in Apple1[W][OA

    Science.gov (United States)

    Li, Yuan-Yuan; Mao, Ke; Zhao, Cheng; Zhao, Xian-Yan; Zhang, Hua-Lei; Shu, Huai-Rui; Hao, Yu-Jin

    2012-01-01

    MdMYB1 is a crucial regulator of light-induced anthocyanin biosynthesis and fruit coloration in apple (Malus domestica). In this study, it was found that MdMYB1 protein accumulated in the light but degraded via a ubiquitin-dependent pathway in the dark. Subsequently, the MdCOP1-1 and MdCOP1-2 genes were isolated from apple fruit peel and were functionally characterized in the Arabidopsis (Arabidopsis thaliana) cop1-4 mutant. Yeast (Saccharomyces cerevisiae) two-hybrid, bimolecular fluorescence complementation, and coimmunoprecipitation assays showed that MdMYB1 interacts with the MdCOP1 proteins. Furthermore, in vitro and in vivo experiments indicated that MdCOP1s are necessary for the ubiquitination and degradation of MdMYB1 protein in the dark and are therefore involved in the light-controlled stability of the MdMYB1 protein. Finally, a viral vector-based transformation approach demonstrated that MdCOP1s negatively regulate the peel coloration of apple fruits by modulating the degradation of the MdMYB1 protein. Our findings provide new insight into the mechanism by which light controls anthocyanin accumulation and red fruit coloration in apple and even other plant species. PMID:22855936

  6. Transcription Factor AREB2 Is Involved in Soluble Sugar Accumulation by Activating Sugar Transporter and Amylase Genes.

    Science.gov (United States)

    Ma, Qi-Jun; Sun, Mei-Hong; Lu, Jing; Liu, Ya-Jing; Hu, Da-Gang; Hao, Yu-Jin

    2017-08-01

    Sugars play important roles in plant growth and development, crop yield and quality, as well as responses to abiotic stresses. Abscisic acid (ABA) is a multifunctional hormone. However, the exact mechanism by which ABA regulates sugar accumulation is largely unknown in plants. Here, we tested the expression profile of several sugar transporter and amylase genes in response to ABA treatment. MdSUT2 and MdAREB2 were isolated and genetically transformed into apple ( Malus domestica ) to investigate their roles in ABA-induced sugar accumulation. The MdAREB2 transcription factor was found to bind to the promoters of the sugar transporter and amylase genes and activate their expression. Both MdAREB2 and MdSUT2 transgenic plants produced more soluble sugars than controls. Furthermore, MdAREB2 promoted the accumulation of sucrose and soluble sugars in an MdSUT2 -dependent manner. Our results demonstrate that the ABA-responsive transcription factor MdAREB2 directly activates the expression of amylase and sugar transporter genes to promote soluble sugar accumulation, suggesting a mechanism by which ABA regulates sugar accumulation in plants. © 2017 American Society of Plant Biologists. All Rights Reserved.

  7. Transgenic Suppression of AGAMOUS Genes in Apple Reduces Fertility and Increases Floral Attractiveness

    Science.gov (United States)

    Klocko, Amy L.; Borejsza-Wysocka, Ewa; Brunner, Amy M.; Shevchenko, Olga; Aldwinckle, Herb; Strauss, Steven H.

    2016-01-01

    We investigated the ability of RNA interference (RNAi) directed against two co-orthologs of AGAMOUS (AG) from Malus domestica (domestic apple, MdAG) to reduce the risks of invasiveness and provide genetic containment of transgenes, while also promoting the attractiveness of flowers for ornamental usage. Suppression of two MdAG-like genes, MdMADS15 and MdMADS22, led to the production of trees with highly showy, polypetalous flowers. These “double-flowers” had strongly reduced expression of both MdAG-like genes. Members of the two other clades within in the MdAG subfamily showed mild to moderate differences in gene expression, or were unchanged, with the level of suppression approximately proportional to the level of sequence identity between the gene analyzed and the RNAi fragment. The double-flowers also exhibited reduced male and female fertility, had few viable pollen grains, a decreased number of stigmas, and produced few viable seeds after cross-pollination. Despite these floral alterations, RNAi-AG trees with double-flowers set full-sized fruit. Suppression or mutation of apple AG-like genes appears to be a promising method for combining genetic containment with improved floral attractiveness. PMID:27500731

  8. Control of plant defense mechanisms and fire blight pathogenesis through the regulation of 6-thioguanine biosynthesis in Erwinia amylovora.

    Science.gov (United States)

    Coyne, Sébastien; Litomska, Agnieszka; Chizzali, Cornelia; Khalil, Mohammed N A; Richter, Klaus; Beerhues, Ludger; Hertweck, Christian

    2014-02-10

    Fire blight is a devastating disease of Rosaceae plants, such as apple and pear trees. It is characterized by necrosis of plant tissue, caused by the phytopathogenic bacterium Erwinia amylovora. The plant pathogen produces the well-known antimetabolite 6-thioguanine (6TG), which plays a key role in fire blight pathogenesis. Here we report that YcfR, a member of the LTTR family, is a major regulator of 6TG biosynthesis in E. amylovora. Inactivation of the regulator gene (ycfR) led to dramatically decreased 6TG production. Infection assays with apple plants (Malus domestica cultivar Holsteiner Cox) and cell cultures of Sorbus aucuparia (mountain ash, rowan) revealed abortive fire blight pathogenesis and reduced plant response (biphenyl and dibenzofuran phytoalexin production). In the presence of the ΔycfR mutant, apple trees were capable of activating the abscission machinery to remove infected tissue. In addition to unveiling the regulation of 6TG biosynthesis in a major plant pathogen, we demonstrate for the first time that this antimetabolite plays a pivotal role in dysregulating the plant response to infection. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. An effector of apple proliferation phytoplasma targets TCP transcription factors-a generalized virulence strategy of phytoplasma?

    Science.gov (United States)

    Janik, Katrin; Mithöfer, Axel; Raffeiner, Margot; Stellmach, Hagen; Hause, Bettina; Schlink, Katja

    2017-04-01

    The plant pathogen Candidatus Phytoplasma mali (P. mali) is the causative agent of apple proliferation, a disease of increasing importance in apple-growing areas within Europe. Despite its economic importance, little is known about the molecular mechanisms of disease manifestation within apple trees. In this study, we identified two TCP (TEOSINTE BRANCHED/CYCLOIDEA/PROLIFERATING CELL FACTOR) transcription factors of Malus x domestica as binding partners of the P. mali SAP11-like effector ATP_00189. Phytohormone analyses revealed an effect of P. mali infection on jasmonates, salicylic acid and abscisic acid levels, showing that P. mali affects phytohormonal levels in apple trees, which is in line with the functions of the effector assumed from its binding to TCP transcription factors. To our knowledge, this is the first characterization of the molecular targets of a P. mali effector and thus provides the basis to better understand symptom development and disease progress during apple proliferation. As SAP11 homologues are found in several Phytoplasma species infecting a broad range of different plants, SAP11-like proteins seem to be key players in phytoplasmal infection. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  10. Novel edible oil sources: Microwave heating and chemical properties.

    Science.gov (United States)

    Hashemi, Seyed Mohammad Bagher; Mousavi Khaneghah, Amin; Koubaa, Mohamed; Lopez-Cervantes, Jaime; Yousefabad, Seyed Hossein Asadi; Hosseini, Seyedeh Fatemeh; Karimi, Masoumeh; Motazedian, Azam; Asadifard, Samira

    2017-02-01

    The aim of this work was to investigate the effect of various microwave heating times (1, 3, 5, 10, and 15min) on the chemical properties of novel edible oil sources, including Mashhadi melon (Cucumis melo var. Iranians cv. Mashhadi), Iranian watermelon (Citrullus lanatus cv. Fire Fon), pumpkin (Cucurbita pepo subsp. pepo var. Styriaca), and yellow apple (Malus domestica cv. Golden Delicious) seed oils. The evaluated parameters were peroxide value (PV), conjugated diene (CD) and triene (CT) values, carbonyl value (CV), p-anisidine value (AnV), oil stability index (OSI), radical scavenging activity (RSA), total tocopherols, total phenolics, as well as chlorophyll and carotenoid contents. Results showed that extended microwave heating involves decreased quality of the seed oils, mainly due to the formation of primary and secondary oxidation products. Microwave heating time also affects the total contents of chlorophylls, carotenoids, phenolics and tocopherols, which clearly decrease by increasing the exposure time. The order of oxidative stability of the analyzed edible oils was pumpkin>Mashhadi melon>Iranian watermelon>yellow apple. The obtained results demonstrated the promising potential of these novel edible oils for different food applications. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Nitrogen availability in an apple orchard with weed management

    Directory of Open Access Journals (Sweden)

    Gustavo Brunetto

    2018-05-01

    Full Text Available ABSTRACT: Weed management in apple orchards (Malus domestica can affect the leaching of nitrogen (N in soil. The study aimed to evaluate the potential leaching of N forms in soil of an apple orchard with different weed management treatments. The experiment was conducted in an apple orchard implanted in 2008. In October 2011, 80 plants were selected and the following treatments were implemented: no weed management (NM, desiccation of weeds on the tree row with herbicide use (DR and mechanical mowing of weeds on the tree row (MR. Yield was evaluated in the 2011/2012, 2012/2013 and 2013/2014 crop seasons. In May 2012 porous cup lysimeters were installed in the NM, DR and MR treatments. In the solution collected at 0.20m, NH4 +-N and NO3 --N were analyzed sixteen times and mineral N concentration was calculated. The highest concentrations of NO3 --N and mineral N occurred in soil solution with DR, which increases availability of the nutrient to apple trees, but also enhances the potential losses. Weed management and N flow in the solution did not affect apple yield.

  12. Use of waste material in cultivation substrates

    Directory of Open Access Journals (Sweden)

    Petr Salaš

    2004-01-01

    Full Text Available Gardeners' practical experience and experimental work prove the affirmation that the used substrate is a very important base for the production of quality nursery products. It is important to emphasis the complexity and synergy of all factors influencing the ecosystem and there mutual relations. Physical, chemical and biological properties do not separately affect the growth and development of plants. In addition, the relations are not statical but differ in relation with other factors changes. This article is dealing with the possibility to use waste material from timber processing in cultivation substrates. The large scale use of such substrates would enable people to reach a relative independence from peat substrates, of which the global reserve is gradually decreasing.Our research activities focus on the use of bark. The basic problems of a bark substrate are easy dehydration and unbalanced nutrition of trees and shrubs. The suggested and experimented cultivation technology solves these problems. It is based on the cultivation of woody species in bark substrates, using modern irrigation systems, slow release fertilisers (Silvamix Forte and special soil conditioners (TerraCottem. This technology was tested on the following species of trees and shrubs: Malus and Buxus.

  13. Application of molecular markers in apple breeding

    Directory of Open Access Journals (Sweden)

    Marić Slađana

    2010-01-01

    Full Text Available Apple is economically the most important species of genus Malus Miller. In respect of production, trade and consumption, it ranks first among deciduous fruit and third on a global scale among all fruit species. Apple breeding is carried out on a large scale in several scientific institutes throughout the world. Due to this activity, apple is a fruit species with the highest number of described monogenic traits; 76 genes, encoding morphological traits, pest and disease resistance, as well as 69 genes encoding enzymes. The development of molecular markers (RFLPs, AFLPs, SCARs and SSRs has allowed the mapping of the apple genome and the development of several saturated genetic maps, to which genes controlling important traits are assigned. Markers flanking these genes not only play an important role in selecting parental combinations and seedlings with positive traits, but they are also particularly important in detecting recessive traits, such as seedless fruit. In addition they enable pre-selection for polygenic quantitative traits. In recent years, particular attention has been paid to biochemical and physiological processes involved in the pathway of important traits e.g., ripening and the storage capability of apple fruit.

  14. Extension and Application of Credibility Models in Predicting Claim Frequency

    Directory of Open Access Journals (Sweden)

    Yuan-tao Xie

    2018-01-01

    Full Text Available In nonlife actuarial science, credibility models are one of the main methods of experience ratemaking. Bühlmann-Straub credibility model can be expressed as a special case of linear mixed models (LMMs with the underlying assumption of normality. In this paper, we extend the assumption of Bühlmann-Straub model to include Poisson and negative binomial distributions as they are more appropriate for describing the distribution of a number of claims. By using the framework of generalized linear mixed models (GLMMs, we obtain the generalized credibility premiums that contain as particular cases another credibility premium in the literature. Compared to generalized linear mixed models, our extended credibility models also have an advantage in that the credibility factor falls into the range from 0 to 1. The performance of our models in comparison with an existing model in the literature is also evaluated through numerical studies, which shows that our approach produces premium estimates close to the optima. In addition, our proposed model can also be applied to the most commonly used ratemaking approach, namely, the net, the optimal Bonus-Malus system.

  15. La Serra d'Almos (Tarragona): an example of phenological data rescue and preservation in Catalonia

    Science.gov (United States)

    Busto, Montserrat; Cunillera, Jordi; de Yzaguirre, Xavi; Borrell, Josep

    2016-04-01

    The interruption of important phenological series and the progressive disappearance of phenological observations in Catalonia led the Meteorological Service of Catalonia (SMC) to design and impulse a new phenological network promoted by the Climate Change Unit of this Met Service. The "Fenocat" network was born in March 2013, and currently has around fifty observers distributed throughout Catalonia that observe plants, birds and butterflies. We are providing data from different plant phenophases to PEP725 database. Besides this new phenological network (Fenocat), one of the aims of SMC is to rescue and preserve historical data from different observation points in Catalonia. We show in this poster the example of rescue and preservation of phenological data from la Serra d'Almos (in Tivissa, near Tarragona, Catalonia, NE Iberian Peninsula), an observation series that began in 1973. After digitalization process and quality control tasks, we show preliminary results of this phenological series, and we compare them with those of similar European series. We show the evolution trends for different observed species, such as almond tree (Prunus dulcis), hazel (Corylus avellana), plum (Prunus domestica), olive tree (Olea europea), apple tree (Malus domestica) or vineyard (Vitis vinifera).

  16. A comparative ultrastructural study of pit membranes with plasmodesmata associated thickenings in four angiosperm species.

    Science.gov (United States)

    Rabaey, David; Lens, Frederic; Huysmans, Suzy; Smets, Erik; Jansen, Steven

    2008-11-01

    Recent micromorphological observations of angiosperm pit membranes have extended the number and range of taxa with pseudo-tori in tracheary elements. This study investigates at ultrastructural level (TEM) the development of pseudo-tori in the unrelated Malus yunnanensis, Ligustrum vulgare, Pittosporum tenuifolium, and Vaccinium myrtillus in order to determine whether these plasmodesmata associated thickenings have a similar developmental pattern across flowering plants. At early ontogenetic stages, the formation of a primary thickening was observed, resulting from swelling of the pit membrane in fibre-tracheids and vessel elements. Since plasmodesmata appear to be frequently, but not always, associated with these primary pit membrane thickenings, it remains unclear which ultrastructural characteristics control the formation of pseudo-tori. At a very late stage during xylem differentiation, a secondary thickening is deposited on the primary pit membrane thickening. Plasmodesmata are always associated with pseudo-tori at these final developmental stages. After autolysis, the secondary thickening becomes electron-dense and persistent, while the primary thickening turns transparent and partially or entirely dissolves. The developmental patterns observed in the species studied are similar and agree with former ontogenetic studies in Rosaceae, suggesting that pseudo-tori might be homologous features across angiosperms.

  17. Fruit vinegars attenuate cardiac injury via anti-inflammatory and anti-adiposity actions in high-fat diet-induced obese rats.

    Science.gov (United States)

    Bounihi, Abdenour; Bitam, Arezki; Bouazza, Asma; Yargui, Lyece; Koceir, Elhadj Ahmed

    2017-12-01

    Fruit vinegars (FVs) are used in Mediterranean folk medicine for their hypolipidemic and weight-reducing properties. To investigate the preventive effects of three types of FV, commonly available in Algeria, namely prickly pear [Opuntia ficus-indica (L.) Mill (Cectaceae)], pomegranate [Punica granatum L. (Punicaceae)], and apple [Malus domestica Borkh. (Rosaceae)], against obesity-induced cardiomyopathy and its underlying mechanisms. Seventy-two male Wistar rats were equally divided into 12 groups. The first group served as normal control (distilled water, 7 mL/kg bw), and the remaining groups were respectively treated with distilled water (7 mL/kg bw), acetic acid (0.5% w/v, 7 mL/kg bw) and vinegars of pomegranate, apple or prickly pear (at doses of 3.5, 7 and 14 mL/kg bw, acetic acid content as mentioned above) along with a high-fat diet (HFD). The effects of the oral administration of FV for 18 weeks on the body and visceral adipose tissue (VAT) weights, plasma inflammatory and cardiac enzymes biomarkers, and in heart tissue were evaluated. Vinegars treatments significantly (p inflammatory and anti-adiposity properties of these vinegars.

  18. Aminoethoxyvinylglycine: isolated and combined with other growth regulators on quality of ‘Brookfield’ apples after storage

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2015-06-01

    Full Text Available Growth regulators are used in the production of apples worldwide, especially to extend the harvest period and maintain postharvest quality. This study aimed to investigate the effects of applying aminoethoxyvinylglycine (AVG in isolation as well as in combination with other growth regulators and postharvest techniques on the harvest quality and storage potential of ‘Brookfield’ apples (Malus domestica, a ‘Gala’ strain. Fruit receiving AVG only had the highest starch content and the highest titratable acidity at harvest. After 8 months of storage, the AVG + 1-MCP (1-methylcyclopropene and AVG + ABS (ethylene absorption conserved higher flesh firmness than to all the other treatments. Naphthaleneacetic acid (NAA application induced ACC oxidase enzyme activity at harvest, but not after storage. AVG application, with or without the aid of another technique, did not decrease the red skin color of ‘Brookfield’ apples. Low mealiness and a high healthy fruit percentage was obtained when the fruits were submitted to pre-harvest AVG application combined with NAA, 1-MCP and ABS. Internal carbon dioxide had an inverse correlation with the quantity of healthy fruit and was directly correlated with mealiness.

  19. Estimate of respiration rate and physicochemical changes of fresh-cut apples stored under different temperatures

    Directory of Open Access Journals (Sweden)

    Cristiane Fagundes

    2013-03-01

    Full Text Available In this study, the influence of storage temperature and passive modified packaging (PMP on the respiration rate and physicochemical properties of fresh-cut Gala apples (Malus domestica B. was investigated. The samples were packed in flexible multilayer bags and stored at 2 °C, 5 °C, and 7 °C for eleven days. Respiration rate as a function of CO2 and O2 concentrations was determined using gas chromatography. The inhibition parameters were estimated using a mathematical model based on Michaelis-Menten equation. The following physicochemical properties were evaluated: total soluble solids, pH, titratable acidity, and reducing sugars. At 2 °C, the maximum respiration rate was observed after 150 hours. At 5 °C and 7 °C the maximum respiration rates were observed after 100 and 50 hours of storage, respectively. The inhibition model results obtained showed a clear effect of CO2 on O2 consumption. The soluble solids decreased, although not significantly, during storage at the three temperatures studied. Reducing sugars and titratable acidity decreased during storage and the pH increased. These results indicate that the respiration rate influenced the physicochemical properties.

  20. Differential response of cell-cycle and cell-expansion regulators to heat stress in apple (Malus domestica) fruitlets.

    Science.gov (United States)

    Flaishman, Moshe A; Peles, Yuval; Dahan, Yardena; Milo-Cochavi, Shira; Frieman, Aviad; Naor, Amos

    2015-04-01

    Temperature is one of the most significant factors affecting physiological and biochemical aspects of fruit development. Current and progressing global warming is expected to change climate in the traditional deciduous fruit tree cultivation regions. In this study, 'Golden Delicious' trees, grown in a controlled environment or commercial orchard, were exposed to different periods of heat treatment. Early fruitlet development was documented by evaluating cell number, cell size and fruit diameter for 5-70 days after full bloom. Normal activities of molecular developmental and growth processes in apple fruitlets were disrupted under daytime air temperatures of 29°C and higher as a result of significant temporary declines in cell-production and cell-expansion rates, respectively. Expression screening of selected cell cycle and cell expansion genes revealed the influence of high temperature on genetic regulation of apple fruitlet development. Several core cell-cycle and cell-expansion genes were differentially expressed under high temperatures. While expression levels of B-type cyclin-dependent kinases and A- and B-type cyclins declined moderately in response to elevated temperatures, expression of several cell-cycle inhibitors, such as Mdwee1, Mdrbr and Mdkrps was sharply enhanced as the temperature rose, blocking the cell-cycle cascade at the G1/S and G2/M transition points. Moreover, expression of several expansin genes was associated with high temperatures, making them potentially useful as molecular platforms to enhance cell-expansion processes under high-temperature regimes. Understanding the molecular mechanisms of heat tolerance associated with genes controlling cell cycle and cell expansion may lead to the development of novel strategies for improving apple fruit productivity under global warming. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  1. A multidisciplinary approach providing new insight into fruit flesh browning physiology in apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Di Guardo, Mario; Tadiello, Alice; Farneti, Brian; Lorenz, Giorgia; Masuero, Domenico; Vrhovsek, Urska; Costa, Guglielmo; Velasco, Riccardo; Costa, Fabrizio

    2013-01-01

    In terms of the quality of minimally processed fruit, flesh browning is fundamentally important in the development of an aesthetically unpleasant appearance, with consequent off-flavours. The development of browning depends on the enzymatic action of the polyphenol oxidase (PPO). In the 'Golden Delicious' apple genome ten PPO genes were initially identified and located on three main chromosomes (2, 5 and 10). Of these genes, one element in particular, here called Md-PPO, located on chromosome 10, was further investigated and genetically mapped in two apple progenies ('Fuji x Pink Lady' and 'Golden Delicious x Braeburn'). Both linkage maps, made up of 481 and 608 markers respectively, were then employed to find QTL regions associated with fruit flesh browning, allowing the detection of 25 QTLs related to several browning parameters. These were distributed over six linkage groups with LOD values spanning from 3.08 to 4.99 and showed a rate of phenotypic variance from 26.1 to 38.6%. Anchoring of these intervals to the apple genome led to the identification of several genes involved in polyphenol synthesis and cell wall metabolism. Finally, the expression profile of two specific candidate genes, up and downstream of the polyphenolic pathway, namely phenylalanine ammonia lyase (PAL) and polyphenol oxidase (PPO), provided insight into flesh browning physiology. Md-PPO was further analyzed and two haplotypes were characterised and associated with fruit flesh browning in apple.

  2. Role of scab-resistant apple varieties in forming assortment of new industrial apple plantings (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Ю. Д. Гончарук

    2015-12-01

    Full Text Available Purpose. Identifying new scab-resistant apple varieties with high biological potential by the set of agronomic characters and the ability to realize it effectively in various soil and climatic conditions. Methods. Field, laboratory, comparison, generalization, statistical ones. Results. The author presents the results of study of 17 scab-resistant non-irrigated apple varieties on a semi-dwarf rootstock as to their adaptability to biotic and abio­tic stressors as well as their economic productivity. The studied varieties appeared to be winter-hardy, frost- and heat-resistant, but medium drought-tolerant ones. They are characterized by weak and moderate susceptibility to powdery mildew, high resistance to fruit rot and very low amounts of brown spot, except for Gold Rush variety. Such 10 year old varieties as ‘Edera’, Florina’, ‘Amulet’ and ‘Perlyna Kyieva’ and 8 year old ‘Afrodita’, ‘Vitos’, ‘Orlovskoie Polesie’ and ‘Topaz’ formed the highest productivity during the years of study. Due to the pollen quality and high interfertility, ‘Revena’ and ‘Gold Rush’ varieties were identified as universal pollinators for winter scab-resistant apple varieties. Conclusions. Such ecologically resistant winter varieties as ‘Topaz’, ‘Freedom’, ‘Edera’ and autumnal ‘Remo’, ‘Afrodita’, ‘Vitos’, ‘Amulet’ were recognized as promising for new intensive non-irrigated plantations in the Forest-Steppe zone of Ukraine. They can be the basis of new gardens occupying 25–30% of the area where ecologically safe fruits for various target purposes will be grown supplying demands of the population and processing industry.

  3. A Multidisciplinary Approach Providing New Insight into Fruit Flesh Browning Physiology in Apple (Malus x domestica Borkh.)

    Science.gov (United States)

    Farneti, Brian; Lorenz, Giorgia; Masuero, Domenico; Vrhovsek, Urska; Costa, Guglielmo; Velasco, Riccardo; Costa, Fabrizio

    2013-01-01

    In terms of the quality of minimally processed fruit, flesh browning is fundamentally important in the development of an aesthetically unpleasant appearance, with consequent off-flavours. The development of browning depends on the enzymatic action of the polyphenol oxidase (PPO). In the ‘Golden Delicious’ apple genome ten PPO genes were initially identified and located on three main chromosomes (2, 5 and 10). Of these genes, one element in particular, here called Md-PPO, located on chromosome 10, was further investigated and genetically mapped in two apple progenies (‘Fuji x Pink Lady’ and ‘Golden Delicious x Braeburn’). Both linkage maps, made up of 481 and 608 markers respectively, were then employed to find QTL regions associated with fruit flesh browning, allowing the detection of 25 QTLs related to several browning parameters. These were distributed over six linkage groups with LOD values spanning from 3.08 to 4.99 and showed a rate of phenotypic variance from 26.1 to 38.6%. Anchoring of these intervals to the apple genome led to the identification of several genes involved in polyphenol synthesis and cell wall metabolism. Finally, the expression profile of two specific candidate genes, up and downstream of the polyphenolic pathway, namely phenylalanine ammonia lyase (PAL) and polyphenol oxidase (PPO), provided insight into flesh browning physiology. Md-PPO was further analyzed and two haplotypes were characterised and associated with fruit flesh browning in apple. PMID:24205065

  4. Postglacial recolonization history of the European crabapple (Malus sylvestris Mill.), a wild contributor to the domesticated apple

    NARCIS (Netherlands)

    Cornille, A.; Giraud, T.; Bellard, C.; Tellier, A.; Cam, le B.; Smulders, M.J.M.; Kleinschmit, J.; Roldan-Ruiz, I.; Gladieux, P.

    2013-01-01

    Understanding the way in which the climatic oscillations of the Quaternary Period have shaped the distribution and genetic structure of extant tree species provides insight into the processes driving species diversification, distribution and survival. Deciphering the genetic consequences of past

  5. Gamma radiation and thermal treatment effects on the conservation of natural apple (Malus domestica) juice, cv. gala

    International Nuclear Information System (INIS)

    Blumer, Lucimara.

    1995-12-01

    This work studies the apple juice preservation without chemicals. The samples were exposed to the following treatments: heating (control, 60 0 C/20 min and 80 0 C/20 min); irradiation (control; 2, 4 and 6 kGy); heating plus irradiation. The quality control was carried out by physical and chemical analyses (soluble solids; titratable acidity, pH, ascorbic acid and color), microbiological and sensorial analyses. The samples were stored at refrigeration temperature (5 ± 3 0 C) for 180 days. The results showed few variations in the soluble solids, acidity, pH and ascorbic acid for all treatments. However, the 6 kGy dose kept the chemical characteristics of the juice, providing a clear juice, with better appearance and microorganisms free. (author). 24 refs., 11 figs., 12 tabs

  6. A genomics approach to understanding the role of auxin in apple (Malus x domestica) fruit size control.

    Science.gov (United States)

    Devoghalaere, Fanny; Doucen, Thomas; Guitton, Baptiste; Keeling, Jeannette; Payne, Wendy; Ling, Toby John; Ross, John James; Hallett, Ian Charles; Gunaseelan, Kularajathevan; Dayatilake, G A; Diak, Robert; Breen, Ken C; Tustin, D Stuart; Costes, Evelyne; Chagné, David; Schaffer, Robert James; David, Karine Myriam

    2012-01-13

    Auxin is an important phytohormone for fleshy fruit development, having been shown to be involved in the initial signal for fertilisation, fruit size through the control of cell division and cell expansion, and ripening related events. There is considerable knowledge of auxin-related genes, mostly from work in model species. With the apple genome now available, it is possible to carry out genomics studies on auxin-related genes to identify genes that may play roles in specific stages of apple fruit development. High amounts of auxin in the seed compared with the fruit cortex were observed in 'Royal Gala' apples, with amounts increasing through fruit development. Injection of exogenous auxin into developing apples at the start of cell expansion caused an increase in cell size. An expression analysis screen of auxin-related genes involved in auxin reception, homeostasis, and transcriptional regulation showed complex patterns of expression in each class of gene. Two mapping populations were phenotyped for fruit size over multiple seasons, and multiple quantitative trait loci (QTLs) were observed. One QTL mapped to a region containing an Auxin Response Factor (ARF106). This gene is expressed during cell division and cell expansion stages, consistent with a potential role in the control of fruit size. The application of exogenous auxin to apples increased cell expansion, suggesting that endogenous auxin concentrations are at least one of the limiting factors controlling fruit size. The expression analysis of ARF106 linked to a strong QTL for fruit weight suggests that the auxin signal regulating fruit size could partially be modulated through the function of this gene. One class of gene (GH3) removes free auxin by conjugation to amino acids. The lower expression of these GH3 genes during rapid fruit expansion is consistent with the apple maximising auxin concentrations at this point.

  7. Evaluation of the 14C-prochloraz residue levels in irradiated mangoes (Mangifera indica) and apples (Malus domestica)

    International Nuclear Information System (INIS)

    Costa, Maria Aparecida

    1998-01-01

    The Brazilian crops mangoes and apples has expanding in the last years. However, tropical fruits crops are susceptible to infection that harms the crop yield. The control of these diseases is made through fungicides such as prochloraz which possesses protecting eradicating action by controlling anthracnose in mangoes and scabies in apples. Agrochemicals are of great importance in the agriculture considering the of relationship cost/benefit. However they may cause a series of problems in the ecosystem, being the levels of agrochemicals residues in fruits one of these factors. The aim of this work was to evaluate the prochloraz levels in mangoes treated in both stages of pre and post harvest, and in apples treated in the pre harvest. In the treatment of the mangoes, the interaction, fungicide with the gamma radiation with dose of 1,0 kGy, was used to induce prochloraz degradation. Treated post harvest mangoes were stored, at 12 deg C during 21 days. The results showed that the prochloraz did not present reduction in the residual levels of the mangoes after 21 day storage, that is the safe period established by the Brazilian legislation on agrochemicals, in treated mangoes. The refrigerated storage (12 deg C) and the gamma radiation also did not contribute to the degradation of the fungicide in mangoes. In average the concentration of the fungicide prochloraz in the peels (bar X = 1,64 mug/g) was higher than in the mangoes pulp (bar x = 0,06 mug/g), which allows the consumption of this fruit, since the peel is always discarded. The degradation product, formed in peels of mangoes in fruits treated in the pre and post harvest was the metabolite BIS 44596; for mangoes treated in the pre-post harvest the metabolite formed was the BIS 445186. Both metabolites were found in very low levels, confirming that occurs degradation of the fungicide in mangoes. In apples treated with the prochloraz, reduction of 500/0 in the levels. (author)

  8. Effect of Different Calcium Sources Application on Antioxidant, Enzymatic Activity and Qualitative Characteristics of Apple (Malus domestic)

    OpenAIRE

    MirHassan Rasouli-Sadaghiani; Mohammad Moghaddas Gerani; Sanaz Ashrafi Saeidlou; Ebrahim Sepehr

    2017-01-01

    In order to determine the effect of different Ca sources, in improving enzymatic activity and some qualitative properties of red apple (Malusdomestica) an experiment was carried out in a completely randomized design. Apple trees were sprayed 5 times with CaCl2, CaO, Ca-EDTA and Ca(NO3)2 salts with an interval of 20 days from late June until early October. After harvesting fruits were kept in cold storage at standard condition for 150 days. Nitrogen, phosphorus, potassium, calcium, magnesium, ...

  9. Characterization of Direct Current-Electrical Penetration Graph Waveforms and Correlation With the Probing Behavior of Matsumuratettix hiroglyphicus (Hemiptera: Cicadellidae), the Insect Vector of Sugarcane White Leaf Phytoplasma.

    Science.gov (United States)

    Roddee, J; Kobori, Y; Yorozuya, H; Hanboonsong, Y

    2017-06-01

    The leafhopper Matsumuratettix hiroglyphicus (Matsumura) (Hemiptera: Cicadellidae) is an important vector of phytoplasma causing white leaf disease in sugarcane. Thus, the aim of our study was to understand and describe the stylet-probing activities of this vector while feeding on sugarcane plants, by using direct current (DC) electrical penetration graph (EPG) monitoring. The EPG signals were classified into six distinct waveforms, according to amplitude, frequency, voltage level, and electrical origin of the observed traces during stylet penetration into the host plant tissues (probing). These six EPG waveforms of probing behavior comprise no stylet penetration (NP); stylet pathway through epidermis, mesophyll, and parenchymal cells (waveform A); contact at the bundle sheath layer (waveform B); salivation into phloem sieve elements (waveform C); phloem sap ingestion (waveform D); and short ingestion time of xylem sap (waveform E). The above waveform patterns were correlated with histological data of salivary sheath termini in plant tissue generated from insect stylet tips. The key findings of this study were that M. hiroglyphicus ingests the phloem sap at a relatively higher rate and for longer duration from any other cell type, suggesting that M. hiroglyphicus is mainly a phloem-feeder. Quantitative comparison of probing behavior revealed that females typically probe more frequently and longer in the phloem than males. Thus, females may acquire and inoculate greater amounts of phytoplasma than males, enhancing the efficiency of phytoplasma transmission and potentially exacerbating disease spreading. Overall, our study provides basic information on the probing behavior and transmission mechanism of M. hiroglyphicus. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  10. Vertical Distribution of Termites on Trees in Two Forest Landscapes in Taiwan.

    Science.gov (United States)

    Li, Hou-Feng; Yeh, Hsin-Ting; Chiu, Chun-I; Kuo, Chih-Yu; Tsai, Ming-Jer

    2016-03-25

    Termites are a key functional group in the forest ecosystem, but they damage trees. To investigate the termite infestation pattern on the whole tree, we cut 108 blackboard trees,Alstonia scholaris(L.) R. Br., and 50 Japanese cedars,Cryptomeria japonica (L. f.) D. Don, into sections. The bark surface and cross sections of the tree trunk were examined along the axes. A high percentage of blackboard trees (92.6%) was infested by fungus-growing termites,Odontotermes formosanus(Shiraki), but damage was limited to the bark surface at a 2-m height. The infestation rate of dampwood termites,Neotermes koshunensis(Shiraki), was only 4.6% (5/108), and all infestations were associated with trunk wounds.N. koshunensiswas found at significantly higher portion of a tree thanO. formosanus Among 50 Japanese cedars, 20 living trees were not infested by any termites, but 26 of the 30 dead trees were infested by subterranean termites,Reticulitermes flaviceps(Oshima), which excavated tunnels in the trunk. The infestation rate at basal sections was higher than that at distal sections. Only one Japanese cedar tree was infested by another dampwood termite,Glyptotermes satsumensis(Matsumura). The two dominant termite species,O. formosanusandR. flaviceps, had subterranean nests and infested trees from bottom up. The two primitive termitesN. koshunensis andG. satsumensishad low infestation rates and are most likely to infest trees by alates from top down. The niche segregation in trees of three termite families, Kalotermitidae, Rhinotermitidae, and Termitidae, was distinct. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Nutrient-Dependent Impact of Microbes on Drosophila suzukii Development

    Directory of Open Access Journals (Sweden)

    XiaoLi Bing

    2018-03-01

    Full Text Available Drosophila suzukii Matsumura is an invasive species of vinegar fly that has become a prominent pest of berries and other soft-skinned fruits. Unlike most other Drosophila species, female D. suzukii flies lay their eggs in ripening and ripe fruits and larvae develop within the fruit. To understand how D. suzukii larvae utilize ripe and ripening fruits, which usually have low levels of protein, we investigated the microbiota of field-captured and laboratory-reared D. suzukii flies and further examined the combined influence of diet and microbes on host fitness. Field-captured flies were associated with diverse microbiota, which varied significantly with sampling location and season. In contrast, laboratory-reared flies possessed strikingly lower bacterial abundance and diversity. A comparison of conventionally reared (CR and germ-free (GF flies revealed that the microbiota of D. suzukii does not alter its development significantly but decreases its life span under conditions of a nutrient-sufficient diet. However, the microbiota is essential for D. suzukii development on strawberry-based or blueberry-based fruit diets. This developmental failure could be rescued by reassociation with single bacterial or fungal species or by the addition of a high quantity of heat-killed microbes. In addition, we found that proteins are limiting with respect to fly development on fruit-based diets and that GF flies show signs of protein starvation. Taken together, our study results demonstrate that the microbiota provides key proteins required for the development of D. suzukii reared on fresh fruit. Our work shows that the impact of microbes on fly fitness depends strongly on nutritional conditions.

  12. Nutrient-Dependent Impact of Microbes on Drosophila suzukii Development

    Science.gov (United States)

    Bing, XiaoLi; Gerlach, Joseph; Loeb, Gregory

    2018-01-01

    ABSTRACT Drosophila suzukii Matsumura is an invasive species of vinegar fly that has become a prominent pest of berries and other soft-skinned fruits. Unlike most other Drosophila species, female D. suzukii flies lay their eggs in ripening and ripe fruits and larvae develop within the fruit. To understand how D. suzukii larvae utilize ripe and ripening fruits, which usually have low levels of protein, we investigated the microbiota of field-captured and laboratory-reared D. suzukii flies and further examined the combined influence of diet and microbes on host fitness. Field-captured flies were associated with diverse microbiota, which varied significantly with sampling location and season. In contrast, laboratory-reared flies possessed strikingly lower bacterial abundance and diversity. A comparison of conventionally reared (CR) and germ-free (GF) flies revealed that the microbiota of D. suzukii does not alter its development significantly but decreases its life span under conditions of a nutrient-sufficient diet. However, the microbiota is essential for D. suzukii development on strawberry-based or blueberry-based fruit diets. This developmental failure could be rescued by reassociation with single bacterial or fungal species or by the addition of a high quantity of heat-killed microbes. In addition, we found that proteins are limiting with respect to fly development on fruit-based diets and that GF flies show signs of protein starvation. Taken together, our study results demonstrate that the microbiota provides key proteins required for the development of D. suzukii reared on fresh fruit. Our work shows that the impact of microbes on fly fitness depends strongly on nutritional conditions. PMID:29559576

  13. Diurnal Activity of Drosophila suzukii (Diptera: Drosophilidae) in Highbush Blueberry and Behavioral Response to Irrigation and Application of Insecticides.

    Science.gov (United States)

    Van Timmeren, Steven; Horejsi, Logan; Larson, Shadi; Spink, Katherine; Fanning, Philip; Isaacs, Rufus

    2017-10-01

    Spotted wing Drosophila, Drosophila suzukii Matsumura (Diptera: Drosophilidae), is an invasive vinegar fly that has become a primary direct pest of berry crops worldwide. We conducted 2 yr of behavioral studies in blueberry plantings to determine how fly activity varied throughout the day. Observations of diurnal activity of adult D. suzukii found the greatest activity in the morning hours between 0600 and 0800 hours, when the majority of flies were on the berries. Flies were also active in the evening mainly between 1800 and 2000 hours; however, this trend was more prominent in 2015, which had cooler and more humid evenings. Experiments examining the effect of irrigation on D. suzukii behavior showed that flies remained active during and after irrigation. The effect of insecticide treatments alone and in combination with irrigation revealed that treatment with spinosad had limited effects on the number of flies per bush, whereas spinetoram reduced the number flying and on the bushes in some cases. Zeta-cypermethrin caused longer and more consistent reduction in D. suzukii flying and on bushes. In all treatments, we observed surviving flies flying near and on treated bushes, indicating that these insecticides do not completely deter fly activity. Irrigation did not influence the effects of zeta-cypermethrin on fly behavior during daily observations up to 3 d after application. Our results highlight that the diurnal patterns of activity of D. suzukii on host plants are flexible and are relatively unaffected by irrigation or insecticide applications. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  14. Reduction of CO2 emissions by influencing fuel prices

    International Nuclear Information System (INIS)

    Keller, M.; Zbinden, R.; Haan, P.; Gruetter, J.; Ott, W.

    2002-01-01

    The CO 2 law stipulates quantitative targets for CO 2 emissions (reductions of 10% by 2010 compared with 1990, 15% for heating fuels, 8% for motor fuels). For motor fuels, it is currently estimated that the target will be missed by about 15%, or 2 to 2.5 million tonnes of CO 2 . In order to reach the targets, therefore, all measures that can be taken to reduce emissions are to be checked out and, where sensible and possible, implemented too. The subject of this study is the preferential treatment of diesel, natural gas, liquefied gas and bio-fuels as far as taxation is concerned, with compensation of tax losses on the petrol side. Also, the possibilities for promoting energy-efficient cars are looked at. The reduction of the price for diesel (at least 25 Swiss cents when compensated for via the petrol price) is considered to be unsuitable for reaching the targets because, in the final analysis, fuel sales - the determining factor for the CO 2 emissions that are charged to Switzerland - will increase instead of decreasing. Also, reservations are expressed from the environmental point of view (increased NO x emissions and, in particular, emissions of particulate matter). The modified measure proposed (fixed difference between the prices for petrol and diesel of 25 Swiss cents, for example) is looked at less critically, because it does actually lead to a reduction of CO 2 , even if only a modest one (approx. 10% of the gap to be bridged). On the environmental side, the same reservations apply. Bonus-malus systems, on the other hand, permit a selective choice of the objects of promotion (efficient and, possibly, low-emission vehicles), avoid the unjust preferential treatment of goods traffic and can be implemented without disturbing international price structures (fuel tourism). A bonus-malus system applied at purchase (e.g. different levels of car taxation) is considered to be more efficient than a differentiation in vehicle (road) tax. The promotion of gas is a

  15. Thidiazuron effects on shoot growth, return bloom, fruit set and nutrition of apples Efeito do thidiazuron no crescimento, no florescimento, na frutificação e na nutrição em macieiras

    Directory of Open Access Journals (Sweden)

    Cassandro Vidal Talamini do Amarante

    2002-10-01

    Full Text Available Apple (Malus domestica Borkh. trees, cultivars Gala and Fuji, were sprayed at full bloom with thidiazuron (TDZ at doses of 0, 5, 10, or 20 g ha-1 of a.i. in order to evaluate its effects on plant growth and development, return bloom, fruit set, nutrition, and fruit yield. Fruit set increased with TDZ dose in 'Gala' but not in 'Fuji'. TDZ did not affect fruit yield in any cultivar. In 'Gala', the return bloom was reduced in about 50% at TDZ doses of 10 or 20 g ha-1. TDZ increased shoot growth in both cultivars. In leaves, TDZ decreased the concentration of Ca and Mg in 'Gala' and of Mg in 'Fuji', but did not affect the chlorophyll content, leaf area, length, width, and dry mass per cm² regardless of cultivar. In fruits, the effect of TDZ varied according to the portion evaluated. Highest doses of TDZ decreased the concentration of Ca and K in 'Gala' and of K in 'Fuji' in the entire fruits (flesh + skin; in the skin, highest doses of TDZ reduced the levels of N, Ca, and Mg in both cultivars, in addition to the level of K in 'Fuji'.Macieiras (Malus domestica Borkh., cultivares Gala e Fuji, foram pulverizadas na plena floração com thidiazuron (TDZ nas doses de 0, 5, 10 e 20 g ha-1 de ingrediente ativo com o objetivo de serem avaliadas quanto ao crescimento, florescimento, nutrição, frutificação e rendimento de frutos. A frutificação efetiva aumentou com a dose de TDZ na cultivar Gala, mas não na cultivar Fuji. Os tratamentos não afetaram o rendimento de frutos em nenhuma cultivar. Na cultivar Gala o florescimento no ano posterior ao da aplicação de TDZ foi reduzido em cerca de 50% nas doses de 10 e 20 g ha-1. O TDZ promoveu aumento no crescimento dos ramos do ano em ambas as cultivares. Nas folhas, o aumento nas doses de TDZ reduziu os teores de Ca e Mg na cultivar Gala, e de Mg na cultivar Fuji mas não afetou o conteúdo de clorofila, área, comprimento, diâmetro e massa seca cm-2 da folha, em ambas as cultivares. Em frutos inteiros

  16. Endophytic bacterial community living in roots of healthy and 'Candidatus Phytoplasma mali'-infected apple (Malus domestica, Borkh.) trees.

    Science.gov (United States)

    Bulgari, Daniela; Bozkurt, Adem I; Casati, Paola; Cağlayan, Kadriye; Quaglino, Fabio; Bianco, Piero A

    2012-11-01

    'Candidatus Phytoplasma mali', the causal agent of apple proliferation (AP) disease, is a quarantine pathogen controlled by chemical treatments against insect vectors and eradication of diseased plants. In accordance with the European Community guidelines, novel strategies should be developed for sustainable management of plant diseases by using resistance inducers (e.g. endophytes). A basic point for the success of this approach is the study of endophytic bacteria associated with plants. In the present work, endophytic bacteria living in healthy and 'Ca. Phytoplasma mali'-infected apple trees were described by cultivation-dependent and independent methods. 16S rDNA sequence analysis showed the presence of the groups Proteobacteria, Acidobacteria, Bacteroidetes, Actinobacteria, Chlamydiae, and Firmicutes. In detail, library analyses underscored 24 and 17 operational taxonomic units (OTUs) in healthy and infected roots, respectively, with a dominance of Betaproteobacteria. Moreover, differences in OTUs number and in CFU/g suggested that phytoplasmas could modify the composition of endophytic bacterial communities associated with infected plants. Intriguingly, the combination of culturing methods and cloning analysis allowed the identification of endophytic bacteria (e.g. Bacillus, Pseudomonas, and Burkholderia) that have been reported as biocontrol agents. Future research will investigate the capability of these bacteria to control 'Ca. Phytoplasma mali' in order to develop sustainable approaches for managing AP.

  17. Target metabolite and gene transcription profiling during the development of superficial scald in apple (Malus x domestica Borkh).

    Science.gov (United States)

    Busatto, Nicola; Farneti, Brian; Tadiello, Alice; Vrhovsek, Urska; Cappellin, Luca; Biasioli, Franco; Velasco, Riccardo; Costa, Guglielmo; Costa, Fabrizio

    2014-07-20

    Fruit quality features resulting from ripening processes need to be preserved throughout storage for economical reasons. However, during this period several physiological disorders can occur, of which superficial scald is one of the most important, due to the development of large brown areas on the fruit skin surface. This study examined the variation in polyphenolic content with the progress of superficial scald in apple, also with respect to 1-MCP, an ethylene competitor interacting with the hormone receptors and known to interfere with this etiology. The change in the accumulation of these metabolites was further correlated with the gene set involved in this pathway, together with two specific VOCs (Volatile Organic Compounds), α-farnesene and its oxidative form, 6-methyl-5-hepten-2-one. Metabolite profiling and qRT-PCR assay showed these volatiles are more heavily involved in the signalling system, while the browning coloration would seem to be due more to a specific accumulation of chlorogenic acid (as a consequence of the activation of MdPAL and MdC3H), and its further oxidation carried out by a polyphenol oxidase gene (MdPPO). In this physiological scenario, new evidence regarding the involvement of an anti-apoptotic regulatory mechanism for the compartmentation of this phenomenon in the skin alone was also hypothesized, as suggested by the expression profile of the MdDAD1, MdDND1 and MdLSD1 genes. The results presented in this work represent a step forward in understanding the physiological mechanisms of superficial scald in apple, shedding light on the regulation of the specific physiological cascade.

  18. The Phytoene synthase gene family of apple (Malus x domestica) and its role in controlling fruit carotenoid content.

    Science.gov (United States)

    Ampomah-Dwamena, Charles; Driedonks, Nicky; Lewis, David; Shumskaya, Maria; Chen, Xiuyin; Wurtzel, Eleanore T; Espley, Richard V; Allan, Andrew C

    2015-07-28

    Carotenoid compounds play essential roles in plants such as protecting the photosynthetic apparatus and in hormone signalling. Coloured carotenoids provide yellow, orange and red colour to plant tissues, as well as offering nutritional benefit to humans and animals. The enzyme phytoene synthase (PSY) catalyses the first committed step of the carotenoid biosynthetic pathway and has been associated with control of pathway flux. We characterised four PSY genes found in the apple genome to further understand their involvement in fruit carotenoid accumulation. The apple PSY gene family, containing six members, was predicted to have three functional members, PSY1, PSY2, and PSY4, based on translation of the predicted gene sequences and/or corresponding cDNAs. However, only PSY1 and PSY2 showed activity in a complementation assay. Protein localisation experiments revealed differential localization of the PSY proteins in chloroplasts; PSY1 and PSY2 localized to the thylakoid membranes, while PSY4 localized to plastoglobuli. Transcript levels in 'Granny Smith' and 'Royal Gala' apple cultivars showed PSY2 was most highly expressed in fruit and other vegetative tissues. We tested the transient activation of the apple PSY1 and PSY2 promoters and identified potential and differential regulation by AP2/ERF transcription factors, which suggested that the PSY genes are controlled by different transcriptional mechanisms. The first committed carotenoid pathway step in apple is controlled by MdPSY1 and MdPSY2, while MdPSY4 play little or no role in this respect. This has implications for apple breeding programmes where carotenoid enhancement is a target and would allow co-segregation with phenotypes to be tested during the development of new cultivars.

  19. Effect of bagging on fruit quantitative and qualitative characteristics of Fuji and Granny Smith apples (Malus domestica Borkh

    Directory of Open Access Journals (Sweden)

    Faezeh Fateminia

    2018-02-01

    Full Text Available Apple fruit color is determined by the amount of pigments in its peel which is directly affected by sunlight.  A method for improving apple fruit color is bagging. In present study, the effect of bagging and its optimum removing time was investigated on the amount of peel pigments and other fruit quantitative and qualitative characteristics for Fuji and Granny Smith apples. The experimental treatments were, no bag (control, debagging 7 and 14 days before harvest, and keeping the bag until harvest time. At the end of experiment, the amount of pigments, total soluble solids, titratable acidity, pulp phenol, peel phenol, antioxidants percentage, fruit weight and volume were measured. The results showed that in debagging 7 and 14 days before harvest treatments, the amount of anthocyanin and soluble solids statistically increased as compared with control; however other measured characteristics were significantly reduced in both apple cultivars. The maximum amount of fruit anthocyanin (60.96 mg/g fresh weight belonged to Fuji cultivar in 14 days treatment and the least amount of fruit anthocyanin (1.64 mg/g fresh weight belonged to Granny Smith cultivar in zero-day treatment. The highest amount of fruit chlorophyll a (5.09µgr/lit was observed in control fruit and the lowest amount of fruit chlorophyll a (3.94 µgr/lit was observed in 14 days treatment. The decrease of chlorophyll amount is a positive characteristic for the Fuji and a negative one for Granny Smith. Therefore, bagging and 14 days before harvest debagging treatment increased the amount of anthocyanin and decreased chlorophyll which resulted in Fuji cultivar better coloring and reducing the green color quality of Granny Smith cultivar.

  20. Changes in primary metabolites and polyphenols in the peel of "Braeburn" apples (Malus domestica Borkh.) during advanced maturation.

    Science.gov (United States)

    Bizjak, Jan; Mikulic-Petkovsek, Maja; Stampar, Franci; Veberic, Robert

    2013-10-30

    During the two growing seasons the evolution of primary metabolites and wide range of polyphenols in the "Braeburn" apple peel during advanced maturation were investigated. During the five weeks sucrose significantly increased, whereas fructose and glucose fluctuated around the same level in one season and decreased in another. Regarding malic and citric acids, an expected decrease was recorded. The concentrations of hydroxycinnamic acids, dihydrochalcones, and flavanols remained quite constant or slightly decreased during advanced apple ripening. On the contrary an intensive accumulation of quercetin glycosides and anthocyanins took place during this period, starting with the onset of rapid formation approximately 3 weeks before the technological maturity of apples. Total phenolic content was relatively constant or slightly increased. The present results suggest that measures designed to improve the apple color and quality of "Braeburn" apples should be performed approximately 3-4 weeks before the expected technological maturity of apples.

  1. Maturity and storage influence on the apple (Malus domestica) allergen Mal d 3, a nonspecific lipid transfer protein

    NARCIS (Netherlands)

    Sancho, Ana I.; Foxall, Robert; Rigby, Neil M.; Browne, Thomas; Zuidmeer, Laurian; van Ree, Ronald; Waldron, Keith W.; Mills, E. N. Clare

    2006-01-01

    Consumption of apples can provoke severe allergic reactions, in susceptible individuals, due to the presence of the allergen Mal d 3, a nonspecific lipid transfer protein, found largely in the fruit skin. Levels of Mal d 3 were determined in peel as a function of apple cultivar, position of the

  2. Effects of Exogenous Melatonin on Methyl Viologen-Mediated Oxidative Stress in Apple Leaf

    Directory of Open Access Journals (Sweden)

    Zhiwei Wei

    2018-01-01

    Full Text Available Oxidative stress is a major source of damage of plants exposed to adverse environments. We examined the effect of exogenous melatonin (MT in limiting of oxidative stress caused by methyl viologen (MV; paraquatin in apple leaves (Malus domestica Borkh.. When detached leaves were pre-treated with melatonin, their level of stress tolerance increased. Under MV treatment, melatonin effectively alleviated the decrease in chlorophyll concentrations and maximum potential Photosystem II efficiency while also mitigating membrane damage and lipid peroxidation when compared with control leaves that were sprayed only with water prior to the stress experiment. The melatonin-treated leaves also showed higher activities and transcripts of antioxidant enzymes superoxide dismutase, peroxidase, and catalase. In addition, the expression of genes for those enzymes was upregulated. Melatonin-synthesis genes MdTDC1, MdT5H4, MdAANAT2, and MdASMT1 were also upregulated under oxidative stress in leaves but that expression was suppressed in response to 1 mM melatonin pretreatment during the MV treatments. Therefore, we conclude that exogenous melatonin mitigates the detrimental effects of oxidative stress, perhaps by slowing the decline in chlorophyll concentrations, moderating membrane damage and lipid peroxidation, increasing the activities of antioxidant enzymes, and changing the expression of genes for melatonin synthesis.

  3. The small ubiquitin-like modifier E3 ligase MdSIZ1 promotes anthocyanin accumulation by sumoylating MdMYB1 under low-temperature conditions in apple.

    Science.gov (United States)

    Zhou, Li-Jie; Li, Yuan-Yuan; Zhang, Rui-Fen; Zhang, Chun-Ling; Xie, Xing-Bin; Zhao, Cheng; Hao, Yu-Jin

    2017-10-01

    MdMYB1 acts as a crucial component of the MYB-bHLH-WD40 complex to regulate anthocyanin biosynthesis in red-skinned apples (Malus domestica), but little is known about its post-translational regulation. Here, a small ubiquitin-like modifier E3 ligase MdSIZ1 was screened out as an MdMYB1-interacting protein with a yeast two-hybridization approach. The interaction between MdSIZ1 and MdMYB1 was further verified with pull-down and CoIP assays. Furthermore, it was found that MdSIZ1 directly sumoylated MdMYB1 proteins in vivo and in vitro, especially under moderately low temperature (17 °C) conditions, and that this sumoylation was required for MdMYB1 protein stability. Moreover, the transcription level of MdSIZ1 gene was remarkably induced by low temperature and phosphorus deficiency, and MdSIZ1 overexpression exerted a large positive influence on anthocyanin accumulation and red fruit coloration, suggesting its important role in the regulation of anthocyanin biosynthesis under stress conditions. Our findings reveal an important role for a small ubiquitin-like modifier modification of MYB transcription factors in regulation of anthocyanin biosynthesis in plants. © 2017 John Wiley & Sons Ltd.

  4. Woody vegetation, fuel and fire track the melting of the Scandinavian ice-sheet before 9500 cal yr BP

    Science.gov (United States)

    Carcaillet, Christopher; Hörnberg, Greger; Zackrisson, Olle

    2012-11-01

    New studies indicate the presence of early Holocene ice-free areas far north in Scandinavia. Post-glacial fire and vegetation were investigated based on sedimentary charcoal and pollen from two small lakes in northern Sweden. Accumulation of organic sediment started around 10,900 and 9200 cal yr BP, showing that both lake valleys were ice-free extremely early given their northerly location. Fire events started after 9600 cal yr BP and became less common around the '8.2-ka event'. Woody vegetation provided fuel that contributed to fires. The first vegetation in our pollen record consisted of Hippophae, Dryas, grasses and sedges. Subsequently broadleaved trees (Betula, Salix) increased in abundance and later Pinus, Alnus, ferns and Lycopodium characterized the vegetation. Pollen from Larix, Picea and Malus were also found. The change in vegetation composition was synchronous with the decrease in lake-water pH in the region, indicating ecosystem-scale processes; this occurred during a period of net global and regional warming. The changes in fire frequency and vegetation appear independent of regional trends in precipitation. The reconstructed fire history and vegetation support the scenario of early ice-free areas far north in Scandinavia during early Holocene warming, creating favorable conditions for woody plants and wildfires.

  5. Le Service Accueil et Contrôle d'Accès

    CERN Document Server

    Ducastel, C

    1999-01-01

    L'utilisateur qui vient au CERN pour la première fois, est accueilli généralement par les membres du service 'Accueil et Contrôle d'Accès'. Cet utilisateur sera tout d'abord orienté vers un des postes d'hôtesses d'accueil en charge de l'enregistrement et de la délivrance de cartes CERN. Les informations seront saisies et immédiatement disponibles et transmises, via le système AMS, aux équipements de contrôle d'accès et à la Centrale de Surveillance des accès, chargée de la supervision de tout le dispositif de contrôle d'accès au domaine. Ces contrôles aux entrées et accueil des visiteurs individuels sont complétés par des missions de surveillance à l'intérieur du Domaine pour les agents, et par des travaux de gestions de dossiers administratifs (service enregistrement) pour les hôtesses. Un contrat commun assure une uniformité de formation des agents et hôtesses. Ce contrat est assorti d'une clause de Bonus Malus afin de tendre vers une optimisation des performances.

  6. Genome-wide identification and characterization of WRKY transcriptional factor family in apple and analysis of their responses to waterlogging and drought stress.

    Science.gov (United States)

    Meng, Dong; Li, Yuanyuan; Bai, Yang; Li, Mingjun; Cheng, Lailiang

    2016-06-01

    As one of the largest transcriptional factor families in plants, WRKY genes play significant roles in various biotic and abiotic stress responses. Although the WRKY gene family has been characterized in a few plant species, the details remain largely unknown in the apple (Malus domestica Borkh.). In this study, we identified a total of 127 MdWRKYs from the apple genome, which were divided into four subgroups according to the WRKY domains and zinc finger motif. Most of them were mapped onto the apple's 17 chromosomes and were expressed in more than one tissue, including shoot tips, mature leaves, fruit and apple calli. We then contrasted WRKY expression patterns between calli grown in solid medium (control) and liquid medium (representing waterlogging stress) and found that 34 WRKY genes were differentially expressed between the two growing conditions. Finally, we determined the expression patterns of 10 selected WRKY genes in an apple rootstock, G41, in response to waterlogging and drought stress, which identified candidate genes involved in responses to water stress for functional analysis. Our data provide interesting candidate MdWRKYs for future functional analysis and demonstrate that apple callus is a useful system for characterizing gene expression and function in apple. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  7. An apple plus a Brazil nut a day keeps the doctors away: antioxidant capacity of foods and their health benefits.

    Science.gov (United States)

    Ferrari, Carlos Kusano Bucalen; Percário, Sandro; Silva, José Carlos Costa Baptista; da Silva Torres, Elizabeth Aparecida Ferraz

    2016-01-01

    Antioxidant-rich foods scavenge free radicals and other reactive species, decreasing the risk of different non-communicable chronic diseases. The objective of this study was to review the content of total antioxidant capacity of commonly foods comparing with experimental data and to explore the health benefits due to foods with moderate to high TAC. The TAC was analytically measured using the "Total Antioxidant Capacity" (NX2332) test from Randox® (UK) by spectrometry at 600 nm. Brazil nut (Bertholletia excelsa), "guaraná" (Paullinia cupana Kunth) powder, ready to drink boiled coffee (Coffea arabica L.), and milk chocolate (made from seeds of Theobroma cacao) had the highest TAC values, followed by collard greens (Brassica oleracea L.), beets (Beta vulgaris L.), apples (Malus domestica Borkh.), bananas (Musa paradisiaca), common beans (Phaseolus vulgaris), oranges (Citrus sinensis (L.) Osbeck), onions (Allium cepa L.), and lettuce (Lactuca sativa L.). Other foods also showed antioxidant capacity. The binomial antioxidant capacity of foods and health was extensively discussed according to science literature. Based on the high TAC content of Brazil nuts, guaraná, coffee, chocolate, collard greens, apples, beets, beans, oranges, onions and other foods, their regular dietary intake is strongly recommended to reduce the risk of chronic non-communicable diseases.

  8. Padrão de Nidificação de Monobia angulosa Saussure (Vespidae Durante Estação Seca Prolongada na Região da Chapada Diamantina, Bahia, com Notas Sobre Nidificação em Ninho Abandonado de Xylocopa cearensis Ducke (Apidae

    Directory of Open Access Journals (Sweden)

    Thiago Mahlmann

    2015-03-01

    Abstract. Weather can be treated as an important factor in the nesting pattern of several solitary wasps species. Nesting pattern of wasp Monobia angulosa Saussure (Vespidae: Eumeninae was accessed in present study in the agricultural area of Mucugê-Ibicoara, Chapada Diamantina, Bahia, during an extended period of dry season. In here we also presented the first record of a natural nest in pre-existing cavities prior used by Xylocopa (Neoxylocopa cearensis Ducke (Apidae: Xylocopinae. For a description of the M. angulosa’s natural nest a single nest found in apple orchard (Malus domestica Borkh was used. For the nesting pattern study we used the trap nests technique with 25 points along the agricultural sampled area; traps were placed in remaining native vegetation. Each sample point was at least 4 km apart. Emerged in the laboratory a total of 19 females and 23 males for a total of 19 established nests, males emerged prior females. Unlike the horizontal trap nests, the natural one was built in vertical linear series and a wooden stake was used as a substrate. Nesting concentrated in the warmer months, between February and April, 2012, with very low precipitation, evidencing influence on nesting pattern of this species, probably due fast response to climatic changes.

  9. Effect of anthocyanins, carotenoids, and flavonols on chlorophyll fluorescence excitation spectra in apple fruit: signature analysis, assessment, modelling, and relevance to photoprotection.

    Science.gov (United States)

    Merzlyak, Mark N; Melø, Thor Bernt; Naqvi, K Razi

    2008-01-01

    Whole apple fruit (Malus domestica Borkh.) widely differing in pigment content and composition has been examined by recording its chlorophyll fluorescence excitation and diffuse reflection spectra in the visible and near UV regions. Spectral bands sensitive to the pigment concentration have been identified, and linear models for non-destructive assessment of anthocyanins, carotenoids, and flavonols via chlorophyll fluorescence measurements are put forward. The adaptation of apple fruit to high light stress involves accumulation of these protective pigments, which absorb solar radiation in broad spectral ranges extending from UV to the green and, in anthocyanin-containing cultivars, to the red regions of the spectrum. In ripening apples the protective effect in the blue region could be attributed to extrathylakoid carotenoids. A simple model, which allows the simulation of chlorophyll fluorescence excitation spectra in the visible range and a quantitative evaluation of competitive absorption by anthocyanins, carotenoids, and flavonols, is described. Evidence is presented to support the view that anthocyanins, carotenoids, and flavonols play, in fruit with low-to-moderate pigment content, the role of internal traps (insofar as they compete with chlorophylls for the absorption of incident light in specific spectral bands), affecting thereby the shape of the chlorophyll fluorescence excitation spectrum.

  10. Oriented Growth of α-MnO2 Nanorods Using Natural Extracts from Grape Stems and Apple Peels

    Directory of Open Access Journals (Sweden)

    Lina Sanchez-Botero

    2017-05-01

    Full Text Available We report on the synthesis of alpha manganese dioxide (α-MnO2 nanorods using natural extracts from Vitis vinifera grape stems and Malus domestica ‘Cortland’ apple peels. We used a two-step method to produce highly crystalline α-MnO2 nanorods: (1 reduction of KMnO4 in the presence of natural extracts to initiate the nucleation process; and (2 a thermal treatment to enable further solid-state growth of the nuclei. Transmission electron microscopy (TEM and field emission scanning electron microscopy (FESEM images provided direct evidence of the morphology of the nanorods and these images were used to propose nucleation and growth mechanisms. We found that the α-MnO2 nanorods synthesized using natural extracts exhibit structural and magnetic properties similar to those of nanoparticles synthesized via traditional chemical routes. Furthermore, Fourier transform infrared (FTIR shows that the particle growth of the α-MnO2 nanorods appears to be controlled by the presence of natural capping agents during the thermal treatment. We also evaluated the catalytic activity of the nanorods in the degradation of aqueous solutions of indigo carmine dye, highlighting the potential use of these materials to clean dye-polluted water.

  11. Multiple models for Rosaceae genomics.

    Science.gov (United States)

    Shulaev, Vladimir; Korban, Schuyler S; Sosinski, Bryon; Abbott, Albert G; Aldwinckle, Herb S; Folta, Kevin M; Iezzoni, Amy; Main, Dorrie; Arús, Pere; Dandekar, Abhaya M; Lewers, Kim; Brown, Susan K; Davis, Thomas M; Gardiner, Susan E; Potter, Daniel; Veilleux, Richard E

    2008-07-01

    The plant family Rosaceae consists of over 100 genera and 3,000 species that include many important fruit, nut, ornamental, and wood crops. Members of this family provide high-value nutritional foods and contribute desirable aesthetic and industrial products. Most rosaceous crops have been enhanced by human intervention through sexual hybridization, asexual propagation, and genetic improvement since ancient times, 4,000 to 5,000 B.C. Modern breeding programs have contributed to the selection and release of numerous cultivars having significant economic impact on the U.S. and world markets. In recent years, the Rosaceae community, both in the United States and internationally, has benefited from newfound organization and collaboration that have hastened progress in developing genetic and genomic resources for representative crops such as apple (Malus spp.), peach (Prunus spp.), and strawberry (Fragaria spp.). These resources, including expressed sequence tags, bacterial artificial chromosome libraries, physical and genetic maps, and molecular markers, combined with genetic transformation protocols and bioinformatics tools, have rendered various rosaceous crops highly amenable to comparative and functional genomics studies. This report serves as a synopsis of the resources and initiatives of the Rosaceae community, recent developments in Rosaceae genomics, and plans to apply newly accumulated knowledge and resources toward breeding and crop improvement.

  12. Multiple Models for Rosaceae Genomics[OA

    Science.gov (United States)

    Shulaev, Vladimir; Korban, Schuyler S.; Sosinski, Bryon; Abbott, Albert G.; Aldwinckle, Herb S.; Folta, Kevin M.; Iezzoni, Amy; Main, Dorrie; Arús, Pere; Dandekar, Abhaya M.; Lewers, Kim; Brown, Susan K.; Davis, Thomas M.; Gardiner, Susan E.; Potter, Daniel; Veilleux, Richard E.

    2008-01-01

    The plant family Rosaceae consists of over 100 genera and 3,000 species that include many important fruit, nut, ornamental, and wood crops. Members of this family provide high-value nutritional foods and contribute desirable aesthetic and industrial products. Most rosaceous crops have been enhanced by human intervention through sexual hybridization, asexual propagation, and genetic improvement since ancient times, 4,000 to 5,000 B.C. Modern breeding programs have contributed to the selection and release of numerous cultivars having significant economic impact on the U.S. and world markets. In recent years, the Rosaceae community, both in the United States and internationally, has benefited from newfound organization and collaboration that have hastened progress in developing genetic and genomic resources for representative crops such as apple (Malus spp.), peach (Prunus spp.), and strawberry (Fragaria spp.). These resources, including expressed sequence tags, bacterial artificial chromosome libraries, physical and genetic maps, and molecular markers, combined with genetic transformation protocols and bioinformatics tools, have rendered various rosaceous crops highly amenable to comparative and functional genomics studies. This report serves as a synopsis of the resources and initiatives of the Rosaceae community, recent developments in Rosaceae genomics, and plans to apply newly accumulated knowledge and resources toward breeding and crop improvement. PMID:18487361

  13. Apple Polyphenol Suppresses Indomethacin-Induced Gastric Damage in Experimental Animals by Lowering Oxidative Stress Status and Modulating the MAPK Signaling Pathway.

    Science.gov (United States)

    Lee, Yi-Chen; Cheng, Chun-Wen; Lee, Huei-Jane; Chu, Huei-Chuien

    2017-11-01

    Indomethacin is a nonsteroid anti-inflammatory drug (NSAID) that is used to alleviate pain and inflammation in clinical medicine. Previous studies indicated that NSAIDs can cause gastrointestinal mucosal complications, and it is associated with mucosal lipid peroxidation and oxidative damage. Based on the evidences, decreasing oxidative stress may be an ideal therapeutic strategy for preventing gastrointestinal ulcer. Apple (Rosaceae Malus sp.) is one of the most commonly consumed fruits worldwide. The abundant polyphenolic constituents have received increasing attention for decades. In both in vivo and in vitro studies, the reports showed that apple polyphenol (AP) seems to provide an indirect antioxidant protection by activating cellular antioxidant enzymes to defend against oxidative stress. To address this issue and develop AP into a healthy improvement supplement, we studied the effect and potential mechanisms of AP in indomethacin-treated animal. The results showed AP can decelerate the gastric lesion, significantly suppress lipid peroxidation, increase the level of glutathione and the activity of catalase, and regulate the MAPK signaling proteins. These findings imply that AP protects the gastric mucosa from indomethacin-caused lesions and the protection is at least partially attributable to its antioxidative properties. This alternative medical function of AP may be a safe and effective intervention for preventing indomethacin-induced gastric complications.

  14. Evaluation of the effect of clinostat rotation on pollen germination and tube development as a tool for selection of plants in Space

    Science.gov (United States)

    De Micco, Veronica; Scala, Michele; Aronne, Giovanna

    2006-05-01

    The choice of species and cultivar on which rely to sustain Close Loop Environmental Systems is generally approached by analysing the behaviour of plants in presence of stress (sporophytic selection). In this paper, we investigated the possibility to conduct the selection among genotypes in Space through the male gametophytic selection. Thus, we studied the effect of simulated microgravity on pollen germination and tube development of both woody and herbaceous crop species: Prunus armeniaca (apricot), P. dulcis (almond), Malus domestica (apple) and Vicia faba (broad bean). Pollen collected from just bloomed flowers was assessed for viability and incubated on the optimal growing medium in petri dishes both on a uni-axial clinostat and stationary in 1g. Then, pollen was observed under a light microscope to detect percent germination and growth direction. Histochemical analyses were performed to verify the presence and distribution of storage substances. Moreover, specific stainings and epifluorescent microscopy were applied to count nuclei, follow the migration of sperm cells and investigate the presence, size and morphology of callose plugs. Results showed that simulated microgravity affected pollen tube development. The different response showed by the various species indicates that male-gametophytic selection could be useful for the selection of plants in microgravity.

  15. Fabrication, characterization and application of pectin degrading Fe{sub 3}O{sub 4}–SiO{sub 2} nanobiocatalyst

    Energy Technology Data Exchange (ETDEWEB)

    Seenuvasan, Muthulingam; Malar, Carlin Geor; Preethi, Sridhar; Balaji, Nagarajan; Iyyappan, Jeyaraj; Kumar, Madhava Anil [Department of Biotechnology, Madha Engineering College, Chennai (India); Kumar, Kannaiyan Sathish, E-mail: sathishkannaiyan.k@gmail.com [Department of Chemical Engineering, SSN College of Engineering, Chennai (India)

    2013-05-01

    The covalent binding of pectinase onto amino functionalized silica-coated magnetic nanoparticles (CSMNPs) through glutaraldehyde activation was investigated for nanobiocatalyst fabrication. The average particle size and morphology of the nanoparticles were characterized using transmission electron microscopy (TEM). The statistical analysis for TEM image suggests that the coating and binding process did not cause any significant change in size of MNPs. The morphological and phase change of the magnetic nanoparticles (MNPs) after various coatings and immobilization were characterized by X-ray diffraction (XRD) studies. The various surface modifications and pectinase binding onto nanoparticles were confirmed by Fourier transform infrared (FT-IR) spectroscopy. The maximum activity of immobilized pectinase was obtained at its weight ratio of 19.0 × 10{sup −3} mg bound pectinase/mg CSMNPs. The pH, temperature, reusability, storage ability and kinetic studies were established to monitor their improved stability and activity of the fabricated nanobiocatalyst. Furthermore, the application was extended in the clarification of Malus domestica juice. Highlights: ► Nanobiocatalyst was fabricated for the degradation of pectin. ► The enhancement in stability was studied for fabricated nanobiocatalyst. ► Analytical techniques like TEM, XRD and FT-IR were used. ► The apple juice was clarified using fabricated nanobiocatalyst.

  16. Development, oviposition, and mortality of Neoseiulus fallacis (Acari: Phytoseiidae) in response to reduced-risk insecticides.

    Science.gov (United States)

    Villanueva, Raul T; Walgenbach, James F

    2005-12-01

    Eight reduced-risk insecticides (acetamiprid, thiamethoxam, imidacloprid, thiacloprid, methoxyfenozide, pyriproxyfen, indoxacarb, and spinosad) and three conventional insecticides (azinphosmethyl, fenpropathrin, and esfenvalerate) were tested against Neoseiulus fallacis (Garman) (Acari: Phytoseiidae), the most abundant predacious mite in North Carolina apple (Malus spp.) orchards. To assess the effect of insecticides on development and mortality of N. fallacis immatures, 12-h-old eggs were individually placed on bean leaf disks previously dipped in insecticide solutions. Tetranychus urticae Koch (Acari: Tetranychidae) females were added as a food source. None of the reduced-risk insecticides significantly affected immature N. fallacis compared with the control; however, the pyrethroids esfenvalerate and fenpropathrin were highly toxic to immatures. To evaluate the effect of insecticides on mortality and oviposition of adult N. fallacis, 7- to 8-d-old females were confined on insecticide-treated bean leaves with Malephora crocea (Aizoaceae) pollen added as a food source. Spinosad resulted in the highest mortality, whereas azinphosmethyl, acetamiprid, fenpropathrin, and imidacloprid were moderately toxic, and mortality from esfenvalerate, indoxacarb, thiacloprid, methoxyfenozide, pyriproxyfen, and thiamethoxam did not differ significantly from the control. Oviposition was affected in a similar manner, with the exception of acetamiprid that did not affect oviposition, and thiamethoxam that reduced oviposition.

  17. On the species status of the root-knot nematode Meloidogyne ulmi Palmisano & Ambrogioni, 2000 (Nematoda, Meloidogynidae

    Directory of Open Access Journals (Sweden)

    Mohammed Ahmed

    2013-12-01

    Full Text Available The root-knot nematode Meloidogyne ulmi is synonymised with Meloidogyne mali based on morphological and morphometric similarities, common hosts, as well as biochemical similarities at both protein and DNA levels. M. mali was first described in Japan on Malus prunifolia Borkh.; and M. ulmi in Italy on Ulmus chenmoui W.C. Cheng. Morphological and morphometric studies of their holo- and paratypes revealed important similarities in the major characters as well as some general variability in a few others. Host test also showed that besides the two species being able to parasitize the type hosts of the other, they share some other common hosts. Our study of the esterase and malate dehydrogenase isozyme phenotypes of some M. ulmi populations gave a perfectly comparable result to that already known for M. mali. Finally, phylogenetic studies of their SSU and LSU rDNA sequence data revealed that the two are not distinguishable at DNA level. All these put together, leave strong evidences to support the fact that M. ulmi is not a valid species, but a junior synonym of M. mali. Brief discussion on the biology and life cycle of M. mali is given. An overview of all known hosts and the possible distribution of M. mali in Europe are also presented.

  18. Comparative genomics of 12 strains of Erwinia amylovora identifies a pan-genome with a large conserved core.

    Directory of Open Access Journals (Sweden)

    Rachel A Mann

    Full Text Available The plant pathogen Erwinia amylovora can be divided into two host-specific groupings; strains infecting a broad range of hosts within the Rosaceae subfamily Spiraeoideae (e.g., Malus, Pyrus, Crataegus, Sorbus and strains infecting Rubus (raspberries and blackberries. Comparative genomic analysis of 12 strains representing distinct populations (e.g., geographic, temporal, host origin of E. amylovora was used to describe the pan-genome of this major pathogen. The pan-genome contains 5751 coding sequences and is highly conserved relative to other phytopathogenic bacteria comprising on average 89% conserved, core genes. The chromosomes of Spiraeoideae-infecting strains were highly homogeneous, while greater genetic diversity was observed between Spiraeoideae- and Rubus-infecting strains (and among individual Rubus-infecting strains, the majority of which was attributed to variable genomic islands. Based on genomic distance scores and phylogenetic analysis, the Rubus-infecting strain ATCC BAA-2158 was genetically more closely related to the Spiraeoideae-infecting strains of E. amylovora than it was to the other Rubus-infecting strains. Analysis of the accessory genomes of Spiraeoideae- and Rubus-infecting strains has identified putative host-specific determinants including variation in the effector protein HopX1(Ea and a putative secondary metabolite pathway only present in Rubus-infecting strains.

  19. Habitat affinity of resident natural enemies of the invasive Aphis glycines (Hemiptera: Aphididae), on soybean, with comments on biological control.

    Science.gov (United States)

    Brewer, Michael J; Noma, Takuji

    2010-06-01

    We integrated a natural enemy survey of the broader landscape into a more traditional survey for Aphis glycines Matsumura (Hemiptera: Aphididae), parasitoids and predatory flies on soybean using A. glycines-infested soybean, Glycine max (L.) Merr., placed in cropped and noncropped plant systems to complement visual field observations. Across three sites and 5 yr, 18 parasitoids and predatory flies in total (Hymenoptera: Aphelinidae [two species] and Bracondae [seven species], Diptera: Cecidomyiidae [one species], Syrphidae [seven species], Chamaemyiidae [one species]) were detected, with significant variability in recoveries detected across plant system treatments and strong contrasts in habitat affinity detected among species. Lysiphlebus testaceipes Cresson was the most frequently detected parasitoid, and no differences in abundance were detected in cropped (soybean, wheat [Triticum aestivum L.], corn [Zea mays L.], and alfalfa [Medicago sativa L.]) and noncropped (poplar [Populus euramericana (Dode) Guinier] and early successional vegetation) areas. In contrast, Binodoxys kelloggensis Pike, Starý & Brewer had strong habitat affinity for poplar and early successional vegetation. The low recoveries seasonally and across habitats of Aphelinus asychis Walker, Aphelinus sp., and Aphidius colemoni Viereck make their suitability to A. glycines on soybean highly suspect. The widespread occurrence of many of the flies reflects their broad habitat affinity and host aphid ranges. The consistent low field observations of parasitism and predation suggest that resident parasitoids and predatory flies are unlikely to contribute substantially to A. glycines suppression, at least during the conventional time period early in the pest invasion when classical biological control activities are considered. For selected species that were relatively well represented across plant systems (i.e., L. testaceipes and Aphidoletes aphidimyza Rondani), conservation biological control efforts

  20. First record of spotted wing drosophila Drosophila suzukii (Diptera: Drosophilidae in Montenegro

    Directory of Open Access Journals (Sweden)

    Snježana Hrnčić

    2015-01-01

    Full Text Available The spotted wing drosophila Drosophila suzukii Matsumura (Diptera: Drosophilidae is an invasive pest originating from Southeast Asia. It was detected for the first time in Europe in 2008 (Spain and Italy and subsequently in other European countries. It is a highly polyphagous pest that infests healthy, ripening fruit and presents a serious threat to fruit production, particularly of soft skinned fruit. In the first half of October 2013, a new fruit fly species was unexpectedly detected in Tephri traps baited with the three-component female-biased attractant BioLure that is regularly used for monitoring the Mediterranean fruit fly Ceratitis capitata Wiedem. (Diptera: Tephritidae in Montenegro. Brief visual inspection identified the new species as the spotted wing drosophila D. suzukii. The pest was first recorded in several localities on the Montenegrin seacoast around Boka Kotor Bay. After the finding, all Drosophila specimens were collected from traps for further laboratory observation. A quick follow-up monitoring of other Tephri traps was carried out within the next few days on the rest of the seacoast (localities from Tivat to Ulcinj. Additionally, Tephri traps were set up around Lake Skadar and in the city of Podgorica, as well as on fresh fruit markets in Podgorica. The results of this preliminary study showed that D. suzukii was present in all surveyed locations and adults were captured until late December. Both sexes were found in traps with BioLure. Our data show that D. suzukii is present in southern parts of Montenegro and there is a serious threat of its further spreading, particularly towards northern parts of the country where the main raspberry and blueberry production is placed. The results also show that Tephri traps baited with BioLure can be used for detection and monitoring of spotted wing drosophila.