WorldWideScience

Sample records for malus domestica orchard

  1. Using multilevel systematic sampling to study apple fruit (Malus domestica Borkh.) quality and its variability at the orchard scale

    DEFF Research Database (Denmark)

    Martínez Vega, Mabel V.; Wulfsohn, Dvoralai; Clemmensen, Line Katrine Harder

    2013-01-01

    sample of ‘Granny Smith’ (Malus x domestica cv. ‘Granny Smith’) apples obtained from a 17 ha orchard based on a final sample of 74 fruit. Estimates of fruit marketable yield and fruit size distribution agreed well with packing house records. The estimated marketable yield was 356.6 ± 89.2 t compared...... recommended sample sizes to accurately describe the distribution of various quality variables of apples at the orchard scale....

  2. The Occurrence of the Cicada Cicadatra persica on Apple Trees, Malus domestica, in Erneh, Syria

    Science.gov (United States)

    Dardar, Marah A.; Belal, Hamzeh M.R.; Basheer, Abedlnabi M.

    2013-01-01

    An infestation of Cicadatra persica KirKaldy (Hemiptera: Cicadidae) on apple trees, Malus domestica Borkhausen (Rosales: Rosaceae), was reported for the first time in the apple fruit orchards of Erneh, Syria. Nymphs, adults, exuvia, and exit holes in the soil were observed. The species was identified as C. persica based on morphological characters. Some biological observations and an acoustic analysis of the male's songs were also achieved. PMID:23909877

  3. Differential dependence of apple ( Malus domestica Borkh.) cultivars ...

    African Journals Online (AJOL)

    Golden Delicious' and 'Topred' apple (Malus domestica Borkh.) peel on the xanthophyll cycle for photoprotection was studied under laboratory conditions. Mature fruit peel was either treated with 1 mm dithiothreitol (DTT) to inhibit the ...

  4. Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study

    OpenAIRE

    Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

    2018-01-01

    RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an...

  5. Genetic variability in apple fruit polyphenol composition in Malus × domestica and Malus sieversii germplasm grown in New Zealand.

    Science.gov (United States)

    Volz, Richard K; McGhie, Tony K

    2011-11-09

    Variations in the concentrations of flavan-3-ol, oligomeric procyanidin, chlorogenic acid, dihydrochalcone, flavonol, and anthocyanin polyphenol groups and total polyphenols were examined in the fruit peel and cortical flesh of 93 (80 Malus × domestica and 13 Malus sieversii) apple genotypes in at least 1 year between 2003 and 2005 grown at one site in New Zealand (NZ). Differences among genotypes accounted for 46-97% of the total variation in the concentrations of total polyphenols and each of the individual phenol groups in the flesh and peel in both species, whereas effects of year and genotype × year were minimal, except for peel flavonols in M. × domestica and flesh flavonols in both species. In these cases, differences among genotypes accounted for less than 30% of the total variation, which was less than the variation found for the interaction between genotype and year. Total polyphenol concentrations among genotypes were spread over a 7- and 9-fold range in the flesh and a 4- and 3-fold range in the peel of M. sieversii and M. × domestica, respectively, with the spread in concentrations of individual polyphenol groups in each tissue and within each species varying from a 2-fold to over a 500-fold range. Higher concentrations were generally found in M. sieversii. In M. × domestica, cultivars and breeding selections originating in NZ had lower average flesh and peel total polyphenols and chlorogenic acid than older cultivars previously imported into NZ from overseas countries.

  6. Phytohormone Interaction Modulating Fruit Responses to Photooxidative and Heat Stress on Apple (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Carolina A. Torres

    2017-12-01

    Full Text Available Sun-related physiological disorders such as sun damage on apples (Malus domestica Borkh are caused by cumulative photooxidative and heat stress during their growing season triggering morphological, physiological, and biochemical changes in fruit tissues not only while it is on the tree but also after it has been harvested. The objective of the work was to establish the interaction of auxin (indole-3-acetic acid; IAA, abscisic acid (ABA, jasmonic acid (JA, salicylic acid (SA, and ethylene (ET and its precursor ACC (free and conjugated, MACC during development of sun-injury-related disorders pre- and post-harvest on apples. Peel tissue was extracted from fruit growing under different sun exposures (Non-exposed, NE; Exposed, EX and with sun injury symptoms (Moderate, Mod. Sampling was carried out every 15 days from 75 days after full bloom (DAFB until 120 days post-harvest in cold storage (1°C, > 90%RH. Concentrations of IAA, ABA, JA, SA, were determined using UHPLC mass spectrometry, and ET and ACC (free and conjugated MACC using gas chromatography. IAA was found not to be related directly to sun injury development, but it decreased 60% in sun exposed tissue, and during fruit development. ABA, JA, SA, and ethylene concentrations were significantly higher (P ≤ 0.05 in Mod tissue, but their concentration, except for ethylene, were not affected by sun exposure. ACC and MACC concentrations increased until 105 DAFB in all sun exposure categories. During post-harvest, ethylene climacteric peak was delayed on EX compared to Mod. ABA and SA concentrations remained stable throughout storage in both tissue. JA dramatically increased post-harvest in both EX and Mod tissue, and orchards, confirming its role in low temperature tolerance. The results suggest that ABA, JA, and SA together with ethylene are modulating some of the abiotic stress defense responses on sun-exposed fruit during photooxidative and heat stress on the tree.

  7. Polyphenolic Characterization and Antioxidant Activity of Malus domestica and Prunus domestica Cultivars from Costa Rica.

    Science.gov (United States)

    Navarro, Mirtha; Moreira, Ileana; Arnaez, Elizabeth; Quesada, Silvia; Azofeifa, Gabriela; Vargas, Felipe; Alvarado, Diego; Chen, Pei

    2018-01-30

    The phenolic composition of skin and flesh from Malus domestica apples (Anna cultivar) and Prunus domestica plums (satsuma cultivar) commercial cultivars in Costa Rica, was studied using Ultra Performance Liquid Chromatography coupled with High Resolution Mass Spectrometry (UPLC-DAD-ESI-MS) on enriched-phenolic extracts, with particular emphasis in proanthocyanidin and flavonoids characterization. A total of 52 compounds were identified, including 21 proanthocyanidins ([(+)-catechin and (-)-epicatechin]) flavan-3-ols monomers, five procyanidin B-type dimers and two procyanidin A-type dimers, five procyanidin B-type trimers and two procyanidin A-type trimers, as well as one procyanidin B-type tetramer, two procyanidin B-type pentamers, and two flavan-3-ol gallates); 15 flavonoids (kaempferol, quercetin and naringenin derivatives); nine phenolic acids (protochatechuic, caffeoylquinic, and hydroxycinnamic acid derivatives); five hydroxychalcones (phloretin and 3-hydroxyphloretin derivatives); and two isoprenoid glycosides (vomifoliol derivatives). These findings constitute the first report of such a high number and diversity of compounds in skins of one single plum cultivar and of the presence of proanthocyanidin pentamers in apple skins. Also, it is the first time that such a large number of glycosylated flavonoids and proanthocyanidins are reported in skins and flesh of a single plum cultivar. In addition, total phenolic content (TPC) was measured with high values observed for all samples, especially for fruits skins with a TPC of 619.6 and 640.3 mg gallic acid equivalents/g extract respectively for apple and plum. Antioxidant potential using 2,2-diphenyl-1-picrylhidrazyl (DPPH) and oxygen radical absorbance capacity (ORAC) methods were evaluated, with results showing also high values for all samples, especially again for fruit skins with IC 50 of 4.54 and 5.19 µg/mL (DPPH) and 16.8 and 14.6 mmol TE/g (ORAC) respectively for apple and plum, indicating the potential

  8. Transcriptomic responses to biotic stresses in Malus x domestica: a meta-analysis study.

    Science.gov (United States)

    Balan, Bipin; Marra, Francesco Paolo; Caruso, Tiziano; Martinelli, Federico

    2018-01-31

    RNA-Seq analysis is a strong tool to gain insight into the molecular responses to biotic stresses in plants. The objective of this work is to identify specific and common molecular responses between different transcriptomic data related to fungi, virus and bacteria attacks in Malus x domestica. We analyzed seven transcriptomic datasets in Malus x domestica divided in responses to fungal pathogens, virus (Apple Stem Grooving Virus) and bacteria (Erwinia amylovora). Data were dissected using an integrated approach of pathway- and gene- set enrichment analysis, Mapman visualization tool, gene ontology analysis and inferred protein-protein interaction network. Our meta-analysis revealed that the bacterial infection enhanced specifically genes involved in sugar alcohol metabolism. Brassinosteroids were upregulated by fungal pathogens while ethylene was highly affected by Erwinia amylovora. Gibberellins and jasmonates were strongly repressed by fungal and viral infections. The protein-protein interaction network highlighted the role of WRKYs in responses to the studied pathogens. In summary, our meta-analysis provides a better understanding of the Malus X domestica transcriptome responses to different biotic stress conditions; we anticipate that these insights will assist in the development of genetic resistance and acute therapeutic strategies. This work would be an example for next meta-analysis works aiming at identifying specific common molecular features linked with biotic stress responses in other specialty crops.

  9. ‘Fuji’ apple (Malus domestica Borkh) volatile production during high pCO2 controlled atmosphere storage

    Science.gov (United States)

    ‘Fuji’apple [Malus sylvestris var. domestica (Borkh.) Mansf.] volatile compound dynamics were characterized during cold storage in air or at low pO2 controlled atmosphere (CA) with up to 5 kPa CO2. Volatile compounds in storage chambers were adsorbed onto solid sorbent traps and analyzed by GC-MS....

  10. Boron toxicity causes multiple effects on Malus domestica pollen tube growth

    Directory of Open Access Journals (Sweden)

    Kefeng eFang

    2016-02-01

    Full Text Available Boron is an essential micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this stress is not known. This study aimed to evaluate the effect of boron stress on Malus domestica pollen tube growth and its possible regulatory pathway. Our results show that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron stress could decrease [Ca2+]c and induce the disappearance of the [Ca2+]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron stress. Immuno-localization and fluorescence labeling, together with Fourier-transform infrared analysis (FTIR, suggested that boron stress influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca2+]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

  11. Boron Toxicity Causes Multiple Effects on Malus domestica Pollen Tube Growth.

    Science.gov (United States)

    Fang, Kefeng; Zhang, Weiwei; Xing, Yu; Zhang, Qing; Yang, Liu; Cao, Qingqin; Qin, Ling

    2016-01-01

    Boron is an important micronutrient for plants. However, boron is also toxic to cells at high concentrations, although the mechanism of this toxicity is not known. This study aimed to evaluate the effect of boron toxicity on Malus domestica pollen tube growth and its possible regulatory pathway. Our results showed that a high concentration of boron inhibited pollen germination and tube growth and led to the morphological abnormality of pollen tubes. Fluorescent labeling coupled with a scanning ion-selective electrode technique detected that boron toxicity could decrease [Ca(2+)]c and induce the disappearance of the [Ca(2+)]c gradient, which are critical for pollen tube polar growth. Actin filaments were therefore altered by boron toxicity. Immuno-localization and fluorescence labeling, together with fourier-transform infrared analysis, suggested that boron toxicity influenced the accumulation and distribution of callose, de-esterified pectins, esterified pectins, and arabinogalactan proteins in pollen tubes. All of the above results provide new insights into the regulatory role of boron in pollen tube development. In summary, boron likely plays a structural and regulatory role in relation to [Ca(2+)]c, actin cytoskeleton and cell wall components and thus regulates Malus domestica pollen germination and tube polar growth.

  12. Antioxidant, antimicrobial activity and mineral composition of low-temperature fractioning products of Malus domestica Borkh (common Antonovka

    Directory of Open Access Journals (Sweden)

    Elena Kuznetsova

    2017-01-01

    Full Text Available The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has been performed. We obtained by fractionation the biologically active products that are the dehydrated concentrate of juice and the powder of pomace fibers. Use of low temperature minimizes biological value losses during processing. These fractions of fruit Malus domestica Borkh (Common Antonovka are experimentally studied. It is found that the fractions have high antioxidant activity and include bioflavonoids and organic and phenol carboxylic acids. Analysis of chromatograms showed availability of the identical compounds in the products of low-temperature fractionation. Sodium and potassium are part of the cells of biological systems as highly mobile ionic forms. Therefore, these elements prevail in the concentrated juice. Iron, manganese, copper, and zinc are biogenic trace elements or components of enzyme systems and are evenly distributed as in plant cell walls as well in protoplasm. It follows from the results of the study of the mineral composition that the products of the low-temperature fractioning can be used for a functional food as a result of its high content of magnesium and iron. The low-temperature fractionation of fruit Malus domestica Borkh (Common Antonovka has antimicrobial activity against the standard strains of spoilage: Bacillus subtilis VKM-B-501, Micrococcus luteus VKM-As-2230, Aspergillus flavus VKM-F-1024, Penicillium expansion VKM-F-275, Mucor mucedo VKM- F-1257, Rhizopus stolonifer VKM- F-2005. Experimental data show that the products of low-temperature fractioning of Malus domestica Borkh (Common Antonovka inhibit microorganism's growth. The detected composition of Malus domestica Borkh (Common Antonovka fractions allows using these products as natural additives in food technology to maintain and increase period of storage and also for preventive nutrition.

  13. RNA interference silencing of CHS greatly alters the growth pattern of apple (Malus x domestica).

    Science.gov (United States)

    Dare, Andrew P; Hellens, Roger P

    2013-08-01

    Plants produce a vast array of phenolic compounds which are essential for their survival on land. One major class of polyphenols are the flavonoids and their formation is dependent on the enzyme chalcone synthase (CHS). In a recent study we silenced the CHS genes of apple (Malus × domestica Borkh.) and observed a loss of pigmentation in the fruit skin, flowers and stems. More surprisingly, highly silenced lines were significantly reduced in size, with small leaves and shortened internode lengths. Chemical analysis also revealed that the transgenic shoots contained greatly reduced concentrations of flavonoids which are known to modulate auxin flow. An auxin transport study verified this, with an increased auxin transport in the CHS-silenced lines. Overall, these findings suggest that auxin transport in apple has adapted to take place in the presence of high endogenous concentrations of flavonoids. Removal of these compounds therefore results in abnormal auxin movement and a highly disrupted growth pattern.

  14. Optimizing dehydration of apples Malus Domestica with fructo-oligosaccharide incorporation

    Directory of Open Access Journals (Sweden)

    Mariana Buranelo Egea

    2012-10-01

    Full Text Available The objective of the present study was to study the effect of the variables of the osmotic dehydration process on sliced Fuji apples (Malus domestica using a 2 x 3² factorial design. The variables studied in the apple slices were the pretreatment (blanching or acidification, the temperatures (30, 45 and 60ºC and the FOS concentration (40%, 50% and 60% m/v of the osmotic solution. There was no difference among the pretreatments for the water activity and titratable acidity. The slices pre-treated by the acidification presented less enzymatic browning (greatest luminosity L* value combined with a greater soluble solid contents (thus, this treatment was selected. Treatments T4 (45ºC and 40% m/v and T7 (60ºC and 40%m/v, using the acidification presented responses within the recommended standards and FOS were validated by the repetition.

  15. Antioxidant and antimicrobial properties of dried Portuguese apple variety (Malus domestica Borkh. cv Bravo de Esmolfe).

    Science.gov (United States)

    Pires, Tânia C S P; Dias, Maria Inês; Barros, Lillian; Alves, Maria José; Oliveira, M Beatriz P P; Santos-Buelga, Celestino; Ferreira, Isabel C F R

    2018-02-01

    Malus domestica Borkh apples are one of the most consumed fruits in the world, due to their sweetness and flavour. Herein, 'Bravo de Esmolfe' apple fruits were characterized regarding their nutritional value, chemical composition and bioactive properties. Besides nutrients, flavan-3-ols (i.e., epicatechin and B-type procyanidins) as also hydroxycinnamoyl-quinic acids and phloretin derivatives were identified in the samples. Extracts prepared from 'Bravo de Esmolfe' also proved to have antioxidant activity and antibacterial effects against Gram-positive bacteria, namely methicillin-susceptible Staphylococcus aureus (MSSA), methicillin-resistant Staphylococcus aureus (MRSA), Listeria monocytogenes and Enterococcus faecalis, and against the Gram-negative bacteria Escherichia coli, Escherichia coli (ESBL) (producing extended spectrum β-lactamases) and Morganella morganii. There is very little information about 'Bravo de Esmolfe' apple, so this study is important to inform consumers about an alternative source of nutritional and bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Chemical Composition and In Vitro Cytotoxic Activity of Essential Oil of Leaves of Malus domestica Growing in Western Himalaya (India)

    OpenAIRE

    Walia, Mayanka; Mann, Tavleen S.; Kumar, Dharmesh; Agnihotri, Vijai K.; Singh, Bikram

    2012-01-01

    Light pale-colored volatile oil was obtained from fresh leaves of Malus domestica tree, growing in Dhauladhar range of Himalaya (Himachal Pradesh, India), with characteristic eucalyptol dominant fragrance. The oil was found to be a complex mixture of mono-, sesqui-, di-terpenes, phenolics, and aliphatic hydrocarbons. Seventeen compounds accounting for nearly 95.3% of the oil were characterized with the help of capillary GC, GC-MS, and NMR. Major compounds of the oil were characterized as euca...

  17. A review of apple anthracnose canker biology and management in cider apple orchards in the Maritime Pacific Northwest

    Science.gov (United States)

    Cider apple (Malus ×domestica Borkh.) is an emerging crop in western Washington and the Pacific Northwest (PNW) region, but a major obstacle to planting new orchards and orchard productivity is the widespread occurrence of apple anthracnose canker, caused by the fungal pathogen Neofabraea malicortic...

  18. Genome-wide analysis of the GH3 family in apple (Malus × domestica).

    Science.gov (United States)

    Yuan, Huazhao; Zhao, Kai; Lei, Hengjiu; Shen, Xinjie; Liu, Yun; Liao, Xiong; Li, Tianhong

    2013-05-02

    Auxin plays important roles in hormone crosstalk and the plant's stress response. The auxin-responsive Gretchen Hagen3 (GH3) gene family maintains hormonal homeostasis by conjugating excess indole-3-acetic acid (IAA), salicylic acid (SA), and jasmonic acids (JAs) to amino acids during hormone- and stress-related signaling pathways. With the sequencing of the apple (Malus × domestica) genome completed, it is possible to carry out genomic studies on GH3 genes to indentify candidates with roles in abiotic/biotic stress responses. Malus sieversii Roem., an apple rootstock with strong drought tolerance and the ancestral species of cultivated apple species, was used as the experimental material. Following genome-wide computational and experimental identification of MdGH3 genes, we showed that MdGH3s were differentially expressed in the leaves and roots of M. sieversii and that some of these genes were significantly induced after various phytohormone and abiotic stress treatments. Given the role of GH3 in the negative feedback regulation of free IAA concentration, we examined whether phytohormones and abiotic stresses could alter the endogenous auxin level. By analyzing the GUS activity of DR5::GUS-transformed Arabidopsis seedlings, we showed that ABA, SA, salt, and cold treatments suppressed the auxin response. These findings suggest that other phytohormones and abiotic stress factors might alter endogenous auxin levels. Previous studies showed that GH3 genes regulate hormonal homeostasis. Our study indicated that some GH3 genes were significantly induced in M. sieversii after various phytohormone and abiotic stress treatments, and that ABA, SA, salt, and cold treatments reduce the endogenous level of axuin. Taken together, this study provides evidence that GH3 genes play important roles in the crosstalk between auxin, other phytohormones, and the abiotic stress response by maintaining auxin homeostasis.

  19. In silico analysis of the polygalacturonase inhibiting protein 1 from apple, Malus domestica.

    Science.gov (United States)

    Matsaunyane, Lerato Bt; Oelofse, Dean; Dubery, Ian A

    2015-03-11

    The Malus domestica polygalacturonase inhibiting protein 1 (MdPGIP1) gene, encoding the M. domestica polygalacturonase inhibiting protein 1 (MdPGIP1), was isolated from the Granny Smith apple cultivar (GenBank accession no. DQ185063). The gene was used to transform tobacco and potato for enhanced resistance against fungal diseases. Analysis of the MdPGIP1 nucleotide sequence revealed that the gene comprises 993 nucleotides that encode a 330 amino acid polypeptide. In silico characterization of the MdPGIP1 polypeptide revealed domains typical of PGIP proteins, which include a 24 amino acid putative signal peptide, a potential cleavage site [Alanine-Leucine-Serine (ALS)] for the signal peptide, a 238 amino acid leucine-rich repeat (LRR) domain, a 46 amino acid N-terminal domain and a 22 amino acid C-terminal domain. The hydropathic evaluation of MdPGIP1 indicated a repetitive hydrophobic motif in the LRR domain and a hydrophilic surface area consistent with a globular protein. The typical consensus glycosylation sequence of Asn-X-Ser/Thr was identified in MdPGIP1, indicating potential N-linked glycosylation of MdPGIP1. The molecular mass of non-glycosylated MdPGIP1 was calculated as 36.615 kDa and the theoretical isoelectric point as 6.98. Furthermore, the secondary and tertiary structure of MdPGIP1 was modelled, and revealed that MdPGIP1 is a curved and elongated molecule that contains sheet B1, sheet B2 and 310-helices on its LRR domain. The overall properties of the MdPGIP1 protein is similar to that of the prototypical Phaseolus vulgaris PGIP 2 (PvPGIP2), and the detected differences supported its use in biotechnological applications as an inhibitor of targeted fungal polygalacturonases (PGs).

  20. Characterization of resistance gene analogues (RGAs in apple (Malus × domestica Borkh. and their evolutionary history of the Rosaceae family.

    Directory of Open Access Journals (Sweden)

    Michele Perazzolli

    Full Text Available The family of resistance gene analogues (RGAs with a nucleotide-binding site (NBS domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh. cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80% of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15, and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  1. Characterization of Resistance Gene Analogues (RGAs) in Apple (Malus × domestica Borkh.) and Their Evolutionary History of the Rosaceae Family

    Science.gov (United States)

    Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

    2014-01-01

    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar ‘Golden Delicious’. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera. PMID:24505246

  2. Characterization of resistance gene analogues (RGAs) in apple (Malus × domestica Borkh.) and their evolutionary history of the Rosaceae family.

    Science.gov (United States)

    Perazzolli, Michele; Malacarne, Giulia; Baldo, Angela; Righetti, Laura; Bailey, Aubrey; Fontana, Paolo; Velasco, Riccardo; Malnoy, Mickael

    2014-01-01

    The family of resistance gene analogues (RGAs) with a nucleotide-binding site (NBS) domain accounts for the largest number of disease resistance genes and is one of the largest gene families in plants. We have identified 868 RGAs in the genome of the apple (Malus × domestica Borkh.) cultivar 'Golden Delicious'. This represents 1.51% of the total number of predicted genes for this cultivar. Several evolutionary features are pronounced in M. domestica, including a high fraction (80%) of RGAs occurring in clusters. This suggests frequent tandem duplication and ectopic translocation events. Of the identified RGAs, 56% are located preferentially on six chromosomes (Chr 2, 7, 8, 10, 11, and 15), and 25% are located on Chr 2. TIR-NBS and non-TIR-NBS classes of RGAs are primarily exclusive of different chromosomes, and 99% of non-TIR-NBS RGAs are located on Chr 11. A phylogenetic reconstruction was conducted to study the evolution of RGAs in the Rosaceae family. More than 1400 RGAs were identified in six species based on their NBS domain, and a neighbor-joining analysis was used to reconstruct the phylogenetic relationships among the protein sequences. Specific phylogenetic clades were found for RGAs of Malus, Fragaria, and Rosa, indicating genus-specific evolution of resistance genes. However, strikingly similar RGAs were shared in Malus, Pyrus, and Prunus, indicating high conservation of specific RGAs and suggesting a monophyletic origin of these three genera.

  3. Maize Lc transcription factor enhances biosynthesis of anthocyanins, distinct proanthocyanidins and phenylpropanoids in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Li, Houhua; Flachowsky, Henryk; Fischer, Thilo C; Hanke, Magda-Viola; Forkmann, Gert; Treutter, Dieter; Schwab, Wilfried; Hoffmann, Thomas; Szankowski, Iris

    2007-10-01

    Flavonoids are a large family of polyphenolic compounds with manifold functions in plants. Present in a wide range of vegetables and fruits, flavonoids form an integral part of the human diet and confer multiple health benefits. Here, we report on metabolic engineering of the flavonoid biosynthetic pathways in apple (Malus domestica Borkh.) by overexpression of the maize (Zea mays L.) leaf colour (Lc) regulatory gene. The Lc gene was transferred into the M. domestica cultivar Holsteiner Cox via Agrobacterium tumefaciens-mediated transformation which resulted in enhanced anthocyanin accumulation in regenerated shoots. Five independent Lc lines were investigated for integration of Lc into the plant genome by Southern blot and PCR analyses. The Lc-transgenic lines contained one or two Lc gene copies and showed increased mRNA levels for phenylalanine ammonia-lyase (PAL), chalcone synthase (CHS), flavanone 3 beta-hydroxylase (FHT), dihydroflavonol 4-reductase (DFR), leucoanthocyanidin reductases (LAR), anthocyanidin synthase (ANS) and anthocyanidin reductase (ANR). HPLC-DAD and LC-MS analyses revealed higher levels of the anthocyanin idaein (12-fold), the flavan 3-ol epicatechin (14-fold), and especially the isomeric catechin (41-fold), and some distinct dimeric proanthocyanidins (7 to 134-fold) in leaf tissues of Lc-transgenic lines. The levels of phenylpropanoids and their derivatives were only slightly increased. Thus, Lc overexpression in Malus domestica resulted in enhanced biosynthesis of specific flavonoid classes, which play important roles in both phytopathology and human health.

  4. Effect of irradiance and spectral composition of radiation on in vitro shoot proliferation in Malus domestica

    International Nuclear Information System (INIS)

    Noè, N.; Eccher, T.; Bonini, L.

    1997-01-01

    Four clones of Malus domestica cv. Golden Delicious - namely Smoothee, Crielaard, Reinders and Golden B - were cultured in vitro from single-node microcuttings placed on solid medium under irradiance (PPFD) of 50 micromol m -2 s -1 . After 9 months an average shoot proliferation of 5.3 was achieved; Crielaard showed the highest rate (7.1), followed Golden B (5.4), Smoothee and Reinders (4.4). Proliferating shoots were then exposed to higher PPFD (80 micromol m -2 s -1 ) and different spectral composition of radiation using PMMA-B and PMMA-R/FR filters. High PPFD decreased the average proliferation rate to 4.5, in particular in Crielaard and Golden B, while it increased proliferation in Reinders. When a PMMA-R/FR filter was interposed, the mean proliferation rate slightly increased. PMMA-B filters decreased the overall proliferation rate to 3.0; only in Crielaard it was increased, but shoots were very small. Thus PPFD and spectral composition influenced in vitro shoot proliferation and growth and the responses were different among the clones. (author)

  5. Phenotypic changes associated with RNA interference silencing of chalcone synthase in apple (Malus × domestica).

    Science.gov (United States)

    Dare, Andrew P; Tomes, Sumathi; Jones, Midori; McGhie, Tony K; Stevenson, David E; Johnson, Ross A; Greenwood, David R; Hellens, Roger P

    2013-05-01

    We have identified in apple (Malus × domestica) three chalcone synthase (CHS) genes. In order to understand the functional redundancy of this gene family RNA interference knockout lines were generated where all three of these genes were down-regulated. These lines had no detectable anthocyanins and radically reduced concentrations of dihydrochalcones and flavonoids. Surprisingly, down-regulation of CHS also led to major changes in plant development, resulting in plants with shortened internode lengths, smaller leaves and a greatly reduced growth rate. Microscopic analysis revealed that these phenotypic changes extended down to the cellular level, with CHS-silenced lines showing aberrant cellular organisation in the leaves. Fruit collected from one CHS-silenced line was smaller than the 'Royal Gala' controls, lacked flavonoids in the skin and flesh and also had changes in cell morphology. Auxin transport experiments showed increased rates of auxin transport in a CHS-silenced line compared with the 'Royal Gala' control. As flavonoids are well known to be key modulators of auxin transport, we hypothesise that the removal of almost all flavonoids from the plant by CHS silencing creates a vastly altered environment for auxin transport to occur and results in the observed changes in growth and development. © 2013 The Authors The Plant Journal © 2013 Blackwell Publishing Ltd.

  6. Characterization of three chalcone synthase-like genes from apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Yahyaa, Mosaab; Ali, Samah; Davidovich-Rikanati, Rachel; Ibdah, Muhammad; Shachtier, Alona; Eyal, Yoram; Lewinsohn, Efraim; Ibdah, Mwafaq

    2017-08-01

    Apple (Malus x domestica Brokh.) is a widely cultivated deciduous tree species of significant economic importance. Apple leaves accumulate high levels of flavonoids and dihydrochalcones, and their formation is dependent on enzymes of the chalcone synthase family. Three CHS genes were cloned from apple leaves and expressed in Escherichia coli. The encoded recombinant enzymes were purified and functionally characterized. In-vitro activity assays indicated that MdCHS1, MdCHS2 and MdCHS3 code for proteins exhibiting polyketide synthase activity that accepted either p-dihydrocoumaroyl-CoA, p-coumaroyl-CoA, or cinnamoyl-CoA as starter CoA substrates in the presence of malonyl-CoA, leading to production of phloretin, naringenin chalcone, and pinocembrin chalcone. MdCHS3 coded a chalcone-dihydrochalcone synthase enzyme with narrower substrate specificity than the previous ones. The apparent Km values of MdCHS3 for p-dihydrocoumaryl-CoA and p-coumaryl-CoA were both 5.0 μM. Expression analyses of MdCHS genes varied according to tissue type. MdCHS1, MdCHS2 and MdCHS3 expression levels were associated with the levels of phloretin accumulate in the respective tissues. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala)

    Science.gov (United States)

    Zhang, Wen; Lunn, John E.; Feil, Regina; Wang, Yufei; Zhao, Jingjing; Tao, Hongxia; Zhao, Zhengyang

    2017-01-01

    ABSTRACT Trehalose-6-phosphate (Tre6P) is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala). Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple. PMID:28069587

  8. Future bloom and blossom frost risk for Malus domestica considering climate model and impact model uncertainties.

    Science.gov (United States)

    Hoffmann, Holger; Rath, Thomas

    2013-01-01

    The future bloom and risk of blossom frosts for Malus domestica were projected using regional climate realizations and phenological ( = impact) models. As climate impact projections are susceptible to uncertainties of climate and impact models and model concatenation, the significant horizon of the climate impact signal was analyzed by applying 7 impact models, including two new developments, on 13 climate realizations of the IPCC emission scenario A1B. Advancement of phenophases and a decrease in blossom frost risk for Lower Saxony (Germany) for early and late ripeners was determined by six out of seven phenological models. Single model/single grid point time series of bloom showed significant trends by 2021-2050 compared to 1971-2000, whereas the joint signal of all climate and impact models did not stabilize until 2043. Regarding blossom frost risk, joint projection variability exceeded the projected signal. Thus, blossom frost risk cannot be stated to be lower by the end of the 21st century despite a negative trend. As a consequence it is however unlikely to increase. Uncertainty of temperature, blooming date and blossom frost risk projection reached a minimum at 2078-2087. The projected phenophases advanced by 5.5 d K(-1), showing partial compensation of delayed fulfillment of the winter chill requirement and faster completion of the following forcing phase in spring. Finally, phenological model performance was improved by considering the length of day.

  9. Trehalose 6-phosphate signal is closely related to sorbitol in apple (Malus domestica Borkh. cv. Gala

    Directory of Open Access Journals (Sweden)

    Wen Zhang

    2017-02-01

    Full Text Available Trehalose-6-phosphate (Tre6P is a precursor of trehalose, which is widespread in nature and greatly influences plant growth and development. Tre6P acts as a signal of carbon availability in many plants, but little is known about the function of Tre6P in rosaceous plants, which have specific sorbitol biosynthesis and transportation pathways. In the present study, Tre6P levels and Sorbitol:Tre6P ratios were analyzed in apple (Malus domestica, Borkh. cv. Gala. Tre6P levels were positively correlated with sorbitol content but negatively correlated with sucrose, glucose, and fructose content in developing fruit. However, under sorbitol-limited conditions, Tre6P levels were positively correlated with both sorbitol and sucrose. In the presence of different exogenous sugar supply, Tre6P levels increased corresponding with sorbitol, but this was not the case with sucrose. In addition, Tre6P content and sorbitol:Tre6P ratios were more highly correlated with ADP-glucose levels under sorbitol-limited conditions and fruit development stages, respectively. These results suggest that Tre6P is more closely related to sorbitol than other soluble sugars and has an important role in influencing carbon metabolism in apple.

  10. Two QTL characterized for soft scald and soggy breakdown in apple (Malus × domestica) through pedigree-based analysis of a large population of interconnected families

    NARCIS (Netherlands)

    Howard, Nicholas P.; Weg, van de Eric; Tillman, John; Tong, Cindy B.S.; Silverstein, Kevin A.T.; Luby, James J.

    2018-01-01

    Soft scald and soggy breakdown are important postharvest physiological disorders of apple (Malus × domestica). ‘Honeycrisp’ and some of its offspring are particularly susceptible to developing these disorders. The purpose of this study was to identify molecular markers associated with high

  11. Genome-wide identification and expression analysis of MAPK and MAPKK gene family in Malus domestica.

    Science.gov (United States)

    Zhang, Shizhong; Xu, Ruirui; Luo, Xiaocui; Jiang, Zesheng; Shu, Huairui

    2013-12-01

    MAPK signal transduction modules play crucial roles in regulating many biological processes in plants, which are composed of three classes of hierarchically organized protein kinases, namely MAPKKKs, MAPKKs, and MAPKs. Although genome-wide analysis of this family has been carried out in some species, little is known about MAPK and MAPKK genes in apple (Malus domestica). In this study, a total of 26 putative apple MAPK genes (MdMPKs) and 9 putative apple MAPKK genes (MdMKKs) have been identified and located within the apple genome. Phylogenetic analysis revealed that MdMAPKs and MdMAPKKs could be divided into 4 subfamilies (groups A, B, C and D), respectively. The predicted MdMAPKs and MdMAPKKs were distributed across 13 out of 17 chromosomes with different densities. In addition, analysis of exon-intron junctions and of intron phase inside the predicted coding region of each candidate gene has revealed high levels of conservation within and between phylogenetic groups. According to the microarray and expressed sequence tag (EST) analysis, the different expression patterns indicate that they may play different roles during fruit development and rootstock-scion interaction process. Moreover, MAPK and MAPKK genes were performed expression profile analyses in different tissues (root, stem, leaf, flower and fruit), and all of the selected genes were expressed in at least one of the tissues tested, indicating that the MAPKs and MAPKKs are involved in various aspects of physiological and developmental processes of apple. To our knowledge, this is the first report of a genome-wide analysis of the apple MAPK and MAPKK gene family. This study provides valuable information for understanding the classification and putative functions of the MAPK signal in apple. © 2013.

  12. Characterisation of microRNAs from apple (Malus domestica 'Royal Gala') vascular tissue and phloem sap.

    Science.gov (United States)

    Varkonyi-Gasic, Erika; Gould, Nick; Sandanayaka, Manoharie; Sutherland, Paul; MacDiarmid, Robin M

    2010-08-04

    Plant microRNAs (miRNAs) are a class of small, non-coding RNAs that play an important role in development and environmental responses. Hundreds of plant miRNAs have been identified to date, mainly from the model species for which there are available genome sequences. The current challenge is to characterise miRNAs from plant species with agricultural and horticultural importance, to aid our understanding of important regulatory mechanisms in crop species and enable improvement of crops and rootstocks. Based on the knowledge that many miRNAs occur in large gene families and are highly conserved among distantly related species, we analysed expression of twenty-one miRNA sequences in different tissues of apple (Malus x domestica 'Royal Gala'). We identified eighteen sequences that are expressed in at least one of the tissues tested. Some, but not all, miRNAs expressed in apple tissues including the phloem tissue were also detected in the phloem sap sample derived from the stylets of woolly apple aphids. Most of the miRNAs detected in apple phloem sap were also abundant in the phloem sap of herbaceous species. Potential targets for apple miRNAs were identified that encode putative proteins shown to be targets of corresponding miRNAs in a number of plant species. Expression patterns of potential targets were analysed and correlated with expression of corresponding miRNAs. This study validated tissue-specific expression of apple miRNAs that target genes responsible for plant growth, development, and stress response. A subset of characterised miRNAs was also present in the apple phloem translocation stream. A comparative analysis of phloem miRNAs in herbaceous species and woody perennials will aid our understanding of non-cell autonomous roles of miRNAs in plants.

  13. Transcription Profiles Reveal Sugar and Hormone Signaling Pathways Mediating Flower Induction in Apple (Malus domestica Borkh.).

    Science.gov (United States)

    Xing, Li-Bo; Zhang, Dong; Li, You-Mei; Shen, Ya-Wen; Zhao, Cai-Ping; Ma, Juan-Juan; An, Na; Han, Ming-Yu

    2015-10-01

    Flower induction in apple (Malus domestica Borkh.) is regulated by complex gene networks that involve multiple signal pathways to ensure flower bud formation in the next year, but the molecular determinants of apple flower induction are still unknown. In this research, transcriptomic profiles from differentiating buds allowed us to identify genes potentially involved in signaling pathways that mediate the regulatory mechanisms of flower induction. A hypothetical model for this regulatory mechanism was obtained by analysis of the available transcriptomic data, suggesting that sugar-, hormone- and flowering-related genes, as well as those involved in cell-cycle induction, participated in the apple flower induction process. Sugar levels and metabolism-related gene expression profiles revealed that sucrose is the initiation signal in flower induction. Complex hormone regulatory networks involved in cytokinin (CK), abscisic acid (ABA) and gibberellic acid pathways also induce apple flower formation. CK plays a key role in the regulation of cell formation and differentiation, and in affecting flowering-related gene expression levels during these processes. Meanwhile, ABA levels and ABA-related gene expression levels gradually increased, as did those of sugar metabolism-related genes, in developing buds, indicating that ABA signals regulate apple flower induction by participating in the sugar-mediated flowering pathway. Furthermore, changes in sugar and starch deposition levels in buds can be affected by ABA content and the expression of the genes involved in the ABA signaling pathway. Thus, multiple pathways, which are mainly mediated by crosstalk between sugar and hormone signals, regulate the molecular network involved in bud growth and flower induction in apple trees. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  14. Old Apple (Malus domestica L. Borkh) Varieties with Hypoallergenic Properties: An Integrated Approach for Studying Apple Allergenicity.

    Science.gov (United States)

    Vegro, Mara; Eccher, Giulia; Populin, Francesca; Sorgato, Chiara; Savazzini, Federica; Pagliarani, Giulia; Tartarini, Stefano; Pasini, Gabriella; Curioni, Andrea; Antico, Andrea; Botton, Alessandro

    2016-12-07

    Freshly consumed apples (Malus domestica L. Borkh) can cause allergic reactions because of the presence of four classes of allergens. Knowledge of the genetic factors affecting the allergenic potential of apples would provide important information for the selection of hypoallergenic genotypes, which can be combined with the adoption of new agronomical practices to produce fruits with a reduced amount of allergens. In the present research, a multiple analytical approach was adopted to characterize the allergenic potential of 24 apple varieties released at different ages (pre- and post-green revolution). A specific workflow was set up including protein quantification by means of polyclonal antibodies, immunological analyses with sera of allergic subjects, enzymatic assays, clinical assessments on allergic patients, and gene expression assays on fruit samples. Taken as a whole, the results indicate that most of the less allergenic genotypes were found among those deriving from selection processes carried out prior to the so-called "green revolution".

  15. Effects of apple (Malus x domestica) rootstocks on scion performance and hormone concentration

    Science.gov (United States)

    Rootstocks can influence the productivity and profitability of an orchard in a very significant way. Dwarfing rootstocks had a large impact in making possible the high-density orchards that have been planted during the last 15 years. However, there is a serious threat to high-density apple orchards,...

  16. WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations.

    Science.gov (United States)

    Riccio, Gennaro; Maisto, Maria; Bottone, Sara; Badolati, Nadia; Rossi, Giovanni Battista; Tenore, Gian Carlo; Stornaiuolo, Mariano; Novellino, Ettore

    2017-11-18

    Inhibitors of the Wingless-related Integration site (WNT)/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP). This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i) test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. 'Annurca' and Malus domestica cv 'Limoncella'; (ii) identify the mechanisms underpinning their activities and; (iii) evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

  17. WNT Inhibitory Activity of Malus Pumila miller cv Annurca and Malus domestica cv Limoncella Apple Extracts on Human Colon-Rectal Cells Carrying Familial Adenomatous Polyposis Mutations

    Directory of Open Access Journals (Sweden)

    Gennaro Riccio

    2017-11-01

    Full Text Available Inhibitors of the Wingless-related Integration site (WNT/β-catenin pathway have recently been under consideration as potential chemopreventive agents against Familial Adenomatous Polyposis (FAP. This autosomal-dominant syndrome is caused by germline mutations in the gene coding for the protein APC and leads to hyperactivation of the WNT/β-catenin signaling pathway, uncontrolled intestinal cell proliferation and formation of adenocarcinomas. The aim of the present work was to: (i test, on in vitro cultures of cells carrying FAP mutations and on ex vivo biopsies of FAP patients, the WNT inhibitory activity of extracts from two common southern Italian apples, Malus pumila Miller cv. ‘Annurca’ and Malus domestica cv ‘Limoncella’; (ii identify the mechanisms underpinning their activities and; (iii evaluate their potency upon gastrointestinal digestion. We here show that both Annurca and Limoncella apple extracts act as WNT inhibitors, mostly thanks to their polyphenolic contents. They inhibit the pathway in colon cells carrying FAP mutations with active dilutions falling in ranges close to consumer-relevant concentrations. Food-grade manufacturing of apple extracts increases their WNT inhibitory activity as result of the conversion of quercetin glycosides into the aglycone quercetin, a potent WNT inhibitor absent in the fresh fruit extract. However, in vitro simulated gastrointestinal digestion severely affected WNT inhibitory activity of apple extracts, as result of a loss of polyphenols. In conclusion, our results show that apple extracts inhibit the WNT pathway in colon cells carrying FAP mutations and represent a potential nutraceutical alternative for the treatment of this pathology. Enteric coating is advisable to preserve the activity of the extracts in the colon-rectal section of the digestive tract.

  18. Apple ring rot-responsive putative microRNAs revealed by high-throughput sequencing in Malus × domestica Borkh.

    Science.gov (United States)

    Yu, Xin-Yi; Du, Bei-Bei; Gao, Zhi-Hong; Zhang, Shi-Jie; Tu, Xu-Tong; Chen, Xiao-Yun; Zhang, Zhen; Qu, Shen-Chun

    2014-08-01

    MicroRNAs (miRNAs) are small non-coding RNAs, which silence target mRNA via cleavage or translational inhibition to function in regulating gene expression. MiRNAs act as important regulators of plant development and stress response. For understanding the role of miRNAs responsive to apple ring rot stress, we identified disease-responsive miRNAs using high-throughput sequencing in Malus × domestica Borkh.. Four small RNA libraries were constructed from two control strains in M. domestica, crabapple (CKHu) and Fuji Naga-fu No. 6 (CKFu), and two disease stress strains, crabapple (DSHu) and Fuji Naga-fu No. 6 (DSFu). A total of 59 miRNA families were identified and five miRNAs might be responsive to apple ring rot infection and validated via qRT-PCR. Furthermore, we predicted 76 target genes which were regulated by conserved miRNAs potentially. Our study demonstrated that miRNAs was responsive to apple ring rot infection and may have important implications on apple disease resistance.

  19. The volatile profiles of a rare apple (Malus domestica Borkh.) honey: shikimic acid-pathway derivatives, terpenes, and others.

    Science.gov (United States)

    Kuś, Piotr Marek; Jerković, Igor; Tuberoso, Carlo Ignazio Giovanni; Šarolić, Mladenka

    2013-09-01

    The volatile profiles of rare Malus domestica Borkh. honey were investigated for the first time. Two representative samples from Poland (sample I) and Spain (sample II) were selected by pollen analysis (44-45% of Malus spp. pollen) and investigated by GC/FID/MS after headspace solid-phase microextraction (HS-SPME) and ultrasonic solvent extraction (USE). The apple honey is characterized by high percentage of shikimic acid-pathway derivatives, as well as terpenes, norisoprenoids, and some other compounds such as coumaran and methyl 1H-indole-3-acetate. The main compounds of the honey headspace were (sample I; sample II): benzaldehyde (9.4%; 32.1%), benzyl alcohol (0.3%; 14.4%), hotrienol (26.0%, 6.2%), and lilac aldehyde isomers (26.3%; 1.7%), but only Spanish sample contained car-2-en-4-one (10.2%). CH2 Cl2 and pentane/Et2 O 1 : 2 (v/v) were used for USE. The most relevant compounds identified in the extracts were: benzaldehyde (0.9-3.9%), benzoic acid (2.0-11.2%), terpendiol I (0.3-7.4%), coumaran (0.0-2.8%), 2-phenylacetic acid (2.0-26.4%), methyl syringate (3.9-13.1%), vomifoliol (5.0-31.8%), and methyl 1H-indole-3-acetate (1.9-10.2%). Apple honey contained also benzyl alcohol, 2-phenylethanol, (E)-cinnamaldehyde, (E)-cinnamyl alcohol, eugenol, vanillin, and linalool that have been found previously in apple flowers, thus disclosing similarity of both volatile profiles. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  20. Sodium-hydrogen exchanger inhibitory potential of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale.

    Science.gov (United States)

    Verma, Vivek; Singh, Nirmal; Jaggi, Amteshwar Singh

    2014-02-01

    The involvement of sodium-hydrogen exchangers (NHE) has been described in the pathophysiology of diseases including ischemic heart and brain diseases, cardiomyopathy, congestive heart failure, epilepsy, dementia, and neuropathic pain. Synthetic NHE inhibitors have not achieved much clinical success; therefore, plant-derived phytoconstituents may be explored as NHE inhibitors. In the present study, the NHE inhibitory potential of hydroalcoholic and alkaloidal fractions of Malus domestica, Musa × paradisiaca, Daucus carota, and Symphytum officinale was evaluated. The different concentrations of hydroalcoholic and alkaloidal extracts of the selected plants were evaluated for their NHE inhibitory activity in the platelets using the optical swelling assay. Among the hydroalcoholic extracts, the highest NHE inhibitory activity was shown by M. domestica (IC50=2.350 ± 0.132 μg/mL) followed by Musa × paradisiaca (IC50=7.967 ± 0.451 μg/mL), D. carota (IC50=37.667 ± 2.517 μg/mL), and S. officinale (IC50=249.330 ± 1.155 μg/mL). Among the alkaloidal fractions, the highest NHE inhibitory activity was shown by the alkaloidal fraction of Musa × paradisiacal (IC50=0.010 ± 0.001 μg/mL) followed by D. carota (IC50=0.024 ± 0.002 μg/mL), M. domestica (IC50=0.031 ± 0.005 μg/mL), and S. officinale (IC50=4.233 ± 0.379 μg/mL). The IC50 of alkaloidal fractions was comparable to the IC50 of synthetic NHE inhibitor, EIPA [5-(N-ethyl-N-isopropyl)amiloride] (IC50=0.033 ± 0.004 μg/mL). It may be concluded that the alkaloidal fractions of these plants possess potent NHE inhibitory activity and may be exploited for their therapeutic potential in NHE activation-related pathological complications.

  1. Foliar application of amino acids modulates aroma components of 'FUJI' apple (malus domestica L.)

    International Nuclear Information System (INIS)

    Gou, W.; Zhang, L.; Chen, F.; Cui, Z.; Zhao, Y.; Zheng, P.; Tian, L.; Zhang, L.; Zhang, C.

    2015-01-01

    Volatile flavor compounds play a key role in determining the perception and acceptability as well as enhancing market competitiveness of apple (Malus domestica L.). In our study, we evaluated the effects of foliar-applied four different amino acids, i.e. leucine (Leu), isoleucine (Ile), valine (Val) and alanine (Ala), on aroma components and two key enzymes activities involved in aroma metabolism of Fuji apple. The total amount of aromatic components under Ala treatment was significantly higher than those under other treatments. There was a considerable increase in total aroma content, including hexanal, 2-methyl-butanol, nonanal, (E)-2-hexenal, methyleugenol, ethyl acetate, butanoic acid-pentyl ester, butanoic acid-hexyl ester, butyric acid ethyl ester, acetic acid-2-methyl-butyl ester, treated with spraying amino acids compared with the control. More specifically, hexanal, 2-methyl-butanol, methyleugenol and acetic acid-2-methyl-butyl ester exhibited a greater substantial increase of their contents than those of in other ingredients. However, butanoic acid-2-methyl-2-methyl butyl ester maintained a highest level among all aroma components regardless of different amino acids application. Furthermore, the activities of alcohol dehydrogenase (ADH) and alcohol acyltransferase (AAT) were much higher under Ala treatment than those under other treatments. We concluded that foliar-applied organic nitrogen (N), especially for Ala, can improve aroma metabolism and it could be used in production to enhance fruit quality on a commercial scale. (author)

  2. Involvement of plasma membrane peroxidases and oxylipin pathway in the recovery from phytoplasma disease in apple (Malus domestica).

    Science.gov (United States)

    Patui, Sonia; Bertolini, Alberto; Clincon, Luisa; Ermacora, Paolo; Braidot, Enrico; Vianello, Angelo; Zancani, Marco

    2013-06-01

    Apple trees (Malus domestica Borkh.) may be affected by apple proliferation (AP), caused by 'Candidatus Phytoplasma mali'. Some plants can spontaneously recover from the disease, which implies the disappearance of symptoms through a phenomenon known as recovery. In this article it is shown that NAD(P)H peroxidases of leaf plasma membrane-enriched fractions exhibited a higher activity in samples from both AP-diseased and recovered plants. In addition, an increase in endogenous SA was characteristic of the symptomatic plants, since its content increased in samples obtained from diseased apple trees. In agreement, phenylalanine ammonia lyase (PAL) activity, a key enzyme of the phenylpropanoid pathway, was increased too. Jasmonic acid (JA) increased only during recovery, in a phase subsequent to the pathological state, and in concomitance to a decline of salicylic acid (SA). Oxylipin pathway, responsible for JA synthesis, was not induced during the development of AP-disease, but it appeared to be stimulated when the recovery occurred. Accordingly, lipoxygenase (LOX) activity, detected in plasma membrane-enriched fractions, showed an increase in apple leaves obtained from recovered plants. This enhancement was paralleled by an increase of hydroperoxide lyase (HPL) activity, detected in leaf microsomes, albeit the latter enzyme was activated in either the disease or recovery conditions. Hence, a reciprocal antagonism between SA- and JA-pathways could be suggested as an effective mechanism by which apple plants react to phytoplasma invasions, thereby providing a suitable defense response leading to the establishment of the recovery phenomenon. Copyright © Physiologia Plantarum 2012.

  3. Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica) fruit.

    Science.gov (United States)

    Atkinson, Ross G; Sutherland, Paul W; Johnston, Sarah L; Gunaseelan, Kularajathevan; Hallett, Ian C; Mitra, Deepali; Brummell, David A; Schröder, Roswitha; Johnston, Jason W; Schaffer, Robert J

    2012-08-02

    While there is now a significant body of research correlating apple (Malus x domestica) fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1), there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in 'Royal Gala' apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. PG1-suppressed 'Royal Gala' apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. These findings confirm PG1's role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

  4. Evaluation of the hormonal state of columnar apple trees (Malus x domestica) based on high throughput gene expression studies.

    Science.gov (United States)

    Krost, Clemens; Petersen, Romina; Lokan, Stefanie; Brauksiepe, Bastienne; Braun, Peter; Schmidt, Erwin R

    2013-02-01

    The columnar phenotype of apple trees (Malus x domestica) is characterized by a compact growth habit with fruit spurs instead of lateral branches. These properties provide significant economic advantages by enabling high density plantings. The columnar growth results from the presence of a dominant allele of the gene Columnar (Co) located on chromosome 10 which can appear in a heterozygous (Co/co) or homozygous (Co/Co) state. Although two deep sequencing approaches could shed some light on the transcriptome of columnar shoot apical meristems (SAMs), the molecular mechanisms of columnar growth are not yet elaborated. Since the influence of phytohormones is believed to have a pivotal role in the establishment of the phenotype, we performed RNA-Seq experiments to study genes associated with hormone homeostasis and clearly affected by the presence of Co. Our results provide a molecular explanation for earlier findings on the hormonal state of columnar apple trees. Additionally, they allow hypotheses on how the columnar phenotype might develop. Furthermore, we show a statistically approved enrichment of differentially regulated genes on chromosome 10 in the course of validating RNA-Seq results using additional gene expression studies.

  5. Suppressing Sorbitol Synthesis Substantially Alters the Global Expression Profile of Stress Response Genes in Apple (Malus domestica) Leaves.

    Science.gov (United States)

    Wu, Ting; Wang, Yi; Zheng, Yi; Fei, Zhangjun; Dandekar, Abhaya M; Xu, Kenong; Han, Zhenhai; Cheng, Lailiang

    2015-09-01

    Sorbitol is a major product of photosynthesis in apple (Malus domestica) that is involved in carbohydrate metabolism and stress tolerance. However, little is known about how the global transcript levels in apple leaves respond to decreased sorbitol synthesis. In this study we used RNA sequencing (RNA-seq) profiling to characterize the transcriptome of leaves from transgenic lines of the apple cultivar 'Greensleeves' exhibiting suppressed expression of aldose-6-phosphate reductase (A6PR) to gain insights into sorbitol function and the consequences of decreased sorbitol synthesis on gene expression. We observed that, although the leaves of the low sorbitol transgenic lines accumulate higher levels of various primary metabolites, only very limited changes were found in the levels of transcripts associated with primary metabolism. We suggest that this is indicative of post-transcriptional and/or post-translational regulation of primary metabolite accumulation and central carbon metabolism. However, we identified significantly enriched gene ontology terms belonging to the 'stress related process' category in the antisense lines (P-value sorbitol plays a role in the responses of apple trees to abiotic and biotic stresses. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  6. The effect of apple (Malus Domestica juice on the damage of mice liver cells due to paracetamol treatment

    Directory of Open Access Journals (Sweden)

    Anthony Hartanto

    2009-07-01

    Full Text Available The liver is an important organ for body metabolism process. Liver disease is one of serious health problems in developing countries including Indonesia. Liver damage is caused by viral infection, toxic agent exposure (medications, alcohol, hormonal disturbance, neoplasm and autoimmune diseases. The use of high dose paracetamol to reduce pain also leads to liver damage. Apple (Malus domestica juice is a natural anti oxidant agent. This laboratory experimental study was performed to discover the effect of giving apple juice on damaged cell regeneration due to the use of paracetamol. The study was performed in 21 male mice from Swiss-Webster strain that were divided into group I, II, and III. Group, I served as control while group II received 1 mg/ml paracetamol dose for 5 days and Group III received 1 mg/ml paracetamol for 5 days and 1 ml of apple juice on the 5th to 10th day. The observation of the mice liver cells was conducted using a light microscope with 400x magnification to get the number of necrotic liver cells per view field. The results of this study showed a difference in the number of necrotic liver cells between Group II and III. ANOVA statistical test ( = 0.05 concluded that apple juice significantly helps regeneration process in damaged liver cells caused by paracetamol.

  7. Down-regulation of POLYGALACTURONASE1 alters firmness, tensile strength and water loss in apple (Malus x domestica fruit

    Directory of Open Access Journals (Sweden)

    Atkinson Ross G

    2012-08-01

    Full Text Available Abstract Background While there is now a significant body of research correlating apple (Malus x domestica fruit softening with the cell wall hydrolase ENDO-POLYGALACTURONASE1 (PG1, there is currently little knowledge of its physiological effects in planta. This study examined the effect of down regulation of PG1 expression in ‘Royal Gala’ apples, a cultivar that typically has high levels of PG1, and softens during fruit ripening. Results PG1-suppressed ‘Royal Gala’ apples harvested from multiple seasons were firmer than controls after ripening, and intercellular adhesion was higher. Cell wall analyses indicated changes in yield and composition of pectin, and a higher molecular weight distribution of CDTA-soluble pectin. Structural analyses revealed more ruptured cells and free juice in pulled apart sections, suggesting improved integrity of intercellular connections and consequent cell rupture due to failure of the primary cell walls under stress. PG1-suppressed lines also had reduced expansion of cells in the hypodermis of ripe apples, resulting in more densely packed cells in this layer. This change in morphology appears to be linked with reduced transpirational water loss in the fruit. Conclusions These findings confirm PG1’s role in apple fruit softening and suggests that this is achieved in part by reducing cellular adhesion. This is consistent with previous studies carried out in strawberry but not with those performed in tomato. In apple PG1 also appears to influence other fruit texture characters such as juiciness and water loss.

  8. Molecular cloning and functional analysis of a blue light receptor gene MdCRY2 from apple (Malus domestica).

    Science.gov (United States)

    Li, Yuan-Yuan; Mao, Ke; Zhao, Cheng; Zhao, Xian-Yan; Zhang, Rui-Fen; Zhang, Hua-Lei; Shu, Huai-Rui; Hao, Yu-Jin

    2013-04-01

    MdCRY2 was isolated from apple fruit skin, and its function was analyzed in MdCRY2 transgenic Arabidopsis. The interaction between MdCRY2 and AtCOP1 was found by yeast two-hybrid and BiFC assays. Cryptochromes are blue/ultraviolet-A (UV-A) light receptors involved in regulating various aspects of plant growth and development. Investigations of the structure and functions of cryptochromes in plants have largely focused on Arabidopsis (Arabidopsis thaliana), tomato (Solanum lycopersicum), pea (Pisum sativum), and rice (Oryza sativa). However, no data on the function of CRY2 are available in woody plants. In this study, we isolated a cryptochrome gene, MdCRY2, from apple (Malus domestica). The deduced amino acid sequences of MdCRY2 contain the conserved N-terminal photolyase-related domain and the flavin adenine dinucleotide (FAD) binding domain, as well as the C-terminal DQXVP-acidic-STAES (DAS) domain. Relationship analysis indicates that MdCRY2 shows the highest similarity to the strawberry FvCRY protein. The expression of MdCRY2 is induced by blue/UV-A light, which represents a 48-h circadian rhythm. To investigate the function of MdCRY2, we overexpressed the MdCRY2 gene in a cry2 mutant and wild type (WT) Arabidopsis, assessed the phenotypes of the resulting transgenic plants, and found that MdCRY2 functions to regulate hypocotyl elongation, root growth, flower initiation, and anthocyanin accumulation. Furthermore, we examined the interaction between MdCRY2 and AtCOP1 using a yeast two-hybrid assay and a bimolecular fluorescence complementation assay. These data provide functional evidence for a role of blue/UV-A light-induced MdCRY2 in controlling photomorphogenesis in apple.

  9. Shoot bending promotes flower bud formation by miRNA-mediated regulation in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Xing, Libo; Zhang, Dong; Zhao, Caiping; Li, Youmei; Ma, Juanjuan; An, Na; Han, Mingyu

    2016-02-01

    Flower induction in apple (Malus domestica Borkh.) trees plays an important life cycle role, but young trees produce fewer and inferior quality flower buds. Therefore, shoot bending has become an important cultural practice, significantly promoting the capacity to develop more flower buds during the growing seasons. Additionally, microRNAs (miRNAs) play essential roles in plant growth, flower induction and stress responses. In this study, we identified miRNAs potentially involved in the regulation of bud growth, and flower induction and development, as well as in the response to shoot bending. Of the 195 miRNAs identified, 137 were novel miRNAs. The miRNA expression profiles revealed that the expression levels of 68 and 27 known miRNAs were down-regulated and up-regulated, respectively, in response to shoot bending, and that the 31 differentially expressed novel miRNAs between them formed five major clusters. Additionally, a complex regulatory network associated with auxin, cytokinin, abscisic acid (ABA) and gibberellic acid (GA) plays important roles in cell division, bud growth and flower induction, in which related miRNAs and targets mediated regulation. Among them, miR396, 160, 393, and their targets associated with AUX, miR159, 319, 164, and their targets associated with ABA and GA, and flowering-related miRNAs and genes, regulate bud growth and flower bud formation in response to shoot bending. Meanwhile, the flowering genes had significantly higher expression levels during shoot bending, suggesting that they are involved in this regulatory process. This study provides a framework for the future analysis of miRNAs associated with multiple hormones and their roles in the regulation of bud growth, and flower induction and formation in response to shoot bending in apple trees. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  10. Genome-wide identification and analysis of the aldehyde dehydrogenase (ALDH) gene superfamily in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Li, Xiaoqin; Guo, Rongrong; Li, Jun; Singer, Stacy D; Zhang, Yucheng; Yin, Xiangjing; Zheng, Yi; Fan, Chonghui; Wang, Xiping

    2013-10-01

    Aldehyde dehydrogenases (ALDHs) represent a protein superfamily encoding NAD(P)(+)-dependent enzymes that oxidize a wide range of endogenous and exogenous aliphatic and aromatic aldehydes. In plants, they are involved in many biological processes and play a role in the response to environmental stress. In this study, a total of 39 ALDH genes from ten families were identified in the apple (Malus × domestica Borkh.) genome. Synteny analysis of the apple ALDH (MdALDH) genes indicated that segmental and tandem duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of these gene families in apple. Moreover, synteny analysis between apple and Arabidopsis demonstrated that several MdALDH genes were found in the corresponding syntenic blocks of Arabidopsis, suggesting that these genes appeared before the divergence of lineages that led to apple and Arabidopsis. In addition, phylogenetic analysis, as well as comparisons of exon-intron and protein structures, provided further insight into both their evolutionary relationships and their putative functions. Tissue-specific expression analysis of the MdALDH genes demonstrated diverse spatiotemporal expression patterns, while their expression profiles under abiotic stress and various hormone treatments indicated that many MdALDH genes were responsive to high salinity and drought, as well as different plant hormones. This genome-wide identification, as well as characterization of evolutionary relationships and expression profiles, of the apple MdALDH genes will not only be useful for the further analysis of ALDH genes and their roles in stress response, but may also aid in the future improvement of apple stress tolerance. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  11. Chilling-related cell damage of apple (Malus × domestica Borkh.) fruit cortical tissue impacts antioxidant, lipid and phenolic metabolism.

    Science.gov (United States)

    Leisso, Rachel S; Buchanan, David A; Lee, Jinwook; Mattheis, James P; Sater, Chris; Hanrahan, Ines; Watkins, Christopher B; Gapper, Nigel; Johnston, Jason W; Schaffer, Robert J; Hertog, Maarten L A T M; Nicolaï, Bart M; Rudell, David R

    2015-02-01

    'Soggy breakdown' (SB) is an internal flesh disorder of 'Honeycrisp' apple (Malus × domestica Borkh.) fruit that occurs during low temperature storage. The disorder is a chilling injury (CI) in which visible symptoms typically appear after several weeks of storage, but information about the underlying metabolism associated with its induction and development is lacking. The metabolic profile of flesh tissue from wholly healthy fruit and brown and healthy tissues from fruit with SB was characterized using gas chromatography-mass spectrometry (GC-MS) and liquid chromatograph-mass spectrometry (LC-MS). Partial least squares discriminant analysis (PLS-DA) and correlation networks revealed correlation among ester volatile compounds by composition and differences in phytosterol, phenolic and putative triacylglycerides (TAGs) metabolism among the tissues. anova-simultaneous component analysis (ASCA) was used to test the significance of metabolic changes linked with tissue health status. ASCA-significant components included antioxidant compounds, TAGs, and phytosterol conjugates. Relative to entirely healthy tissues, elevated metabolite levels in symptomatic tissue included γ-amino butyric acid, glycerol, sitosteryl (6'-O-palmitoyl) β-d-glucoside and sitosteryl (6'-O-stearate) β-d-glucoside, and TAGs containing combinations of 16:0, 18:3, 18:2 and 18:1 fatty acids. Reduced metabolite levels in SB tissue included 5-caffeoyl quinate, β-carotene, catechin, epicatechin, α-tocopherol, violaxanthin and sitosteryl β-d glucoside. Pathway analysis indicated aspects of primary metabolism differed according to tissue condition, although differences in metabolites involved were more subtle than those of some secondary metabolites. The results implicate oxidative stress and membrane disruption processes in SB development and constitute a diagnostic metabolic profile for the disorder. © 2014 Scandinavian Plant Physiology Society.

  12. A gene expression analysis of cell wall biosynthetic genes in Malus × domestica infected by ‘Candidatus Phytoplasma mali’

    Science.gov (United States)

    Guerriero, Gea; Giorno, Filomena; Ciccotti, Anna Maria; Schmidt, Silvia; Baric, Sanja

    2016-01-01

    Apple proliferation (AP) represents a serious threat to several fruit-growing areas and is responsible for great economic losses. Several studies have highlighted the key role played by the cell wall in response to pathogen attack. The existence of a cell wall integrity signaling pathway which senses perturbations in the cell wall architecture upon abiotic/biotic stresses and activates specific defence responses has been widely demonstrated in plants. More recently a role played by cell wall-related genes has also been reported in plants infected by phytoplasmas. With the aim of shedding light on the cell wall response to AP disease in the economically relevant fruit-tree Malus × domestica Borkh., we investigated the expression of the cellulose (CesA) and callose synthase (CalS) genes in different organs (i.e., leaves, roots and branch phloem) of healthy and infected symptomatic outdoor-grown trees, sampled over the course of two time points (i.e., spring and autumn 2011), as well as in in vitro micropropagated control and infected plantlets. A strong up-regulation in the expression of cell wall biosynthetic genes was recorded in roots from infected trees. Secondary cell wall CesAs showed up-regulation in the phloem tissue from branches of infected plants, while either a down-regulation of some genes or no major changes were observed in the leaves. Micropropagated plantlets also showed an increase in cell wall-related genes and constitute a useful system for a general assessment of gene expression analysis upon phytoplasma infection. Finally, we also report the presence of several ‘knot’-like structures along the roots of infected apple trees and discuss the occurrence of this interesting phenotype in relation to the gene expression results and the modalities of phytoplasma diffusion. PMID:23086810

  13. Dormancy alleviation by NO or HCN leading to decline of protein carbonylation levels in apple (Malus domestica Borkh.) embryos.

    Science.gov (United States)

    Krasuska, Urszula; Ciacka, Katarzyna; Dębska, Karolina; Bogatek, Renata; Gniazdowska, Agnieszka

    2014-08-15

    Deep dormancy of apple (Malus domestica Borkh.) embryos can be overcome by short-term pre-treatment with nitric oxide (NO) or hydrogen cyanide (HCN). Dormancy alleviation of embryos modulated by NO or HCN and the first step of germination depend on temporary increased production of reactive oxygen species (ROS). Direct oxidative attack on some amino acid residues or secondary reactions via reactive carbohydrates and lipids can lead to the formation of protein carbonyl derivatives. Protein carbonylation is a widely accepted covalent and irreversible modification resulting in inhibition or alteration of enzyme/protein activities. It also increases the susceptibility of proteins to proteolytic degradation. The aim of this work was to investigate protein carbonylation in germinating apple embryos, the dormancy of which was removed by pre-treatment with NO or HCN donors. It was performed using a quantitative spectrophotometric method, while patterns of carbonylated protein in embryo axes were analyzed by immunochemical techniques. The highest concentration of protein carbonyl groups was observed in dormant embryos. It declined in germinating embryos pre-treated with NO or HCN, suggesting elevated degradation of modified proteins during seedling formation. A decrease in the concentration of carbonylated proteins was accompanied by modification in proteolytic activity in germinating apple embryos. A strict correlation between the level of protein carbonyl groups and cotyledon growth and greening was detected. Moreover, direct in vitro carbonylation of BSA treated with NO or HCN donors was analyzed, showing action of both signaling molecules as protein oxidation agents. Copyright © 2014 Elsevier GmbH. All rights reserved.

  14. Genome-wide identification and analysis of the SBP-box family genes in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Li, Jun; Hou, Hongmin; Li, Xiaoqin; Xiang, Jiang; Yin, Xiangjing; Gao, Hua; Zheng, Yi; Bassett, Carole L; Wang, Xiping

    2013-09-01

    SQUAMOSA promoter binding protein (SBP)-box genes encode a family of plant-specific transcription factors and play many crucial roles in plant development. In this study, 27 SBP-box gene family members were identified in the apple (Malus × domestica Borkh.) genome, 15 of which were suggested to be putative targets of MdmiR156. Plant SBPs were classified into eight groups according to the phylogenetic analysis of SBP-domain proteins. Gene structure, gene chromosomal location and synteny analyses of MdSBP genes within the apple genome demonstrated that tandem and segmental duplications, as well as whole genome duplications, have likely contributed to the expansion and evolution of the SBP-box gene family in apple. Additionally, synteny analysis between apple and Arabidopsis indicated that several paired homologs of MdSBP and AtSPL genes were located in syntenic genomic regions. Tissue-specific expression analysis of MdSBP genes in apple demonstrated their diversified spatiotemporal expression patterns. Most MdmiR156-targeted MdSBP genes, which had relatively high transcript levels in stems, leaves, apical buds and some floral organs, exhibited a more differential expression pattern than most MdmiR156-nontargeted MdSBP genes. Finally, expression analysis of MdSBP genes in leaves upon various plant hormone treatments showed that many MdSBP genes were responsive to different plant hormones, indicating that MdSBP genes may be involved in responses to hormone signaling during stress or in apple development. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  15. A PR-4 gene identified from Malus domestica is involved in the defense responses against Botryosphaeria dothidea.

    Science.gov (United States)

    Bai, Suhua; Dong, Chaohua; Li, Baohua; Dai, Hongyi

    2013-01-01

    Pathogenesis-related protein-4 (PR-4) family is a group of proteins with a Barwin domain in C-terminus and generally thought to be involved in plant defense responses. However, their detailed roles are poorly understood in defense of apple plant against pathogenic infection. In the present study, a new PR-4 gene (designated as MdPR-4) was identified from Malus domestica, and its roles in defense responses of apple were investigated. The open reading frame of MdPR-4 gene is of 447 bp encoding a protein of 148 amino acids with a Barwin domain in C-terminus and a signal peptide of 26 amino acids in N-terminus. Sequence and structural analysis indicated that MdPR-4 protein belongs to class II of PR-4 family. The high-level expression of MdPR-4 was observed in flowers and leaves as revealed by quantitative real time PCR. The temporal expression analysis demonstrated that MdPR-4 expression could be up-regulated by Botryosphaeria dothidea infection and salicylic acid (SA) or methyl jasmonate (MeJA) treatment, but suppressed by diethyldithiocarbamic acid (DIECA). In vitro assays, recombinant MdPR-4 protein exhibited ribonuclease activity specific for single strand RNA and significant inhibition to hyphal growth of three apple pathogenic fungi B. dothidea, Valsa ceratosperma and Glomerella cingulata. Moreover, the inhibition was reduced by the presence of 5'-ADP. Taken all together, the results indicate that MdPR-4 protein is involved in the defense responses of apple against pathogenic attack by directly inhibiting hyphal growth, and the inhibition is correlated with its ribonuclease activity, where as MdPR-4 expression is regulated by both SA and JA signaling pathway. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  16. Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development

    Science.gov (United States)

    Schaeffer, Scott M.; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie

    2017-01-01

    Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids—chromoplasts—are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant ‘Granny Smith’, carotenoid-predominant ‘Golden Delicious’, and anthocyanin-predominant ‘Top Red Delicious’. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex biochemistry of plastids in perennial non-model systems. PMID:28698906

  17. Physiological and phenotypic variations between columnar and standard apple (Malus x domestica Borkh.) trees

    DEFF Research Database (Denmark)

    Talwara, Susheela

    Columnar apple trees have very determined growth habit, short internodes, nearly absent branching and can be planted densely in the orchards to obtain higher yields. Such tree architecture provides a possibility for automation and mechanization in agriculture and hence lowering the labour cost wh...... the variations between columnar and standard apple trees. This knowledge provides a better insight on the production abilities of the columnar apple trees which may be useful for future crop improvement strategies.......Columnar apple trees have very determined growth habit, short internodes, nearly absent branching and can be planted densely in the orchards to obtain higher yields. Such tree architecture provides a possibility for automation and mechanization in agriculture and hence lowering the labour cost...... on the physiological and phenotypic characteristics of the columnar apple trees were made by comparing them with the standard traditionally grown non-columnar apple trees. Data from the leaves morphological and anatomical studies and from various physiological investigations have been assembled to compare...

  18. The distribution and impact of common copy-number variation in the genome of the domesticated apple, Malus x domestica Borkh.

    Science.gov (United States)

    Boocock, James; Chagné, David; Merriman, Tony R; Black, Michael A

    2015-10-23

    Copy number variation (CNV) is a common feature of eukaryotic genomes, and a growing body of evidence suggests that genes affected by CNV are enriched in processes that are associated with environmental responses. Here we use next generation sequence (NGS) data to detect copy-number variable regions (CNVRs) within the Malus x domestica genome, as well as to examine their distribution and impact. CNVRs were detected using NGS data derived from 30 accessions of M. x domestica analyzed using the read-depth method, as implemented in the CNVrd2 software. To improve the reliability of our results, we developed a quality control and analysis procedure that involved checking for organelle DNA, not repeat masking, and the determination of CNVR identity using a permutation testing procedure. Overall, we identified 876 CNVRs, which spanned 3.5 % of the apple genome. To verify that detected CNVRs were not artifacts, we analyzed the B- allele-frequencies (BAF) within a single nucleotide polymorphism (SNP) array dataset derived from a screening of 185 individual apple accessions and found the CNVRs were enriched for SNPs having aberrant BAFs (P apple scab. We present the first analysis and catalogue of CNVRs in the M. x domestica genome. The enrichment of the CNVRs with R gene models and their overlap with gene loci of agricultural significance draw attention to a form of unexplored genetic variation in apple. This research will underpin further investigation of the role that CNV plays within the apple genome.

  19. Mapping in an apple (Malus x domestica) F1 segregating population based on physical clustering of differentially expressed genes.

    Science.gov (United States)

    Jensen, Philip J; Fazio, Gennaro; Altman, Naomi; Praul, Craig; McNellis, Timothy W

    2014-04-04

    Apple tree breeding is slow and difficult due to long generation times, self-incompatibility, and complex genetics. The identification of molecular markers linked to traits of interest is a way to expedite the breeding process. In the present study, we aimed to identify genes whose steady-state transcript abundance was associated with inheritance of specific traits segregating in an apple (Malus × domestica) rootstock F1 breeding population, including resistance to powdery mildew (Podosphaera leucotricha) disease and woolly apple aphid (Eriosoma lanigerum). Transcription profiling was performed for 48 individual F1 apple trees from a cross of two highly heterozygous parents, using RNA isolated from healthy, actively-growing shoot tips and a custom apple DNA oligonucleotide microarray representing 26,000 unique transcripts. Genome-wide expression profiles were not clear indicators of powdery mildew or woolly apple aphid resistance phenotype. However, standard differential gene expression analysis between phenotypic groups of trees revealed relatively small sets of genes with trait-associated expression levels. For example, thirty genes were identified that were differentially expressed between trees resistant and susceptible to powdery mildew. Interestingly, the genes encoding twenty-four of these transcripts were physically clustered on chromosome 12. Similarly, seven genes were identified that were differentially expressed between trees resistant and susceptible to woolly apple aphid, and the genes encoding five of these transcripts were also clustered, this time on chromosome 17. In each case, the gene clusters were in the vicinity of previously identified major quantitative trait loci for the corresponding trait. Similar results were obtained for a series of molecular traits. Several of the differentially expressed genes were used to develop DNA polymorphism markers linked to powdery mildew disease and woolly apple aphid resistance. Gene expression profiling

  20. Freezing pattern and frost killing temperature of apple (Malus domestica) wood under controlled conditions and in nature.

    Science.gov (United States)

    Pramsohler, Manuel; Hacker, Jürgen; Neuner, Gilbert

    2012-07-01

    The freezing pattern and frost killing temperatures of apple (Malus domestica Borkh.) xylem were determined by differential thermal analysis and infrared differential thermal analysis (IDTA). Results from detached or attached twigs in controlled freezing experiments and during natural field freezing of trees were compared. Non-lethal freezing of apoplastic water in apple xylem as monitored during natural winter frosts in the field occurred at -1.9 ± 0.4 °C and did not change seasonally. The pattern of whole tree freezing was variable and specific to the environmental conditions. On detached twigs high-temperature freezing exotherms (HTEs) occurred 2.8 K below the temperature observed under natural frosts in the field with a seasonal mean of -4.7 ± 0.5 °C. Microporous apple xylem showed freezing without a specific pattern within a few seconds in IDTA images during HTEs, which is in contrast to macroporous xylem where a 2D freezing pattern mirrors anatomical structures. The pith tissue always remained unfrozen. Increasing twig length increased ice nucleation temperature; for increased twig diameter the effect was not significant. In attached twigs frozen in field portable freezing chambers, HTEs were recorded at a similar mean temperature (-4.6 ± 1.0 °C) to those for detached twigs. Upon lethal intracellular freezing of apple xylem parenchyma cells (XPCs) low-temperature freezing exotherms (LTEs) can be recorded. Low-temperature freezing exotherms determined on detached twigs varied significantly between a winter minimum of -36.9 °C and a summer maximum -12.7 °C. Within the temperature range wherein LTEs were recorded by IDTA in summer (-12.7 ± 0.5 to -20.3 ± 1.1 °C) various tiny clearly separated discontinuous freezing events could be detected similar to that in other species with contrasting XPC anatomy. These freezing events appeared to be initially located in the primary and only later in the secondary xylem. During the LTE no

  1. Study of the optimal production process and application of apple fruit (malus domestica (l.) borkh) fermentation

    International Nuclear Information System (INIS)

    Zhang, J.; Shao, W.; Ziang, R.

    2015-01-01

    In orchard production, fruit abscission is common due to insect damage, disease, crop thinning and natural dropping. However, the utilization of these discarded plant resources has received little research attention. In this study, we used apple fruit from such plant resources, mainly young and mature dropped fruit, as materials and mixed them with a fermentation agent, brown sugar and water. The effects of the proportion of fermentation agent and the fermentation conditions (O2, temperature, fermenting time and fruit crushing degree) were studied using an orthogonal experimental design. We discovered a novel fermented fertilizer, apple fruit fermentation nutrient solution (AFF), for which the optimal fermentation formula and conditions were comminuted young apples: fermentation agent: brown sugar: water weight ratio of 5:0.1:1:4 and 45 days of aerobic fermentation. Analysis of the fermentation solutions showed that the supernatant obtained using these optimized parameters had the highest mineral element content among the fermentation formulas and conditions studied. The results of a spraying experiment with 200-, 500- and 800-fold dilutions showed that AFF significantly promoted the net photosynthetic rate, leaf area and thickness, specific leaf weight, and chlorophyll and mineral element content in the leaves of young apple trees relative to the control treatment. The effects of 200-fold diluted AFF on the photosynthetic rate, the developmental quality and mineral element contents were greater than those of the 500- and 800-fold dilutions. The results of the spraying of adult trees with 200-fold diluted AFF compared to a water control demonstrated that AFF significantly enhanced the average weight of a single fruit, the shape index, hardness, content of soluble solids, titratable acid content, vitamin C content, and aroma compound content of the fruit of the adult trees. This evidence suggests that the AFF obtained using the optimal production process could

  2. Overexpression of a Novel Apple NAC Transcription Factor Gene, MdNAC1, Confers the Dwarf Phenotype in Transgenic Apple (Malus domestica)

    Science.gov (United States)

    Jia, Dongfeng; Gong, Xiaoqing; Li, Mingjun; Li, Chao; Sun, Tingting

    2018-01-01

    Plant height is an important trait for fruit trees. The dwarf characteristic is commonly associated with highly efficient fruit production, a major objective when breeding for apple (Malus domestica). We studied the function of MdNAC1, a novel NAC transcription factor (TF) gene in apple related to plant dwarfing. Localized primarily to the nucleus, MdNAC1 has transcriptional activity in yeast cells. Overexpression of the gene results in a dwarf phenotype in transgenic apple plants. Their reduction in size is manifested by shorter, thinner stems and roots, and a smaller leaf area. The transgenics also have shorter internodes and fewer cells in the stems. Levels of endogenous abscisic acid (ABA) and brassinosteroid (BR) are lower in the transgenic plants, and expression is decreased for genes involved in the biosynthesis of those phytohormones. All of these findings demonstrate that MdNAC1 has a role in plants dwarfism, probably by regulating ABA and BR production. PMID:29702625

  3. Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.

    2009-01-01

    On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported...... for the quantitative allocation of plant cell wall monomers into relevant structural polysaccharide elements. By this method the relative molar distribution (mol %) of the different polysaccharides in the red wine grape skins was estimated as 57-62 mol % homogalacturonan, 6.0-14 mol % cellulose, 10-11 mol % xyloglucan......, 7 mol % arabinan, 4.5-5.0 mol % rhamnogalacturonan I, 3.5-4.0 mol % rhamnogalacturonan II, 3 mol % arabinogalactan, and 0.5-1.0 mol % mannans; the ranges indicate minor variations in the skin composition of the three different cultivars. These cell wall polysaccharides made up similar to 43...

  4. The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars.

    Science.gov (United States)

    Wei, Xiaoyu; Liu, Fengli; Chen, Cheng; Ma, Fengwang; Li, Mingjun

    2014-01-01

    In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of "Gala" apple. Genes for sugar alcohol [including 17 sorbitol transporters (SOTs)], sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs). Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

  5. The Malus domestica sugar transporter gene family: identifications based on genome and expression profiling related to the accumulation of fruit sugars

    Directory of Open Access Journals (Sweden)

    Xiaoyu eWei

    2014-11-01

    Full Text Available In plants, sugar transporters are involved not only in long-distance transport, but also in sugar accumulations in sink cells. To identify members of sugar transporter gene families and to analyze their function in fruit sugar accumulation, we conducted a phylogenetic analysis of the Malus domestica genome. Expression profiling was performed with shoot tips, mature leaves, and developed fruit of ‘Gala’ apple. Genes for sugar alcohol (including 17 sorbitol transporters, sucrose, and monosaccharide transporters, plus SWEET genes, were selected as candidates in 31, 9, 50, and 27 loci, respectively, of the genome. The monosaccharide transporter family appears to include five subfamilies (30 MdHTs, 8 MdEDR6s, 5 MdTMTs, 3 MdvGTs, and 4 MdpGLTs. Phylogenetic analysis of the protein sequences indicated that orthologs exist among Malus, Vitis, and Arabidopsis. Investigations of transcripts revealed that 68 candidate transporters are expressed in apple, albeit to different extents. Here, we discuss their possible roles based on the relationship between their levels of expression and sugar concentrations. The high accumulation of fructose in apple fruit is possibly linked to the coordination and cooperation between MdTMT1/2 and MdEDR6. By contrast, these fruits show low MdSWEET4.1 expression and a high flux of fructose produced from sorbitol. Our study provides an exhaustive survey of sugar transporter genes and demonstrates that sugar transporter gene families in M. domestica are comparable to those in other species. Expression profiling of these transporters will likely contribute to improving our understanding of their physiological functions in fruit formation and the development of sweetness properties.

  6. Application of a high-speed breeding technology to apple (Malus × domestica) based on transgenic early flowering plants and marker-assisted selection.

    Science.gov (United States)

    Flachowsky, Henryk; Le Roux, Pierre-Marie; Peil, Andreas; Patocchi, Andrea; Richter, Klaus; Hanke, Magda-Viola

    2011-10-01

    Breeding of apple (Malus × domestica) remains a slow process because of protracted generation cycles. Shortening the juvenile phase to achieve the introgression of traits from wild species into prebreeding material within a reasonable time frame is a great challenge. In this study, we evaluated early flowering transgenic apple lines overexpressing the BpMADS4 gene of silver birch with regard to tree morphology in glasshouse conditions. Based on the results obtained, line T1190 was selected for further analysis and application to fast breeding. The DNA sequences flanking the T-DNA were isolated and the T-DNA integration site was mapped on linkage group 4. The inheritance and correctness of the T-DNA integration were confirmed after meiosis. A crossbred breeding programme was initiated by crossing T1190 with the fire blight-resistant wild species Malus fusca. Transgenic early flowering F(1) seedlings were selected and backcrossed with 'Regia' and 98/6-10 in order to introgress the apple scab Rvi2, Rvi4 and powdery mildew Pl-1, Pl-2 resistance genes and the fire blight resistance quantitative trait locus FB-F7 present in 'Regia'. Three transgenic BC'1 seedlings pyramiding Rvi2, Rvi4 and FB-F7, as well as three other BC'1 seedlings combining Pl-1 and Pl-2, were identified. Thus, the first transgenic early flowering-based apple breeding programme combined with marker-assisted selection was established. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  7. Measuring and modelling the water use of fruit tree orchards in the Western Cape province of South Africa

    CSIR Research Space (South Africa)

    Gush, Mark B

    2012-10-01

    Full Text Available There is increasing competition among the various sectors of the South African economy for limited water resources, and irrigated agriculture is estimated to use approximately 60% of available surface water (NWRS2, 2012). With a 90% dependence on irrigation... ?Cripps Pink? (?Pink Lady?) apple (Malus domestica) orchard in the Koue Bokkeveld region near Ceres (S33? 12? 03.57?; E19? 20? 15.06?), and an eight- year old ?Alpine? nectarine (Prunus persica) orchard near Wolseley (S33? 25? 0.59? and E19? 14? 44...

  8. Genome-wide identification and expression analysis of the B-box gene family in the Apple (Malus domestica Borkh.) genome.

    Science.gov (United States)

    Liu, Xin; Li, Rong; Dai, Yaqing; Chen, Xuesen; Wang, Xiaoyun

    2018-04-01

    The B-box proteins (BBXs) are a family of zinc finger proteins containing one/two B-box domain(s). Compared with intensive studies of animal BBXs, investigations of the plant BBX family are limited, though some specific plant BBXs have been demonstrated to act as transcription factors in the regulation of flowering and photomorphogenesis. In this study, using a global search of the apple (Malus domestica Borkh.) genome, a total of 64 members of BBX (MdBBX) were identified. All the MdBBXs were divided into five groups based on the phylogenetic relationship, numbers of B-boxes contained and whether there was with an additional CCT domain. According to the characteristics of organ-specific expression, MdBBXs were divided into three groups based on the microarray information. An analysis of cis-acting elements showed that elements related to the stress response were prevalent in the promoter sequences of most MdBBXs. Twelve MdBBX members from different groups were randomly selected and exposed to abiotic stresses. Their expressions were up-regulated to some extent in the roots and leaves. Six among 12 MdBBXs were sensitive to osmotic pressure, salt, cold stress and exogenous abscisic acid treatment, with their expressions enhanced more than 20-fold. Our results suggested that MdBBXs may take part in response to abiotic stress.

  9. Root-zone temperatures affect phenology of bud break, flower cluster development, shoot extension growth and gas exchange of 'Braeburn' (Malus domestica) apple trees.

    Science.gov (United States)

    Greer, Dennis H; Wünsche, Jens N; Norling, Cara L; Wiggins, Harry N

    2006-01-01

    We investigated the effects of root-zone temperature on bud break, flowering, shoot growth and gas exchange of potted mature apple (Malus domestica (Borkh.)) trees with undisturbed roots. Soil respiration was also determined. Potted 'Braeburn' apple trees on M.9 rootstock were grown for 70 days in a constant day/night temperature regime (25/18 degrees C) and one of three constant root-zone temperatures (7, 15 and 25 degrees C). Both the proportion and timing of bud break were significantly enhanced as root-zone temperature increased. Rate of floral cluster opening was also markedly increased with increasing root-zone temperature. Shoot length increased but shoot girth growth declined as root-zone temperatures increased. Soil respiration and leaf photosynthesis generally increased as root-zone temperatures increased. Results indicate that apple trees growing in regions where root zone temperatures are or = 15 degrees C. The effect of root-zone temperature on shoot performance may be mediated through the mobilization of root reserves, although the role of phytohormones cannot be discounted. Variation in leaf photosynthesis across the temperature treatments was inadequately explained by stomatal conductance. Given that root growth increases with increasing temperature, changes in sink activity induced by the root-zone temperature treatments provide a possible explanation for the non-stomatal effect on photosynthesis. Irrespective of underlying mechanisms, root-zone temperatures influence bud break and flowering in apple trees.

  10. Development of FT-NIR Models for the Simultaneous Estimation of Chlorophyll and Nitrogen Content in Fresh Apple (Malus Domestica Leaves

    Directory of Open Access Journals (Sweden)

    Elena Tamburini

    2015-01-01

    Full Text Available Agricultural practices determine the level of food production and, to great extent, the state of the global environment. During the last decades, the indiscriminate recourse to fertilizers as well as the nitrogen losses from land application have been recognized as serious issues of modern agriculture, globally contributing to nitrate pollution. The development of a reliable Near-Infra-Red Spectroscopy (NIRS-based method, for the simultaneous monitoring of nitrogen and chlorophyll in fresh apple (Malus domestica leaves, was investigated on a set of 133 samples, with the aim of estimating the nutritional and physiological status of trees, in real time, cheaply and non-destructively. By means of a FT (Fourier Transform-NIR instrument, Partial Least Squares (PLS regression models were developed, spanning a concentration range of 0.577%–0.817% for the total Kjeldahl nitrogen (TKN content (R2 = 0.983; SEC = 0.012; SEP = 0.028, and of 1.534–2.372 mg/g for the total chlorophyll content (R2 = 0.941; SEC = 0.132; SEP = 0.162. Chlorophyll-a and chlorophyll-b contents were also evaluated (R2 = 0.913; SEC = 0.076; SEP = 0.101 and R2 = 0.899; SEC = 0.059; SEP = 0.101, respectively. All calibration models were validated by means of 47 independent samples. The NIR approach allows a rapid evaluation of the nitrogen and chlorophyll contents, and may represent a useful tool for determining nutritional and physiological status of plants, in order to allow a correction of nutrition programs during the season.

  11. Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

    Directory of Open Access Journals (Sweden)

    Menghan Wei

    Full Text Available As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica, pear (Pyrus communis, peach (Prunus persica, plum (Prunus mume and strawberry (Fragaria vesca in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA], while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA. Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR. Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

  12. Transformation of apple (Malus × domestica) using mutants of apple acetolactate synthase as a selectable marker and analysis of the T-DNA integration sites.

    Science.gov (United States)

    Yao, Jia-Long; Tomes, Sumathi; Gleave, Andrew P

    2013-05-01

    Apple acetolactate synthase mutants were generated by site-specific mutagenesis and successfully used as selection marker in tobacco and apple transformation. T-DNA/Apple genome junctions were analysed using genome-walking PCR and sequencing. An Agrobacterium-mediated genetic transformation system was developed for apple (Malus × domestica), using mutants of apple acetolactate synthase (ALS) as a selectable marker. Four apple ALS mutants were generated by site-specific mutagenesis and subsequently cloned under the transcriptional control of the CaMV 35S promoter and ocs 3' terminator, in a pART27-derived plant transformation vector. Three of the four mutations were found to confer resistance to the herbicide Glean(®), containing the active agent chlorsulfuron, in tobacco (Nicotiana tabacum) transformation. In apple transformation, leaf explants infected with Agrobacterium tumefaciens EHA105 containing one of the three ALS mutants resulted in the production of shoots on medium containing 2-8 μg L(-1) Glean(®), whilst uninfected wild-type explants failed to regenerate shoots or survive on medium containing 1 and 3 μg L(-1) Glean(®), respectively. Glean(®)-resistant, regenerated shoots were further multiplied and rooted on medium containing 10 μg L(-1) Glean(®). The T-DNA and apple genome-DNA junctions from eight rooted transgenic apple plants were analysed using genome-walking PCR amplification and sequencing. This analysis confirmed T-DNA integration into the apple genome, identified the genome integration sites and revealed the extent of any vector backbone integration, T-DNA rearrangements and deletions of apple genome DNA at the sites of integration.

  13. Transcriptome analysis of an apple (Malus × domestica) yellow fruit somatic mutation identifies a gene network module highly associated with anthocyanin and epigenetic regulation.

    Science.gov (United States)

    El-Sharkawy, Islam; Liang, Dong; Xu, Kenong

    2015-12-01

    Using RNA-seq, this study analysed an apple (Malus×domestica) anthocyanin-deficient yellow-skin somatic mutant 'Blondee' (BLO) and its red-skin parent 'Kidd's D-8' (KID), the original name of 'Gala', to understand the molecular mechanisms underlying the mutation. A total of 3299 differentially expressed genes (DEGs) were identified between BLO and KID at four developmental stages and/or between two adjacent stages within BLO and/or KID. A weighted gene co-expression network analysis (WGCNA) of the DEGs uncovered a network module of 34 genes highly correlated (r=0.95, P=9.0×10(-13)) with anthocyanin contents. Although 12 of the 34 genes in the WGCNA module were characterized and known of roles in anthocyanin, the remainder 22 appear to be novel. Examining the expression of ten representative genes in the module in 14 diverse apples revealed that at least eight were significantly correlated with anthocyanin variation. MdMYB10 (MDP0000259614) and MdGST (MDP0000252292) were among the most suppressed module member genes in BLO despite being undistinguishable in their corresponding sequences between BLO and KID. Methylation assay of MdMYB10 and MdGST in fruit skin revealed that two regions (MR3 and MR7) in the MdMYB10 promoter exhibited remarkable differences between BLO and KID. In particular, methylation was high and progressively increased alongside fruit development in BLO while was correspondingly low and constant in KID. The methylation levels in both MR3 and MR7 were negatively correlated with anthocyanin content as well as the expression of MdMYB10 and MdGST. Clearly, the collective repression of the 34 genes explains the loss-of-colour in BLO while the methylation in MdMYB10 promoter is likely causal for the mutation. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  14. Response of apple (malus domestica borkh.) cultivars grafted on two rootstocks under sub-humid temperate climate of azad jammu and kashmir

    International Nuclear Information System (INIS)

    Ahmed, M.J.; Gillani, G.M.; Kiani, F.A.

    2013-01-01

    Nine apple (Malus domestica Borkh.) cultivars grafted on two rootstocks were assessed on morphological and biochemical basis under sub-humid temperate region of Azad Jammu and Kashmir. Starking Delicious, Kala Kulu, Fuji, Red Chief, Royal Gala, Red Labnani, Red Delicious, Star Crimson and Sky Spur grafted on local Crab apple and MM.111 were studied for various growth characteristics. Red Chief exhibited maximum (415.8 cm) plant height on crab apple whereas, more flower (1866) tree-1, higher number (967.0) of fruit set tree/sup -1/, fruits matured (490.0) tree/sup -1/ and maximum (46.33 kg) weight of fruits tree/sup -1/ were recorded on MM.111. Minimum duration (5 days) of flowering was presented by Sky Spur on local crab apple while minimum (92.0) days for fruit maturation were required by Royal Gala on MM.111. Maximum (112.5 g) fruit weight, total soluble solids (13.95%), total sugars (10.9 %) and reducing sugars (7.94%) were recorded for Starking Delicious on MM.111. On the other hand more pH (3.51) and ascorbic acid (9.2 %) content were recorded for Kala Kulu on crab apple. Red Chief found to be high yielding cultivar on MM.111 than crab apple while total sugars, TSS and average fruit weight were better for Starking Delicious. It was concluded that performance of apple cultivars were variable on both rootstocks. However, MM.111 proved better than local crab apple under prevailing conditions. (author)

  15. Apple (Malus domestica) MdERF2 negatively affects ethylene biosynthesis during fruit ripening by suppressing MdACS1 transcription.

    Science.gov (United States)

    Li, Tong; Jiang, Zhongyu; Zhang, Lichao; Tan, Dongmei; Wei, Yun; Yuan, Hui; Li, Tianlai; Wang, Aide

    2016-12-01

    Ripening in climacteric fruit requires the gaseous phytohormone ethylene. Although ethylene signaling has been well studied, knowledge of the transcriptional regulation of ethylene biosynthesis is still limited. Here we show that an apple (Malus domestica) ethylene response factor, MdERF2, negatively affects ethylene biosynthesis and fruit ripening by suppressing the transcription of MdACS1, a gene that is critical for biosynthesis of ripening-related ethylene. Expression of MdERF2 was suppressed by ethylene during ripening of apple fruit, and we observed that MdERF2 bound to the promoter of MdACS1 and directly suppressed its transcription. Moreover, MdERF2 suppressed the activity of the promoter of MdERF3, a transcription factor that we found to bind to the MdACS1 promoter, thereby increasing MdACS1 transcription. We determined that the MdERF2 and MdERF3 proteins directly interact, and this interaction suppresses the binding of MdERF3 to the MdACS1 promoter. Moreover, apple fruit with transiently downregulated MdERF2 expression showed higher ethylene production and faster ripening. Our results indicate that MdERF2 negatively affects ethylene biosynthesis and fruit ripening in apple by suppressing the transcription of MdACS1 via multiple mechanisms, thereby acting as an antagonist of positive ripening regulators. Our findings offer a deep understanding of the transcriptional regulation of ethylene biosynthesis during climacteric fruit ripening. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.

  16. Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection.

    Science.gov (United States)

    Wei, Menghan; Wang, Sanhong; Dong, Hui; Cai, Binhua; Tao, Jianmin

    2016-01-01

    As one of the Ca2+ sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and strawberry (Fragaria vesca) in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD) or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA]), while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA). Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR). Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.

  17. Comparative ultrastructure of fruit plastids in three genetically diverse genotypes of apple (Malus × domestica Borkh.) during development.

    Science.gov (United States)

    Schaeffer, Scott M; Christian, Ryan; Castro-Velasquez, Nohely; Hyden, Brennan; Lynch-Holm, Valerie; Dhingra, Amit

    2017-10-01

    Comparative ultrastructural developmental time-course analysis has identified discrete stages at which the fruit plastids undergo structural and consequently functional transitions to facilitate subsequent development-guided understanding of the complex plastid biology. Plastids are the defining organelle for a plant cell and are critical for myriad metabolic functions. The role of leaf plastid, chloroplast, is extensively documented; however, fruit plastids-chromoplasts-are poorly understood, especially in the context of the diverse metabolic processes operating in these diverse plant organs. Recently, in a comparative study of the predicted plastid-targeted proteomes across seven plant species, we reported that each plant species is predicted to harbor a unique set of plastid-targeted proteins. However, the temporal and developmental context of these processes remains unknown. In this study, an ultrastructural analysis approach was used to characterize fruit plastids in the epidermal and collenchymal cell layers at 11 developmental timepoints in three genotypes of apple (Malus × domestica Borkh.): chlorophyll-predominant 'Granny Smith', carotenoid-predominant 'Golden Delicious', and anthocyanin-predominant 'Top Red Delicious'. Plastids transitioned from a proplastid-like plastid to a chromoplast-like plastid in epidermis cells, while in the collenchyma cells, they transitioned from a chloroplast-like plastid to a chloro-chromo-amyloplast plastid. Plastids in the collenchyma cells of the three genotypes demonstrated a diverse array of structures and features. This study enabled the identification of discrete developmental stages during which specific functions are most likely being performed by the plastids as indicated by accumulation of plastoglobuli, starch granules, and other sub-organeller structures. Information regarding the metabolically active developmental stages is expected to facilitate biologically relevant omics studies to unravel the complex

  18. Local Plant Diversity Across Multiple Habitats Supports a Diverse Wild Bee Community in Pennsylvania Apple Orchards.

    Science.gov (United States)

    Kammerer, Melanie A; Biddinger, David J; Rajotte, Edwin G; Mortensen, David A

    2016-02-01

    Wild pollinators supply essential, historically undervalued pollination services to crops and other flowering plant communities with great potential to ensure agricultural production against the loss of heavily relied upon managed pollinators. Local plant communities provision wild bees with crucial floral and nesting resources, but the distribution of floristic diversity among habitat types in North American agricultural landscapes and its effect on pollinators are diverse and poorly understood, especially in orchard systems. We documented floristic diversity in typical mid-Atlantic commercial apple (Malus domestica Borkh.) orchards including the forest and orchard-forest edge ("edge") habitats surrounding orchards in a heterogeneous landscape in south-central Pennsylvania, USA. We also assessed the correlation between plant richness and orchard pollinator communities. In this apple production region, edge habitats are the most species rich, supporting 146 out of 202 plant species recorded in our survey. Plant species richness in the orchard and edge habitats were significant predictors of bee species richness and abundance in the orchard, as well as landscape area of the forest and edge habitats. Both the quantity and quality of forest and edges close to orchards play a significant role in provisioning a diverse wild bee community in this agroecosystem. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Development and validation of a 20K single nucleotide polymorphism (SNP) whole genome genotyping array for apple (Malus × domestica Borkh).

    Science.gov (United States)

    Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

    2014-01-01

    High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

  20. Development and validation of a 20K single nucleotide polymorphism (SNP whole genome genotyping array for apple (Malus × domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Luca Bianco

    Full Text Available High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus. A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs. Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs.

  1. Development and Validation of a 20K Single Nucleotide Polymorphism (SNP) Whole Genome Genotyping Array for Apple (Malus × domestica Borkh)

    Science.gov (United States)

    Bianco, Luca; Cestaro, Alessandro; Sargent, Daniel James; Banchi, Elisa; Derdak, Sophia; Di Guardo, Mario; Salvi, Silvio; Jansen, Johannes; Viola, Roberto; Gut, Ivo; Laurens, Francois; Chagné, David; Velasco, Riccardo; van de Weg, Eric; Troggio, Michela

    2014-01-01

    High-density SNP arrays for genome-wide assessment of allelic variation have made high resolution genetic characterization of crop germplasm feasible. A medium density array for apple, the IRSC 8K SNP array, has been successfully developed and used for screens of bi-parental populations. However, the number of robust and well-distributed markers contained on this array was not sufficient to perform genome-wide association analyses in wider germplasm sets, or Pedigree-Based Analysis at high precision, because of rapid decay of linkage disequilibrium. We describe the development of an Illumina Infinium array targeting 20K SNPs. The SNPs were predicted from re-sequencing data derived from the genomes of 13 Malus × domestica apple cultivars and one accession belonging to a crab apple species (M. micromalus). A pipeline for SNP selection was devised that avoided the pitfalls associated with the inclusion of paralogous sequence variants, supported the construction of robust multi-allelic SNP haploblocks and selected up to 11 entries within narrow genomic regions of ±5 kb, termed focal points (FPs). Broad genome coverage was attained by placing FPs at 1 cM intervals on a consensus genetic map, complementing them with FPs to enrich the ends of each of the chromosomes, and by bridging physical intervals greater than 400 Kbps. The selection also included ∼3.7K validated SNPs from the IRSC 8K array. The array has already been used in other studies where ∼15.8K SNP markers were mapped with an average of ∼6.8K SNPs per full-sib family. The newly developed array with its high density of polymorphic validated SNPs is expected to be of great utility for Pedigree-Based Analysis and Genomic Selection. It will also be a valuable tool to help dissect the genetic mechanisms controlling important fruit quality traits, and to aid the identification of marker-trait associations suitable for the application of Marker Assisted Selection in apple breeding programs. PMID:25303088

  2. Differential response of cell-cycle and cell-expansion regulators to heat stress in apple (Malus domestica) fruitlets.

    Science.gov (United States)

    Flaishman, Moshe A; Peles, Yuval; Dahan, Yardena; Milo-Cochavi, Shira; Frieman, Aviad; Naor, Amos

    2015-04-01

    Temperature is one of the most significant factors affecting physiological and biochemical aspects of fruit development. Current and progressing global warming is expected to change climate in the traditional deciduous fruit tree cultivation regions. In this study, 'Golden Delicious' trees, grown in a controlled environment or commercial orchard, were exposed to different periods of heat treatment. Early fruitlet development was documented by evaluating cell number, cell size and fruit diameter for 5-70 days after full bloom. Normal activities of molecular developmental and growth processes in apple fruitlets were disrupted under daytime air temperatures of 29°C and higher as a result of significant temporary declines in cell-production and cell-expansion rates, respectively. Expression screening of selected cell cycle and cell expansion genes revealed the influence of high temperature on genetic regulation of apple fruitlet development. Several core cell-cycle and cell-expansion genes were differentially expressed under high temperatures. While expression levels of B-type cyclin-dependent kinases and A- and B-type cyclins declined moderately in response to elevated temperatures, expression of several cell-cycle inhibitors, such as Mdwee1, Mdrbr and Mdkrps was sharply enhanced as the temperature rose, blocking the cell-cycle cascade at the G1/S and G2/M transition points. Moreover, expression of several expansin genes was associated with high temperatures, making them potentially useful as molecular platforms to enhance cell-expansion processes under high-temperature regimes. Understanding the molecular mechanisms of heat tolerance associated with genes controlling cell cycle and cell expansion may lead to the development of novel strategies for improving apple fruit productivity under global warming. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  3. Nitrogen availability in an apple orchard with weed management

    Directory of Open Access Journals (Sweden)

    Gustavo Brunetto

    2018-05-01

    Full Text Available ABSTRACT: Weed management in apple orchards (Malus domestica can affect the leaching of nitrogen (N in soil. The study aimed to evaluate the potential leaching of N forms in soil of an apple orchard with different weed management treatments. The experiment was conducted in an apple orchard implanted in 2008. In October 2011, 80 plants were selected and the following treatments were implemented: no weed management (NM, desiccation of weeds on the tree row with herbicide use (DR and mechanical mowing of weeds on the tree row (MR. Yield was evaluated in the 2011/2012, 2012/2013 and 2013/2014 crop seasons. In May 2012 porous cup lysimeters were installed in the NM, DR and MR treatments. In the solution collected at 0.20m, NH4 +-N and NO3 --N were analyzed sixteen times and mineral N concentration was calculated. The highest concentrations of NO3 --N and mineral N occurred in soil solution with DR, which increases availability of the nutrient to apple trees, but also enhances the potential losses. Weed management and N flow in the solution did not affect apple yield.

  4. Description et modélisation de la croissance et du développement du pommier (Malus x domestica Borkh. I. Structure la plus probable de l'arbre jeune

    Directory of Open Access Journals (Sweden)

    Planchon V.

    2003-01-01

    Full Text Available Description and modelisation of growth and development of appletree (Malus x domestica Borkh.. I. Most probable structure of young tree. Based on the observation of all or, at least, a large number of shoots growing on unpruned apple trees, cv. Cox's Orange Pippin and Jonagold grafted on EM9, an original codification system has been conceived. It allows to locate and identify quickly and unequivocally any shoot or growth. From a comprehensive collection of such codified observations, the most probable structure of young one to five year old trees has been established, with the amount and characters of the different observed shoot types. Both varieties display very similar gross structures, despite minor differences in form, flowering mode and productivity. The development of the trees occurs in two phases. The first one builds up a frame composed by the trunk and several storied sets of branches. Flowering is rather strictly alternate during this phase. The second one consists in the reinforcement of the branches by axillary growth, but even more by sympodial branching due to increasing and repeated terminal flowering. This basic structure provides a reference to appreciate changes in tree development brought about by rootstock, fruit load or training practices.

  5. Effects of location within the tree canopy on carbohydrates, organic acids, amino acids and phenolic compounds in the fruit peel and flesh from three apple (Malus × domestica) cultivars

    Science.gov (United States)

    Feng, Fengjuan; Li, Mingjun; Ma, Fengwang; Cheng, Lailiang

    2014-01-01

    Fruits from three cultivars of apple (Malus × domestica Borkh.)—‘McIntosh’, ‘Gala’ and ‘Mutsu’—were harvested from the exterior and interior of the tree canopy. Peel and flesh tissues were sampled separately to determine how the position of the fruit on the tree might affect the levels of the primary and secondary metabolites in the fruit. Fruit from the outer-canopy had a higher fresh weight and a higher soluble solids content compared with inner-canopy fruit. Both the flesh and peel of the outer-canopy fruit had higher concentrations of soluble sugars and sugar alcohols, but lower starch concentrations than the inner-canopy fruit. Canopy position did not significantly affect malic acid concentrations, except in the peel of ‘McIntosh’ and the flesh of ‘Mutsu’. Although levels of ascorbic and succinic acids were higher in the peel of the outer-canopy fruit, the responses of other organic acids to canopy position depended on tissue type and cultivar. Except for histidine, lysine, threonine and glycine, most amino acids accumulated at higher concentrations in the inner-canopy fruit. By contrast, levels of phenolic compounds from both the peel and flesh were significantly higher in the outer-canopy fruit. The significant effects of location within the canopy on both primary metabolites and secondary metabolites demonstrate the importance of light exposure on apple fruit quality. PMID:26504536

  6. Identification and cloning of an NADPH-dependent hydroxycinnamoyl-CoA double bond reductase involved in dihydrochalcone formation in Malus×domestica Borkh.

    Science.gov (United States)

    Ibdah, Mwafaq; Berim, Anna; Martens, Stefan; Valderrama, Andrea Lorena Herrera; Palmieri, Luisa; Lewinsohn, Efraim; Gang, David R

    2014-11-01

    The apple tree (Malus sp.) is an agriculturally and economically important source of food and beverages. Many of the health beneficial properties of apples are due to (poly)phenolic metabolites that they contain, including various dihydrochalcones. Although many of the genes and enzymes involved in polyphenol biosynthesis are known in many plant species, the specific reactions that lead to the biosynthesis of the dihydrochalcone precursor, p-dihydrocoumaroyl-CoA (3), are unknown. To identify genes involved in the synthesis of these metabolites, existing genome databases of the Rosaceae were screened for apple genes with significant sequence similarity to Arabidopsis alkenal double bond reductases. Herein described are the isolation and characterization of a Malus hydroxycinnamoyl-CoA double bond reductase, which catalyzed the NADPH-dependent reduction of p-coumaroyl-CoA and feruloyl-CoA to p-dihydrocoumaroyl-CoA and dihydroferuloyl-CoA, respectively. Its apparent Km values for p-coumaroyl-CoA, feruloyl-CoA and NADPH were 96.6, 92.9 and 101.3μM, respectively. The Malus double bond reductase preferred feruloyl-CoA to p-coumaroyl-CoA as a substrate by a factor of 2.1 when comparing catalytic efficiencies in vitro. Expression analysis of the hydroxycinnamoyl-CoA double bond reductase gene revealed that its transcript levels showed significant variation in tissues of different developmental stages, but was expressed when expected for involvement in dihydrochalcone formation. Thus, the hydroxycinnamoyl-CoA double bond reductase appears to be responsible for the reduction of the α,β-unsaturated double bond of p-coumaroyl-CoA, the first step of dihydrochalcone biosynthesis in apple tissues, and may be involved in the production of these compounds. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Identification of host fruit volatiles from domestic apple (Malus domestica), native black hawthorn (Crataegus douglasii) and introduced ornamental hawthorn (C. monogyna) attractive to Rhagoletis pomonella flies from the western United States.

    Science.gov (United States)

    Cha, Dong H; Yee, Wee L; Goughnour, Robert B; Sim, Sheina B; Powell, Thomas H Q; Feder, Jeffrey L; Linn, Charles E

    2012-03-01

    The apple maggot fly, Rhagoletis pomonella, infests apple (Malus domestica) and hawthorn species (most notably the downy hawthorn, Crataegus mollis) in the eastern USA. Evidence suggests that the fly was introduced into the western USA sometime in the last 60 years. In addition to apple, R. pomonella also infests two species of hawthorns in the western USA as major hosts: the native black hawthorn (C. douglasii) and the introduced ornamental English hawthorn, C. monogyna. Apple and downy hawthorn-origin flies in the eastern USA use volatile blends emitted from the surface of their respective ripening fruit to find and discriminate among host trees. To test whether the same is true for western flies, we used coupled gas chromatography and electroantennographic detection (GC-EAD) and developed a 7-component apple fruit blend for western apple-origin flies, an 8-component black hawthorn fruit blend for flies infesting C. douglasii, and a 9-component ornamental hawthorn blend for flies from C. monogyna. Crataegus douglasii and C. monogyna-origin flies showed similar levels of upwind directed flight to their respective natal synthetic fruit blends in flight tunnel assays compared to whole fruit adsorbent extracts, indicating that the blends contain all the behaviorally relevant fruit volatiles to induce maximal response levels. The black and ornamental hawthorn blends shared four compounds in common including 3-methylbutan-1-ol, which appears to be a key volatile for R. pomonella populations in the eastern, southern, and western USA that show a preference for fruit from different Crataegus species. However, the blends also differed from one another and from domesticated apple in several respects that make it possible that western R. pomonella flies behaviorally discriminate among fruit volatiles and form ecologically differentiated host races, as is the case for eastern apple and hawthorn flies.

  8. Virus-induced gene silencing of the two squalene synthase isoforms of apple tree (Malus × domestica L.) negatively impacts phytosterol biosynthesis, plastid pigmentation and leaf growth.

    Science.gov (United States)

    Navarro Gallón, Sandra M; Elejalde-Palmett, Carolina; Daudu, Dimitri; Liesecke, Franziska; Jullien, Frédéric; Papon, Nicolas; Dugé de Bernonville, Thomas; Courdavault, Vincent; Lanoue, Arnaud; Oudin, Audrey; Glévarec, Gaëlle; Pichon, Olivier; Clastre, Marc; St-Pierre, Benoit; Atehortùa, Lucia; Yoshikawa, Nobuyuki; Giglioli-Guivarc'h, Nathalie; Besseau, Sébastien

    2017-07-01

    The use of a VIGS approach to silence the newly characterized apple tree SQS isoforms points out the biological function of phytosterols in plastid pigmentation and leaf development. Triterpenoids are beneficial health compounds highly accumulated in apple; however, their metabolic regulation is poorly understood. Squalene synthase (SQS) is a key branch point enzyme involved in both phytosterol and triterpene biosynthesis. In this study, two SQS isoforms were identified in apple tree genome. Both isoforms are located at the endoplasmic reticulum surface and were demonstrated to be functional SQS enzymes using an in vitro activity assay. MdSQS1 and MdSQS2 display specificities in their expression profiles with respect to plant organs and environmental constraints. This indicates a possible preferential involvement of each isoform in phytosterol and/or triterpene metabolic pathways as further argued using RNAseq meta-transcriptomic analyses. Finally, a virus-induced gene silencing (VIGS) approach was used to silence MdSQS1 and MdSQS2. The concomitant down-regulation of both MdSQS isoforms strongly affected phytosterol synthesis without alteration in triterpene accumulation, since triterpene-specific oxidosqualene synthases were found to be up-regulated to compensate metabolic flux reduction. Phytosterol deficiencies in silenced plants clearly disturbed chloroplast pigmentation and led to abnormal development impacting leaf division rather than elongation or differentiation. In conclusion, beyond the characterization of two SQS isoforms in apple tree, this work brings clues for a specific involvement of each isoform in phytosterol and triterpene pathways and emphasizes the biological function of phytosterols in development and chloroplast integrity. Our report also opens the door to metabolism studies in Malus domestica using the apple latent spherical virus-based VIGS method.

  9. The AINTEGUMENTA genes, MdANT1 and MdANT2, are associated with the regulation of cell production during fruit growth in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Dash, Madhumita; Malladi, Anish

    2012-06-25

    Fruit growth in apple (Malus × domestica Borkh.) is mediated by cell production and expansion. Genes involved in regulating these processes and thereby fruit growth, are not well characterized. We hypothesized that the apple homolog(s) of AINTEGUMENTA (ANT), an APETALA2-repeat containing transcription factor, regulates cell production during fruit growth in apple. Two ANT genes, MdANT1 and MdANT2, were isolated from apple and their expression was studied during multiple stages of fruit development. MdANT1 and MdANT2 expression was high during early fruit growth coincident with the period of cell production, rapidly declined during exit from cell production, and remained low during the rest of fruit development. The effects of increase in carbohydrate availability during fruit growth were characterized. Increase in carbohydrate availability enhanced fruit growth largely through an increase in cell production. Expression of MdANT1 and MdANT2 increased sharply by up to around 5-fold in response to an increase in carbohydrate availability. Expression of the ANT genes was compared across two apple genotypes, 'Gala' and 'Golden Delicious Smoothee' (GS), which differ in the extent of fruit growth, largely due to differences in cell production. In comparison to 'Gala', the larger fruit-size genotype, GS, displayed higher levels and a longer duration of MdANT1 and MdANT2 expression. Expression of the ANTs and cell cycle genes in the fruit core and cortex tissues isolated using laser capture microdissection was studied. During early fruit growth, expression of the MdANTs was higher within the cortex, the tissue that constitutes the majority of the fruit. Additionally, MdANT1 and MdANT2 expression was positively correlated with that of A- and B-type CYCLINS, B-type CYCLIN-DEPENDENT-KINASES (CDKBs) and MdDEL1. Multiple lines of evidence from this study suggest that MdANT1 and MdANT2 regulate cell production during fruit growth in apple. ANTs may coordinate the expression of

  10. Delta 13C predicts water deficit sensitivity in Malus sieversii (Ledeb.) M. Roem. from a xerophytic site in Kazakhstan

    Science.gov (United States)

    Modern apples [Malus x domestica (Borkh.)] are thought to have originated in western China from the progenitor species, Malus sieversii (Ledeb.) M. Roem. Due to many generations of selection for traits associated with high fruit quality, our current breeding germplasm has become dangerously narrow....

  11. Malus spp.

    African Journals Online (AJOL)

    Jane

    2011-07-11

    Jul 11, 2011 ... differences in cultivars and plant materials, technology steps such as preventing the explants contamination, selecting culture medium, regulating hormone proportion and exercising seedlings outdoor have been the difficulties in the establishment of regeneration system for. Malus plant, especially for ...

  12. Dermal insecticide residues from birds inhabiting an orchard

    Science.gov (United States)

    Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.

    2007-01-01

    The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.

  13. Transcriptomics of shading-induced and NAA-induced abscission in apple (Malus domestica) reveals a shared pathway involving reduced photosynthesis, alterations in carbohydrate transport and signaling and hormone crosstalk

    Science.gov (United States)

    Naphthaleneacetic acid (NAA), a synthetic auxin analogue, is widely used as an effective thinner in apple orchards. When applied shortly after fruit set, some fruit abscise leading to improved fruit size and quality. However, the thinning results of NAA are inconsistent and difficult to predict, s...

  14. Contrasting responses of soil respiration and temperature sensitivity to land use types: Cropland vs. apple orchard on the Chinese Loess Plateau.

    Science.gov (United States)

    Wang, Rui; Sun, Qiqi; Wang, Ying; Zheng, Wei; Yao, Lunguang; Hu, Yaxian; Guo, Shengli

    2018-04-15

    Land use plays an essential role in regional carbon cycling, potentially influencing the exchange rates of CO 2 flux between soil and the atmosphere in terrestrial ecosystems. Temperature sensitivity of soil respiration (Q 10 ), as an efficient parameter to reflect the possible feedback between the global carbon cycle and climate change, has been extensively studied. However, very few reports have assessed the difference in temperature sensitivity of soil respiration under different land use types. In this study, a three-year field experiment was conducted in cropland (winter wheat, Triticum aestivum L.) and apple orchard (Malus domestica Borkh) on the semi-arid Loess Plateau from 2011 to 2013. Soil respiration (measured using Li-Cor 8100), bacterial community structure (represented by 16S rRNA), soil enzyme activities, and soil physicochemical properties of surface soil were monitored. The average annual soil respiration rate in the apple orchard was 12% greater than that in the cropland (2.01 vs. 1.80μmolm -2 s -1 ), despite that the average Q 10 values in the apple orchard was 15% lower than that in the cropland (ranging from 1.63 to 1.41). As to the differences among predominant phyla, Proteobacteria was 26% higher in the apple orchard than that in the cropland, whereas Actinobacteria and Acidobacteria were 18% and 36% lower in the apple orchard. The β-glucosidase and cellobiohydrolase activity were 15% (44.92 vs. 39.09nmolh -1 g -1 ) and 22% greater (21.39 vs. 17.50nmolh -1 g -1 ) in the apple orchard than that in the cropland. Compared to the cropland, the lower Q 10 values in the apple orchard resulted from the variations of bacterial community structure and β-glucosidase and cellobiohydrolase activity. In addition, the lower C: N ratios in the apple orchard (6.50 vs. 8.40) possibly also contributed to its lower Q 10 values. Our findings call for further studies to include the varying effects of land use types into consideration when applying Q 10 values

  15. Efficient sampling to determine distribution of fruit quality and yield in a commercial apple orchard

    DEFF Research Database (Denmark)

    Martinez Vega, Mabel Virginia; Wulfsohn, D.; Zamora, I.

    2012-01-01

    In situ assessment of fruit quality and yield can provide critical data for marketing and for logistical planning of the harvest, as well as for site-specific management. Our objective was to develop and validate efficient field sampling procedures for this purpose. We used the previously reported...... ‘fractionator’ tree sampling procedure and supporting handheld software (Gardi et al., 2007; Wulfsohn et al., 2012) to obtain representative samples of fruit from a 7.6-ha apple orchard (Malus ×domestica ‘Fuji Raku Raku’) in central Chile. The resulting sample consisted of 70 fruit on 56 branch segments...... of yield. Estimated marketable yield was 295.8±50.2 t. Field and packinghouse records indicated that of 348.2 t sent to packing (52.4 t or 15% higher than our estimate), 263.0 t was packed for export (32.8 t less or -12% error compared to our estimate). The estimated distribution of caliber compared very...

  16. Efficient sampling to determine the distribution of fruit quality and yield in a commercial apple orchard

    DEFF Research Database (Denmark)

    Martinez, M.; Wulfsohn, Dvora-Laio; Zamora, I.

    2012-01-01

    In situ assessment of fruit quality and yield can provide critical data for marketing and for logistical planning of the harvest, as well as for site-specific management. Our objective was to develop and validate efficient field sampling procedures for this purpose. We used the previously reported...... 'fractionator' tree sampling procedure and supporting handheld software (Gardi et al., 2007; Wulfsohn et al., 2012) to obtain representative samples of fruit from a 7.6-ha apple orchard (Malus ×domestica 'Fuji Raku Raku') in central Chile. The resulting sample consisted of 70 fruit on 56 branch segments...... of yield. Estimated marketable yield was 295.8±50.2 t. Field and packinghouse records indicated that of 348.2 t sent to packing (52.4 t or 15% higher than our estimate), 263.0 t was packed for export (32.8 t less or -12% error compared to our estimate). The estimated distribution of caliber compared very...

  17. Transcriptomics of shading-induced and NAA-induced abscission in apple (Malus domestica) reveals a shared pathway involving reduced photosynthesis, alterations in carbohydrate transport and signaling and hormone crosstalk.

    Science.gov (United States)

    Zhu, Hong; Dardick, Chris D; Beers, Eric P; Callanhan, Ann M; Xia, Rui; Yuan, Rongcai

    2011-10-17

    Naphthaleneacetic acid (NAA), a synthetic auxin analogue, is widely used as an effective thinner in apple orchards. When applied shortly after fruit set, some fruit abscise leading to improved fruit size and quality. However, the thinning results of NAA are inconsistent and difficult to predict, sometimes leading to excess fruit drop or insufficient thinning which are costly to growers. This unpredictability reflects our incomplete understanding of the mode of action of NAA in promoting fruit abscission. Here we compared NAA-induced fruit drop with that caused by shading via gene expression profiling performed on the fruit abscission zone (FAZ), sampled 1, 3, and 5 d after treatment. More than 700 genes with significant changes in transcript abundance were identified from NAA-treated FAZ. Combining results from both treatments, we found that genes associated with photosynthesis, cell cycle and membrane/cellular trafficking were downregulated. On the other hand, there was up-regulation of genes related to ABA, ethylene biosynthesis and signaling, cell wall degradation and programmed cell death. While the differentially expressed gene sets for NAA and shading treatments shared only 25% identity, NAA and shading showed substantial similarity with respect to the classes of genes identified. Specifically, photosynthesis, carbon utilization, ABA and ethylene pathways were affected in both NAA- and shading-induced young fruit abscission. Moreover, we found that NAA, similar to shading, directly interfered with leaf photosynthesis by repressing photosystem II (PSII) efficiency within 10 minutes of treatment, suggesting that NAA and shading induced some of the same early responses due to reduced photosynthesis, which concurred with changes in hormone signaling pathways and triggered fruit abscission. This study provides an extensive transcriptome study and a good platform for further investigation of possible regulatory genes involved in the induction of young fruit

  18. Genetical metabolomics in apples (Malus x domestica Borkh)

    NARCIS (Netherlands)

    Khan, S.A.

    2012-01-01

    The aim of this thesis was finding genes that control the production of potentially health beneficial metabolites in apple fruits. The approach was genetic mapping of secondary metabolites such as phenolic compounds in an F1 progeny, leading to the detection of genetic loci that controlled these

  19. Polyphenol profiles of French cider apple varieties (Malus domestica sp.).

    Science.gov (United States)

    Sanoner, P; Guyot, S; Marnet, N; Molle, D; Drilleau, J P

    1999-12-01

    The cortex of 14 French apple varieties (12 cider and 2 juice varieties), one English cider variety, and one dessert apple (i.e., Golden Delicious) were studied for their polyphenol composition. Total polyphenols were assayed by the Folin-Ciocalteu method, and the precise polyphenolic composition (monomeric catechins, proanthocyanidins, hydroxycinnamic acids, and dihydrochalcones) was obtained by HPLC following thiolysis. ESI-MS and ESI-MS/MS analyses showed that chlorogenic acid and p-coumaroylquinic acid were methylated under the conditions of thiolysis. Depending on the variety, the global polyphenol concentration varied from 1 to 7 g per kilogram of fresh cortex. Cider varieties globally showed a higher polyphenol concentration than the dessert apple Golden Delicious, bitter varieties being the more concentrated. The proportion of the polyphenol classes varied greatly from one cultivar to another. For all varieties, procyanidins were always the predominant class. They were mainly constituted of (-)-epicatechin units with a small proportion of (+)-catechin as a terminal unit. The average degree of polymerization ranged between 4.2 and 7.5 depending upon the variety with an exception for the sharp varieties Guillevic and Avrolles which showed significant concentrations of procyanidins with DPn of 40 and 50, respectively.

  20. Ecohydrological interactions between soil and trees in Alpine apple orchards

    Science.gov (United States)

    Penna, Daniele; Scandellari, Francesca; Zanotelli, Damiano; Michael, Engel; Tagliavini, Massimo; Comiti, Francesco

    2016-04-01

    Tracer-based investigations of water exchanges between soil and trees in natural forested catchments are receiving relevant attention in modern ecohydrology. However, the interactions between tree water use and the hydrological cycle in agricultural environments are still poorly understood. In this work, we use stable isotopes of water (2H and 18O) and electric conductivity as tracers to improve our understanding of the functional interrelations between water generating surface runoff and recharging groundwater, and water taken up by apple trees (Malus domestica, cv. 'Pinova') in an Alpine valley in South Tyrol, Northern Italy. From April to October 2015 we monitored two orchards approximately of the same size (roughly 400 m2) and soil texture (silt loam) located in a flat area at different distance from the Adige/Etsch River (50 m vs. 450 m). We have addressed the following questions: i) at which soil depth do apple trees take up water? ii) do apple trees take up water from shallow groundwater? iii) are there differences in the isotopic composition of the water fluxes between the two sites? Samples for isotopic analysis were taken approximately fortnightly from the river, two groundwater wells close to each field, mobile soil water (from suction cups at 25 cm and 50 cm), open area precipitation, throughfall, irrigation and sap (through a portable pressure bomb). Tightly-bound soil water was also cryogenically extracted from samples taken every 10 cm from 60 cm-long soil cores taken at three locations for each field on one occasion in mid-summer. Ancillary measurements were electrical conductivity of all water sources except for sap. In addition to meteorological and discharge data, soil moisture was continuously measured at 10 cm and 50 cm in three locations, and sap flow on three trees, for each field. Preliminary results show that two water pools with distinct isotopic signature exist: i) river water, groundwater and irrigation water show values relatively

  1. Oggetti e memoria domestica

    Directory of Open Access Journals (Sweden)

    Marina Brancato

    2011-12-01

    Full Text Available Questo contributo è un ideale viaggio nella memoria attraverso le stanze che compongono le nostre case. Un itinerario fra gli oggetti che fanno da sfondo quotidiano alla nostra scenografia domestica. Nello specifico indagheremo album fotografici, souvenir, ninnoli (mnemoteche domestiche. Sin dall’inizio abbiamo considerato gli ambienti domestici veri e propri serbatoi di memorie individuali e collettive. In tali serbatoi i soggetti depositano tracce delle proprie biografie, esprimendo e confermando progetti identitari.

  2. Protein (Viridiplantae): 130362 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Malus domestica MEDKLSIVAKSIAPSPIQELSHLARRCNAINLAEGFPDFPAPSHIKHAAISAIHSDFNQYRHVQGICDHLANIMKQMHGLDVNPLTDMA...ICCGQSEALAAAAFAIIDKGDEVILFDPCYETYEGCIKMAGGVSVYVPLDPPHWTLDPNRFINAFNERTKALVLNSPHNPTGK

  3. Salinity-Induced Callus Browning and Re-Differentiation, Root Formation by Plantlets and Anatomical Structures of Plantlet Leaves in Two Malus Species

    International Nuclear Information System (INIS)

    Gou, W.; Zheng, P.; Zheng, P.; Wang, K.; Zhang, L.; Akram, N. A.

    2016-01-01

    Apple (Malus domestica L.) is widely grown in northern China. However, soil salinization has become one of the most severe factors limiting apple productivity in some regions including the Loess Plateau. In our study, the regeneration system of both rootstock Rehd (Malus robusta Rehd) and scion Fuji (Malus domestica Borkh. cv. Fuji) was established In vitro. The two Malus species were cultured on the MS medium containing 0 or 150 mM NaCl to examine salt-induced effects on callus browning and re-differentiation, root formation of plantlets and anatomical structures of plantlet leaves at 15 days old callus and plantlet stages. Salt stress caused a marked increase in callus browning rate, while a decrease in re-differentiation rate, rooting rate, root number and length in both species. Additionally, anatomical structures of plantlet leave showed salt-induced damage such as reduced palisade tissue and intracellular chloroplast, incomplete development of xylem and severe damage of the phloem tissue. Salt stress also caused a few adaptive structural features in leaves including increased thickness of upper and lower epidermis, elevated proportion of spongy tissue and formation of lignified vessels. The responses of the two Malus species did not differ significantly at the differentiation stage. However, they were more sensitive to salinity at the callus stage than those at the plantlet stage in each species. Therefore, callus stage has been found to be more suitable for evaluating responses of the two apple species to salt stress. The Fuji and Rehd could be treated as a good scion/rootstock combination of apple to adapt to soil salinity based on their similar degree of salt stress-tolerance. (author)

  4. A genome-wide expression profile of salt-responsive genes in the apple rootstock Malus zumi.

    Science.gov (United States)

    Li, Qingtian; Liu, Jia; Tan, Dunxian; Allan, Andrew C; Jiang, Yuzhuang; Xu, Xuefeng; Han, Zhenhai; Kong, Jin

    2013-10-18

    In some areas of cultivation, a lack of salt tolerance severely affects plant productivity. Apple, Malus x domestica Borkh., is sensitive to salt, and, as a perennial woody plant the mechanism of salt stress adaption will be different from that of annual herbal model plants, such as Arabidopsis. Malus zumi is a salt tolerant apple rootstock, which survives high salinity (up to 0.6% NaCl). To examine the mechanism underlying this tolerance, a genome-wide expression analysis was performed, using a cDNA library constructed from salt-treated seedlings of Malus zumi. A total of 15,000 cDNA clones were selected for microarray analysis. In total a group of 576 cDNAs, of which expression changed more than four-fold, were sequenced and 18 genes were selected to verify their expression pattern under salt stress by semi-quantitative RT-PCR. Our genome-wide expression analysis resulted in the isolation of 50 novel Malus genes and the elucidation of a new apple-specific mechanism of salt tolerance, including the stabilization of photosynthesis under stress, involvement of phenolic compounds, and sorbitol in ROS scavenging and osmoprotection. The promoter regions of 111 genes were analyzed by PlantCARE, suggesting an intensive cross-talking of abiotic stress in Malus zumi. An interaction network of salt responsive genes was constructed and molecular regulatory pathways of apple were deduced. Our research will contribute to gene function analysis and further the understanding of salt-tolerance mechanisms in fruit trees.

  5. Identification, genealogical structure and population genetics of S-alleles in Malus sieversii, the wild ancestor of domesticated apple.

    Science.gov (United States)

    Ma, X; Cai, Z; Liu, W; Ge, S; Tang, L

    2017-09-01

    The self-incompatibility (SI) gene that is specifically expressed in pistils encodes the SI-associated ribonuclease (S-RNase), functioning as the female-specificity determinant of a gametophytic SI system. Despite extensive surveys in Malus domestica, the S-alleles have not been fully investigated for Malus sieversii, the primary wild ancestor of the domesticated apple. Here we screened the M. sieversii S-alleles via PCR amplification and sequencing, and identified 14 distinct alleles in this species. By contrast, nearly 40 are present in its close wild relative, Malus sylvestris. We further sequenced 8 nuclear genes to provide a neutral reference, and investigated the evolution of S-alleles via genealogical and population genetic analyses. Both shared ancestral polymorphism and an excess of non-synonymous substitution were detected in the S-RNases of the tribe Maleae in Rosaceae, indicating the action of long-term balancing selection. Approximate Bayesian Computations based on the reference neutral loci revealed a severe bottleneck in four of the six studied M. sieversii populations, suggesting that the low number of S-alleles found in this species is mainly the result of diversity loss due to a drastic population contraction. Such a bottleneck may lead to ambiguous footprints of ongoing balancing selection detected at the S-locus. This study not only elucidates the constituents and number of S-alleles in M. sieversii but also illustrates the potential utility of S-allele number shifts in demographic inference for self-incompatible plant species.

  6. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple.

    Science.gov (United States)

    Tian, Ji; Zhang, Jie; Han, Zhen-Yun; Song, Ting-Ting; Li, Jin-Yan; Wang, Ya-Ru; Yao, Yun-Cong

    2017-03-03

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to their promoters, but to be only partially responsible for regulating PAs biosynthetic genes. In contrast, McMYB12b showed preferential binding to the promoters of PAs biosynthetic genes. Overexpression of McMYB12a and McMYB12b in tobacco (Nicotiana tabacum) altered the expression of flavonoid biosynthetic genes and promoted the accumulation of PAs and anthocyanins in tobacco petals. Conversely, transient silencing their expression in crabapple plants, using a conserved gene region, resulted in reduced PAs and anthocyanin production a green leaf phenotype. Meanwhile, transient overexpression of the two genes and silenced McMYB12s in apple (Malus domestica) fruit had a similar effect as overexpression in tobacco and silenced in crabapple. This study reveals a new mechanism for the coordinated regulation of PAs and anthocyanin accumulation in crabapple leaves, which depends on an auto-regulatory balance involving McMYB12a and McMYB12b expression.

  7. Temperaturas efetivas para a dormência da macieira(Malus domestica Borkh Effective temperatures for apple tree dormancy (Malus domestica Borkh

    Directory of Open Access Journals (Sweden)

    Gilberto Luiz Putti

    2003-08-01

    Full Text Available As cultivares de macieira exigem diferentes requerimentos em frio, ou seja, o total de horas abaixo de um limite de temperatura do ar, porém são poucas as informações sobre quais temperaturas são mais eficientes para superar a dormência. As cultivares de macieira Condesa, Baronesa, Daiane, Imperatriz, Fuji e Gala foram estudadas quanto à quantidade de frio e as temperaturas do ar para a indução da brotação. O delineamento experimental foi o inteiramente casualizado, no esquema fatorial, com seis cultivares, cinco níveis de unidades de frio ( 300; 600; 900; 1200 e 1500 UF e três temperaturas do ar ( 5; 10 e 15ºC. O tempo médio para brotação foi menor quando as cultivares foram submetidas a 1.500 unidades de frio, independentemente da temperatura. A temperatura efetiva para acumular frio varia com a cultivar, podendo chegar até 15ºC para cultivares de menor exigência em frio.Apple tree cultivars demand several requirements in cold but there's a little of information about what temperatures are the most efficient. Apple tree cultivars Condesa, Baronesa, Daiane, Imperatriz, Fuji and Gala were studied on quantity of cold and different temperatures for shooting inducement. Experimental delineation was full casualized on the factorial system, with six cultivars, five levels of cold unities and three temperatures. Average time for shooting was minor when the cultivars were exposed to 1,500 cold unities independently of the temperature. Effective temperature in order to accumulate cold ranges according to the cultivar, and it is able reaching until 15ºC in case of cultivar of lower demand in cold.

  8. Conservação da maçã (Malus domestica Borkh. cv. Braeburn Storage in controlled atmosphere of 'Braeburn' (Malus domestica, Borkh. apples

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2000-04-01

    Full Text Available O experimento foi desenvolvido com o objetivo de avaliar o efeito da temperatura e de diferentes regimes de armazenamento em atmosfera controlada (AC sobre as qualidades físico-químicas e ocorrência de distúrbios fisiológicos da maçã cv. Braeburn. O delineamento experimental foi o inteiramente casualizado, com duas repetições e a unidade experimental composta por 40 frutos. Os frutos foram armazenados nas seguintes condições de AC: na temperatura de 1ºC com 1,5kPaO2/ 4,0kPaCO2, 1,5kPaO2/3,0kPaCO2, 1,0kPaO2/1,0kPaCO2, 1,0kPaO2/2,0kPaCO2, 1,0kPaO2/3,0kPaCO2 e em armazenamento refrigerado (AR e na temperatura de 0ºC com 1,0kPaO2/3,0kPaCO2 e em AR. A umidade relativa foi mantida a 96%. As análises laboratoriais foram realizadas aos oito meses de armazenamento, na abertura das câmaras e após sete dias de exposição à temperatura ambiente (±31ºC. Logo após a retirada dos frutos da câmara, não se observaram diferenças significativas na firmeza de polpa, acidez titulável e teor de sólidos solúveis totais (SST entre as condições de AC. Contudo, após sete dias de exposição à temperatura ambiente, o tratamento com 1,0kPaO2/3,0kPaCO2, na temperatura de 0ºC, manteve a firmeza de polpa, acidez titulável e o teor de SST mais elevados, além de não exibir degenerescência senescente. O armazenamento em AC com 4,0kPa de CO2 e o armazenamento refrigerado causaram degenerescência senescente. Já a degenerescência com cortiça foi induzida pelo uso de 3,0 e 4,0kPa de CO2, associado com 1,5kPa de O2. As podridões foram significativamente maiores em AR do que em AC, sendo mais freqüente em baixa concentração de CO2 (1kPa. A incidência de rachaduras e escaldadura foi insignificante e não foi associada a nenhuma condição de armazenamento. No armazenamento refrigerado, os frutos apresentaram qualidade insatisfatória para a comercialização e consumo após oito meses de armazenamento.The experiment was carried out with the objective of evaluating the effect of the temperature and of different controlled atmosphere (CA storage regimes on the fruit qualities, and occurrence of physiological disorders of 'Braeburn' apples. The experimental design was the completely randomized with two replication. Fruits were stored in cold storage at 0 and 1ºC and in the following CA conditions: at temperature of 1ºC with 1,5kPaO2/4,0KkPaCO2, 1,5kPaO2/3,0kPaCO2, 1,0kPaO2/ 1,0kPaCO2, 1,0kPaO2/2,0kPaCO2, 1,0kPaO2/3,0kPaCO2 and at temperature of 0ºC with 1,0kPaO2/3,0kPaCO2. The relative humidity was maintained around 96%. The evaluation was done after eight months of storage, at the opening of the chambers and after seven days shelf life (31ºC. At chambers openning, there was no significant difference in the flesh firmness, titratable acidity and total soluble solids (TSS among the CA conditions. However, after seven days in shelf life, the treatment with 1,0kPaO2/3,0kPaCO2 in the temperature of 0ºC maintained higher flesh firmness, titratable acidity and TSS, and did not exhibiting flesh breakdown. The CA storage, with 4,0kPa CO2 and cold storage caused flesh breakdown. Already the cork breakdown, was induced by 3,0 and 4,0kPa of CO2 associated with 1,5kPa of O2. The occurrence of rot was significantly higher in cold storage than in CA and more frequent al low CO2 (1kPa. The incidence of mealiness and scald could not be associated with any storage condition. Cold storage fruits presented unsatisfactory quality for marketing and consumption after 8 months of storage.

  9. Process-based allometry describes the influence of management on orchard tree aboveground architecture

    Directory of Open Access Journals (Sweden)

    Zachary T. Brym

    2018-06-01

    Full Text Available We evaluated allometric relationships in length, diameter, and mass of branches for two variably managed orchard tree species (tart cherry, Prunus cerasus; apple, Malus spp.. The empirically estimated allometric exponents (a of the orchard trees were described in the context of two processed-based allometry models that make predictions for a: the West, Brown and Enquist fractal branching model (WBE and the recently introduced Flow Similarity model (FS. These allometric models make predictions about relationships in plant morphology (e.g., branch mass, diameter, length, volume, surface area based on constraints imposed on plant growth by physical and physiological processes. We compared our empirical estimates of a to the model predictions to interpret the physiological implications of pruning and management in orchard systems. Our study found strong allometric relationships among the species and individuals studied with limited agreement with the expectations of either model. The 8/3-power law prediction of the mass ∼ diameter relationship by the WBE, indicative of biomechanical limitations, was marginally supported by this study. Length-including allometric relationships deviated from predictions of both models, but shift toward the expectation of flow similarity. In this way, managed orchard trees deviated from strict adherence to the idealized expectations of the models, but still fall within the range of model expectations in many cases despite intensive management.

  10. Effect of root application of 6-benzylamine purine on auxin transport in Malus domestica

    International Nuclear Information System (INIS)

    Stutte, G.

    1987-01-01

    The effect of 6-benzylamine purine (BA) on movement of napthalene acetic acid (NAA) applied to the shoot was investigated. Three-month-old York apple seedlings in sand culture were placed under mercury halide lamps (285 μmol m -2 s -1 ) at 22 0 C for 24 hours; then 13.8, 27.5 or 55 μMol of BA was applied as a soil drench. [ 14 C]-NAA was injected into the shoot at petiole base of 4th mature leaf. After 24 hours plants were harvested and movement of label acropetally to new shoot growth and basipetally to old shoot growth or roots determined. Seventeen (S.E. 3.3) percent of applied label was recovered away from application site. In controls, 67% of 14 C that moved was recovered from new shoot growth, 9% in roots and 24% in old shoot tissue. The 13.8 μMol treatment resulted in 37% of label being recovered in root tissue and 48% in new growth. The 27.5 and 55 μMol applications increased the amount recovered in old shoot tissue but did not increase labelling of root tissues

  11. Dynamic changes in proteins during apple (Malus x domestica) fruit ripening and storage

    OpenAIRE

    Shi, Yun; Jiang, Li; Zhang, Li; Kang, Ruoyi; Yu, Zhifang

    2014-01-01

    A proteomic study, using two-dimensional polyacrylamide gel electrophoresis and matrix-assisted laser desorption/ionization time-of-flight/time-of-flight, was conducted in apple fruit (cv. ‘Golden Delicious’) starting at 10 days prior to harvest through 50 days in storage. Total protein was extracted using a phenol/sodium dodecyl sulfate protocol. More than 400 protein spots were detected in each gel and 55 differentially expressed proteins (p

  12. TREE CANOPY PRUNING DOES NOT REGULATE BIENNIAL BEARING IN ”ELSTAR” APPLE (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Nikola Pavičić

    2004-12-01

    Full Text Available Four alternative pruning strategies (A– 25 generative buds, B– 50 generative buds, C– 75 generative buds and D–100 generative buds per tree for Elstar apple cultivar and their possible impact on improvement in productivity were examined in 1999 and 2000. Year was significant factor for all traits, except yield. The pruning strategy is significant for number of fruits per flower cluster and fruit mass. Interaction year and pruning strategy is significant only for number of fruits per flower cluster. Fruit mass was larger for pruning strategy A compared to the pruning strategies C and D. Yield efficiency and biennial bearing index were not affected by pruning strategies. The biennial bearing index variance was the lowest for the pruning strategy B. Trunk cross sectional area (TCSA had negative impact on fruit mass in pruning strategy C. Correlation between the flower and crop density was positive in pruning strategy A. Flower density was in positive correlation with yield in pruning strategy C. The research shows that tree pruning alone will not result in adequate yield regulation in ‘Elstar’ apple.

  13. Characterization of the MLO gene family in Rosaceae and gene expression analysis in Malus domestica.

    Science.gov (United States)

    Pessina, Stefano; Pavan, Stefano; Catalano, Domenico; Gallotta, Alessandra; Visser, Richard G F; Bai, Yuling; Malnoy, Mickael; Schouten, Henk J

    2014-07-22

    Powdery mildew (PM) is a major fungal disease of thousands of plant species, including many cultivated Rosaceae. PM pathogenesis is associated with up-regulation of MLO genes during early stages of infection, causing down-regulation of plant defense pathways. Specific members of the MLO gene family act as PM-susceptibility genes, as their loss-of-function mutations grant durable and broad-spectrum resistance. We carried out a genome-wide characterization of the MLO gene family in apple, peach and strawberry, and we isolated apricot MLO homologs through a PCR-approach. Evolutionary relationships between MLO homologs were studied and syntenic blocks constructed. Homologs that are candidates for being PM susceptibility genes were inferred by phylogenetic relationships with functionally characterized MLO genes and, in apple, by monitoring their expression following inoculation with the PM causal pathogen Podosphaera leucotricha. Genomic tools available for Rosaceae were exploited in order to characterize the MLO gene family. Candidate MLO susceptibility genes were identified. In follow-up studies it can be investigated whether silencing or a loss-of-function mutations in one or more of these candidate genes leads to PM resistance.

  14. Characterization of the MLO gene family in Rosaceae and gene expression analysis in Malus domestica

    NARCIS (Netherlands)

    Pessina, S.; Pavan, S.N.C.; Catalano, D.; Gallotta, A.; Visser, R.G.F.; Bai, Y.; Malnoy, M.; Schouten, H.J.

    2014-01-01

    Background Powdery mildew (PM) is a major fungal disease of thousands of plant species, including many cultivated Rosaceae. PM pathogenesis is associated with up-regulation of MLO genes during early stages of infection, causing down-regulation of plant defense pathways. Specific members of the MLO

  15. Variability of the polyphenolic composition of cider apple (Malus domestica) fruits and juices.

    Science.gov (United States)

    Guyot, Sylvain; Marnet, Nathalie; Sanoner, Philippe; Drilleau, Jean-François

    2003-10-08

    Five French cider apple varieties were compared on the basis of their detailed polyphenol profile in the cortex and in the juices. Among the factors studied, variety was the most important variability factor in fruits, whereas polyphenol profiles showed an overall stability from one year to another, and a limited decrease of polyphenol concentration was observed during the starch regression period of fruit maturation. In juices, procyanidins remained the preponderant polyphenol class with concentrations up to 2.4 g/L even in centrifuged juices. Compared to the fruits, the average degree of polymerization of procyanidins was significantly reduced in the juice. Centrifugation of the crude juice had only minor effects on the polyphenol composition. For one variety, highly polymerized procyanidins with average degrees of polymerization of 25 were shown to be soluble in the centrifuged juice at a concentration of close to 1.2 g/L. Oxygenation of the juices during processing resulted in a significant decrease of all classes of native polyphenols. Catechins and procyanidins were particularly affected by oxidation, whereas caffeoylquinic acid was partly preserved. The transfer of polyphenols after pressing was maximal for dihydrochalcones and minimal for procyanidins with extraction yield values close to 80 and 30%, respectively.

  16. Transcriptomic analysis of molecular responses in Malus domestica 'M26' roots affected by apple replant disease.

    Science.gov (United States)

    Weiß, Stefan; Bartsch, Melanie; Winkelmann, Traud

    2017-06-01

    Gene expression studies in roots of apple replant disease affected plants suggested defense reactions towards biotic stress to occur which did not lead to adequate responses to the biotic stressors. Apple replant disease (ARD) leads to growth inhibition and fruit yield reduction in replanted populations and results in economic losses for tree nurseries and fruit producers. The etiology is not well understood on a molecular level and causal agents show a great diversity indicating that no definitive cause, which applies to the majority of cases, has been found out yet. Hence, it is pivotal to gain a better understanding of the molecular and physiological reactions of the plant when affected by ARD and later to overcome the disease, for example by developing tolerant rootstocks. For the first time, gene expression was investigated in roots of ARD affected plants employing massive analysis of cDNA ends (MACE) and RT-qPCR. In reaction to ARD, genes in secondary metabolite production as well as plant defense, regulatory and signaling genes were upregulated whereas for several genes involved in primary metabolism lower expression was detected. For internal verification of MACE data, candidate genes were tested via RT-qPCR and a strong positive correlation between both datasets was observed. Comparison of apple 'M26' roots cultivated in ARD soil or γ-irradiated ARD soil suggests that typical defense reactions towards biotic stress take place in ARD affected plants but they did not allow responding to the biotic stressors attack adequately, leading to the observed growth depressions in ARD variants.

  17. Tècniques de maneig de pomera (Malus domestica Borkhausen) en agricultura ecològica

    OpenAIRE

    Alins Valls, Georgina

    2009-01-01

    En la darrera dècada, la superfície en agricultura ecològica a Europa ha experimentat unfort augment, però la producció de fruita dolça encara no arriba a l'1% de la producció totaldegut a les dificultats tècniques que comporta. La producció de pomes en agricultura ecològica planteja tota una sèrie de reptes com l'elecció de la varietat, el control de plagues, malalties i flora arvense i l'aclarida, entre altres. El treball realitzat en aquesta tesi ha tingut com a objectiu incrementar el con...

  18. Changes in quality of apple (Malus domestica) cultivars due to γ-irradiation and storage conditions

    International Nuclear Information System (INIS)

    Hussain, P.R.; Dar, M.A.; Meena, R.S.; Wani, A.M.; Mir, M.A.; Shafi, F.

    2008-01-01

    Ambri, Golden Delicious and Royal Delicious apple varieties were γ-irradiated (0.1-0.5 kGy) and stored under ambient (15 ±2 degC, 80%RH) and refrigerated (3±1 degC, 90%RH) conditions. They were evaluated periodically for firmness, total soluble solids, acidity, juice yield, physiological loss in weight, overall acceptability and yeast and mold counts. The γ-irradiation doses of 0.2, 0.3 and 0.5 kGy proved beneficial in maintaining the overall quality of all the 3 varieties of apple under both the storage conditions. γ-irradiation significantly reduced the yeast and mold counts of apples under storage. (author)

  19. Effect of gamma irradiation on storability of apples (Malus Domestica L.)

    International Nuclear Information System (INIS)

    Al-Bachir, M.

    2000-01-01

    The aim of this study was to investigate the effect of gamma irradiation on storability of the two main apple varieties, Golden Delicious and Starking, in Syria. The experiments were performed in 1995 and 1996. Fruits were irradiated with 0, 0.5, 1.0 and 1,5 kGy. Irradiated and unirradiated fruits were stored at 1 to 2 Centigrade and 80 to 90% Rh. Weight loss and spoilage due to physiological disorders and fungal diseases were evaluated throughout the different storage periods. firmness, coloration and Ph values were estimated immediately after irradiation. The results showed that, in both varieties, gamma irradiation increased the weight loss after 45 days of storage in apples gathered in 1995 but not in the 1996 season. After 180 days of storage, gamma irradiation had different effects on weight loss depending on the growing year and variety, and increased fungal spoilage. Application of gamma irradiation prevented the growth of Aspergillus niger and the formation of skin scald in 'Golden Delicious' fruits. Immediately after treatment, gamma irradiation increased the softening of fruits, changed their color from green to yellow and decreased the Ph value of the juice. (author)

  20. Transcriptomic signatures in seeds of apple (Malus domestica L. Borkh) during fruitlet abscission.

    Science.gov (United States)

    Ferrero, Sergio; Carretero-Paulet, Lorenzo; Mendes, Marta Adelina; Botton, Alessandro; Eccher, Giulia; Masiero, Simona; Colombo, Lucia

    2015-01-01

    Abscission is the regulated process of detachment of an organ from a plant. In apple the abscission of fruits occurs during their early development to control the fruit load depending on the nutritional state of the plant. In order to control production and obtain fruits with optimal market qualities, the horticultural procedure of thinning is performed to further reduce the number of fruitlets. In this study we have conducted a transcriptomic profiling of seeds from two different types of fruitlets, according to size and position in the fruit cluster. Transcriptomic profiles of central and lateral fruit seeds were obtained by RNAseq. Comparative analysis was performed by the functional categorization of differentially expressed genes by means of Gene Ontology (GO) annotation of the apple genome. Our results revealed the overexpression of genes involved in responses to stress, hormone biosynthesis and also the response and/or transport of auxin and ethylene. A smaller set of genes, mainly related to ion transport and homeostasis, were found to be down-regulated. The transcriptome characterization described in this manuscript contributes to unravelling the molecular mechanisms and pathways involved in the physiological abscission of apple fruits and suggests a role for seeds in this process.

  1. Comprehensive QTL mapping survey dissects the complex fruit texture physiology in apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Longhi, Sara; Moretto, Marco; Viola, Roberto; Velasco, Riccardo; Costa, Fabrizio

    2012-02-01

    Fruit ripening is a complex physiological process in plants whereby cell wall programmed changes occur mainly to promote seed dispersal. Cell wall modification also directly regulates the textural properties, a fundamental aspect of fruit quality. In this study, two full-sib populations of apple, with 'Fuji' as the common maternal parent, crossed with 'Delearly' and 'Pink Lady', were used to understand the control of fruit texture by QTL mapping and in silico gene mining. Texture was dissected with a novel high resolution phenomics strategy, simultaneously profiling both mechanical and acoustic fruit texture components. In 'Fuji × Delearly' nine linkage groups were associated with QTLs accounting from 15.6% to 49% of the total variance, and a highly significant QTL cluster for both textural components was mapped on chromosome 10 and co-located with Md-PG1, a polygalacturonase gene that, in apple, is known to be involved in cell wall metabolism processes. In addition, other candidate genes related to Md-NOR and Md-RIN transcription factors, Md-Pel (pectate lyase), and Md-ACS1 were mapped within statistical intervals. In 'Fuji × Pink Lady', a smaller set of linkage groups associated with the QTLs identified for fruit texture (15.9-34.6% variance) was observed. The analysis of the phenotypic variance over a two-dimensional PCA plot highlighted a transgressive segregation for this progeny, revealing two QTL sets distinctively related to both mechanical and acoustic texture components. The mining of the apple genome allowed the discovery of the gene inventory underlying each QTL, and functional profile assessment unravelled specific gene expression patterns of these candidate genes.

  2. Dynamic Transcription profiles of Qinguan apple (Malus × domestica leaves in response to Marssonina coronaria inoculation

    Directory of Open Access Journals (Sweden)

    Junke eZhang

    2015-10-01

    Full Text Available Marssonina apple blotch, caused by the fungus Marssonina coronaria, is one of the most destructive apple diseases in China and East Asia. A better understanding of the plant’s response to fungi during pathogenesis is urgently needed to improve plant resistance and to breed resistant cultivars. To address this, the transcriptomes of ‘Qinguan’ (a cultivar with high resistance to M. coronaria apple leaves were sequenced at 12, 24, 48 and 72 hours post-inoculation (hpi with Marssonina coronaria. The comparative results showed that a total of 1956 genes were differentially expressed between the inoculated and control samples at the 4 time points. Gene ontology (GO term enrichment analysis of differentially expressed genes (DEGs revealed changes in cellular component, secondary metabolism including chalcone isomerase activity, phytoalexin biosynthetic process, anthocyanin-containing compound biosynthetic process, lignin biosynthetic process, positive regulation of flavonoid biosynthetic process; and molecular functions or biological processes related to the defense response, biotic stimulus response, wounding response and fungus response. Kyoto Encyclopedia of Genes and Genomes (KEGG pathway analysis showed that DEGs were significantly enriched in flavonoid biosynthesis, vitamin B6 metabolism, phenylpropanoid biosynthesis, and the stilbenoid, diarylheptanoid and gingerol biosynthesis pathways. Furthermore, the importance of changes in cellular components and partial polyphenol compounds when encountering M. coronaria are discussed.

  3. Solar UV light regulates flavonoid metabolism in apple (Malus x domestica).

    Science.gov (United States)

    Henry-Kirk, Rebecca A; Plunkett, Blue; Hall, Miriam; McGhie, Tony; Allan, Andrew C; Wargent, Jason J; Espley, Richard V

    2018-03-01

    Ultraviolet-B light (UV-B) is one environmental signal perceived by plants that affects the flavonoid pathway and influences the levels of anthocyanins, flavonols, and proanthocyanidins. To understand the mechanisms underlying UV exposure, apple trees were grown under spectral filters that altered transmission of solar UV light. Fruit analysis showed that UV induced changes in physiology, metabolism, and gene expression levels during development over a season. These changes were sustained after storage. Under low UV, ripening was delayed, fruit size decreased, and anthocyanin and flavonols were reduced. Expression analysis showed changes in response to UV light levels for genes in the regulation and biosynthesis of anthocyanin and flavonols. Transcription of flavonol synthase (FLS), ELONGATED HYPOCOTYL 5 (HY5), MYB10, and MYB22 were down-regulated throughout fruit development under reduced UV. Functional testing showed that the FLS promoter was activated by HY5, and this response was enhanced by the presence of MYB22. The MYB22 promoter can also be activated by the anthocyanin regulator, MYB10. As ambient levels of UV light vary around the globe, this study has implications for future crop production, the quality of which can be determined by the response to UV. © 2018 John Wiley & Sons Ltd.

  4. Effect of gamma irradiation on storability of apples (Malus domestica L.)

    Energy Technology Data Exchange (ETDEWEB)

    Al-Bachir, M [Atomic Energy Commission (AECS), Dept. of Radiation Agriculture, Damascus (Syrian Arab Republic)

    1997-12-01

    The effects of gamma irradiation on storability of two main apple varieties in Syria, Golden Delicious and Starking, were investigated. Fruits were irradiated with 0, 0.5, 1, and 1.5 kGy and combined irradiation with 1 kGy after packaging the fruits with polyethylene or paper bags. Irradiated and unirradiated fruits were stored at 1 to 2 C deg and 80 to 90% Rh. Weight loss and spoilage were evaluated throughout the different storage periods. Firmness, coloration and pH values were estimated immediately after irradiation. The results showed that in both varieties, gamma irradiation increased the weight loss after 45 days of storage in the 1995, but not in the 1996 season. After 180 days of storage gamma irradiation had different effects on weight loss depending on the season and variety, and increased the fungal spoilage. Application of gamma irradiation prevented the growth of Aspergillus niger and the formation of skin scald in Golden Delicious fruits. Immediately after treatment, gamma irradiation increased the softening of fruits, changed their colour from green to yellow and decreased the pH value of the juice. Combined treatments decreased the rate of weight loss and skin scald in Golden Delicious fruits and increased the fungal spoilage. (author)

  5. Genes and quality trait loci (QTLs) associated with firmness in Malus x domestica

    KAUST Repository

    Marondedze, Claudius

    2013-03-31

    Fruit firmness, a quality quantitative trait, has long been established as a key textural property and one of the essential parameters for estimating ripening and shelf life of apples. Loss of firmness, also referred to as fruit softening, is undesirable in apples and represents a serious problem for growers in many countries. This results in the reduction of apple shelf life and in turn influences its commercialization. Low firmness impacts negatively on the sensory values of juiciness, crunchiness and crispness. Fruit firmness is affected by the inheritance of alleles at multiple loci and their possible interactions with the environment. Identification of these loci is key for the determination of genetic candidate markers that can be implemented in marker assisted selection and breeding for trees and/or cultivars that can yield firmer fruits with economic value. In turn, this technique can help reduce the time needed to evaluate plants and new cultivars could become available faster. This review provides an overview of quantitative trait loci (QTL), including additional putative QTLs that we have identified, and genes associated with firmness and their importance to biotechnology, the breeding industry and eventually the consumers.

  6. Genes and quality trait loci (QTLs) associated with firmness in Malus x domestica

    KAUST Repository

    Marondedze, Claudius; Thomas, Ludivine

    2013-01-01

    , crunchiness and crispness. Fruit firmness is affected by the inheritance of alleles at multiple loci and their possible interactions with the environment. Identification of these loci is key for the determination of genetic candidate markers that can

  7. Application of Freezing and Thawing in Apple (Malus domestica) Juice Extraction.

    Science.gov (United States)

    Nadulski, Rafał; Kobus, Zbigniew; Wilczyński, Kamil; Zawiślak, Kazimierz; Grochowicz, Józef; Guz, Tomasz

    2016-09-28

    The paper presents the results of the research on the impact of enzymatic liquefaction, freezing and thawing on the efficiency of juice pressure extraction from apple pulp and quality of the obtained juices. The research was conducted using three types of pretreatment prior the pressing: crushing and enzymatic liquefaction in temperature of 25 °C, crushing and enzymatic liquefaction in temperature of 45 °C and crushing followed by freezing and thawing of the pulp. The study included three varieties of apples. The juice was obtained using a laboratory basket press. It was determined that the pretreatment of the pulp as well as the varietal characteristics of the fruits have a significant impact on the efficiency of the pressure extraction process. The enzymatic treatment of the pulp, irrespective of the temperature at which it was conducted, significantly increased the efficiency of the process. No effect of the temperature (25 or 45 °C) of enzymatic treatment on the efficiency of the pressure extraction process was found. Pretreatment of the pulp based on freezing and thawing contributes to the increase of efficiency of pressing in the case of two apple cultivars, that is, Idared and Red Delicious. It was showed that total phenolic content, antioxidant activity, the soluble solids content and juice acidity (pH) depend on the pretreatment of the pulp and the varietal characteristics of apples. Following the application of pretreatment of the pulp, an increase was observed in the content of polyphenols and in the antioxidant activity of the juices obtained. © 2016 Institute of Food Technologists®

  8. Effect of gamma irradiation on bitter pit of apple fruits (Malus Domestica Borkh)

    International Nuclear Information System (INIS)

    Al-Bachir, M.; Farah, S.

    2000-12-01

    Tow varieties of apple fruits Golden and Starking were irradiated with 0, 0.5, 1.0, 1.5 kGy and with 0, 1.0, 1.5 kGy respectively. Irradiated and unirradiated fruits were stored at 1 to 2 centigrade and relative humidity of 80 to 90%. Fruit quality (firmness, skin thickness and bitter pit) and juice characteristics (moisture, ash, carbohydrates, organic acids, Ph, and viscosity), were determined during storage periods (0, 3 and 6 months). The used doses of gamma irradiation significantly decreased the percentage and intensity of bitter pit. Irradiated fruits were softer immediately after irradiation and through storage periods, there were no differences in firmness between irradiated and unirradiated fruits. Gamma irradiation increased the thickness of skin in Golden fruits and decreased it in Starking. Juice production from both varieties immediately after irradiation was not affected by gamma irradiation. However the juice produced from irradiated fruits had higher organic acids (citric and malic acids), viscosity and Ph values than the control. (author)

  9. Impact of shelf life on content of primary and secondary metabolites in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Veberic, Robert; Schmitzer, Valentina; Petkovsek, Maja M; Stampar, Franci

    2010-01-01

    In this study, we evaluated the changes in apple fruit quality during shelf life. After a month of cold storage, apples of cultivars "Jonagold" and "Golden Delicious" were exposed to ambient temperatures for 21 d, with subsequent sampling every 3 or 4 d. Fruit firmness, changes in amounts of sugars, malic acid, and phenolics were observed during shelf life. Chemical analyses were done with HPLC-PDA system. An interchange between various sugars was noticed, but in general, the sum of sugars remained at the same level. The content of malic acid remained stable or dropped, resulting in sweeter fruit. Levels of phenolics were more constant in the pulp of both cultivars analyzed, while in the peel, the changes were more pronounced. In the pulp, a peak in the content of hydroxycinnamic acids and flavanols was noticed on the 2nd or 3rd sampling and afterwards, the amounts remained constant. In the peel an initial decrease of all analyzed phenolic groups was observed in both cultivars, however it was more pronounced in "Jonagold." It can be concluded that changes in primary and secondary metabolites are not the main reason for the lower quality of fruit exposed to ambient temperatures. On the other hand, fruit firmness might be the limiting factor for shelf life duration. © 2010 Institute of Food Technologists®

  10. Localization of candidate allergen genes on the apple (Malus domestica) genome and their putative allergenicity

    NARCIS (Netherlands)

    Gao Zhongshan,

    2005-01-01

    Apple is generally considered as a healthy food, but 2-3% European people can not eat this fruit because it provokes allergy reaction. Four classes of apple allergen genes have been identified, they are Mal d 1, Mal d 2, Mal d 3 and Mal d 4 . This thesis focuses on the genomic characterization of

  11. Development and characterisation of 140 new microsatellites in apple (Malus x domestica Borkh.)

    NARCIS (Netherlands)

    Liebhard, R.; Gianfranceschi, L.; Koller, B.; Ryder, C.D.; Tarchini, R.; Weg, van de W.E.; Gessler, C.

    2002-01-01

    The availability of suitable genetic markers is essential to efficiently select and breed apple varieties of high quality and with multiple disease resistances. Microsatellites (simple sequence repeats, SSR) are very useful in this respect since they are codominant, highly polymorphic, abundant and

  12. Light quality management in fruit orchards: physiological and technological aspects Manejo de la calidad de la luz en huertos frutales: Aspectos fisiológicos y tecnológicos

    Directory of Open Access Journals (Sweden)

    Richard M. Bastías

    2012-12-01

    Full Text Available Light quality (sunlight spectrum management promises to provide a new technological alternative to sustainable production in horticultural crops. However, little information exists about physiological and technological aspects on light quality management in fruit crops. Sunlight composition changes widely in orchard canopies, inducing different plant responses in fruit trees mediated by phytochrome (PHY and cryptochrome (CRY activity. High proportion of far-red (FR in relation to red (R light increases shoot elongation, while blue (B light induces shoot dwarfing. Red and ultraviolet (UV light increases fruit skin anthocyanin synthesis, while FR light shows a negative effect. Red and B light can also alter leaf morpho-physiological traits in fruit trees, such palisade thickness, stomatal aperture, and chlorophyll content. Besides improvement of photosynthetically active radiation (PAR availability, the use of reflective films improves UV and R light proportion, with positive effects on PHY mediated-responses (fruit color, fruit weight, shoot growth, as reported in apple (Malus domestica Borkh., peach (Prunus persica (L. Batsch, and sweet cherry (Prunus avium (L. L.. Colored nets widely alter spectral light composition with effects on plant growth, yield, and quality in apple, kiwifruit (Actinidia deliciosa A. Chev. C.F. Liang & A.R. Ferguson, peach, and blueberry (Vaccinium corymbosum L. orchards. Mechanisms of colored nets seem to be associated to photosynthetic and morphogenetic process regulated by PAR availability, R/B light proportion, and CRY activity. Alteration of light quality affects significantly fruit tree plant responses and could be a useful tool for sustainable (e.g. lower use of chemicals and labor-practices management of yield and quality in modern orchards.El manejo de la calidad de la luz (espectro de la luz solar promete proveer una nueva alternativa tecnológica para la producción sostenible de cultivos hortícolas. Sin

  13. Cryopreservation of apple (Malus spp.): development, progress and future prospects

    Science.gov (United States)

    Apple (Malus sp.) is one of the most economically important temperate fruit crops. Wild Malus genetic resources and existing cultivars provide valuable genes for breeding new elite cultivars and rootstocks through traditional and biotechnological breeding programs. Over the last three decades, great...

  14. Forested landscapes promote richness and abundance of native bees (Hymenoptera: Apoidea: Anthophila) in Wisconsin apple orchards.

    Science.gov (United States)

    Watson, J C; Wolf, A T; Ascher, J S

    2011-06-01

    Wild bees provide vital pollination services for many native and agricultural plant species, yet the landscape conditions needed to support wild bee populations are not well understood or appreciated. We assessed the influence of landscape composition on bee abundance and species richness in apple (Malus spp.) orchards of northeastern Wisconsin during the spring flowering period. A diverse community of bee species occurs in these apple orchards, dominated by wild bees in the families Andrenidae and Halictidae and the honey bee, Apis mellifera L. Proportion of forest area in the surrounding landscape was a significant positive predictor of wild bee abundance in orchards, with strongest effects at a GIS (Geographic Information Systems) buffer distance of 1,000 m or greater. Forest area also was positively associated with species richness, showing strongest effects at a buffer distance of 2,000 m. Nonagricultural developed land (homes, lawns, etcetera) was significantly negatively associated with species richness at buffer distances >750 m and wild bee abundance in bowl traps at all distances. Other landscape variables statistically associated with species richness or abundance of wild bees included proportion area of pasture (positive) and proportion area of roads (negative). Forest area was not associated with honey bee abundance at any buffer distance. These results provide clear evidence that the landscape surrounding apple orchards, especially the proportion of forest area, affects richness and abundance of wild bees during the spring flowering period and should be a part of sustainable land management strategies in agro-ecosystems of northeastern Wisconsin and other apple growing regions.

  15. Orchard navigation using derivative free Kalman filtering

    DEFF Research Database (Denmark)

    Hansen, Søren; Bayramoglu, Enis; Andersen, Jens Christian

    2011-01-01

    This paper describes the use of derivative free filters for mobile robot localization and navigation in an orchard. The localization algorithm fuses odometry and gyro measurements with line features representing the surrounding fruit trees of the orchard. The line features are created on basis of 2...

  16. Cryobiotechnology of apple (Malus spp.): development, progress and future prospects.

    Science.gov (United States)

    Wang, Min-Rui; Chen, Long; Teixeira da Silva, Jaime A; Volk, Gayle M; Wang, Qiao-Chun

    2018-05-01

    Cryopreservation provides valuable genes for further breeding of elite cultivars, and cryotherapy improves the production of virus-free plants in Malus spp., thus assisting the sustainable development of the apple industry. Apple (Malus spp.) is one of the most economically important temperate fruit crops. Wild Malus genetic resources and existing cultivars provide valuable genes for breeding new elite cultivars and rootstocks through traditional and biotechnological breeding programs. These valuable genes include those resistant to abiotic factors such as drought and salinity, and to biotic factors such as fungi, bacteria and aphids. Over the last three decades, great progress has been made in apple cryobiology, making Malus one of the most extensively studied plant genera with respect to cryopreservation. Explants such as pollen, seeds, in vivo dormant buds, and in vitro shoot tips have all been successfully cryopreserved, and large Malus cryobanks have been established. Cryotherapy has been used for virus eradication, to obtain virus-free apple plants. Cryopreservation provided valuable genes for further breeding of elite cultivars, and cryotherapy improved the production of virus-free plants in Malus spp., thus assisting the sustainable development of the apple industry. This review provides updated and comprehensive information on the development and progress of apple cryopreservation and cryotherapy. Future research will reveal new applications and uses for apple cryopreservation and cryotherapy.

  17. Effectiveness of odor-baited trap trees for plum curculio (Coleoptera: Curculionidae) monitoring in commercial apple orchards in the northeast.

    Science.gov (United States)

    Piñero, Jaime C; Agnello, Arthur M; Tuttle, Arthur; Leskey, Tracy C; Faubert, Heather; Koehler, Glen; Los, Lorraine; Morin, Glenn; Leahy, Kathleen; Cooley, Daniel R; Prokopy, Ronald J

    2011-10-01

    The plum curculio, Conotrachelus nenuphar (Herbst), is a key pest of pome and stone fruit in eastern and central North America. For effective management of this insect pest in commercial apple (Malus spp.) orchards in the northeastern United States and Canada, one of the greatest challenges has been to determine the need for and timing of insecticide applications that will protect apple fruit from injury by adults. In a 2004-2005 study, we assessed the efficacy and economic viability of a reduced-risk integrated pest management strategy involving an odor-baited trap tree approach to determine need for and timing of insecticide use against plum curculio based on appearance of fresh egg-laying scars. Evaluations took place in commercial apple orchards in seven northeastern U.S. states. More specifically, we compared the trap-tree approach with three calendar-driven whole-block sprays and with heat-unit accumulation models that predict how long insecticide should be applied to orchard trees to prevent injury by plum curculio late in the season. Trap tree plots received a whole-plot insecticide spray by the time of petal fall, and succeeding sprays (if needed) were applied to peripheral-row trees only, depending on a threshold of one fresh plum curculio egg-laying scar out of 25 fruit sampled from a single trap tree. In both years, level of plum curculio injury to fruit sampled from perimeter-row, the most interior-row trees and whole-plot injury in trap tree plots did not differ significantly from that recorded in plots subject to conventional management or in plots managed using the heat-unit accumulation approach. The amount of insecticide used in trap tree plots was reduced at least by 43% compared with plots managed with the conventional approach. Advantages and potential pitfalls of the bio-based trap tree approach to plum curculio monitoring in apple orchards are discussed.

  18. Ionic gelation of low-esterification degree pectins from immature thinned apples

    OpenAIRE

    Rascón-Chu, Agustín; Martínez-López, Ana-Luisa; Carvajal-Millán, Elizabeth; Martínez-Robinson, Karla G.; Campa-Mada, Alma C.

    2016-01-01

    Fruit thinning is a regular practice in apple (Malus x domestica Borkh.) orchards to increase fruit size and to promote blooming. This practice generates immature, small (10 to 40 mm diameter) fruits, which are occasionally used as cattle feed. The use of thinned apples for pectin extraction could increase orchards profitability and promote development of new transformation processes. Pectin is a polysaccharide located on the cell wall of plant tissues. Commercial pectins are extracted from d...

  19. Pertumbuhan dan Reproduksi Lalat Musca domestica pada Berbagai Media Perkembangbiakan

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2013-02-01

    Full Text Available Abstract. Musca domestica was insect that disturbing human and other animal. Intensity M. Domestica with human living includes public healthy. The aim of research is to observe succeed of Mdomestica in breeding wether difJerent place. Larva growth in each stadia was different, 2-4 days average. Its contributed by humidity. On dry container, pupae that succes eksklosi only 50%. Presentation offood show difJerences oflarvae development. 3rd stage of larvae that has enough food is 17mm in length and 12mm in length for larvae with less food. Salty water make larvae growing faster than water without salto Development of Musca domestica in laboratory injluenced by high humidity, preset of food and adaptation of Musca domestica its self.Keywords : Musca domestica, rearing, development, humidity, food, salt - water

  20. On-farm energy flow in grape orchards

    OpenAIRE

    Mohsen Karimi; Hossein Moghaddam

    2018-01-01

    Efficient use of energy is an important step toward enhancing the sustainability of agricultural systems. In this study, we evaluated the energy balance of grape orchards in Shahriar, Iran. We collected information of energy input and energy output in 120 grape orchards through face to face questionnaires. This information was further used to evaluate net energy, energy use efficiency, energy intensity, and energy productivity in these orchards. The total energy used in grape orchards was 317...

  1. Intracellular localization of Na + /H + antiporter from Malus zumi ...

    African Journals Online (AJOL)

    In this study, we examined the intracellular localization of the product of Na+/H+ antiporter gene (MzNHX1) cloned from Malus zumi. Analysis using yeast cells expressing a fusion protein of MzNHX1 and green fluorescent protein confirmed the localization of MzNHX1 on the tonoplast.

  2. The Polarization of Light and Malus' Law Using Smartphones

    Science.gov (United States)

    Monteiro, Martín; Stari, Cecilia; Cabeza, Cecilia; Marti, Arturo C.

    2017-01-01

    Originally an empirical law, nowadays Malus' law is seen as a key experiment to demonstrate the transverse nature of electromagnetic waves, as well as the intrinsic connection between optics and electromagnetism. In this work, a simple and inexpensive setup is proposed to quantitatively verify the nature of polarized light. A flat computer screen…

  3. Turbulent energy losses during orchard heating

    Energy Technology Data Exchange (ETDEWEB)

    Bland, W.L.

    1979-01-01

    Two rapid-response drag anemometers and low time constant thermocouples, all at 4 m above a heated orchard floor, sampled wind component in the vertical direction and temperature at 30 Hz. The turbulent heat flux calculated revealed not more than 10% of the heat lost from the orchard was via turbulent transort. The observations failed to support previous estimates that at least a third of the energy applied was lost through turbulent transport. Underestimation of heat loss due to mean flow and a newly revealed flux due to spatial variations in the mean flow may explain the unaccounted for loss.

  4. Morfogênese in vitro de brotos de macieira (Malus domestica Borkh. a partir de fragmentos delgados de folhas In vitro morphogenesis of shoots of apple tree (Malus domestica Borkh. Starting from thin fragments of leaves

    Directory of Open Access Journals (Sweden)

    Alan Cristiano Erig

    2005-06-01

    Full Text Available O pré-requisito para se obter sucesso na transformação genética de plantas, e também para a multiplicação rápida do genótipo modificado pela micropropagação, é um protocolo de regeneração eficiente. Objetivou-se com este trabalho estudar a expressão do potencial morfogenético de fragmentos delgados de folhas de macieira e otimizar um protocolo de regeneração visando futuros trabalhos de transformação genética. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema fatorial 3 x 2 x 6, com três cultivares de macieira (Galaxy, Maxigala e Mastergala, dois tipos de explantes (fragmentos finos de folhas cortados no sentido transversal e longitudinal, e seis concentrações de thidiazuron (TDZ no meio de cultura (0; 4,54; 9,08; 13,62; 18,16 e 22,7 µM, totalizando 36 tratamentos. Os sais e vitaminas do meio MS foram acrescidos de mio-inositol (100 mg.L-1, sacarose (30 g.L-1, ágar (6 g.L-1 e adicionados de 1,6 µM ácido naftalenoacético (ANA. Foram utilizados frascos com capacidade para 150 mL com 6 mL de meio de cultura. Os explantes foram obtidos de plantas cultivadas in vitro, em fase de multiplicação, 45 dias após a repicagem, e se constituíram de finos fragmentos da parte mediana de folhas, cortados no sentido transversal (comprimento de 8 a 10 mm ou longitudinal (comprimento de 10 a 12 mm, ambos com largura aproximada de 1 mm. A porcentagem de regeneração, a intensidade de formação de calo e o número de brotos por explante foram avaliados aos 45 dias de cultivo. A partir dos resultados obtidos concluiu-se que a expressão do potencial morfogenético dos fragmentos delgados de folhas cortados no sentido transversal é maior do que o daqueles cortados no sentido longitudinal, e o seu cultivo em meio de cultura com 4,54 µM de TDZ, propicia, simultaneamente, elevada porcentagem de regeneração, maior número de brotos e menor intensidade de calo.The prerequisite to obtain success in the plants genetic transformation, and also for the fast multiplication of the modified genotype through the micropropagation, it is a efficient regeneration protocol. The objective of this work was to study the expression of the morphogenetic potential of thin fragments of apple tree leaves, and to optimize a regeneration protocol seeking futures works of genetic transformation. The completely randomized experimental design was used, in factorial outline 3 x 2 x 6, with three cultivate of apple tree (Galaxy, Maxigala and Mastergala, two explants types (thin fragments of leaves cut in the transversal and longitudinal direction, and six concentrations of thidiazuron (TDZ in the culture medium (0; 4.54; 9.08; 13.62; 18.16 and 22.7 µM, totaling 36 treatments. The MS medium salts and vitamins were added of myo-inositol (100 mg.L-1, sucrose (30 g.L-1, agar (6 g.L-1 and 1.6 µM naphthaleneacetic acid (NAA. Flasks with capacity for 150 mL with 6 mL of culture medium were used. The explants were obtained of plants in vitro cultivated, in multiplication phase, 45 days after the inoculation, and they were constituted of fine fragments of the medium part of leaves, cut in the tranversal direction (length from 8 to 10 mm or longitudinal (length from 10 to 12 mm, both with approximate width of 1 mm. The regeneration percentage, the intensity of callus formation and the number of shoots formed by explant were evaluated by the 45 days of cultivation. Starting from the obtained results it was ended that the expression of the morphogenetic potential of the thin fragments of leaf cut in the transversal direction is higher than those cut in the longitudinal direction, and its cultivation in culture medium with 4.54 µM of TDZ, propitiates, simultaneously, high regeneration percentage, great number of shoots formation and smaller callus intensity.

  5. COMPORTAMENTO DA CULTIVAR DE MACIEIRA FUJI (Malus domestica, Borkh. SOBRE TRÊS DIFERENTES PORTA-ENXERTOS BEHAVIOUR OF THE APPLE CULTIVAR FUJI (Malus domestica, Borkh. ONTO THREE DIFFERENT ROOTSTOCKS

    Directory of Open Access Journals (Sweden)

    FREDERICO DENARDI

    2001-12-01

    Full Text Available Verifica-se, a nível mundial, uma forte tendência para o plantio da macieira em alta densidade de cultivo. Neste sistema de plantio, são utilizados porta-enxertos de pequeno porte, conhecidos como anões. O mais utilizado é o M-9, em virtude do forte controle sobre o porte da copa, da precocidade de produção, da alta produtividade e da boa qualidade dos frutos que induz à copa. No Sul do Brasil, por questões de tradição internacional, facilidade de obtenção e do menor custo de investimento no plantio, até recentemente, têm sido plantados porta-enxertos de vigor médio, como o MM-106, o M-7 e o MM-111, para plantios de média densidade. O primeiro é atualmente pouco usado devido à alta suscetibilidade à podridão-do-colo (Phytophthora cactorum. O objetivo deste trabalho foi comparar o desempenho do anão M-9, do semi-anão M-7 e do semivigoroso MM-111 no controle do vigor da copa, na precocidade de produção, na produtividade e no tamanho dos frutos da cv. de macieira Fuji. O experimento foi conduzido em blocos ao acaso, com 4 repetições de 3 plantas por parcela. Como copa, foi utilizada a cv. Fuji, polinizada pela cv. Gala. O experimento foi implantado em 1996, em Fraiburgo-SC, principal pólo produtor de maçãs do País. O espaçamento de cultivo foi de 2,0 m por 5,0 m. O experimento foi conduzido por 4 anos, avaliando-se a precocidade (n0 de gemas de flor/cm² de área transversal do caule, produção (kg/planta, produtividade (t/ha, peso médio dos frutos (g e distribuição dos frutos por categoria de tamanho (%. Os resultados obtidos indicaram que o M-9 foi o mais precoce, produzindo, no terceiro ano, 1,94 vez mais gemas de flor que o M-7 e 2,70 vezes mais que o MM-111. Em termos de produção, no terceiro ano, o M-9 produziu 2,53 vezes mais que o M-7 e 2,70 vezes mais que o MM-111. No quarto ano, o M-9 produziu 1,28 vez mais que o M-7 e 1,26 vez mais que o MM-111. O peso médio dos frutos foi de 159,2 g, 135,5 g e 131,2 g, para o M-9, o M-7 e o MM-111, respectivamente. Em termos de distribuição por categoria de tamanho, o M-9 produziu 90,8% de frutos maiores que 62 mm, o M-7 produziu 79,5% e o MM-111, 70,9%, indicando que o M-9, além de mais precoce e mais produtivo, também produz frutos de maior calibre.There is a worldwide tendency for planting apples at high density system onto the so called dwarf apple rootstocks, which have a strong effect on controlling the vigor of the trees. The most used is the M-9 due to its efficiency on vigor control, precocity of flowering, high productivity and also good fruit quality it induces to the scion varieties. In South of Brazil more vigorous rootstocks, as MM-106, M-7 and MM-111, have been widely used because worldwide tradition, lower initial cost as they require less trees/ha, and their facility of propagation The objective of this work was to compare the dwarf M-9 with the semi-dwarf M-7 and the semi-vigorous MM-111 concerned to vigor control, precocity of flowering, productivity and fruit quality of the apple cultivar Fuji. The statistical design was on completely randomized blocks, with 4 replications of three trees on each plot. The main cultivar was Fuji, pollinated by cv. Gala. The experiment was established in 1996 in Fraiburgo, the main apple producer area in the country. The layout of planting was 2,0 m within row by 5,0 m between rows. The study was carried out for four years. The parameters evaluated were precocity (n0 of flower buds per cm² of trunk cross sectional area, production (kg/tree, productivity (t/ha, fruit weigh (g and distribution of fruit size (%. The results obtained on the 3rd season showed that M-9 was the most precocious, producing 1.94 times more flower buds per cm² of trunk cross sectional area than on M-7 and 2.7 times more than on MM-111. Concerned to production on 3rd season, M-9 produced 2.5 times more than M-7 and 2.7 times more than MM-111. On the 4th season M-9 produced 1.28 times more than M-7 and 1.26 times more than MM-111 (Table 2. The fruit weight was 159,2 g, 135,5 g and 131,2 g for M-9, M-7 and MM-111, respectively. In terms of distribution of fruit weight, M-9 produced 90,8% of fruits In the class > 62 mm, against 79,5% on M-7 and 70,9% on MM-111, showing that M-9 is not only the most precocious, but it is also the most productive and produces fruits of larger size than M-7 and MM-111.

  6. Effect of gala apples (Malus domestica Borkh on lipidemia of hyperlipidemic rats Efeito da maçã gala (Malus domestica Borkh na lipidemia de ratos hipercolesterolêmicos

    Directory of Open Access Journals (Sweden)

    Jocelem Mastrodi Salgado

    2008-06-01

    Full Text Available A healthy life style and a balanced diet, associated with a high fruit and vegetable intake, are linked to good health and the prevention of diseases. Apples contain bioactive compounds that help in the prevention and control of hyperlipidemia. One of the Public Health concerns in Brazil is to reduce cardiovascular diseases. Therefore, the objective of this work was to analyze the chemical composition of Gala apples and to study the effect of their consumption on weight gain, food intake, serum levels of total cholesterol, HDL-C, LDL-C, triglycerides, hepatic cholesterol and fecal cholesterol in male albino Wistar rats fed a hypercholesterolemic diet. Six animals were utilized for each treatment (control, 5, 15 and 25% apple diet, during 30 and 60 days. This study showed that one apple (200 g can provide 14.5% of recommended total fiber and 55% of recommended vitamin C, besides supplying considerable quantities of phenolic compounds (0.38 g.100 g-1 and tannins (0.16 g.100 g-1. All animals showed a non-significant reduction in their weight gain and food intake with an increase in the concentration of apple in the diets. At the end of 30 days, all of the diets provided a significant reduction in the levels of triglycerides compared to the control group. The 15 and 25% apple diets showed significant reductions in the serum levels of total cholesterol and LDL-C and an increase in the level of fecal cholesterol in relation to the control group. The 25% apple diet provided a significant reduction in the hepatic cholesterol levels compared to the control group. After 60 days, the serum levels of total cholesterol, LDL-C, HDL-C and triglycerides in rats fed with 5, 15 and 25% apple diets were similar to the control group. This probably happened due to a revertion of the process. These results show the importance of Gala apples in the control of hyperlipidemia in rats. A diet rich in vegetables and fruits, including apples, associated to a healthy life style, over time, could prevent or reduce the risk of heart disease.Um estilo de vida saudável e uma dieta balanceada, associados com uma alta ingestão de frutas e vegetais estão ligados também à boa saúde e a prevenção de doenças. Maçãs contêm compostos bioativos que ajudam à prevenção e controle da hiperlipidemia. Uma das preocupações da Saúde Pública no Brasil é reduzir as doenças cardiovasculares. Assim, o objetivo deste trabalho foi analisar a composição química da maçã Gala e estudar o efeito do seu consumo no ganho de peso, comida ingerida, níveis sanguíneos de colesterol total, HDL-C, LDL-C, triglicérides, colesterol hepático e colesterol fecal em ratos albinos Wistar, alimentados com uma dieta hipercolesterolêmica. Foram utilizados seis animais para cada tratamento (controle, 5, 15, e 25% dieta de maçã, durante 30 e 60 dias. Este estudo mostrou que uma maçã (200 g pode contribuir com 14,5% do total de fibras e 55% da vitamina C recomendados, além de suprir consideráveis quantidades de produtos fenólicos (0,38 g .100 g-1 e taninos (0,16 g .100 g-1. Todos os animais mostraram uma redução não significativa no ganho de peso e ingestão de comida com o aumento na quantidade de maçã na sua dieta. Ao final de 30 dias, todas as dietas resultaram em uma redução significativa de triglicérides comparados ao grupo controle. As dietas de 15 e 25% mostraram redução significativa nos níveis séricos de colesterol total e LDL-C e um aumento nos níveis fecais de colesterol em relação ao grupo controle. A dieta de 25% de maçã resultou em uma significativa redução dos níveis de colesterol hepático comparados com o grupo controle. Depois de 60 dias, os níveis séricos de colesterol total, LDL-C, HDL-C e triglicérides em ratos alimentados com 5, 15 e 25% de dieta de maçã eram similares ao grupo controle. Isto, provavelmente foi devido a uma reversão do processo. Estes resultados mostram a importância da maçã Gala no controle da hiperlipidemia em ratos. A dieta rica em vegetais e frutas, incluindo maçãs, e associada a um estilo de vida saudável, com o tempo pode prevenir e reduzir o risco de doenças cardíacas.

  7. Evaluation of the {sup 14}C-prochloraz residue levels in irradiated mangoes (Mangifera indica) and apples (Malus domestica).; Avaliacao dos niveis de residuos de {sup 14}C-prochloraz em mangas (Mangigera indica) irradiadas e em macas (Malus domestica)

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Maria Aparecida

    1998-07-01

    The Brazilian crops mangoes and apples has expanding in the last years. However, tropical fruits crops are susceptible to infection that harms the crop yield. The control of these diseases is made through fungicides such as prochloraz which possesses protecting eradicating action by controlling anthracnose in mangoes and scabies in apples. Agrochemicals are of great importance in the agriculture considering the of relationship cost/benefit. However they may cause a series of problems in the ecosystem, being the levels of agrochemicals residues in fruits one of these factors. The aim of this work was to evaluate the prochloraz levels in mangoes treated in both stages of pre and post harvest, and in apples treated in the pre harvest. In the treatment of the mangoes, the interaction, fungicide with the gamma radiation with dose of 1,0 kGy, was used to induce prochloraz degradation. Treated post harvest mangoes were stored, at 12 deg C during 21 days. The results showed that the prochloraz did not present reduction in the residual levels of the mangoes after 21 day storage, that is the safe period established by the Brazilian legislation on agrochemicals, in treated mangoes. The refrigerated storage (12 deg C) and the gamma radiation also did not contribute to the degradation of the fungicide in mangoes. In average the concentration of the fungicide prochloraz in the peels (bar X = 1,64 mug/g) was higher than in the mangoes pulp (bar x = 0,06 mug/g), which allows the consumption of this fruit, since the peel is always discarded. The degradation product, formed in peels of mangoes in fruits treated in the pre and post harvest was the metabolite BIS 44596; for mangoes treated in the pre-post harvest the metabolite formed was the BIS 445186. Both metabolites were found in very low levels, confirming that occurs degradation of the fungicide in mangoes. In apples treated with the prochloraz, reduction of 500/0 in the levels. (author)

  8. Gamma radiation and thermal treatment effects on the conservation of natural apple (Malus domestica) juice, cv. gala; Efeito da radiacao gama e do tratamento termico na conservacao do suco natural de maca (Malus domestica), cv. gala

    Energy Technology Data Exchange (ETDEWEB)

    Blumer, Lucimara

    1995-12-01

    This work studies the apple juice preservation without chemicals. The samples were exposed to the following treatments: heating (control, 60{sup 0} C/20 min and 80{sup 0} C/20 min); irradiation (control; 2, 4 and 6 kGy); heating plus irradiation. The quality control was carried out by physical and chemical analyses (soluble solids; titratable acidity, pH, ascorbic acid and color), microbiological and sensorial analyses. The samples were stored at refrigeration temperature (5 {+-} 3{sup 0} C) for 180 days. The results showed few variations in the soluble solids, acidity, pH and ascorbic acid for all treatments. However, the 6 kGy dose kept the chemical characteristics of the juice, providing a clear juice, with better appearance and microorganisms free. (author). 24 refs., 11 figs., 12 tabs.

  9. Autonomous Rule Based Robot Navigation In Orchards

    DEFF Research Database (Denmark)

    Andersen, Jens Christian; Ravn, Ole; Andersen, Nils Axel

    2010-01-01

    Orchard navigation using sensor-based localization and exible mission management facilitates successful missions independent of the Global Positioning System (GPS). This is especially important while driving between tight tree rows where the GPS coverage is poor. This paper suggests localization ...

  10. Modification of leaf morphology and anatomy as a consequence of columnar architecture in domestic apple (Malus x domestica Borkh.) trees

    DEFF Research Database (Denmark)

    Talwara, Susheela; Grout, Brian William Wilson; Toldam-Andersen, Torben Bo

    2013-01-01

    A quantitative study has been made of the modifications to leaf morphology and anatomy evident in columnar apples trees when compared to standard ones, using the original cultivar and the first columnar mutant derived from it, as well as other closely and more distantly related cultivars. Signifi......A quantitative study has been made of the modifications to leaf morphology and anatomy evident in columnar apples trees when compared to standard ones, using the original cultivar and the first columnar mutant derived from it, as well as other closely and more distantly related cultivars....... Significant increases in leaf number, area, weight per unit area, thickness and midrib angle, together with altered shape, have been recorded consistently for the leaves subtending the developing fruits of the columnar cultivars. Additionally, significant increases in leaf rolling, epicuticular wax, stomatal...... of leaf characteristics is considered in terms of the very open architectural phenotype of columnar trees and the impact this may have on the canopy microclimate that influences leaf development....

  11. Leaf micro-environment influence the altered foliar phenotype of columnar apple (Malus x domestica Borkh.) trees

    DEFF Research Database (Denmark)

    Talwara, Susheela; Grout, Brian William Wilson; Toldam-Andersen, Torben Bo

    2015-01-01

    in the phenotype of the leaves in the leaf clusters that subtend the fruits of CATs, compared to their standard counterparts. This initial investigation considers standard and columnar trees at different levels of genetic relatedness and records significant increases in leaf area, leaf mass per unit area......Columnar apple trees (CATs) have radically-altered architecture (significantly shorter internodes and lateral branches) when compared to standard apple trees, attributed to a mutation of the Co gene involved in apical dominance. These changes in architecture have been associated with changes......, chlorophyll content and competitive shading in the fruiting leaf clusters of columnar cultivars. Additionally, significant increases in intercepted light have been shown to be associated with the columnar structure, and carbon fixation is also increased. We propose that leaf micro-environment of columnar...

  12. Identification and expression analysis of the IPT and CKX gene families during axillary bud outgrowth in apple (Malus domestica Borkh.).

    Science.gov (United States)

    Tan, Ming; Li, Guofang; Qi, Siyan; Liu, Xiaojie; Chen, Xilong; Ma, Juanjuan; Zhang, Dong; Han, Mingyu

    2018-04-20

    Cytokinins (CKs) play a crucial role in promoting axillary bud outgrowth and targeting the control of CK metabolism can be used to enhance branching in plants. CK levels are maintained mainly by CK biosynthesis (isopentenyl transferase, IPT) and degradation (dehydrogenase, CKX) genes in plants. A systematic study of the IPT and CKX gene families in apple, however, has not been conducted. In the present study, 12 MdIPTs and 12 MdCKXs were identified in the apple genome. Systematic phylogenetic, structural, and synteny analyses were performed. Expression analysis of these genes in different tissues was also assessed. MdIPT and MdCKX genes exhibit distinct expression patterns in different tissues. The response of MdIPT, MdCKX, and MdPIN1 genes to various treatments (6-BA, decapitation and Lovastatin, an inhibitor of CKs synthesis) that impact branching were also investigated. Results indicated that most of the MdIPT and MdCKX, and MdPIN1 genes were upregulated by 6-BA and decapitation treatment, but inhibited by Lovastatin, a compound that effectively suppresses axillary bud outgrowth induced by decapitation. These findings suggest that cytokinin biosynthesis is required for the activation of bud break and the export of auxin from buds in apple tree with intact primary shoot apex or decapitated apple tree. MdCKX8 and MdCKX10, however, exhibited little response to decapitation, but were significantly up-regulated by 6-BA and Lovastatin, a finding that warrants further investigation in order to understand their function in bud-outgrowth. Copyright © 2018 Elsevier B.V. All rights reserved.

  13. Target metabolite and gene transcription profiling during the development of superficial scald in apple (Malus x domestica Borkh).

    Science.gov (United States)

    Busatto, Nicola; Farneti, Brian; Tadiello, Alice; Vrhovsek, Urska; Cappellin, Luca; Biasioli, Franco; Velasco, Riccardo; Costa, Guglielmo; Costa, Fabrizio

    2014-07-20

    Fruit quality features resulting from ripening processes need to be preserved throughout storage for economical reasons. However, during this period several physiological disorders can occur, of which superficial scald is one of the most important, due to the development of large brown areas on the fruit skin surface. This study examined the variation in polyphenolic content with the progress of superficial scald in apple, also with respect to 1-MCP, an ethylene competitor interacting with the hormone receptors and known to interfere with this etiology. The change in the accumulation of these metabolites was further correlated with the gene set involved in this pathway, together with two specific VOCs (Volatile Organic Compounds), α-farnesene and its oxidative form, 6-methyl-5-hepten-2-one. Metabolite profiling and qRT-PCR assay showed these volatiles are more heavily involved in the signalling system, while the browning coloration would seem to be due more to a specific accumulation of chlorogenic acid (as a consequence of the activation of MdPAL and MdC3H), and its further oxidation carried out by a polyphenol oxidase gene (MdPPO). In this physiological scenario, new evidence regarding the involvement of an anti-apoptotic regulatory mechanism for the compartmentation of this phenomenon in the skin alone was also hypothesized, as suggested by the expression profile of the MdDAD1, MdDND1 and MdLSD1 genes. The results presented in this work represent a step forward in understanding the physiological mechanisms of superficial scald in apple, shedding light on the regulation of the specific physiological cascade.

  14. A multidisciplinary approach providing new insight into fruit flesh browning physiology in apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Di Guardo, Mario; Tadiello, Alice; Farneti, Brian; Lorenz, Giorgia; Masuero, Domenico; Vrhovsek, Urska; Costa, Guglielmo; Velasco, Riccardo; Costa, Fabrizio

    2013-01-01

    In terms of the quality of minimally processed fruit, flesh browning is fundamentally important in the development of an aesthetically unpleasant appearance, with consequent off-flavours. The development of browning depends on the enzymatic action of the polyphenol oxidase (PPO). In the 'Golden Delicious' apple genome ten PPO genes were initially identified and located on three main chromosomes (2, 5 and 10). Of these genes, one element in particular, here called Md-PPO, located on chromosome 10, was further investigated and genetically mapped in two apple progenies ('Fuji x Pink Lady' and 'Golden Delicious x Braeburn'). Both linkage maps, made up of 481 and 608 markers respectively, were then employed to find QTL regions associated with fruit flesh browning, allowing the detection of 25 QTLs related to several browning parameters. These were distributed over six linkage groups with LOD values spanning from 3.08 to 4.99 and showed a rate of phenotypic variance from 26.1 to 38.6%. Anchoring of these intervals to the apple genome led to the identification of several genes involved in polyphenol synthesis and cell wall metabolism. Finally, the expression profile of two specific candidate genes, up and downstream of the polyphenolic pathway, namely phenylalanine ammonia lyase (PAL) and polyphenol oxidase (PPO), provided insight into flesh browning physiology. Md-PPO was further analyzed and two haplotypes were characterised and associated with fruit flesh browning in apple.

  15. The Phytoene synthase gene family of apple (Malus x domestica) and its role in controlling fruit carotenoid content.

    Science.gov (United States)

    Ampomah-Dwamena, Charles; Driedonks, Nicky; Lewis, David; Shumskaya, Maria; Chen, Xiuyin; Wurtzel, Eleanore T; Espley, Richard V; Allan, Andrew C

    2015-07-28

    Carotenoid compounds play essential roles in plants such as protecting the photosynthetic apparatus and in hormone signalling. Coloured carotenoids provide yellow, orange and red colour to plant tissues, as well as offering nutritional benefit to humans and animals. The enzyme phytoene synthase (PSY) catalyses the first committed step of the carotenoid biosynthetic pathway and has been associated with control of pathway flux. We characterised four PSY genes found in the apple genome to further understand their involvement in fruit carotenoid accumulation. The apple PSY gene family, containing six members, was predicted to have three functional members, PSY1, PSY2, and PSY4, based on translation of the predicted gene sequences and/or corresponding cDNAs. However, only PSY1 and PSY2 showed activity in a complementation assay. Protein localisation experiments revealed differential localization of the PSY proteins in chloroplasts; PSY1 and PSY2 localized to the thylakoid membranes, while PSY4 localized to plastoglobuli. Transcript levels in 'Granny Smith' and 'Royal Gala' apple cultivars showed PSY2 was most highly expressed in fruit and other vegetative tissues. We tested the transient activation of the apple PSY1 and PSY2 promoters and identified potential and differential regulation by AP2/ERF transcription factors, which suggested that the PSY genes are controlled by different transcriptional mechanisms. The first committed carotenoid pathway step in apple is controlled by MdPSY1 and MdPSY2, while MdPSY4 play little or no role in this respect. This has implications for apple breeding programmes where carotenoid enhancement is a target and would allow co-segregation with phenotypes to be tested during the development of new cultivars.

  16. Identification of SFBB-containing canonical and noncanonical SCF complexes in pollen of apple (Malus × domestica).

    Science.gov (United States)

    Minamikawa, Mai F; Koyano, Ruriko; Kikuchi, Shinji; Koba, Takato; Sassa, Hidenori

    2014-01-01

    Gametophytic self-incompatibility (GSI) of Rosaceae, Solanaceae and Plantaginaceae is controlled by a single polymorphic S locus. The S locus contains at least two genes, S-RNase and F-box protein encoding gene SLF/SFB/SFBB that control pistil and pollen specificity, respectively. Generally, the F-box protein forms an E3 ligase complex, SCF complex with Skp1, Cullin1 (CUL1) and Rbx1, however, in Petunia inflata, SBP1 (S-RNase binding protein1) was reported to play the role of Skp1 and Rbx1, and form an SCFSLF-like complex for ubiquitination of non-self S-RNases. On the other hand, in Petunia hybrida and Petunia inflata of Solanaceae, Prunus avium and Pyrus bretschneideri of Rosaceae, SSK1 (SLF-interacting Skp1-like protein1) is considered to form the SCFSLF/SFB complex. Here, we isolated pollen-expressed apple homologs of SSK1 and CUL1, and named MdSSK1, MdCUL1A and MdCUL1B. MdSSK1 was preferentially expressed in pollen, but weakly in other organs analyzed, while, MdCUL1A and MdCUL1B were almost equally expressed in all the organs analyzed. MdSSK1 transcript abundance was significantly (>100 times) higher than that of MdSBP1. In vitro binding assays showed that MdSSK1 and MdSBP1 interacted with MdSFBB1-S9 and MdCUL1, and MdSFBB1-S9 interacted more strongly with MdSSK1 than with MdSBP1. The results suggest that both MdSSK1-containing SCFSFBB1 and MdSBP1-containing SCFSFBB1-like complexes function in pollen of apple, and the former plays a major role.

  17. Insertion of a solo LTR retrotransposon associates with spur mutations in 'Red Delicious' apple (Malus × domestica).

    Science.gov (United States)

    Han, Mengxue; Sun, Qibao; Zhou, Junyong; Qiu, Huarong; Guo, Jing; Lu, Lijuan; Mu, Wenlei; Sun, Jun

    2017-09-01

    Insertion of a solo LTR, which possesses strong bidirectional, stem-specific promoter activities, is associated with the evolution of a dwarfing apple spur mutation. Spur mutations in apple scions revolutionized global apple production. Since long terminal repeat (LTR) retrotransposons are tightly related to natural mutations, inter-retrotransposon-amplified polymorphism technique and genome walking were used to find sequences in the apple genome based on these LTRs. In 'Red Delicious' spur mutants, a novel, 2190-bp insertion was identified as a spur-specific, solo LTR (sLTR) located at the 1038th nucleotide of another sLTR, which was 1536 bp in length. This insertion-within-an-insertion was localized within a preexisting Gypsy-50 retrotransposon at position 3,762,767 on chromosome 4. The analysis of transcriptional activity of the two sLTRs (the 2190- and 1536-bp inserts) indicated that the 2190-bp sLTR is a promoter, capable of bidirectional transcription. GUS expression in the 2190-bp-sense and 2190-bp-antisense transgenic lines was prominent in stems. In contrast, no promoter activity from either the sense or the antisense strand of the 1536-bp sLTR was detected. From ~150 kb of DNA on each side of the 2190 bp, sLTR insertion site, corresponding to 300 kb of the 'Golden Delicious' genome, 23 genes were predicted. Ten genes had predicted functions that could affect shoot development. This first report, of a sLTR insertion associated with the evolution of apple spur mutation, will facilitate apple breeding, cloning of spur-related genes, and discovery of mechanisms behind dwarf habit.

  18. Using Apple (Malus domestica, Pumpkin (Cucurbita maxima and Cinnamon (Cinnamom vertum to Obtain an Innovative Jam-Like Food Product

    Directory of Open Access Journals (Sweden)

    Maria Lidia IANCU

    2017-11-01

    Full Text Available The apple, the pumpkin and the cinnamon are raw materials that could be innovatively combined to produce a new sugar-preserved product following an original recipe. It can be considered in accordance with the European quality of jam-type varieties. It is a hybrid product, a component of “the European gastronomy” with old Bavarian roots and Romanian raw material. An adapted technological scheme and a recipe based on the TSS of the raw material and of the finished product were used. The quality indicators were determined using analytical methods. The PCA with the results provided by the panelists were used for the study of the aromatic profile. An identification of flavors, such as apple and cinnamon, is reported, which contributes to the specificity of the sensory profile of the jam. The new product has: TSS = 63.6 oBrix, TA = 0.2%, VA = 0.105 %. These values fall within the range of values for other jam and experimental jam assortments. The proportion of solids is 34%, which is far too low compared to the 45% minimum accepted limit. Taking into account that there is no “surface lifting” flaw, it is recommended to accept the value for the new assortment.

  19. A Multidisciplinary Approach Providing New Insight into Fruit Flesh Browning Physiology in Apple (Malus x domestica Borkh.)

    Science.gov (United States)

    Farneti, Brian; Lorenz, Giorgia; Masuero, Domenico; Vrhovsek, Urska; Costa, Guglielmo; Velasco, Riccardo; Costa, Fabrizio

    2013-01-01

    In terms of the quality of minimally processed fruit, flesh browning is fundamentally important in the development of an aesthetically unpleasant appearance, with consequent off-flavours. The development of browning depends on the enzymatic action of the polyphenol oxidase (PPO). In the ‘Golden Delicious’ apple genome ten PPO genes were initially identified and located on three main chromosomes (2, 5 and 10). Of these genes, one element in particular, here called Md-PPO, located on chromosome 10, was further investigated and genetically mapped in two apple progenies (‘Fuji x Pink Lady’ and ‘Golden Delicious x Braeburn’). Both linkage maps, made up of 481 and 608 markers respectively, were then employed to find QTL regions associated with fruit flesh browning, allowing the detection of 25 QTLs related to several browning parameters. These were distributed over six linkage groups with LOD values spanning from 3.08 to 4.99 and showed a rate of phenotypic variance from 26.1 to 38.6%. Anchoring of these intervals to the apple genome led to the identification of several genes involved in polyphenol synthesis and cell wall metabolism. Finally, the expression profile of two specific candidate genes, up and downstream of the polyphenolic pathway, namely phenylalanine ammonia lyase (PAL) and polyphenol oxidase (PPO), provided insight into flesh browning physiology. Md-PPO was further analyzed and two haplotypes were characterised and associated with fruit flesh browning in apple. PMID:24205065

  20. Cell wall structures leading to cultivar differences in softening rates develop early during apple (Malus x domestica) fruit growth.

    Science.gov (United States)

    Ng, Jovyn K T; Schröder, Roswitha; Sutherland, Paul W; Hallett, Ian C; Hall, Miriam I; Prakash, Roneel; Smith, Bronwen G; Melton, Laurence D; Johnston, Jason W

    2013-11-19

    There is a paucity of information regarding development of fruit tissue microstructure and changes in the cell walls during fruit growth, and how these developmental processes differ between cultivars with contrasting softening behaviour. In this study we compare two apple cultivars that show different softening rates during fruit development and ripening. We investigate whether these different softening behaviours manifest themselves late during ethylene-induced softening in the ripening phase, or early during fruit expansion and maturation. 'Scifresh' (slow softening) and 'Royal Gala' (rapid softening) apples show differences in cortical microstructure and cell adhesion as early as the cell expansion phase. 'Scifresh' apples showed reduced loss of firmness and greater dry matter accumulation compared with 'Royal Gala' during early fruit development, suggesting differences in resource allocation that influence tissue structural properties. Tricellular junctions in 'Scifresh' were rich in highly-esterified pectin, contributing to stronger cell adhesion and an increased resistance to the development of large airspaces during cell expansion. Consequently, mature fruit of 'Scifresh' showed larger, more angular shaped cells than 'Royal Gala', with less airspaces and denser tissue. Stronger cell adhesion in ripe 'Scifresh' resulted in tissue fracture by cell rupture rather than by cell-to-cell-separation as seen in 'Royal Gala'. CDTA-soluble pectin differed in both cultivars during development, implicating its involvement in cell adhesion. Low pectin methylesterase activity during early stages of fruit development coupled with the lack of immuno-detectable PG was associated with increased cell adhesion in 'Scifresh'. Our results indicate that cell wall structures leading to differences in softening rates of apple fruit develop early during fruit growth and well before the induction of the ripening process.

  1. Sensory and metabolic profiles of "Fuji" apples (Malus domestica Borkh.) grown without synthetic agrochemicals: the role of ethylene production.

    Science.gov (United States)

    Tanaka, Fukuyo; Miyazawa, Toshio; Okazaki, Keiki; Tatsuki, Miho; Ito, Tsutae

    2015-01-01

    Flavors of "Fuji" apple cultivated with or without synthetic agrochemicals were compared using quantitative descriptive analyses (QDA) and metabolite profiling for 3 seasons. Experimental plots included conventional crops (with agrochemicals) and organic crops (without agrochemicals) at our institute and organic and conventional farms. Additionally, mass market samples were analyzed. Organic apples were weak in sweetness and floral characteristics and had enhanced green and sour flavors. Most esters and sugars were present in lower concentrations in organic than in conventional apples. Close relation of principal component 1 of QDA and metabolite profiles, to ethylene production suggested that ethylene is considerably involved in flavor synthesis. Reduced ethylene associated with immaturity accounted for insufficient flavor synthesis and weak aroma and flavor attributes of organic apples. Furthermore, organic apples from the farm were more flavorsome than those from the institute in 2012, suggesting possible recovery of ethylene production after a long organic cultivation period.

  2. Endophytic bacterial community living in roots of healthy and 'Candidatus Phytoplasma mali'-infected apple (Malus domestica, Borkh.) trees.

    Science.gov (United States)

    Bulgari, Daniela; Bozkurt, Adem I; Casati, Paola; Cağlayan, Kadriye; Quaglino, Fabio; Bianco, Piero A

    2012-11-01

    'Candidatus Phytoplasma mali', the causal agent of apple proliferation (AP) disease, is a quarantine pathogen controlled by chemical treatments against insect vectors and eradication of diseased plants. In accordance with the European Community guidelines, novel strategies should be developed for sustainable management of plant diseases by using resistance inducers (e.g. endophytes). A basic point for the success of this approach is the study of endophytic bacteria associated with plants. In the present work, endophytic bacteria living in healthy and 'Ca. Phytoplasma mali'-infected apple trees were described by cultivation-dependent and independent methods. 16S rDNA sequence analysis showed the presence of the groups Proteobacteria, Acidobacteria, Bacteroidetes, Actinobacteria, Chlamydiae, and Firmicutes. In detail, library analyses underscored 24 and 17 operational taxonomic units (OTUs) in healthy and infected roots, respectively, with a dominance of Betaproteobacteria. Moreover, differences in OTUs number and in CFU/g suggested that phytoplasmas could modify the composition of endophytic bacterial communities associated with infected plants. Intriguingly, the combination of culturing methods and cloning analysis allowed the identification of endophytic bacteria (e.g. Bacillus, Pseudomonas, and Burkholderia) that have been reported as biocontrol agents. Future research will investigate the capability of these bacteria to control 'Ca. Phytoplasma mali' in order to develop sustainable approaches for managing AP.

  3. The effects of ultrasonic pretreatment and structural changes during the osmotic dehydration of the 'Starking' apple (Malus domestica Borkh)

    Energy Technology Data Exchange (ETDEWEB)

    Rosa-Mendoza, M. E.; Fernandez-Munoz, J. L.; Arjona-Roman, J. L.

    2012-11-01

    During the osmotic dehydration (OD) of fruit, the cell membrane displays a high resistance to mass transfer, thereby reducing the dehydration rate. To reduce thermal damage to cell membranes, alternative methods have recently been introduced to reduce the initial moisture content and/or modify the structure of fruit tissue. The aim of this work was to evaluate the effects of an ultrasound (US) pretreatment for OD on the effective diffusion coefficients and to observe the changes in the molecular structure of 'Starking' apple cubes by Fourier-transform infrared spectroscopy (FTIR) during a 3 h process using a 45 dregee Bx sucrose solution at 60 degree centigrade. In the pretreatment step, apple samples were immersed in an ultrasonic bath at 45 kHz for 20 min. The effective diffusion coefficients for water (Dew) and solids (Des) were calculated from the observed osmotic kinetics according to Fick's second law for the transient state. The solids coefficients were higher than the water coefficients in both processes due to the concentration difference (De = 7.7 × 10{sup -}9 and 9.7 × 10{sup -}9 m{sup 2} s{sup -}1 for ODUS). The structural changes were determined by FTIR by measuring the molecular vibration frequency for sucrose. The 1,500-900 cm{sup -}1 region of the infrared spectra was used to monitor the effect of sucrose concentration on fruit structure. We observed that the first bonds formed were C-H and C-O-C stretching (at 920 and 1,129 cm{sup -}1, respectively) in the sucrose skeleton and glycoside bonds among sucrose molecules. The water concentration affected the diffusion coefficient significantly due to its dependence on the physical structure of the food. (Author) 27 refs.

  4. Role of scab-resistant apple varieties in forming assortment of new industrial apple plantings (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Ю. Д. Гончарук

    2015-12-01

    Full Text Available Purpose. Identifying new scab-resistant apple varieties with high biological potential by the set of agronomic characters and the ability to realize it effectively in various soil and climatic conditions. Methods. Field, laboratory, comparison, generalization, statistical ones. Results. The author presents the results of study of 17 scab-resistant non-irrigated apple varieties on a semi-dwarf rootstock as to their adaptability to biotic and abio­tic stressors as well as their economic productivity. The studied varieties appeared to be winter-hardy, frost- and heat-resistant, but medium drought-tolerant ones. They are characterized by weak and moderate susceptibility to powdery mildew, high resistance to fruit rot and very low amounts of brown spot, except for Gold Rush variety. Such 10 year old varieties as ‘Edera’, Florina’, ‘Amulet’ and ‘Perlyna Kyieva’ and 8 year old ‘Afrodita’, ‘Vitos’, ‘Orlovskoie Polesie’ and ‘Topaz’ formed the highest productivity during the years of study. Due to the pollen quality and high interfertility, ‘Revena’ and ‘Gold Rush’ varieties were identified as universal pollinators for winter scab-resistant apple varieties. Conclusions. Such ecologically resistant winter varieties as ‘Topaz’, ‘Freedom’, ‘Edera’ and autumnal ‘Remo’, ‘Afrodita’, ‘Vitos’, ‘Amulet’ were recognized as promising for new intensive non-irrigated plantations in the Forest-Steppe zone of Ukraine. They can be the basis of new gardens occupying 25–30% of the area where ecologically safe fruits for various target purposes will be grown supplying demands of the population and processing industry.

  5. Quebra da dormência da maciera (Malus domestica Borkh em São Joaquim-SC

    Directory of Open Access Journals (Sweden)

    IUCHI VERA LÚCIA

    2002-01-01

    Full Text Available A macieira é uma fruteira de clima temperado que se caracteriza pelo fenômeno de dormência das gemas, necessitando de determinado número de horas de frio (< 7,2ºC para abertura de gemas. No Brasil, São Joaquim-SC, é o local que apresenta as melhores condições climáticas para o cultivo desta espécie. Entretanto, não é correto afirmar que sempre apresenta horas de frio suficientes para satisfazer as exigências das cultivares. Foram desenvolvidos experimentos no ano 1998 e 1999, em microclimas específicos, que vão de 900 a 1400 metros de altitude, no município de São Joaquim -- SC, permitindo afirmar que apenas para a cultivar Gala, nos locais mais altos, acima de 1300 m, em anos acima de 2.300 unidades de frio, é dispensada a superação de dormência artificial.

  6. Effect of bagging on fruit quantitative and qualitative characteristics of Fuji and Granny Smith apples (Malus domestica Borkh

    Directory of Open Access Journals (Sweden)

    Faezeh Fateminia

    2018-02-01

    Full Text Available Apple fruit color is determined by the amount of pigments in its peel which is directly affected by sunlight.  A method for improving apple fruit color is bagging. In present study, the effect of bagging and its optimum removing time was investigated on the amount of peel pigments and other fruit quantitative and qualitative characteristics for Fuji and Granny Smith apples. The experimental treatments were, no bag (control, debagging 7 and 14 days before harvest, and keeping the bag until harvest time. At the end of experiment, the amount of pigments, total soluble solids, titratable acidity, pulp phenol, peel phenol, antioxidants percentage, fruit weight and volume were measured. The results showed that in debagging 7 and 14 days before harvest treatments, the amount of anthocyanin and soluble solids statistically increased as compared with control; however other measured characteristics were significantly reduced in both apple cultivars. The maximum amount of fruit anthocyanin (60.96 mg/g fresh weight belonged to Fuji cultivar in 14 days treatment and the least amount of fruit anthocyanin (1.64 mg/g fresh weight belonged to Granny Smith cultivar in zero-day treatment. The highest amount of fruit chlorophyll a (5.09µgr/lit was observed in control fruit and the lowest amount of fruit chlorophyll a (3.94 µgr/lit was observed in 14 days treatment. The decrease of chlorophyll amount is a positive characteristic for the Fuji and a negative one for Granny Smith. Therefore, bagging and 14 days before harvest debagging treatment increased the amount of anthocyanin and decreased chlorophyll which resulted in Fuji cultivar better coloring and reducing the green color quality of Granny Smith cultivar.

  7. Gamma radiation and thermal treatment effects on the conservation of natural apple (Malus domestica) juice, cv. gala

    International Nuclear Information System (INIS)

    Blumer, Lucimara.

    1995-12-01

    This work studies the apple juice preservation without chemicals. The samples were exposed to the following treatments: heating (control, 60 0 C/20 min and 80 0 C/20 min); irradiation (control; 2, 4 and 6 kGy); heating plus irradiation. The quality control was carried out by physical and chemical analyses (soluble solids; titratable acidity, pH, ascorbic acid and color), microbiological and sensorial analyses. The samples were stored at refrigeration temperature (5 ± 3 0 C) for 180 days. The results showed few variations in the soluble solids, acidity, pH and ascorbic acid for all treatments. However, the 6 kGy dose kept the chemical characteristics of the juice, providing a clear juice, with better appearance and microorganisms free. (author). 24 refs., 11 figs., 12 tabs

  8. Changes in primary metabolites and polyphenols in the peel of "Braeburn" apples (Malus domestica Borkh.) during advanced maturation.

    Science.gov (United States)

    Bizjak, Jan; Mikulic-Petkovsek, Maja; Stampar, Franci; Veberic, Robert

    2013-10-30

    During the two growing seasons the evolution of primary metabolites and wide range of polyphenols in the "Braeburn" apple peel during advanced maturation were investigated. During the five weeks sucrose significantly increased, whereas fructose and glucose fluctuated around the same level in one season and decreased in another. Regarding malic and citric acids, an expected decrease was recorded. The concentrations of hydroxycinnamic acids, dihydrochalcones, and flavanols remained quite constant or slightly decreased during advanced apple ripening. On the contrary an intensive accumulation of quercetin glycosides and anthocyanins took place during this period, starting with the onset of rapid formation approximately 3 weeks before the technological maturity of apples. Total phenolic content was relatively constant or slightly increased. The present results suggest that measures designed to improve the apple color and quality of "Braeburn" apples should be performed approximately 3-4 weeks before the expected technological maturity of apples.

  9. A genomics approach to understanding the role of auxin in apple (Malus x domestica) fruit size control.

    Science.gov (United States)

    Devoghalaere, Fanny; Doucen, Thomas; Guitton, Baptiste; Keeling, Jeannette; Payne, Wendy; Ling, Toby John; Ross, John James; Hallett, Ian Charles; Gunaseelan, Kularajathevan; Dayatilake, G A; Diak, Robert; Breen, Ken C; Tustin, D Stuart; Costes, Evelyne; Chagné, David; Schaffer, Robert James; David, Karine Myriam

    2012-01-13

    Auxin is an important phytohormone for fleshy fruit development, having been shown to be involved in the initial signal for fertilisation, fruit size through the control of cell division and cell expansion, and ripening related events. There is considerable knowledge of auxin-related genes, mostly from work in model species. With the apple genome now available, it is possible to carry out genomics studies on auxin-related genes to identify genes that may play roles in specific stages of apple fruit development. High amounts of auxin in the seed compared with the fruit cortex were observed in 'Royal Gala' apples, with amounts increasing through fruit development. Injection of exogenous auxin into developing apples at the start of cell expansion caused an increase in cell size. An expression analysis screen of auxin-related genes involved in auxin reception, homeostasis, and transcriptional regulation showed complex patterns of expression in each class of gene. Two mapping populations were phenotyped for fruit size over multiple seasons, and multiple quantitative trait loci (QTLs) were observed. One QTL mapped to a region containing an Auxin Response Factor (ARF106). This gene is expressed during cell division and cell expansion stages, consistent with a potential role in the control of fruit size. The application of exogenous auxin to apples increased cell expansion, suggesting that endogenous auxin concentrations are at least one of the limiting factors controlling fruit size. The expression analysis of ARF106 linked to a strong QTL for fruit weight suggests that the auxin signal regulating fruit size could partially be modulated through the function of this gene. One class of gene (GH3) removes free auxin by conjugation to amino acids. The lower expression of these GH3 genes during rapid fruit expansion is consistent with the apple maximising auxin concentrations at this point.

  10. Maturity and storage influence on the apple (Malus domestica) allergen Mal d 3, a nonspecific lipid transfer protein

    NARCIS (Netherlands)

    Sancho, Ana I.; Foxall, Robert; Rigby, Neil M.; Browne, Thomas; Zuidmeer, Laurian; van Ree, Ronald; Waldron, Keith W.; Mills, E. N. Clare

    2006-01-01

    Consumption of apples can provoke severe allergic reactions, in susceptible individuals, due to the presence of the allergen Mal d 3, a nonspecific lipid transfer protein, found largely in the fruit skin. Levels of Mal d 3 were determined in peel as a function of apple cultivar, position of the

  11. Evaluation of the 14C-prochloraz residue levels in irradiated mangoes (Mangifera indica) and apples (Malus domestica)

    International Nuclear Information System (INIS)

    Costa, Maria Aparecida

    1998-01-01

    The Brazilian crops mangoes and apples has expanding in the last years. However, tropical fruits crops are susceptible to infection that harms the crop yield. The control of these diseases is made through fungicides such as prochloraz which possesses protecting eradicating action by controlling anthracnose in mangoes and scabies in apples. Agrochemicals are of great importance in the agriculture considering the of relationship cost/benefit. However they may cause a series of problems in the ecosystem, being the levels of agrochemicals residues in fruits one of these factors. The aim of this work was to evaluate the prochloraz levels in mangoes treated in both stages of pre and post harvest, and in apples treated in the pre harvest. In the treatment of the mangoes, the interaction, fungicide with the gamma radiation with dose of 1,0 kGy, was used to induce prochloraz degradation. Treated post harvest mangoes were stored, at 12 deg C during 21 days. The results showed that the prochloraz did not present reduction in the residual levels of the mangoes after 21 day storage, that is the safe period established by the Brazilian legislation on agrochemicals, in treated mangoes. The refrigerated storage (12 deg C) and the gamma radiation also did not contribute to the degradation of the fungicide in mangoes. In average the concentration of the fungicide prochloraz in the peels (bar X = 1,64 mug/g) was higher than in the mangoes pulp (bar x = 0,06 mug/g), which allows the consumption of this fruit, since the peel is always discarded. The degradation product, formed in peels of mangoes in fruits treated in the pre and post harvest was the metabolite BIS 44596; for mangoes treated in the pre-post harvest the metabolite formed was the BIS 445186. Both metabolites were found in very low levels, confirming that occurs degradation of the fungicide in mangoes. In apples treated with the prochloraz, reduction of 500/0 in the levels. (author)

  12. Mapping in an apple (Malus x domestica) F1 segregating population based on physical clustering of differentially expressed genes

    Science.gov (United States)

    Background: Apple tree breeding is slow and difficult due to long generation times, self incompatibility, and complex genetics. The identification of molecular markers linked to traits of interest is a way to expedite the breeding process. In the present study, we aimed to identify genes whose stead...

  13. Antimicrobial activity of alcohols from Musca domestica.

    Science.gov (United States)

    Gołębiowski, Marek; Dawgul, Małgorzata; Kamysz, Wojciech; Boguś, Mieczysława I; Wieloch, Wioletta; Włóka, Emilia; Paszkiewicz, Monika; Przybysz, Elżbieta; Stepnowski, Piotr

    2012-10-01

    Information on the stimulatory and inhibitory effects of cuticular alcohols on growth and virulence of insecticidal fungi is unavailable. Therefore, we set out to describe the content of cuticular and internal alcohols in the body of housefly larvae, pupae, males and females. The total cuticular alcohols in larvae, males and females of Musca domestica were detected in comparable amounts (4.59, 3.95 and 4.03 μg g(-1) insect body, respectively), but occurred in smaller quantities in pupae (2.16 μg g(-1)). The major free alcohol in M. domestica larvae was C(12:0) (70.4%). Internal alcohols of M. domestica larvae were not found. Among cuticular pupae alcohols, C(12:0) (31.0%) was the most abundant. In the internal lipids of pupae, only five alcohols were identified in trace amounts. The most abundant alcohol in males was C(24:0) (57.5%). The percentage content of cuticular C(24:0) in males and females (57.5 and 36.5%, respectively) was significantly higher than that of cuticular lipids in larvae and pupae (0.9 and 5.6%, respectively). Only two alcohols were present in the internal lipids of males in trace amounts (C(18:0) and C(20:0)). The most abundant cuticular alcohols in females were C(24:0) (36.5%) and C(12:0) (26.8%); only two alcohols (C(18:0) and C(20:0)) were detected in comparable amounts in internal lipids (3.61±0.32 and 5.01±0.42 μg g(-1), respectively). For isolated alcohols, antimicrobial activity against 10 reference strains of bacteria and fungi was determined. Individual alcohols showed approximately equal activity against fungal strains. C(14:0) was effective against gram-positive bacteria, whereas gram-negative bacteria were resistant to all tested alcohols. Mixtures of alcohols found in cuticular lipids of larvae, pupae, males and females of M. domestica generally presented higher antimicrobial activity than individual alcohols. In contrast, crude extracts containing both cuticular and internal lipids showed no antifungal activity against the

  14. Engineering fire blight resistance into the apple cultivar 'Gala' using the FB_MR5 CC-NBS-LRR resistance gene of Malus × robusta 5.

    Science.gov (United States)

    Broggini, Giovanni A L; Wöhner, Thomas; Fahrentrapp, Johannes; Kost, Thomas D; Flachowsky, Henryk; Peil, Andreas; Hanke, Maria-Viola; Richter, Klaus; Patocchi, Andrea; Gessler, Cesare

    2014-08-01

    The fire blight susceptible apple cultivar Malus × domestica Borkh. cv. 'Gala' was transformed with the candidate fire blight resistance gene FB_MR5 originating from the crab apple accession Malus × robusta 5 (Mr5). A total of five different transgenic lines were obtained. All transgenic lines were shown to be stably transformed and originate from different transgenic events. The transgenic lines express the FB_MR5 either driven by the constitutive CaMV 35S promoter and the ocs terminator or by its native promoter and terminator sequences. Phenotyping experiments were performed with Mr5-virulent and Mr5-avirulent strains of Erwinia amylovora, the causal agent of fire blight. Significantly less disease symptoms were detected on transgenic lines after inoculation with two different Mr5-avirulent E. amylovora strains, while significantly more shoot necrosis was observed after inoculation with the Mr5-virulent mutant strain ZYRKD3_1. The results of these experiments demonstrated the ability of a single gene isolated from the native gene pool of apple to protect a susceptible cultivar from fire blight. Furthermore, this gene is confirmed to be the resistance determinant of Mr5 as the transformed lines undergo the same gene-for-gene interaction in the host-pathogen relationship Mr5-E. amylovora. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  15. Estudio comparativo entre metodologías para el diseño de Sistemas Bonus-Malus.

    Directory of Open Access Journals (Sweden)

    Núñez del Prado, José Antonio

    2004-01-01

    Full Text Available El objetivo de este trabajo es mostrar un método para hacer comparaciones entre Sistemas Bonus Malus. Se comparan Sistemas Bonus Malus obtenidos mediante la metodología GPBM, basada en Programación por Metas y Sistemas Bonus Malus obtenidos mediante la metodología clásica, conocida como Escala de Bayes.

  16. R. Strauss: Symphonia domestica, Op. 53 / David Nice

    Index Scriptorium Estoniae

    Nice, David

    1994-01-01

    Uuest heliplaadist "R. Strauss: Symphonia domestica, Op. 53. National Youth Orchestra of Great Britain / Christopher Seaman. Pickwick IMP Classics CD PCD 1080; Selected comparisons: SNO, Järvi (3/88) Chandos CHAN 8572"

  17. Grassland communities of traditional orchards in the Western Carpathians (Slovakia

    Directory of Open Access Journals (Sweden)

    Hubert Zarnovican

    2017-06-01

    Full Text Available Traditional orchards are a valuable feature of the rural landscape and they are specific for regions with scattered settlement such as the Myjava hilly land and White Carpathians. Here, the permanent species-rich grasslands beneath trees were regularly managed in the traditional manner until some were replaced in the 1970’s and 80’s by intensively managed orchards, some of which were abandoned in the early 1990’s. Our 2011–2015 phytosociological research followed the standard Braun-Blanquet approach. We classified 178 phytosociological relevés recorded in orchard meadows (156 relevés, former intensively managed orchards (16 relevés, and two relevés from a semi-intensively grazed orchard. Traditionally managed orchard meadows were classified in the following five units: (i Pastinaco sativae-Arrhenatheretum elatioris – thermophilous variant, (ii Pastinaco sativae-Arrhenatheretum elatioris – transitional variant to Alchemillo-Arrhenatheretum elatioris, (iii Ranunculo bulbosi-Arrhenatheretum elatioris, (iv Onobrychido viciifoliae-Brometum erecti, and (v Brachypodio pinnati-Molinietum arundinaceae. Formerly intensively managed large-scale orchards were classified as Pastinaco sativae-Arrhenatheretum elatioris association and the semi-intensively grazed orchard as Lolio perennis-Cynosuretum cristati association. The species composition varies considerably due to tree-shading and different management treatments applied in the orchards, so the relevés of the delimited syntaxonomic units are not typical and have transitional character. Moisture, soil nutrients, and soil reaction were identified as the main environmental gradients influencing species composition. We tested four management treatments in direct gradient analysis and found that abandonment has the strongest effect on species composition. Comparison of grassland vegetation in the studied traditional orchards with that described in Germany reveals differences in species

  18. Wound Myiasis Due to Musca domestica (Diptera: Muscidae in Persian Horned Viper, Pseudocerastes persicus (Squamata: Viperidae

    Directory of Open Access Journals (Sweden)

    R Dehghani

    2012-06-01

    Full Text Available A case of myiasis due to Musca domestica describes in Pseudocerastes persicus for the first time. The snake was found in Bari Karafs, Kashan, Iran, with a lesion on its body. Fourteen live larvae of M. domestica removed from its wound. This is the first report of a new larval habitat of M. domestica.

  19. Genome-wide identification of genes involved in polyamine biosynthesis and the role of exogenous polyamines in Malus hupehensis Rehd. under alkaline stress.

    Science.gov (United States)

    Gong, Xiaoqing; Dou, Fangfang; Cheng, Xi; Zhou, Jing; Zou, Yangjun; Ma, Fengwang

    2018-08-30

    Polyamines (PAs) in plants are growth substrates with functions similar to phytohormones. Although they contribute to diverse processes, little is known about their role in stress responses, especially for perennial woody plants. We conducted a genome-wide investigation of 18 sequences involved in PA biosynthesis in the genome of apple (Malus domestica). Further analysis was performed to construct a phylogenetic tree, analyze their protein motifs and gene structures. In addition, we developed their expression profiles in response to stressed conditions. Both MDP0000171041 (MdSAMDC1) and MDP0000198590 (MdSPDS1) were induced by alkaline, salt, ABA, cold, and dehydration stress treatments, suggesting that these genes are the main contributors to activities of S-adenosylmethionine decarboxylase (EC 4.1.1.50) and spermidine synthase (EC 2.5.1.16) in apple. Changes in PA biosynthesis under stress conditions indicated that spermidine and spermine are more essential than putrescine for apple, especially when responding to alkaline or salt stress. When seedlings of M. hupehensis Rehd. were supplied with exogenous PAs, their leaves showed less chlorosis under alkaline stress when compared with untreated plants. This application also inhibited the decline in SPAD levels and reduced relative electrolyte leakage in those stressed seedlings, while increasing their concentration of active iron. These results suggest that the alteration in PA biosynthesis confers enhanced tolerance to alkaline stress in M. hupehensis Rehd. Copyright © 2018. Published by Elsevier B.V.

  20. Navigation and Tree Mapping in Orchards

    DEFF Research Database (Denmark)

    Jæger-Hansen, Claes Lund; Griepentrog, Hans W.; Andersen, Jens Christian

    In this paper an algorithm for estimating tree positions is presented. The sensors used for the algorithm is GNSS and LIDAR, and data is collected in an orchard with grapefruit trees while driving along the rows. The positions of the trees are estimated using ellipse fitting on point clouds....... The average accuracy for the center point estimation is 0.2 m in the along track direction and 0.35 m in the across track direction. The goal of the tree mapping algorithm is create a database of individual trees, and be the basis for creation of a graph map that can be used for mission planning...

  1. Trace elements in wild and orchard honeys

    Energy Technology Data Exchange (ETDEWEB)

    Almeida-Silva, M.; Canha, N.; Galinha, C.; Dung, H.M. [Instituto Tecnologico e Nuclear, URSN, E.N. 10, 2686-953 Sacavem (Portugal); Freitas, M.C., E-mail: cfreitas@itn.pt [Instituto Tecnologico e Nuclear, URSN, E.N. 10, 2686-953 Sacavem (Portugal); Sitoe, T. [Instituto Tecnologico e Nuclear, URSN, E.N. 10, 2686-953 Sacavem (Portugal)

    2011-11-15

    The present study aims the identification and quantification of trace elements in two types of honey samples: Orchard honey and Wild honey from mainland Portugal. Chemical elements content was assessed by Instrumental Neutron Activation Analysis (INAA). Concentrations were determinated for Ag, As, Br, Ca, Cl, Cs, Cu, Fe, K, La, Mg, Mn, Na, Rb, Sb, Sc, U, V and Zn. The nutritional values of both honey types were evaluated since this product contains some elements that are essential dietary nutrients for humans. Physical properties of the honey samples, such as electrical conductivy and pH, were assessed as well.

  2. Profitability of Irrigated Improved Pecan Orchards in the Southern Plains

    OpenAIRE

    Springer, Job D.; Swinford, Wyatt; Rohla, Charles

    2011-01-01

    The objective was to determine if an irrigated improved pecan orchard is economical relative to agronomic systems commonly implemented by producers that have access to irrigation. Results show that the improved pecan orchard is more profitable than competitive enterprises after a twenty year time frame, but is sensitive to pecan price, pecan yield and attitude toward risk.

  3. A tool for identifying potential Eucalyptus nitens seed orchard sites ...

    African Journals Online (AJOL)

    Shy seed production in orchards of Eucalyptus nitens is a major barrier to the deployment of genetic gain in South African plantations. A machine learning method was used to identify optimal sites for the establishment of E. nitens seed orchards within the plantation forestry landscape of the summer rainfall region of South ...

  4. Epiphytic lichens of apple orchards in Poland, Slovakia, and Italy

    Directory of Open Access Journals (Sweden)

    Daria Zarabska

    2013-12-01

    Full Text Available Following the study of epiphytic lichens in 30 apple orchards from Poland, Slovakia and Italy the list of 74 taxa was prepared. The most common are the meso- to xerophytic and heliophilous species. The highest number of taxa was observed in Slovak orchards. Moreover, lichens shared with at least one other country were also noted mainly in Slovakia. Bark of apple trees seems to create favourable habitats for Bacidia rubella, which together with Strangospora pinicola were valuable founds in Polish orchards. In Slovak orchards, special attention should be paid to Acrocordia gemmata, Melanelixia glabra and Usnea hirta. Among interesting records in Italian orchards, Phaeophyscia hispidula and Ph. kairamoi can be mentioned.

  5. SEBARAN STASIONER PADA SISTEM BONUS-MALUS SWISS SERTA MODIFIKASINYA (Stationary Distribution of Swiss Bonus-Malus System and its Modification

    Directory of Open Access Journals (Sweden)

    Cherry Galatia Ballangan

    2002-01-01

    Full Text Available Bonus-Malus System is a system in actuary that introduce the premium class (state partition, where the state is influenced by the number of annual claims reported by the policy holder. We could base the determination of the state on the stationary distribution that represent the number of policy holders in any state. Swiss Bonus-Malus System has 22 state. The number of state that involved in this system result in the difficulty of stationary distribution determination. Therefore, the aim of this paper is to study a method to obtain stationary distribution of Swiss Bonus-Malus System by recursive formula, with this recursive formula, the stationary distribution of Swiss Bonus-Malus System can be determined easier. Modification of this system with infinite state result in the changes of recursive formula to obtain the stationary. This changes including the determining of base value of the recursive formula. Abstract in Bahasa Indonesia : Sistem Bonus-Malus merupakan sistem dalam aktuaria yang memperkenalkan pembagian kelas premi (state yang dipengaruhi oleh jumlah klaim yang diajukan oleh pemegang polis tiap tahunnya. Penetapan state dalam sistem ini didasarkan pada pencarian sebaran stasioner yang menyatakan banyaknya pemegang polis dalam tiap state. Sistem Bonus-Malus Swiss (BMS memiliki 22 state. Banyaknya state yang terlibat dalam sistem ini mengakibatkan sulitnya penentuan sebaran stasioner pada sistem BMS tersebut. Karena itu dalam tulisan ini dipelajari suatu metode penentuan sebaran stasioner dari sistem BMS tersebut, yaitu dengan menggunakan formula rekursif. Dengan formula rekursif ini, sebaran stasioner sistem BMS dapat ditentukan dengan mudah. Modifikasi sistem BMS untuk jumlah state yang tak hingga mengakibatkan perubahan pada formula rekursif untuk mencari sebaran stasionernya. Perubahan ini meliputi penetapan nilai awal dari formula rekursif tersebut. Kata kunci: sebaran stasioner, formula rekursif, sistem Monus-Malus Swiss.

  6. Pollination deficits in UK apple orchards

    Directory of Open Access Journals (Sweden)

    Michael Paul Douglas Garratt

    2014-02-01

    Full Text Available Apple production in the UK is worth over £100 million per annum and this production is heavily dependent on insect pollination. Despite its importance, it is not clear which insect pollinators carry out the majority of this pollination. Furthermore, it is unknown whether current UK apple production, in terms of both yield and quality, suffers pollination deficits and whether production value could be increased through effective management of pollination services. The present study set out to address some of these unknowns and showed that solitary bee activity is high in orchards and that they could be making a valuable contribution to pollination. Furthermore, fruit set and apple seed number were found to be suffering potential pollination deficits although these were not reflected in apple quality. Deficits could be addressed through orchard management practices to improve the abundance and diversity of wild pollinators. Such practices include provision of additional floral resources and nesting habitats as well as preservation of semi-natural areas. The cost effectiveness of such strategies would need to be understood taking into account the potential gains to the apple industry.

  7. Pollination deficits in UK apple orchards

    Directory of Open Access Journals (Sweden)

    Simon Potts

    2013-10-01

    Full Text Available Apple production in the UK is worth over £100 million per annum and this production is heavily dependent on insect pollination. Despite its importance, it is not clear which insect pollinators carry out the majority of this pollination. Furthermore, it is unknown whether current UK apple production, in terms of both yield and quality, suffers pollination deficits and whether production value could be increased through effective management of pollination services. The present study set out to address some of these unknowns and showed that solitary bee activity is high in orchards and that they could be making a valuable contribution to pollination. Furthermore, fruit set and apple seed number were found to be suffering potential pollination deficits although these were not reflected in apple quality. Deficits could be addressed through orchard management practices to improve the abundance and diversity of wild pollinators. Such practices include provision of additional floral resources and nesting habitats as well as preservation of semi-natural areas. The cost effectiveness of such strategies would need to be understood taking into account the potential gains to the apple industry.

  8. Spatial and temporal assessment of pollen- and seed-mediated gene flow from genetically engineered plum Prunus domestica.

    Directory of Open Access Journals (Sweden)

    Ralph Scorza

    Full Text Available Pollen flow from a 0.46 ha plot of genetically engineered (GE Prunus domestica located in West Virginia, USA was evaluated from 2000-2010. Sentinel plum trees were planted at distances ranging from 132 to 854 m from the center of the GE orchard. Plots of mixed plum varieties and seedlings were located at 384, 484 and 998 m from the GE plot. Bee hives (Apis mellifera were dispersed between the GE plum plot and the pollen flow monitoring sites. Pollen-mediated gene flow from out of the GE plum plot to non-GE plums under the study conditions was low, only occurring at all in 4 of 11 years and then in only 0.31% of the 12,116 seeds analyzed. When it occurred, gene flow, calculated as the number of GUS positive embryos/total embryos sampled, ranged from 0.215% at 132 m from the center of the GE plum plot (28 m from the nearest GE plum tree to 0.033-0.017% at longer distances (384-998 m. Based on the percentage of GUS positive seeds per individual sampled tree the range was 0.4% to 12%. Within the GE field plot, gene flow ranged from 4.9 to 39%. Gene flow was related to distance and environmental conditions. A single year sample from a sentinel plot 132 m from the center of the GE plot accounted for 65% of the total 11-year gene flow. Spatial modeling indicated that gene flow dramatically decreased at distances over 400 m from the GE plot. Air temperature and rainfall were, respectively, positively and negatively correlated with gene flow, reflecting the effects of weather conditions on insect pollinator activity. Seed-mediated gene flow was not detected. These results support the feasibility of coexistence of GE and non-GE plum orchards.

  9. Molecular genetic features of polyploidization and aneuploidization reveal unique patterns for genome duplication in diploid Malus.

    Directory of Open Access Journals (Sweden)

    Michael J Considine

    Full Text Available Polyploidization results in genome duplication and is an important step in evolution and speciation. The Malus genome confirmed that this genus was derived through auto-polyploidization, yet the genetic and meiotic mechanisms for polyploidization, particularly for aneuploidization, are unclear in this genus or other woody perennials. In fact the contribution of aneuploidization remains poorly understood throughout Plantae. We add to this knowledge by characterization of eupolyploidization and aneuploidization in 27,542 F₁ seedlings from seven diploid Malus populations using cytology and microsatellite markers. We provide the first evidence that aneuploidy exceeds eupolyploidy in the diploid crosses, suggesting aneuploidization is a leading cause of genome duplication. Gametes from diploid Malus had a unique combinational pattern; ova preserved euploidy exclusively, while spermatozoa presented both euploidy and aneuploidy. All non-reduced gametes were genetically heterozygous, indicating first-division restitution was the exclusive mode for Malus eupolyploidization and aneuploidization. Chromosome segregation pattern among aneuploids was non-uniform, however, certain chromosomes were associated for aneuploidization. This study is the first to provide molecular evidence for the contribution of heterozygous non-reduced gametes to fitness in polyploids and aneuploids. Aneuploidization can increase, while eupolyploidization may decrease genetic diversity in their newly established populations. Auto-triploidization is important for speciation in the extant Malus. The features of Malus polyploidization confer genetic stability and diversity, and present heterozygosity, heterosis and adaptability for evolutionary selection. A protocol using co-dominant markers was proposed for accelerating apple triploid breeding program. A path was postulated for evolution of numerically odd basic chromosomes. The model for Malus derivation was considerably revised

  10. Molecular genetic features of polyploidization and aneuploidization reveal unique patterns for genome duplication in diploid Malus.

    Science.gov (United States)

    Considine, Michael J; Wan, Yizhen; D'Antuono, Mario F; Zhou, Qian; Han, Mingyu; Gao, Hua; Wang, Man

    2012-01-01

    Polyploidization results in genome duplication and is an important step in evolution and speciation. The Malus genome confirmed that this genus was derived through auto-polyploidization, yet the genetic and meiotic mechanisms for polyploidization, particularly for aneuploidization, are unclear in this genus or other woody perennials. In fact the contribution of aneuploidization remains poorly understood throughout Plantae. We add to this knowledge by characterization of eupolyploidization and aneuploidization in 27,542 F₁ seedlings from seven diploid Malus populations using cytology and microsatellite markers. We provide the first evidence that aneuploidy exceeds eupolyploidy in the diploid crosses, suggesting aneuploidization is a leading cause of genome duplication. Gametes from diploid Malus had a unique combinational pattern; ova preserved euploidy exclusively, while spermatozoa presented both euploidy and aneuploidy. All non-reduced gametes were genetically heterozygous, indicating first-division restitution was the exclusive mode for Malus eupolyploidization and aneuploidization. Chromosome segregation pattern among aneuploids was non-uniform, however, certain chromosomes were associated for aneuploidization. This study is the first to provide molecular evidence for the contribution of heterozygous non-reduced gametes to fitness in polyploids and aneuploids. Aneuploidization can increase, while eupolyploidization may decrease genetic diversity in their newly established populations. Auto-triploidization is important for speciation in the extant Malus. The features of Malus polyploidization confer genetic stability and diversity, and present heterozygosity, heterosis and adaptability for evolutionary selection. A protocol using co-dominant markers was proposed for accelerating apple triploid breeding program. A path was postulated for evolution of numerically odd basic chromosomes. The model for Malus derivation was considerably revised. Impacts of

  11. HEAVY METALS IN VINEYARDS AND ORCHARD SOILS

    Directory of Open Access Journals (Sweden)

    GUSTAVO BRUNETTO

    Full Text Available ABSTRACT The application of foliar fungicides in vineyards and orchards can increase soil concentration of heavy metals such as copper (Cu and zinc (Zn, up to the toxicity threshold for fruit trees and cover crops. However, some agronomic practices, such as liming, addition of organic fertilizers, cultivation of soil cover crops and inoculation of young plants with arbuscular mycorrhizal fungi can decrease the availability and the potential of heavy metal toxicity to fruit trees. This review aims to compile and present information about the effects of increasing concentrations of heavy metals, especially Cu and Zn, on soils cultivated with fruit trees and provides some agronomic practices of remediation. Information about the sources of heavy metals found in soils cultivated with fruit trees are presented; mechanisms of absorption, transport, accumulation and potential toxicity to plants are described.

  12. Fatal attraction. Control of the housefly (Musca domestica)

    NARCIS (Netherlands)

    Smallegange, R.C.

    2004-01-01

    Despite its long association with man, the housefly (Musea domestica Linnaeus) remains one of the most difficult pests to control. It is a ubiquitous insect that can be found in houses, stables, food processing factories and other domesticated areas and buildings. Reliance on insecticides for fly

  13. Pesticides and brain cancer linked in orchard farmers of Kashmir

    OpenAIRE

    Bhat, Abdul Rashid; Wani, Muhammed Afzal; Kirmani, A. R.; Raina, T. H.

    2010-01-01

    Background: The atmosphere of valley of Kashmir is ideal for fresh and dry fruit production. Millions of tons of pesticides, insecticides and fungicides (chemicals like chlorpyriphos, mancozeb, captan, dimethoate, phosalone, etc.) are being used by the orchard farmers to spray the plants, fruits and the leaves every year. The increasing trend in the incidence of primary malignant brain tumors in orchard farmers of Kashmir is alarming. Aim: To determine the relationship between the patients of...

  14. Carbon footprint of apple and pear : orchards, storage and distribution

    OpenAIRE

    Figueiredo, F.; Castanheira, E.G.; Feliciano, M.; Rodrigues, M.A.; Peres, A.; Maia, F.; Ramos, A.; Carneiro, J.P.; Coroama, V.C.; Freire, F.

    2013-01-01

    Apple and pear represent 51% of fresh fruit orchards in Portugal. This paper presents a life-cycle (LC) greenhouse gas (GHG) assessment (so-called carbon footprint) of 3 apple and 1 pear Portuguese production systems. An LC model and inventory were implemented, encompassing the farm stage (cultivation of fruit trees in orchards), storage and distribution (transport to retail). The functional unit considered in this study was 1 kg of distributed fruit (at retail). Four different LC inventories...

  15. Exogenous melatonin improves Malus resistance to Marssonina apple blotch.

    Science.gov (United States)

    Yin, Lihua; Wang, Ping; Li, Mingjun; Ke, Xiwang; Li, Cuiying; Liang, Dong; Wu, Shan; Ma, Xinli; Li, Chao; Zou, Yangjun; Ma, Fengwang

    2013-05-01

    We examined whether exogenously applied melatonin could improve resistance to Marssonina apple blotch (Diplocarpon mali) by apple [Malus prunifolia (Willd.) Borkh. cv. Donghongguo]. This serious disease leads to premature defoliation in the main regions of apple production. When plants were pretreated with melatonin, resistance was increased in the leaves. We investigated the potential roles for melatonin in modulating levels of hydrogen peroxide (H2O2), as well the activities of antioxidant enzymes and pathogenesis-related proteins during these plant-pathogen interactions. Pretreatment enabled plants to maintain intracellular H2O2 concentrations at steady-state levels and enhance the activities of plant defence-related enzymes, possibly improving disease resistance. Because melatonin is safe and beneficial to animals and humans, exogenous pretreatment might represent a promising cultivation strategy to protect plants against this pathogen infection. © 2012 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.

  16. The effects of orchard pesticide applications on breeding robins

    Science.gov (United States)

    Johnson, E.V.; Mack, G.L.; Thompson, D.Q.

    1976-01-01

    From 1966 through 1968, robins reproduced successfully in commercial apple orchards which were periodically sprayed with DDT, dieldrin, and other pesticides. Observations by a Z-man team using walkie-talkies revealed that breeding robins obtained essentially all food for themselves and nestlings from unsprayed areas adjacent to the orchards. Invertebrate trapping in sprayed and unsprayed areas showed that these food items were 5 or 6 times more abundant in unsprayed habitat. Worms forced to live in sprayed orchard soil displayed significantly greater mortality than controls. Mean robin clutch sizes in the study orchards were lower than those reported for robins in other studies, perhaps because of food shortage and/or increased foraging distances. Levels of DDT and its analogs in food items from robin foraging areas did not exceed 8 ppm wet weight basis. From late April to July, adult robins showed small but significant increases in DDE levels in all tissues examined, as well as an increase in dieldrin in brains. Pesticides sprayed on the farm had no direct demonstrable adverse effects on the robins; productivity was high and adult mortality low. The situation was in large measure fortuitous, since any changes in orchard management practices which resulted in the presence or availability of invertebrates under orchard trees would be expected to result in robin mortality and/or reduced breeding success.

  17. Recovery patterns, histological observations and genetic integrity in Malus shoot tips cryopreserved using droplet vitrification and encapsulation-dehydration procedures

    Science.gov (United States)

    A droplet-vitrification procedure is described for cryopreservation of Malus shoot tips. Survival patterns, recovery types, histological observations, and genetic integrity were compared for Malus shoot tips cryopreserved using this droplet-vitrification procedure and an encapsulation-dehydration pr...

  18. Tamarind orchards: agro forestry for dry lands

    Energy Technology Data Exchange (ETDEWEB)

    Ravindranath, N.H.; Anita, R. [Indian Inst. of Science, Centre for Ecological Sciences, Bangalore (India); Meili, Anandi [WSD, ADATS Campus, Kolar, Karnataka (India)

    1998-09-01

    Agroforestry has a potential for sequestering as much carbon if not more than forests. Massive benefits can be channeled to small farmers and landless labourers through cultivation of Tamarind and other fast growing and fruit yielding trees. This paper describes a project in a semiarid area of south India. The aim is to upgrade dryland holdings of the member families through economically sound dry land horticulture, community woodlots, and planting of fast growing species along orchard and field boundaries. The small farmers invest massive labour inputs and project gives economic benefits to change their land use practices and improve environmental quality. This paper describes the planning processes of the project, hurdles in findings AIJ partners, current monitoring procedures and costs of C sequestration. This shows the project is economically viable on its own, but initially needed, and continues to need, carbon credit investment in order to spread rapidly across the geopolitical region covered by the organization. It argues that economic gains to small farmers and landless labourers are the most certain way of achieving massive biomass increase and soil carbon replenishment, and that multiple holistic benefits are achieved through this kind of project. (author)

  19. A new alkaloid from the fruit of Nandina domestica Thunb.

    Science.gov (United States)

    Peng, Cai-Ying; Liu, Jian-Qun; Zhang, Rui; Shu, Ji-Cheng

    2014-01-01

    A new steroidal alkaloid, (20S,22R,24R)-24-ethyl-3-oxocholest-4-en-22-amino, named as nandsterine (1), together with 10 known alkaloids, palmatine (2), O-methylbulbocapnine (3), nantenine (4), dehydronantenine (5), glaucine (6), didehydroglaucine (7), dehydrocorydaline (8), jatrorrhizine (9), magnoflorine (10) and berberine (11), was isolated from the fruit of Nandina domestica Thunb. Their structures were elucidated by using spectroscopic methods as well as by comparing with the published data. Compound 1 was a new class of steroidal alkaloid isolated from the family Berberidaceae, meanwhile compounds 2, 3, 6-8 and 10 were obtained from N. domestica for the first time. Compound 1 exhibited cytotoxicity against HL-60 cells (human leukaemia) with IC50 values of 52.1 μM.

  20. Circadian rhytm in the house fly (Musca domestica)

    OpenAIRE

    BAZALOVÁ, Olga

    2010-01-01

    In this thesis the expression pattern of five circadian clock genes (cwo, pdp 1{$\\varepsilon$}, ck 1{$\\varepsilon$}, ck 2{$\\beta$} and pdh) was studied in the housefly (Musca domestica). The influence of temperature on the expression pattern of these five genes and of two others genes, per and tim, was examined. The locomotor activity of flies exposed to three different temperature conditions was studied.

  1. The Missing Set: How Landscape Acts in The Cherry Orchard

    Directory of Open Access Journals (Sweden)

    Ann Leone

    2000-06-01

    Full Text Available Why is the cherry orchard almost entirely absent from the stage? How does this absent landscape function dramatically? Chekhov's own garden expertise supports a study of the way that landscape in this play—its presence at once pervasive and virtual—both transcends and subverts the functions of setting. Such a reading of the function of landscape leads us to new ways of answering old questions about the play, as well: is the orchard more or other than a symbol? is the play a comedy? I examine the features and conventions of an orchard and garden landscape as they collide with characters' apprehension of the orchard as a repository of the past, and with Lopahin's plans—radical, practical and Romantic—for its future. The orchard's fate parallels the dispersal and re-definition of the family; that shared human and landscape drama can be read to show how landscape is constructed and how that construct depends upon, reflects, and may subvert human intentions.

  2. Fungicide application practices and personal protective equipment use among orchard farmers in the agricultural health study.

    Science.gov (United States)

    Hines, C J; Deddens, J A; Coble, J; Alavanja, M C R

    2007-04-01

    Fungicides are routinely applied to deciduous tree fruits for disease management. Seventy-four private orchard applicators enrolled in the Agricultural Health Study participated in the Orchard Fungicide Exposure Study in 2002-2003. During 144 days of observation, information was obtained on chemicals applied and applicator mixing, application, personal protective, and hygiene practices. At least half of the applicators had orchards with orchard applicators.

  3. Dopamine alleviates nutrient deficiency-induced stress in Malus hupehensis.

    Science.gov (United States)

    Liang, Bowen; Li, Cuiying; Ma, Changqing; Wei, Zhiwei; Wang, Qian; Huang, Dong; Chen, Qi; Li, Chao; Ma, Fengwang

    2017-10-01

    Dopamine mediates many physiological processes in plants. We investigated its role in regulating growth, root system architecture, nutrient uptake, and responses to nutrient deficiencies in Malus hupehensis Rehd. Under a nutrient deficiency, plants showed significant reductions in growth, chlorophyll concentrations, and net photosynthesis, along with disruptions in nutrient uptake, transport, and distribution. However, pretreatment with 100 μM dopamine markedly alleviated such inhibitions. Supplementation with that compound enabled plants to maintain their photosynthetic capacity and development of the root system while promoting the uptake of N, P, K, Ca, Mg, Fe, Mn, Cu, Zn, and B, altering the way in which those nutrients were partitioned throughout the plant. The addition of dopamine up-regulated genes for antioxidant enzymes involved in the ascorbate-glutathione cycle (MdcAPX, MdcGR, MdMDHAR, MdDHAR-1, and MdDHAR-2) but down-regulated genes for senescence (SAG12, PAO, and MdHXK). These results indicate that exogenous dopamine has an important antioxidant and anti-senescence effect that might be helpful for improving nutrient uptake. Our findings demonstrate that dopamine offers new opportunities for its use in agriculture, especially when addressing the problem of nutrient deficiencies. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  4. Gap probability - Measurements and models of a pecan orchard

    Science.gov (United States)

    Strahler, Alan H.; Li, Xiaowen; Moody, Aaron; Liu, YI

    1992-01-01

    Measurements and models are compared for gap probability in a pecan orchard. Measurements are based on panoramic photographs of 50* by 135 view angle made under the canopy looking upwards at regular positions along transects between orchard trees. The gap probability model is driven by geometric parameters at two levels-crown and leaf. Crown level parameters include the shape of the crown envelope and spacing of crowns; leaf level parameters include leaf size and shape, leaf area index, and leaf angle, all as functions of canopy position.

  5. Reducing post-harvest losses in South Asia's mango orchards ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-04-29

    Apr 29, 2016 ... Spraying a small concentration of hexanal in mango orchards has been found to delay the ripening of the fruit by an extra three weeks, enabling farmers to earn up to 15% more for their crop. Once the crop is harvested, hexanal-sprayed mangoes also have a much longer shelf life—up to 26 days in cold ...

  6. Punjabi Orchard Farmers: An Immigrant Enclave in Rural California.

    Science.gov (United States)

    Gibson, Margaret A.

    1988-01-01

    Examines the adaptation patterns of Punjabi Sikh orchard farmers in rural California. Discusses the role of the following: (1) the historical context of immigration; (2) the immigrants' perceptions of their particular situation; (3) the group's cultural traditions; and (4) 1965 Immigration Act. (FMW)

  7. Formulating entompathogens for control of boring beetles in avocado orchards

    Science.gov (United States)

    A foam formulation of Beauveria bassiana was adapted to control boring beetles in avocado orchards. The two geographically independent avocado growing areas in the United States are threatened by emerging diseases vectored by boring beetles. In the California growing region, Fusarium dieback is vect...

  8. Pesticides and brain cancer linked in orchard farmers of Kashmir.

    Science.gov (United States)

    Bhat, Abdul Rashid; Wani, Muhammed Afzal; Kirmani, A R; Raina, T H

    2010-10-01

    The atmosphere of valley of Kashmir is ideal for fresh and dry fruit production. Millions of tons of pesticides, insecticides and fungicides (chemicals like chlorpyriphos, mancozeb, captan, dimethoate, phosalone, etc.) are being used by the orchard farmers to spray the plants, fruits and the leaves every year. The increasing trend in the incidence of primary malignant brain tumors in orchard farmers of Kashmir is alarming. To determine the relationship between the patients of primary malignant brain tumors and their occupation. Retrospectively case files along with death certificates of 432 patients of primary malignant brain tumors and 457 controls (non-tumor neurologic diseases), admitted for treatment simultaneously over a period of 4 years from January 2005 to December 2008, to the Department of Neurosurgery, Sher-I-Kashmir Institute of Medical Sciences (SKIMS), Kashmir, were studied. Follow-up and family contact was established. The serum cholinesterase activity was measured by kinetic/DGKC calorimetric method and ethylenediaminetetraacetic acid (EDTA) samples were sent to the laboratory. The results are expressed in U/l which is U/l×1000. The laboratory at SKIMS, Srinagar, and Dr Lal PathLabs at New Delhi used a reference range for serum cholinesterase as 3167-6333 U/l. Analysis revealed that 90.04% (389 out of 432) patients were orchard-farm workers, orchard residents and orchard playing children exposed to the high levels of multiple types of neurotoxic and carcinogenic (chlorpyriphos, dimethoate, mancozeb and captan) chemicals for more than 10-20 years. About 31.9% (124 out of 389) of these from both sexes were younger than 40 years beginning exposure at an early age and had higher (orchard-related 389 patients had high grade tumors as compared to the non-pesticide tumors. Mortality in pesticide exposed tumors was 12%. Higher levels of SCE were found in 31.9% (124 out of 389) patients and decreased levels in only 45.3% (176 out of 389) orchard

  9. Brain cancer and pesticide relationship in orchard farmers of Kashmir.

    Science.gov (United States)

    Bhat, Abdul Rashid; Wani, Muhammed Afzal; Kirmani, A R

    2010-09-01

    The increasing trend in the incidence of primary malignant brain tumors in orchard farmers and their families in Kashmir. To determine the relationship between the patients of primary malignant brain tumors and their occupation. Retrospectively, case files along with death certificates of 432 patients of primary malignant brain tumors and 457 controls (non-tumor neurologic diseases), admitted for treatment simultaneously over a period of 4 years from January 2005 to December 2008, to the Neurosurgery, Sher-i-Kashmir Institute of Medical Sciences (SKIMS), Kashmir, were studied. Follow-up and family interaction was established. Analysis revealed that 90.04% (389 out of 432) patients were orchard farm workers, orchard residents and orchard playing children exposed to the high levels of multiple types of neurotoxic and carcinogenic (chlorpyriphos, dimethoate, mancozeb and captan) chemicals for more than 10 years [relative risk (RR) = 10.6; odds ratio (OR) = >10; 95% confidence interval (CI) = >25-40]. The 9.96% (43 out of 432) patients were not exposed to pesticides. On the other hand, only 19 patients out of 457 controls had recorded history of pesticide exposure and 438 were unrelated to pesticides. Out of 389 patients, 71.7% (279 out of 389) were males and 28.3% (110 out of 389), including six members of three families, were females (one male child). All orchard-related 389 patients had high-grade tumors as compared to the non-pesticide tumors. Mortality in pesticide-exposed tumors was 12%. The higher or upper-normal levels of serum cholinesterase (AChE) were observed in 54.7% (213 out of 389) patients and decreased levels were found in only 45.3% (176 out of 389) orchard-related patients (RR = 19.4; OR = >5; 95% CI = >1-10). Although serum AChE levels were a routine investigation in malignant brain tumors, this was not a routine in other neurological conditions (hospitalized controls). The familial gliomas have shown an emerging trend in the orchard residents of

  10. Modeling and performance of Bonus-Malus Systems: Stationarity versus age-correction

    DEFF Research Database (Denmark)

    Asmussen, Søren

    In a bonus-malus system in car insurance, the bonus class of a customer is updated from a year to the next as a function of the current class and the number of claims in the year (assumed Poisson). Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of t...

  11. Influência de formas de aplicação de boro na qualidade e no rendimento de maçãs (Malus domestica

    Directory of Open Access Journals (Sweden)

    Alessandra Aparecida de Sá

    2014-06-01

    Full Text Available O boro (B é aplicado na maioria dos pomares brasileiros de maçã, porém sem fundamentação experimental regional. Este trabalho teve por objetivo avaliar o efeito de formas, doses e épocas de aplicação de B no rendimento e na qualidade de maçãs. O experimento foi instalado em São Joaquim-SC, em 2002, com as cultivares Imperial Gala e Fuji Suprema conduzidas em áreas diferentes, cujas avaliações foram realizadas nas safras de 2009/2010 e 2010/2011. Os tratamentos consistiram em um fatorial envolvendo doses de B aplicadas ao solo, a cada dois anos, e épocas de pulverização na planta, feitas anualmente. Utilizou-se de delineamento experimental de blocos ao acaso, com três repetições, cujos tratamentos foram arranjados em parcelas subdividas: na parcela principal, foram alocadas as épocas de aplicação foliar de ácido bórico (sem pulverização, 0,3% pulverizado na fase de botão rosado e 0,6% em pós-colheita e nas subparcelas, as doses de bórax no solo (0; 2,5 e 5,0 kg ha-1 de B. A aplicação de B no solo foi mais eficiente do que a pulverização foliar para aumentar o teor de B na polpa, na folha e no solo; no entanto, não afetou nenhum dos atributos relacionados com a qualidade dos frutos, nas duas cultivares. A pulverização com B diminuiu o teor de amido e a acidez titulável, e não afetou o teor de sólidos solúveis e a firmeza da polpa dos frutos. A pulverização na floração diminuiu a germinação de grãos de pólen na cultivar Imperial Gala e a frutificação efetiva na cultivar Fuji Suprema. O rendimento de frutos não foi afetado pela adição de B, independentemente da época, da forma de aplicação ou dose, nas duas cultivares. Assim, não há necessidade de aplicar B nessas cultivares em pomares cultivados em solos com altos teores de matéria orgânica, com o objetivo de incrementar a produção e a qualidade dos frutos.

  12. Genome-wide identification and expression analysis of NBS-encoding genes in Malus x domestica and expansion of NBS genes family in Rosaceae.

    Directory of Open Access Journals (Sweden)

    Preeti Arya

    Full Text Available Nucleotide binding site leucine-rich repeats (NBS-LRR disease resistance proteins play an important role in plant defense against pathogen attack. A number of recent studies have been carried out to identify and characterize NBS-LRR gene families in many important plant species. In this study, we identified NBS-LRR gene family comprising of 1015 NBS-LRRs using highly stringent computational methods. These NBS-LRRs were characterized on the basis of conserved protein motifs, gene duplication events, chromosomal locations, phylogenetic relationships and digital gene expression analysis. Surprisingly, equal distribution of Toll/interleukin-1 receptor (TIR and coiled coil (CC (1 ∶ 1 was detected in apple while the unequal distribution was reported in majority of all other known plant genome studies. Prediction of gene duplication events intriguingly revealed that not only tandem duplication but also segmental duplication may equally be responsible for the expansion of the apple NBS-LRR gene family. Gene expression profiling using expressed sequence tags database of apple and quantitative real-time PCR (qRT-PCR revealed the expression of these genes in wide range of tissues and disease conditions, respectively. Taken together, this study will provide a blueprint for future efforts towards improvement of disease resistance in apple.

  13. Chilling-Mediated DNA Methylation Changes during Dormancy and Its Release Reveal the Importance of Epigenetic Regulation during Winter Dormancy in Apple (Malus x domestica Borkh..

    Directory of Open Access Journals (Sweden)

    Gulshan Kumar

    Full Text Available Winter dormancy is a well known mechanism adopted by temperate plants, to mitigate the chilling temperature of winters. However, acquisition of sufficient chilling during winter dormancy ensures the normal phenological traits in subsequent growing period. Thus, low temperature appears to play crucial roles in growth and development of temperate plants. Apple, being an important temperate fruit crop, also requires sufficient chilling to release winter dormancy and normal phenological traits, which are often associated with yield and quality of fruits. DNA cytosine methylation is one of the important epigenetic modifications which remarkably affect the gene expression during various developmental and adaptive processes. In present study, methylation sensitive amplified polymorphism was employed to assess the changes in cytosine methylation during dormancy, active growth and fruit set in apple, under differential chilling conditions. Under high chill conditions, total methylation was decreased from 27.2% in dormant bud to 21.0% in fruit set stage, while no significant reduction was found under low chill conditions. Moreover, the demethylation was found to be decreased, while methylation increased from dormant bud to fruit set stage under low chill as compared to high chill conditions. In addition, RNA-Seq analysis showed high expression of DNA methyltransferases and histone methyltransferases during dormancy and fruit set, and low expression of DNA glcosylases during active growth under low chill conditions, which was in accordance with changes in methylation patterns. The RNA-Seq data of 47 genes associated with MSAP fragments involved in cellular metabolism, stress response, antioxidant system and transcriptional regulation showed correlation between methylation and their expression. Similarly, bisulfite sequencing and qRT-PCR analysis of selected genes also showed correlation between gene body methylation and gene expression. Moreover, significant association between chilling and methylation changes was observed, which suggested that chilling acquisition during dormancy in apple is likely to affect the epigenetic regulation through DNA methylation.

  14. Linkage map positions and allelic diversity of two Mal d 3 (non-specific lipid transfer protein) genes in the cultivated apple (Malus domestica)

    NARCIS (Netherlands)

    Gao, Z.S.; Weg, van de W.E.; Schaart, J.G.; Meer, van der I.M.; Kodde, L.P.; Laimer, M.; Breiteneder, H.; Hoffmann-Sommergruber, K.; Gilissen, L.J.W.J.

    2005-01-01

    Non-specific lipid transfer proteins (nsLTPs) of Rosaceae fruits, such as peach, apricot, cherry, plum and apple, represent major allergens for Mediterranean atopic populations. As a first step in elucidating the genetics of nsLTPs, we directed the research reported here towards identifying the

  15. Genome-wide identification and expression analysis of NBS-encoding genes in Malus x domestica and expansion of NBS genes family in Rosaceae.

    Science.gov (United States)

    Arya, Preeti; Kumar, Gulshan; Acharya, Vishal; Singh, Anil K

    2014-01-01

    Nucleotide binding site leucine-rich repeats (NBS-LRR) disease resistance proteins play an important role in plant defense against pathogen attack. A number of recent studies have been carried out to identify and characterize NBS-LRR gene families in many important plant species. In this study, we identified NBS-LRR gene family comprising of 1015 NBS-LRRs using highly stringent computational methods. These NBS-LRRs were characterized on the basis of conserved protein motifs, gene duplication events, chromosomal locations, phylogenetic relationships and digital gene expression analysis. Surprisingly, equal distribution of Toll/interleukin-1 receptor (TIR) and coiled coil (CC) (1 ∶ 1) was detected in apple while the unequal distribution was reported in majority of all other known plant genome studies. Prediction of gene duplication events intriguingly revealed that not only tandem duplication but also segmental duplication may equally be responsible for the expansion of the apple NBS-LRR gene family. Gene expression profiling using expressed sequence tags database of apple and quantitative real-time PCR (qRT-PCR) revealed the expression of these genes in wide range of tissues and disease conditions, respectively. Taken together, this study will provide a blueprint for future efforts towards improvement of disease resistance in apple.

  16. Characterization of the polyphenol composition of 20 cultivars of cider, processing, and dessert apples (Malus × domestica Borkh.) grown in Virginia.

    Science.gov (United States)

    Thompson-Witrick, Katherine A; Goodrich, Katheryn M; Neilson, Andrew P; Hurley, E Kenneth; Peck, Gregory M; Stewart, Amanda C

    2014-10-15

    Polyphenols and maturity parameters were determined in 20 apple cultivars with potential for hard cider production grown in Virginia, U.S.A. Concentrations of five classes of polyphenols were significantly different across cultivar for both peel and flesh. Total polyphenol concentration ranged from 0.9 μg/g wwb in flesh of Newtown Pippin to 453 μg/g wwb in peel of Red Delicious. Harrison, Granny Smith, Rome, Winesap, and Black Twig cultivars contained the highest concentration of total flavan-3-ols in flesh, indicating potential to impart desired astringency and bitterness to cider under processing conditions where extraction of polyphenols from peel is minimal. These results can inform selection of fruit juice, extracts, and byproducts for investigations of bioactivity and bioavailability of polyphenols, and provide baseline data for horticultural and processing research supporting the growing hard cider industry in Virginia. Based on these data, cultivars Harrison, Granny Smith, Rome, Winesap, and Black Twig show high potential for cider production in Virginia.

  17. Spatial variability in soil properties and diagnostic leaf characteristics of apple (Malus domestica) in apple growing region of Dheerkot Azad Jammu and Kashmir (AJK), Pakistan

    International Nuclear Information System (INIS)

    Arjumend, T.; Abbasi, M. K.

    2016-01-01

    Scientific information on the spatial variability in soil properties and nutrient status is important for understanding ecosystem processes and evaluating agricultural land management practices. This study aims to characterize the spatial variation of selected soil properties and the nutrient status of ten representative sites of apple growing region, and also to evaluate the nutrient contents of apple leaves of the same sites from sub-division Dheerkot, Azad Jammu and Kashmir, (AJK) Pakistan. The sampling sites were: Hill, Chamankot, Chamyati-1 (upper), Chamyati-2 (lower), Dheerkot, Kotli, Karry, Sanghar, Neelabut, and Hanschoki. The treatments included; sites = 10; depths = 04 (0-15, 15-30, 30-45, and 45-60 cm) with 3 replications. Results indicated that texture of all the sites (except one) were loam or clay loam having silt and clay the dominant soil fractions. The soils were neutral to slightly alkaline, pH ranging from 7.2 to 8.3, non-saline, and moderately calcareous (CaCO/sub 3/ 0.00-8.97 percent). The nutrient index (NI) value for soil organic matter (SOM), available P and K were 2.5, 1.5 and 2.1 showing high, medium, and medium range, respectively. The concentration of AB-DTPA extractable Fe, Mn, Cu, and Zn showed high levels of Fe (10.2-16.8 mg kg-1) and Mn (0.90-2.71 mg kg/sup -1/) while Zn (0.42-2.31 mg kg/sup -1/) deficiency was observed in few samples. All the sites were severely deficient in Cu concentration (1.35-2.05 mg kg/sup -1/). The diagnosis of apples leaves indicated that none of the samples was deficient in N (2.30-3.49 percent) and P (0.13-0.33 percent) while out of ten sites, nine sites showed severe deficiency of K (0.85-1.40 percent). The study demonstrated a significant variation in different physico-chemical properties of the soils collected from the same ecological region. In order to overcome the deficiency of some of the nutrients observed both in soil and plant samples, proper fertilization especially the use of organic manures is highly recommended to maintain the fertility status of the soil and also to protect the soil against the threat of degradation. (author)

  18. Silencing of flavanone-3-hydroxylase in apple (Malus × domestica Borkh.) leads to accumulation of flavanones, but not to reduced fire blight susceptibility.

    Science.gov (United States)

    Flachowsky, Henryk; Halbwirth, Heidi; Treutter, Dieter; Richter, Klaus; Hanke, Magda-Viola; Szankowski, Iris; Gosch, Christian; Stich, Karl; Fischer, Thilo C

    2012-02-01

    Transgenic antisense flavanone-3-hydroxylase apple plants were produced to mimic the effect of the agrochemical prohexadione-Ca on apple leaves. This enzyme inhibitor for 2-oxoglutarate dependent dioxygenases is used as a growth retardant and for control of secondary fire blight of leaves. Like using the agent, silencing of flavanone-3-hydroxylase leads to an accumulation of flavanones in leaves, but in contrast not to the formation of 3-deoxyflavonoids. In prohexadione-Ca treated leaves the 3-deoxyflavonoid luteoforol is formed from accumulating flavanones, acting as an antimicrobial compound against the fire blight pathogen Erwinia amylovora. Seemingly, the silencing of just one of the 2-oxoglutarate dependent dioxygenases (in apple also flavonol synthase and anthocyanidin synthase take part downstream in the pathway) does not provide a sufficiently high ratio of flavanones to dihydroflavonols. This seems to be needed to let the dihydroflavonol-4-reductase/flavanone-4-reductase enzyme reduce flavanones to luteoforol, and to let this be reduced by the leucoanthocyanidin-4-reductase/3-deoxyleucoanthocyanidin-4-reductase, each acting with their respective weak secondary activities. Accordingly, also the intended inducible resistance to fire blight by prohexadione-Ca is not observed with the antisense flavanone-3-hydroxylase apple plants. On the other hand, for most transgenic lines with strong flavanone-4-reductase down-regulation, up-regulation of gene expression for the other flavonoid genes was found. This provides further evidence for the feedback regulation of flavonoid gene expression having been previously reported for the prohexadione-Ca inhibited apple plants. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  19. Tracing a key player in the regulation of plant architecture: the columnar growth habit of apple trees (Malus × domestica).

    Science.gov (United States)

    Petersen, Romina; Krost, Clemens

    2013-07-01

    Plant architecture is regulated by a complex interplay of some key players (often transcription factors), phytohormones and other signaling molecules such as microRNAs. The columnar growth habit of apple trees is a unique form of plant architecture characterized by thick and upright stems showing a compaction of internodes and carrying short fruit spurs instead of lateral branches. The molecular basis for columnar growth is a single dominant allele of the gene Columnar, whose identity, function and gene product are unknown. As a result of marker analyses, this gene has recently been fine-mapped to chromosome 10 at 18.51-19.09 Mb [according to the annotation of the apple genome by Velasco (2010)], a region containing a cluster of quantitative trait loci associated with plant architecture, but no homologs to the well-known key regulators of plant architecture. Columnar apple trees have a higher auxin/cytokinin ratio and lower levels of gibberellins and abscisic acid than normal apple trees. Transcriptome analyses corroborate these results and additionally show differences in cell membrane and cell wall function. It can be expected that within the next year or two, an integration of these different research methodologies will reveal the identity of the Columnar gene. Besides enabling breeders to efficiently create new apple (and maybe related pear, peach, cherry, etc.) cultivars which combine desirable characteristics of commercial cultivars with the advantageous columnar growth habit using gene technology, this will also provide new insights into an elevated level of plant growth regulation.

  20. Genome-wide identification and expression profiling of the cystatin gene family in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Tan, Yanxiao; Wang, Suncai; Liang, Dong; Li, Mingjun; Ma, Fengwang

    2014-06-01

    Cystatins or phytocystatins (PhyCys) comprise a family of plant-specific inhibitors of cysteine proteinases. Such inhibitors are thought to be involved in the regulation of several endogenous processes as well as defense against biotic or abiotic stresses. However, information about this family is limited in apple. We identified 26 PhyCys genes within the entire apple genome. They were clustered into three distinct groups distributed across several chromosomes. All of their putative proteins contained one or two typical cystatin domains, which shared the characteristic motifs of PhyCys. Eight selected genes displayed differential expression patterns in various tissues. Moreover, their transcript levels were also up-regulated significantly in leaves during maturation, senescence or in response to treatment with one or more abiotic stresses. Our results indicated that members of this family may function in tissue development, leaf senescence, and adaptation to adverse environments in apple. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  1. Evaluation of yeasts obtained from Antarctic soil samples as biocontrol agents for the management of postharvest diseases of apple (Malus × domestica).

    Science.gov (United States)

    Vero, Silvana; Garmendia, Gabriela; González, M Belén; Bentancur, Oscar; Wisniewski, Michael

    2013-03-01

    Psychrotrophic yeasts were isolated from Antarctic soils, selected based on their ability to grow in apple juice at low temperatures, and were evaluated as potential biocontrol agents for the management of postharvest diseases of apple during cold storage. Among the species recovered, an isolate of Leucosporidium scottii, designated At17, was identified as a good biocontrol agent for blue and gray mold of two apple cultivars. The selected isolate produced soluble and volatile antifungal substances that were inhibitory to apple pathogens. Siderophore production was also demonstrated, but it did not appear to play a role in pathogen inhibition. The selected yeast had the capacity to form a biofilm when grown in apple juice, which is considered an important attribute of postharvest antagonists to successfully colonize wounds and intact fruit surfaces. At17 was resistant to commonly used postharvest fungicides, so application of a combination of low-dose fungicide along with the biocontrol agent could be used as an integrated management practice. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  2. Ethylene regulates Apple (Malus x domestica) fruit softening through a dose x time-dependent mechanism and through differential sensitivities and dependencies of cell wall-modifying genes.

    Science.gov (United States)

    Ireland, Hilary S; Gunaseelan, Kularajathevan; Muddumage, Ratnasiri; Tacken, Emma J; Putterill, Jo; Johnston, Jason W; Schaffer, Robert J

    2014-05-01

    In fleshy fruit species that have a strong requirement for ethylene to ripen, ethylene is synthesized autocatalytically, producing increasing concentrations as the fruits ripen. Apple fruit with the ACC OXIDASE 1 (ACO1) gene suppressed cannot produce ethylene autocatalytically at ripening. Using these apple lines, an ethylene sensitivity dependency model was previously proposed, with traits such as softening showing a high dependency for ethylene as well as low sensitivity. In this study, it is shown that the molecular control of fruit softening is a complex process, with different cell wall-related genes being independently regulated and exhibiting differential sensitivities to and dependencies on ethylene at the transcriptional level. This regulation is controlled through a dose × time mechanism, which results in a temporal transcriptional response that would allow for progressive cell wall disassembly and thus softening. This research builds on the sensitivity dependency model and shows that ethylene-dependent traits can progress over time to the same degree with lower levels of ethylene. This suggests that a developmental clock measuring cumulative ethylene controls the fruit ripening process.

  3. A candidate gene based approach validates Md-PG1 as the main responsible for a QTL impacting fruit texture in apple (Malus x domestica Borkh).

    Science.gov (United States)

    Longhi, Sara; Hamblin, Martha T; Trainotti, Livio; Peace, Cameron P; Velasco, Riccardo; Costa, Fabrizio

    2013-03-04

    Apple is a widely cultivated fruit crop for its quality properties and extended storability. Among the several quality factors, texture is the most important and appreciated, and within the apple variety panorama the cortex texture shows a broad range of variability. Anatomically these variations depend on degradation events occurring in both fruit primary cell wall and middle lamella. This physiological process is regulated by an enzymatic network generally encoded by large gene families, among which polygalacturonase is devoted to the depolymerization of pectin. In apple, Md-PG1, a key gene belonging to the polygalacturonase gene family, was mapped on chromosome 10 and co-localized within the statistical interval of a major hot spot QTL associated to several fruit texture sub-phenotypes. In this work, a QTL corresponding to the position of Md-PG1 was validated and new functional alleles associated to the fruit texture properties in 77 apple cultivars were discovered. 38 SNPs genotyped by gene full length resequencing and 2 SSR markers ad hoc targeted in the gene metacontig were employed. Out of this SNP set, eleven were used to define three significant haplotypes statistically associated to several texture components. The impact of Md-PG1 in the fruit cell wall disassembly was further confirmed by the cortex structure electron microscope scanning in two apple varieties characterized by opposite texture performance, such as 'Golden Delicious' and 'Granny Smith'. The results here presented step forward into the genetic dissection of fruit texture in apple. This new set of haplotypes, and microsatellite alleles, can represent a valuable toolbox for a more efficient parental selection as well as the identification of new apple accessions distinguished by superior fruit quality features.

  4. Identification of TPS family members in apple (Malus x domestica Borkh.) and the effect of sucrose sprays on TPS expression and floral induction.

    Science.gov (United States)

    Du, Lisha; Qi, Siyan; Ma, Juanjuan; Xing, Libo; Fan, Sheng; Zhang, Songwen; Li, Youmei; Shen, Yawen; Zhang, Dong; Han, Mingyu

    2017-11-01

    Trehalose (α-D-glucopyranosyl α-D-glucopyranoside) is a non-reducing disaccharide that serves as a carbon source and stress protectant in apple trees. Trehalose-6-phosphate (T6P) is the biosynthetic precursor of trehalose. It functions as a crucial signaling molecule involved in the regulation of floral induction, and is closely related to sucrose. Trehalose-6-phosphate synthase (TPS) family members are pivotal components of the T6P biosynthetic pathway. The present study identified 13 apple TPS family members and characterized their expression patterns in different tissues and in response to exogenous application of sucrose during floral induction. 'Fuji' apple trees were sprayed with sucrose prior to the onset of floral induction. Bud growth, flowering rate, and endogenous sugar levels were then monitored. The expression of genes associated with sucrose metabolism and flowering were also characterized by RT-quantitative PCR. Results revealed that sucrose applications significantly improved flower production and increased bud size and fresh weight, as well as the sucrose content in buds and leaves. Furthermore, the expression of MdTPS1, 2, 4, 10, and 11 was rapidly and significantly up-regulated in response to the sucrose treatments. In addition, the expression levels of flowering-related genes (e.g., SPL genes, FT1, and AP1) also increased in response to the sucrose sprays. In summary, apple TPS family members were identified that may influence the regulation of floral induction and other responses to sucrose. The relationship between sucrose and T6P or TPS during the regulation of floral induction in apple trees is discussed. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  5. Isolation and characterization of multiple F-box genes linked to the S9- and S10-RNase in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Okada, Kazuma; Moriya, Shigeki; Haji, Takashi; Abe, Kazuyuki

    2013-06-01

    Using 11 consensus primer pairs designed from S-linked F-box genes of apple and Japanese pear, 10 new F-box genes (MdFBX21 to 30) were isolated from the apple cultivar 'Spartan' (S(9)S(10)). MdFBX21 to 23 and MdFBX24 to 30 were completely linked to the S(9) -RNase and S(10-)RNase, respectively, and showed pollen-specific expression and S-haplotype-specific polymorphisms. Therefore, these 10 F-box genes are good candidates for the pollen determinant of self-incompatibility in apple. Phylogenetic analysis and comparison of deduced amino acid sequences of MdFBX21 to 30 with those of 25 S-linked F-box genes previously isolated from apple showed that a deduced amino acid identity of greater than 88.0 % can be used as the tentative criterion to classify F-box genes into one type. Using this criterion, 31 of 35 F-box genes of apple were classified into 11 types (SFBB1-11). All types included F-box genes derived from S(3-) and S(9-)haplotypes, and seven types included F-box genes derived from S(3-), S(9-), and S(10-)haplotypes. Moreover, comparison of nucleotide sequences of S-RNases and multiple F-box genes among S(3-), S(9-), and S(10-)haplotypes suggested that F-box genes within each type showed high nucleotide identity regardless of the identity of the S-RNase. The large number of F-box genes as candidates for the pollen determinant and the high degree of conservation within each type are consistent with the collaborative non-self-recognition model reported for Petunia. These findings support that the collaborative non-self-recognition system also exists in apple.

  6. Genome-wide identification and characterization of the apple (Malus domestica) HECT ubiquitin-protein ligase family and expression analysis of their responsiveness to abiotic stresses.

    Science.gov (United States)

    Xu, Jianing; Xing, Shanshan; Cui, Haoran; Chen, Xuesen; Wang, Xiaoyun

    2016-04-01

    The ubiquitin-protein ligases (E3s) directly participate in ubiquitin (Ub) transferring to the target proteins in the ubiquitination pathway. The HECT ubiquitin-protein ligase (UPL), one type of E3s, is characterized as containing a conserved HECT domain of approximately 350 amino acids in the C terminus. Some UPLs were found to be involved in trichome development and leaf senescence in Arabidopsis. However, studies on plant UPLs, such as characteristics of the protein structure, predicted functional motifs of the HECT domain, and the regulatory expression of UPLs have all been limited. Here, we present genome-wide identification of the genes encoding UPLs (HECT gene) in apple. The 13 genes (named as MdUPL1-MdUPL13) from ten different chromosomes were divided into four groups by phylogenetic analysis. Among these groups, the encoding genes in the intron-exon structure and the included additional functional domains were quite different. Notably, the F-box domain was first found in MdUPL7 in plant UPLs. The HECT domain in different MdUPL groups also presented different spatial features and three types of conservative motifs were identified. The promoters of each MdUPL member carried multiple stress-response related elements by cis-acting element analysis. Experimental results demonstrated that the expressions of several MdUPLs were quite sensitive to cold-, drought-, and salt-stresses by qRT-PCR assay. The results of this study helped to elucidate the functions of HECT proteins, especially in Rosaceae plants.

  7. A and MdMYB1 allele-specific markers controlling apple (Malus x domestica Borkh.) skin color and suitability for marker-assisted selection.

    Science.gov (United States)

    Zhang, X J; Wang, L X; Chen, X X; Liu, Y L; Meng, R; Wang, Y J; Zhao, Z Y

    2014-10-31

    Pre-selection for fruit skin color at the seedling stage would be highly advantageous, with marker-assisted selection offering a potential method for apple pre-selection. A and MdMYB1 alleles are allele-specific DNA markers that are potentially associated with apple skin color, and co-segregate with the Rf and Rni loci, respectively. Here, we assessed the potential application of these 2 alleles for marker-assisted breeding across 30 diverse cultivars and 2 apple seedling progenies. The red skin color phenotype was usually associated with the MdMYB1-1 allele and A(1) allele, respectively, while the 2 molecular markers provided approximately 91% predictability in the 'Fuji' x 'Cripps Pink' and 'Fuji' x 'Gala' progenies. The results obtained from the 30 cultivars and 2 progenies were consistent for the 2 molecular markers. Hence, the results supported that Rf and Rni could be located in a gene cluster, or even correspond to alleles of the same gene. Our results are consistent with the hypothesis that red/yellow dimorphism is controlled by a monogenic system, with the presence of the red anthocyanin pigmentation being dominant. In addition, our results supported that the practical utilization of the 2 function markers to efficiently and accurately select red-skinned apple cultivars in apple scion breeding programs.

  8. Genome-wide analysis of carotenoid cleavage oxygenase genes and their responses to various phytohormones and abiotic stresses in apple (Malus domestica).

    Science.gov (United States)

    Chen, Hongfei; Zuo, Xiya; Shao, Hongxia; Fan, Sheng; Ma, Juanjuan; Zhang, Dong; Zhao, Caiping; Yan, Xiangyan; Liu, Xiaojie; Han, Mingyu

    2018-02-01

    Carotenoid cleavage oxygenases (CCOs) are able to cleave carotenoids to produce apocarotenoids and their derivatives, which are important for plant growth and development. In this study, 21 apple CCO genes were identified and divided into six groups based on their phylogenetic relationships. We further characterized the apple CCO genes in terms of chromosomal distribution, structure and the presence of cis-elements in the promoter. We also predicted the cellular localization of the encoded proteins. An analysis of the synteny within the apple genome revealed that tandem, segmental, and whole-genome duplication events likely contributed to the expansion of the apple carotenoid oxygenase gene family. An additional integrated synteny analysis identified orthologous carotenoid oxygenase genes between apple and Arabidopsis thaliana, which served as references for the functional analysis of the apple CCO genes. The net photosynthetic rate, transpiration rate, and stomatal conductance of leaves decreased, while leaf stomatal density increased under drought and saline conditions. Tissue-specific gene expression analyses revealed diverse spatiotemporal expression patterns. Finally, hormone and abiotic stress treatments indicated that many apple CCO genes are responsive to various phytohormones as well as drought and salinity stresses. The genome-wide identification of apple CCO genes and the analyses of their expression patterns described herein may provide a solid foundation for future studies examining the regulation and functions of this gene family. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  9. Chilling-Mediated DNA Methylation Changes during Dormancy and Its Release Reveal the Importance of Epigenetic Regulation during Winter Dormancy in Apple (Malus x domestica Borkh.).

    Science.gov (United States)

    Kumar, Gulshan; Rattan, Usha Kumari; Singh, Anil Kumar

    2016-01-01

    Winter dormancy is a well known mechanism adopted by temperate plants, to mitigate the chilling temperature of winters. However, acquisition of sufficient chilling during winter dormancy ensures the normal phenological traits in subsequent growing period. Thus, low temperature appears to play crucial roles in growth and development of temperate plants. Apple, being an important temperate fruit crop, also requires sufficient chilling to release winter dormancy and normal phenological traits, which are often associated with yield and quality of fruits. DNA cytosine methylation is one of the important epigenetic modifications which remarkably affect the gene expression during various developmental and adaptive processes. In present study, methylation sensitive amplified polymorphism was employed to assess the changes in cytosine methylation during dormancy, active growth and fruit set in apple, under differential chilling conditions. Under high chill conditions, total methylation was decreased from 27.2% in dormant bud to 21.0% in fruit set stage, while no significant reduction was found under low chill conditions. Moreover, the demethylation was found to be decreased, while methylation increased from dormant bud to fruit set stage under low chill as compared to high chill conditions. In addition, RNA-Seq analysis showed high expression of DNA methyltransferases and histone methyltransferases during dormancy and fruit set, and low expression of DNA glcosylases during active growth under low chill conditions, which was in accordance with changes in methylation patterns. The RNA-Seq data of 47 genes associated with MSAP fragments involved in cellular metabolism, stress response, antioxidant system and transcriptional regulation showed correlation between methylation and their expression. Similarly, bisulfite sequencing and qRT-PCR analysis of selected genes also showed correlation between gene body methylation and gene expression. Moreover, significant association between chilling and methylation changes was observed, which suggested that chilling acquisition during dormancy in apple is likely to affect the epigenetic regulation through DNA methylation.

  10. Polyphenol-rich apple (Malus domestica L.) peel extract attenuates arsenic trioxide induced cardiotoxicity in H9c2 cells via its antioxidant activity.

    Science.gov (United States)

    Vineetha, Vadavanath Prabhakaran; Girija, Seetharaman; Soumya, Rema Sreenivasan; Raghu, Kozhiparambil Gopalan

    2014-03-01

    Evidences suggest that apple peel has a wide range of polyphenols having antioxidant activity and its consumption has been linked with improved health benefits. Arsenic trioxide (ATO) is a very effective drug for the treatment of acute promyelocytic leukemia (APL) but it leads to cardiotoxicity mediated through alterations in various cardiac ion channels and by increasing the intracellular calcium level and reactive oxygen species (ROS). The aim of the present investigation was to study the effect of methanolic extract of apple peel (APME) and aqueous extract of apple peel (APAE) on ATO (5 μM) induced toxicity in the H9c2 cardiac myoblast cell line. We estimated the cellular status of innate antioxidant enzymes, level of ROS, mitochondrial superoxide, glutathione and intracellular calcium with ATO and apple peel extracts. Prior to the cell line based study, we had evaluated the antioxidant potential of apple peel extract by 1,1-diphenyl-2-picrylhydrazyl (DPPH), total reducing power (TRP), superoxide anion and hydroxyl radical scavenging activity, in addition to quantifying total phenolic and flavonoid content. Both the extracts showed considerable antioxidant activity in cell-free chemical assays. In addition, both APME and APAE prevented the alteration in antioxidant status induced by ATO in H9c2 cells. Significant differential alterations had been observed in the activity of lactate dehydrogenase, superoxide dismutase, catalase, glutathione, glutathione peroxidase, thioredoxin reductase, xanthine oxidase, calcium overload and caspase 3 activity with ATO. The overall result revealed the protective property of polyphenol-rich apple peel extract against ATO induced cardiac toxicity via its antioxidant activity.

  11. Effect of halide salts on development of surface browning on fresh-cut 'Granny Smith' (Malus × domestica Borkh) apple slices during storage at low temperature.

    Science.gov (United States)

    Li, Yongxin; Wills, Ron B H; Golding, John B; Huque, Roksana

    2015-03-30

    The postharvest life of fresh-cut apple slices is limited by browning on cut surfaces. Dipping in halide salt solutions was examined for their inhibition of surface browning on 'Granny Smith' apple slices and the effects on biochemical factors associated with browning. Delay in browning by salts was greatest with chloride = phosphate > sulfate > nitrate with no difference between sodium, potassium and calcium ions. The effectiveness of sodium halides on browning was fluoride > chloride = bromide > iodide = control. Polyphenol oxidase (PPO) activity of tissue extracted from chloride- and fluoride-treated slices was not different to control but when added into the assay solution, NaF > NaCl both showed lower PPO activity at pH 3-5 compared to control buffer. The level of polyphenols in treated slices was NaF > NaCl > control. Addition of chlorogenic acid to slices enhanced browning but NaCl and NaF counteracted this effect. There was no effect of either halide salt on respiration, ethylene production, ion leakage, and antioxidant activity. Dipping apple slices in NaCl is a low cost treatment with few impediments to commercial use and could be a replacement for other anti-browning additives. The mode of action of NaCl and NaF is through decreasing PPO activity resulting in reduced oxidation of polyphenols. © 2014 Society of Chemical Industry.

  12. Identification of genes for melatonin synthetic enzymes in 'Red Fuji' apple (Malus domestica Borkh.cv.Red) and their expression and melatonin production during fruit development.

    Science.gov (United States)

    Lei, Qiong; Wang, Lin; Tan, Dun-Xian; Zhao, Yu; Zheng, Xiao-Dong; Chen, Hao; Li, Qing-Tian; Zuo, Bi-Xiao; Kong, Jin

    2013-11-01

    Melatonin is present in many edible fruits; however, the presence of melatonin in apple has not previously been reported. In this study, the genes for melatonin synthetic enzymes including tryptophan decarboxylase, tryptamine 5-hydroxylase (T5H), arylalkylamine N-acetyltransferase, and N-acetylserotonin methyltransferase were identified in 'Red Fuji' apple. Each gene has several homologous genes. Sequence analysis shows that these genes have little homology with those of animals and they only have limited homology with known genes of rice melatonin synthetic enzymes. Multiple origins of melatonin synthetic genes during the evolution are expected. The expression of these genes is fully coordinated with melatonin production in apple development. Melatonin levels in apple exhibit an inverse relationship with the content of malondialdehyde, a product of lipid peroxidation. Two major melatonin synthetic peaks appeared on July 17 and on October 8 in both unbagged and bagged apple samples. At the periods mentioned above, apples experienced rapid expansion and increased respiration. These episodes significantly elevate reactive oxygen species production in the apple. Current data further confirmed that melatonin produced in apple was used to neutralize the toxic oxidants and protect the developing apple against oxidative stress. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. Role of the genes Md-ACO1 and Md-ACS1 in ethylene production and shelf life of apple (Malus domestica Borkh)

    NARCIS (Netherlands)

    Costa, F.; Stella, S.; Weg, van de W.E.; Guerra, W.; Cecchinel, M.; Dallavia, J.; Koller, B.; Sansavini, S.

    2005-01-01

    Shelf life determines the economic life time of mature apples, which can be either freshly harvested or stored. Good shelf life is highly associated with a slow decrease of fruit firmness at room temperature. Apple is a climacteric fruit, in which loss of firmness seems to be physiologically related

  14. A novel feedstuff: ensiling of cowpea (Vigna unguiculata L.) stover and apple (Malus domestica Borkh.) mixtures. Evaluation of the nutritive value, fermentation quality and aerobic stability.

    Science.gov (United States)

    Andrade, Ederson; Gonçalves, Alexandre; Mendes-Ferreira, Ana; Silva, Valéria; Pinheiro, Victor; Rodrigues, Miguel; Ferreira, Luis

    2017-10-01

    Agro-industrial by-products are of low economic value as foods for human consumption but may have potential value as animal feedstuffs. This study evaluated a novel feedstuff, ensiled discarded apple (85%) and cowpea stover (15%) mixtures with two different ensiling periods (45 and 60 days), regarding the nutritive value, fermentation quality and aerobic stability. Generally, no differences (P > 0.05) were observed between ensiling periods for nutritive value and fermentation characteristics. Silages were stable after ensiling, presenting high lactic acid (77.3 g kg -1 dry matter (DM)) and acetic acid (54.7 g kg -1 DM) and low ethanol (15.7 g kg -1 DM) and NH 3 -N (105.6 g kg -1 total N) concentrations. No butyric acid was detected in silages, and they were aerobically stable for up to 216 h. Lactic acid bacteria numbers were high at silo opening (7.14 log colony-forming units (CFU) g -1 ), while Enterobacteriaceae were not detected and yeasts/moulds were low (2.44 log CFU g -1 ). Yeast/mould and Enterobacteriaceae numbers grew considerably during 12 days of air exposure. A mixture of low calibre discarded apples with cowpea stover can be used as animal feed after the ensiling process owing to its nutritive value and long aerobic stability. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  15. Dissipation kinetics of trifloxystrobin and tebuconazole on apple (Malus domestica) and soil--a multi location study from north western Himalayan region.

    Science.gov (United States)

    Patyal, S K; Sharma, I D; Chandel, R S; Dubey, J K

    2013-08-01

    A new combinational fungicide formulation trifloxystrobin 25%+tebuconazole 50% (Nativo 75WG), introduced as a part of resistance management strategy, was studied for dissipation behaviour on apple fruits. Nativo 75WG was sprayed twice at the rate of 400 g and 800 g a.i. ha(-1) equal to trifloxystrobin application rate of 100 and 200 g a.i. ha(-1) and tebuconazole at application rate of 200 and 400 g a.i. ha(-1) at four different locations in the Northwest Himalayan region of India. The fruit samples collected at 10d interval and soil samples taken at harvest time were analyzed after second spray. The residual concentrations of trifloxystrobin, its acid metabolite CGA 321113 and tebuconazole were measured. Residues of both fungicides were determined by using gas chromatograph, Agilent 6890N having electron capture detector. The mean initial deposits of trifloxystrobin at four locations were found to be in the range of 0.333-0.387 mg kg(-1) and 0.512-0.714 mg kg(-1) at the application rate of 100 and 200 g a.i. ha(-1), and half-life were found between 19.38-24.93 d and 19.84-28.86 d at the respective doses. The Σ-trifloxystrobin and tebuconazole residues were below determination limit in 40 d apple fruits and soil samples. Initial deposits of trifloxystrobin and tebuconazole were below their Codex MRLs at the respective single doses. The half life value of the tebuconazole deposits ranged between 19.38-25.99 d and 19.84-28.86 d at the respective single and double dose. The study thus suggests 1d pre harvest interval for safe consumption of apple fruit after the application of Nativo 75 WG at single dose. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Insights into secondary growth in perennial plants: its unequal spatial and temporal dynamics in the apple (Malus domestica) is driven by architectural position and fruit load.

    Science.gov (United States)

    Lauri, P E; Kelner, J J; Trottier, C; Costes, E

    2010-04-01

    Secondary growth is a main physiological sink. However, the hierarchy between the processes which compete with secondary growth is still a matter of debate, especially on fruit trees where fruit weight dramatically increases with time. It was hypothesized that tree architecture, here mediated by branch age, is likely to have a major effect on the dynamics of secondary growth within a growing season. Three variables were monitored on 6-year-old 'Golden Delicious' apple trees from flowering time to harvest: primary shoot growth, fruit volume, and cross-section area of branch portions of consecutive ages. Analyses were done through an ANOVA-type analysis in a linear mixed model framework. Secondary growth exhibited three consecutive phases characterized by unequal relative area increment over the season. The age of the branch had the strongest effect, with the highest and lowest relative area increment for the current-year shoots and the trunk, respectively. The growth phase had a lower effect, with a shift of secondary growth through the season from leafy shoots towards older branch portions. Eventually, fruit load had an effect on secondary growth mainly after primary growth had ceased. The results support the idea that relationships between production of photosynthates and allocation depend on both primary growth and branch architectural position. Fruit load mainly interacted with secondary growth later in the season, especially on old branch portions.

  17. Obtaining apple haploid plants (Malus X domestica Borkh.) from in situ parthenogenesis induced by irradiated pollen and in vitro culture of immature seeds

    International Nuclear Information System (INIS)

    Zhang, Y.X.; Lespinasse, Y.; Chevreau, E.

    1988-01-01

    Two apple varieties, ''Erovan'' and ''Lodi'', have been pollinated with pollen carrying the marker gene R irradiated by gamma rays from Cobalt 60 with doses of 500, 1000 and 1500 Gy. By in vitro cultures of the immature seeds removed 7 to 13 weeks after pollination, haploid plants (2n=x=17) have been obtained from ''Erovan'' [fr

  18. No effect of the farming system (organic/conventional) on the bioavailability of apple (Malus domestica Bork., cultivar Golden Delicious) polyphenols in healthy men: a comparative study.

    Science.gov (United States)

    Stracke, Berenike A; Rüfer, Corinna E; Bub, Achim; Seifert, Stephanie; Weibel, Franco P; Kunz, Clemens; Watzl, Bernhard

    2010-08-01

    The organic food sales have been increasing during the recent years. It has been hypothesised that organically grown fruits are healthier based on their higher content of phytochemicals. However, data on the bioavailability of phytochemicals from organically or conventionally produced plant foods are scarce. Two human intervention studies were performed to compare the bioavailability of polyphenols in healthy men after ingestion of apples from different farming systems. The administered apples were grown organically and conventionally under defined conditions and characterised regarding their polyphenol content and antioxidant capacity. No significant differences in the polyphenol content and the antioxidant capacity from the organic and conventional farming system were observed. In the short-term intervention study, six men consumed either organically or conventionally produced apples in a randomized cross-over study. After intake of 1 kg apples, phloretin (C (max) 13 + or - 5 nmol/l, t (max) 1.7 + or - 1.2 h) and coumaric acid (C (max )35 + or - 12 nmol/l, t (max) 3.0 + or - 0.8 h) plasma concentrations increased significantly (P farming systems. In the long-term intervention study, 43 healthy volunteers consumed organically or conventionally produced apples (500 g/day; 4 weeks) or no apples in a double-blind, randomized intervention study. In this study, 24 h after the last dosing regime, the apple intake did not result in increasing polyphenol concentrations in plasma and urine compared to the control group suggesting no accumulation of apple polyphenols or degradation products in humans. Our study suggests that the two farming systems (organic/conventional) do not result in differences in the bioavailability of apple polyphenols.

  19. Using gamma irradiation for the improvement of MM106 and omara apple Malus domestica Borkh rootstocks to sodium chloride tolerance in Vitro

    International Nuclear Information System (INIS)

    Aljibouri, A.A.M.; Abdel-Hussen, M.A.; Salman, M.A.

    2010-01-01

    In vitro plant lets of MM106 and Omara apple rootstocks were irradiated with gamma ray doses (0, 5, 10, 15, 20, 25, 30, and 35 Gray). Shoot tips of irradiated plant lets with incremental doses were in vitro cultured on MS medium supplemented with different NaCl concentrations to study the effect of gamma rays and NaCl salt on shoot number, shoot length and rooting percentage. Results revealed that gamma rays treatment improved significantly the parameters investigated for both types of rootstocks, especially the doses of 15 and 20 Gy for MM106 and 25 Gy for Omara. On the other hand, salinity caused a significant reduction in all parameters measured with different trend between both types of rootstocks. The results also showed significant interaction between gamma rays doses and NaCl concentrations.

  20. The knock-down of the expression of MdMLO19 reduces susceptibility to powdery mildew (Podosphaera leucotricha) in apple (Malus domestica)

    NARCIS (Netherlands)

    Pessina, Stefano; Angeli, Dario; Martens, Stefan; Visser, Richard G.F.; Bai, Yuling; Salamini, Francesco; Velasco, Riccardo; Schouten, Henk J.; Malnoy, Mickael

    2016-01-01

    Varieties resistant to powdery mildew (PM; caused by Podosphaera leucotricha) are a major component of sustainable apple production. Resistance can be achieved by knocking-out susceptibility S-genes to be singled out among members of the MLO (Mildew Locus O) gene family. Candidates are MLO

  1. The knock-down of the expression of MdMLO19 reduces susceptibility to powdery mildew (Podosphaera leucotricha) in apple (Malus domestica).

    Science.gov (United States)

    Pessina, Stefano; Angeli, Dario; Martens, Stefan; Visser, Richard G F; Bai, Yuling; Salamini, Francesco; Velasco, Riccardo; Schouten, Henk J; Malnoy, Mickael

    2016-10-01

    Varieties resistant to powdery mildew (PM; caused by Podosphaera leucotricha) are a major component of sustainable apple production. Resistance can be achieved by knocking-out susceptibility S-genes to be singled out among members of the MLO (Mildew Locus O) gene family. Candidates are MLO S-genes of phylogenetic clade V up-regulated upon PM inoculation, such as MdMLO11 and 19 (clade V) and MdMLO18 (clade VII). We report the knock-down through RNA interference of MdMLO11 and 19, as well as the complementation of resistance with MdMLO18 in the Arabidopsis thaliana triple mlo mutant Atmlo2/6/12. The knock-down of MdMLO19 reduced PM disease severity by 75%, whereas the knock-down of MdMLO11, alone or in combination with MdMLO19, did not result in any reduction or additional reduction of susceptibility compared with MdMLO19 alone. The test in A. thaliana excluded a role for MdMLO18 in PM susceptibility. Cell wall appositions (papillae) were present in both PM-resistant and PM-susceptible plants, but were larger in resistant lines. No obvious negative phenotype was observed in plants with mlo genes knocked down. Apparently, MdMLO19 plays the pivotal role in apple PM susceptibility and its knock-down induces a very significant level of resistance. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  2. Recent patents on physical, mineral & organic Acid composition of golden delicious and red delicious apples (malus×domestica borkh) grown in the west of Iran.

    Science.gov (United States)

    Rad, Amir H K; Falahi, Ebrahim; Ebrahimzadeh, Farzad

    2014-01-01

    Apple is one of the fruits that has beneficial effects on human healthy diet and life. The aim of this study is to determine some physical, mineral and organic acids composition of apple cultivars grown in different locations throughout Lorestan province. Apple cultivars had been harvested from different locations throughout Lorestan province of Iran. Analyses for 3 elements (Iron, Zinc, and calcium) were conducted by the flame atomic absorption spectrometry. Phosphorus was measured by the UV-Vis spectrophotometer and Sodium and Potassium were measured by the flame photometer. Organic acids were determined by Titration method using NaOH and phenolphethalein indicator. Weight was measured by scale based on 0.1 g and length and diameters were measured by caliper. The mean weight of Red Delicious and Golden Delicious apples was 173.7 g and 146.7 g, respectively. The amount of iron, zinc, calcium, phosphorus, sodium, and potassium for the red variety was 0.24, 0.14, 28, 8.9, 4.7 and 63.8 respectively; values for the Golden variety were 0.23, 0.14, 27.9, 8.8, 4.5, and 66.3 mg/100g fresh weight, respectively. The amount of ascorbic acid, malic acid, and citric acid for Golden delicious was 9.09, 0.27 and 0.28, respectively; for Red delicious apples, the amount was 9.47, 0.26 and 0.28 mg/100 g, respectively. Acidities for Golden delicious and Red delicious were 3.7 and 4, respectively. One hundred gram of apple fruit grown in Lorestan would provide 3% of iron, 1.5% of zinc, 2.8% of calcium and 1.4% of potassium requirements. The amount of organic acid in apples of Lorestan province was lower than some other countries.

  3. Identification/quantification of free and bound phenolic acids in peel and pulp of apples (Malus domestica) using high resolution mass spectrometry (HRMS).

    Science.gov (United States)

    Lee, Jihyun; Chan, Bronte Lee Shan; Mitchell, Alyson E

    2017-01-15

    Free and bound phenolic acids were measured in the pulp and peel of four varieties of apples using high resolution mass spectrometry. Twenty-five phenolic acids were identified and included: 8 hydroxybenzoic acids, 11 hydroxycinnamic acids, 5 hydroxyphenylacetic acids, and 1 hydoxyphenylpropanoic acid. Several phenolics are tentatively identified for the first time in apples and include: methyl gallate, ethyl gallate, hydroxy phenyl acetic acid, three phenylacetic acid isomers, 3-(4-hydroxyphenyl)propionic acid, and homoveratric acid. With exception of chlorogenic and caffeic acid, most phenolic acids were quantified for the first time in apples. Significant varietal differences (pacids were higher in the pulp as compared to apple peel (dry weight) in all varieties. Coumaroylquinic, protocatechuic, 4-hydroxybenzoic, vanillic and t-ferulic acids were present in free forms. With exception of chlorogenic acid, all other phenolic acids were present only as bound forms. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Metabolism of organic acids, nitrogen and amino acids in chlorotic leaves of 'Honeycrisp' apple (Malus domestica Borkh) with excessive accumulation of carbohydrates.

    Science.gov (United States)

    Wang, Huicong; Ma, Fangfang; Cheng, Lailiang

    2010-07-01

    Metabolite profiles and activities of key enzymes in the metabolism of organic acids, nitrogen and amino acids were compared between chlorotic leaves and normal leaves of 'Honeycrisp' apple to understand how accumulation of non-structural carbohydrates affects the metabolism of organic acids, nitrogen and amino acids. Excessive accumulation of non-structural carbohydrates and much lower CO(2) assimilation were found in chlorotic leaves than in normal leaves, confirming feedback inhibition of photosynthesis in chlorotic leaves. Dark respiration and activities of several key enzymes in glycolysis and tricarboxylic acid (TCA) cycle, ATP-phosphofructokinase, pyruvate kinase, citrate synthase, aconitase and isocitrate dehydrogenase were significantly higher in chlorotic leaves than in normal leaves. However, concentrations of most organic acids including phosphoenolpyruvate (PEP), pyruvate, oxaloacetate, 2-oxoglutarate, malate and fumarate, and activities of key enzymes involved in the anapleurotic pathway including PEP carboxylase, NAD-malate dehydrogenase and NAD-malic enzyme were significantly lower in chlorotic leaves than in normal leaves. Concentrations of soluble proteins and most free amino acids were significantly lower in chlorotic leaves than in normal leaves. Activities of key enzymes in nitrogen assimilation and amino acid synthesis, including nitrate reductase, glutamine synthetase, ferredoxin and NADH-dependent glutamate synthase, and glutamate pyruvate transaminase were significantly lower in chlorotic leaves than in normal leaves. It was concluded that, in response to excessive accumulation of non-structural carbohydrates, glycolysis and TCA cycle were up-regulated to "consume" the excess carbon available, whereas the anapleurotic pathway, nitrogen assimilation and amino acid synthesis were down-regulated to reduce the overall rate of amino acid and protein synthesis.

  5. Influence of processing on the quality of pomaceas juice (Pyrus communis and Malus domestica) - doi: 10.4025/actasciagron.v35i1.15360

    OpenAIRE

    Rocha, Andressa Schaia; Universidade Estadual de Ponta Grossa; Zielinski, Acácio Antonio Ferreira; Universidade Estadual de Ponta Grossa; Ávila, Suelen; Universidade Estadual de Ponta Grossa; Nogueira, Alessandro; Universidade Estadual de Ponta Grossa; Wosiacki, Gilvan; Universidade Estadual de Ponta Grossa

    2012-01-01

    Pear (Pyrus communis), which is intensively cultivated in subtropical and temperate climates, has recently attained the 3rd position in the world fruit ranking, just after apple and peach. This fruit exhibits certain similarities to apple with respect to the pulp, but pear is used as a raw material only when apple is no longer available, which suggests that the same technology line may be utilized. Both fruits do have processing compatibilities, and it is permissible to add pear juice to appl...

  6. Musca domestica laboratory susceptibility to three ethnobotanical culinary plants.

    Science.gov (United States)

    El Zayyat, Elham A; Soliman, Mohammed I; Elleboudy, Noha A; Ofaa, Shaimaa E

    2015-10-01

    Throughout history, synanthropic Musca domestica had remained a worldwide problem whenever poor sanitation and bad hygienic conditions exists. Houseflies growing resistance to chemical insecticides are a rising environmental problem that necessitates search for alternatives. Mentha cervina, Ocimum basilicum, and Coriandrum sativum were tested for bioactivity on M. domestica adults and larvae. They are culinary Mediterranean plants. In adulticidal bioassay, using both CDC bottles and fumigation techniques, basil was the most effective extract with LC50 1.074 and 34.996 g/L, respectively. Concerning larvicidal bioassay by fumigation technique, coriander had the highest toxicity index with LC50 29.521 g/L. In both dipping and feeding technique, basil had the highest toxicity with LC50 32.643 and 0.749 g/L, respectively. Basil showed the highest toxicity results in four out of the five models tested followed by coriander then mint; this result highlights the potentiality of basil as a green insecticide in management of flies and opens new insight in the industrialization of basil-based fly control products.

  7. DAILY STEM GROWTH PATTERN IN IRRIGATED APPLE ORCHARDS FROM ARGES COUNTY IN RELATION TO CLIMATE CHANGES

    Directory of Open Access Journals (Sweden)

    E. Chitu

    2012-01-01

    Full Text Available In terms of climate change manifested in the last 30 years in Romania (1982-2011, average data for 29 localities and characterized by a significant increase in maximum and minimum temperatures, especially in the summer months and increased rainfall deficit, fruit trees farm efficiency is becoming increasingly dependent on strict control of water management through irrigation systems. Thus, the maximum air temperatures experienced average growth trend per decade of 0.88°C, 0.82°C and 0.70°C in June, July and August, respectively, and minimum of 0.61°C, 0.67°C and 0.75°C, in the same months. In this context, ensuring continuous easily accessible soil water content to the root system of the trees, in correlation with plant consumption, has become the most widely used measure to mitigate the negative effects of rising temperatures and rainfall deficits. One of the most accurate methods of water stress early diagnosis and monitoring in a very short step of the fruit trees growth processes is the measurement of trunk diameter variations (SDV with electronic dendrometers. To highlight the advantages of applying the method to irrigated apple (Malus domestica Borkh. plantations from the southern Romania, we have organized two experiences with Redix and Braeburn cvs. grafted on M9 in 2009-2012 period. For measurements were used DEX 100 (Dynamax dendrometers and GP1 dataloggers (Delta-T Devices. It was found that all SDV-derived indices (maximum daily shrinkage (MDS, daily recovery (DR and daily growth (DG of the trees trunk between two successive days may be used for early diagnosis of water and temperature stress. DG was significantly negatively influenced by MDS in both cultivars and in all months of the year, except in September. The Redix cv. DG was inhibited only by the MDS values greater than 0.36 mm. DG is a much less sensitive indicator of water and heat trees stress than MDS. Emergence of water stress was highlighted by two indicators: soil

  8. Avian nesting success and diversity in conventionally and organically managed apple orchards

    Science.gov (United States)

    Fluetsch, K.M.; Sparling, D.W.

    1994-01-01

    This study examines the effects of operational use of pesticides on avian species inhabiting apple orchards in Pennsylvania. Mourning dove (Zenaida rnacroura) and American robin (Turdus migratorius) nests were monitored in three organic and three conventional apple orchards during 1990 and 1991. In 1991 we surveyed the avian communities of these orchards by using line transects. Organophosphorus (OP) (e.g., azinphos-methyl, phosphamidon, parathion, dimethoate), carbamate (CA) (e.g., methomyl, formetanate, oxamyl), and organochlorine (endosulfan) pesticides, known to be highly toxic to birds, were sprayed individually or in mixtures as part of routine pest management as many as 19 times during peaks in breeding activity. Spray card tests revealed that OP pesticides were deposited on 86% of the nests in conventional orchards. Daily survival rates (DSRs) for nests of both species were higher in the organic orchards than in the conventional orchards for 1991 and for years combined (p the organic orchards (H= 2.43) than in the conventional orchards (H=1.79). Repeated applications of pesticides within the conventional orchards reduced the reproductive success of doves and robins and may have lowered avian species diversity compared with organic orchards.

  9. Novel cycloartane-type triterpenoid from the fruits of Nandina domestica.

    Science.gov (United States)

    Kodai, Tetsuya; Horiuchi, Yoshinori; Nishioka, Yasuhiro; Noda, Naoki

    2010-04-01

    A novel cycloartane-type triterpenoid was isolated from the fruits of Nandina domestica (Berberidaceae). The structure was characterized as 24-methylene-3-oxocycloartane 13-carboxylic acid on the basis of NMR spectroscopic data.

  10. Feeding Behavior-Related Toxicity due to Nandina domestica in Cedar Waxwings (Bombycilla cedrorum

    Directory of Open Access Journals (Sweden)

    Moges Woldemeskel

    2010-01-01

    Full Text Available Dozens of Cedar Waxwings were found dead in Thomas County, Georgia, USA, in April 2009. Five of these were examined grossly and microscopically. Grossly, all the examined birds had pulmonary, mediastinal, and tracheal hemorrhages. Microscopically, several tissues and organs were diffusely congested and hemorrhagic. Congestion and hemorrhage were marked in the lungs. Intact and partly digested berries of Nandina domestica Thunb. were the only ingesta found in the gastrointestinal tract of these birds. Due to their voracious feeding behavior, the birds had eaten toxic doses of N. domestica berries. N. domestica contains cyanide and is one of the few berries readily available at this time of the year in the region. The gross and microscopic findings are consistent with lesions associated with cyanide toxicity. This paper for the first time documents toxicity associated with N. domestica in Cedar Waxwings.

  11. Brain cancer and pesticide relationship in orchard farmers of Kashmir

    OpenAIRE

    Bhat, Abdul Rashid; Wani, Muhammed Afzal; Kirmani, A. R.

    2010-01-01

    Background: The increasing trend in the incidence of primary malignant brain tumors in orchard farmers and their families in Kashmir. Aim: To determine the relationship between the patients of primary malignant brain tumors and their occupation. Materials and Methods: Retrospectively, case files along with death certificates of 432 patients of primary malignant brain tumors and 457 controls (non-tumor neurologic diseases), admitted for treatment simultaneously over a period of 4 years from Ja...

  12. Development and Application Prospects of Pneumatic Electrostatic Sprayer in Orchard

    OpenAIRE

    Zhou, Yan; Qi, Li-jun; Jia, Shou-xing; Zheng, Xuan; Meng, Xiang-jin; Tang, Zhi-hui; Shen, Cong-ju

    2012-01-01

    We firstly introduce existing situations of development of electrostatic spraying technology both at home and abroad. On the basis of such problems as serious drift, loss and deterioration of environment during orchard spraying in Xinjiang, we design and develop a new electrostatic sprayer which can effectively reduce the pesticide, improve the adhesion rate of pesticide in the target, and reduce pollution on human body and environment. Using electrostatic induction principle, this electrosta...

  13. Genotyping-by-sequencing markers facilitate the identification of quantitative trait loci controlling resistance to Penicillium expansum in Malus sieversii.

    Directory of Open Access Journals (Sweden)

    John L Norelli

    Full Text Available Blue mold caused by Penicillium expansum is the most important postharvest disease of apple worldwide and results in significant financial losses. There are no defined sources of resistance to blue mold in domesticated apple. However, resistance has been described in wild Malus sieversii accessions, including plant introduction (PI613981. The objective of the present study was to identify the genetic loci controlling resistance to blue mold in this accession. We describe the first quantitative trait loci (QTL reported in the Rosaceae tribe Maleae conditioning resistance to P. expansum on genetic linkage group 3 (qM-Pe3.1 and linkage group 10 (qM-Pe10.1. These loci were identified in a M.× domestica 'Royal Gala' X M. sieversii PI613981 family (GMAL4593 based on blue mold lesion diameter seven days post-inoculation in mature, wounded apple fruit inoculated with P. expansum. Phenotypic analyses were conducted in 169 progeny over a four year period. PI613981 was the source of the resistance allele for qM-Pe3.1, a QTL with a major effect on blue mold resistance, accounting for 27.5% of the experimental variability. The QTL mapped from 67.3 to 74 cM on linkage group 3 of the GMAL4593 genetic linkage map. qM-Pe10.1 mapped from 73.6 to 81.8 cM on linkage group 10. It had less of an effect on resistance, accounting for 14% of the experimental variation. 'Royal Gala' was the primary contributor to the resistance effect of this QTL. However, resistance-associated alleles in both parents appeared to contribute to the least square mean blue mold lesion diameter in an additive manner at qM-Pe10.1. A GMAL4593 genetic linkage map composed of simple sequence repeats and 'Golden Delicious' single nucleotide polymorphism markers was able to detect qM-Pe10.1, but failed to detect qM-Pe3.1. The subsequent addition of genotyping-by-sequencing markers to the linkage map provided better coverage of the PI613981 genome on linkage group 3 and facilitated discovery of q

  14. Great tits (Parus major reduce caterpillar damage in commercial apple orchards.

    Directory of Open Access Journals (Sweden)

    Christel M M Mols

    Full Text Available Alternative ways to control caterpillar pests and reduce the use of pesticides in apple orchards are in the interest of the environment, farmers and the public. Great tits have already been shown to reduce damage under high caterpillar density when breeding in nest boxes in an experimental apple orchard. We tested whether this reduction also occurs under practical conditions of Integrated Pest Management (IPM, as well as Organic Farming (OF, by setting up an area with nest boxes while leaving a comparable area as a control within 12 commercial orchards. We showed that in IPM orchards, but not in OF orchards, in the areas with breeding great tits, apples had 50% of the caterpillar damage of the control areas. Offering nest boxes to attract insectivorous passerines in orchards can thus lead to more limited pesticide use, thereby adding to the natural biological diversity in an agricultural landscape, while also being economically profitable to the fruit growers.

  15. Great tits (Parus major) reduce caterpillar damage in commercial apple orchards.

    Science.gov (United States)

    Mols, Christel M M; Visser, Marcel E

    2007-02-07

    Alternative ways to control caterpillar pests and reduce the use of pesticides in apple orchards are in the interest of the environment, farmers and the public. Great tits have already been shown to reduce damage under high caterpillar density when breeding in nest boxes in an experimental apple orchard. We tested whether this reduction also occurs under practical conditions of Integrated Pest Management (IPM), as well as Organic Farming (OF), by setting up an area with nest boxes while leaving a comparable area as a control within 12 commercial orchards. We showed that in IPM orchards, but not in OF orchards, in the areas with breeding great tits, apples had 50% of the caterpillar damage of the control areas. Offering nest boxes to attract insectivorous passerines in orchards can thus lead to more limited pesticide use, thereby adding to the natural biological diversity in an agricultural landscape, while also being economically profitable to the fruit growers.

  16. Phosphorus fractions in apple orchards in southern Brazil

    Directory of Open Access Journals (Sweden)

    Djalma Eugênio Schmitt

    Full Text Available ABSTRACT Phosphorus (P applications at dosages higher than the necessary may cause P buildup in the soil labile fractions and, consequently, pollution of water sources. This study aimed to assess accumulation of P fractions as well as the parameters of adsorption isotherms in soil profiles having a history of application of phosphate fertilizers and cultivated with apple trees. Soil samples were collected from an area with no history of cultivation and 2 apple orchards cultivated for 8 (P8 and 18 (P18 years, in the city of Urubici, Santa Catarina, southern Brazil. Soil samples were air dried, sieved in a 2-mm mesh, and subjected to chemical analyses (P adsorption besides P chemical fractionation. Applications of phosphate fertilizers to the orchards, particularly P18, increased the inorganic and organic concentrations of P in all fractions. The distribution of P in organic and inorganic forms in the planted soils was similar to the distribution observed for the native vegetation soil. The highest inorganic labile P fraction, the lowest maximum P adsorption capacity, and the highest equilibrium concentration values at P18 are indicators of a higher environmental pollution risk of the orchards soils compared to the native soil.

  17. SURFACE ENERGY BALANCE OVER ORANGE ORCHARD USING SURFACE RENEWAL ANALYSIS

    Directory of Open Access Journals (Sweden)

    Salvatore Barbagallo

    2009-12-01

    Full Text Available Reliable estimation of surface sensible and latent heat flux is the most important process to appraise energy and mass exchange among atmosphere and biosphere. In this study the surface energy fluxes were measured over an irrigated orange orchard during 2005-2008 monitoring periods using a Surface Renewal- Energy Balance approach. The experimental area is located in a representative orchard growing area of eastern Sicily (Italy. The performance of Surface Renewal (SR analysis for estimating sensible heat flux (H was analysed and evaluated in terms of correlation with H fluxes from the eddy covariance (EC method. Study revealed that the mean available energy (RN- G and latent heat flux (LE were of about 300 W m-2 and 237 W m-2, respectively, during dry periods and unstable-case atmospheric conditions. The estimated crop coefficient Kc values for the orchard crop averaged close to 0.80, which is considerably higher than previous FAO studies that found the value to be 0.65 for citrus with 70% of ground cover. The intercepted photosynthetically active radiation (LI PAR by the crop was measured and relationships between LAI and crop coefficient (Kc were established.

  18. Programmable Ultrasonic Sensing System for Targeted Spraying in Orchards

    Directory of Open Access Journals (Sweden)

    Marko Hočevar

    2012-11-01

    Full Text Available This research demonstrates the basic elements of a prototype automated orchard sprayer which delivers pesticide spray selectively with respect to the characteristics of the targets. The density of an apple tree canopy was detected by PROWAVE 400EP250 ultrasound sensors controlled by a Cypress PSOC CY8C29466 microcontroller. The ultrasound signal was processed with an embedded computer built around a LPC1343 microcontroller and fed in real time to electro-magnetic valves which open/close spraying nozzles in relation to the canopy structure. The analysis focuses on the detection of appropriate thresholds on 15 cm ultrasound bands, which correspond to maximal response to tree density, and this was selected for accurate spraying guidance. Evaluation of the system was performed in an apple orchard by detecting deposits of tartrazine dye (TD on apple leaves. The employment of programmable microcontrollers and electro-magnetic valves decreased the amount of spray delivered by up to 48.15%. In contrast, the reduction of TD was only up to 37.7% at some positions within the tree crown and 65.1% in the gaps between trees. For all these reasons, this concept of precise orchard spraying can contribute to a reduction of costs and environmental pollution, while obtaining similar or even better leaf deposits.

  19. Programmable Ultrasonic Sensing System for Targeted Spraying in Orchards

    Science.gov (United States)

    Stajnko, Denis; Berk, Peter; Lešnik, Mario; Jejčič, Viktor; Lakota, Miran; Štrancar, Andrej; Hočevar, Marko; Rakun, Jurij

    2012-01-01

    This research demonstrates the basic elements of a prototype automated orchard sprayer which delivers pesticide spray selectively with respect to the characteristics of the targets. The density of an apple tree canopy was detected by PROWAVE 400EP250 ultrasound sensors controlled by a Cypress PSOC CY8C29466 microcontroller. The ultrasound signal was processed with an embedded computer built around a LPC1343 microcontroller and fed in real time to electro-magnetic valves which open/close spraying nozzles in relation to the canopy structure. The analysis focuses on the detection of appropriate thresholds on 15 cm ultrasound bands, which correspond to maximal response to tree density, and this was selected for accurate spraying guidance. Evaluation of the system was performed in an apple orchard by detecting deposits of tartrazine dye (TD) on apple leaves. The employment of programmable microcontrollers and electro-magnetic valves decreased the amount of spray delivered by up to 48.15%. In contrast, the reduction of TD was only up to 37.7% at some positions within the tree crown and 65.1% in the gaps between trees. For all these reasons, this concept of precise orchard spraying can contribute to a reduction of costs and environmental pollution, while obtaining similar or even better leaf deposits. PMID:23202220

  20. Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

    Science.gov (United States)

    Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

    2016-01-01

    Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

  1. Contamination of apple orchard soils and fruit trees with copper-based fungicides: sampling aspects.

    Science.gov (United States)

    Wang, Quanying; Liu, Jingshuang; Liu, Qiang

    2015-01-01

    Accumulations of copper in orchard soils and fruit trees due to the application of Cu-based fungicides have become research hotspots. However, information about the sampling strategies, which can affect the accuracy of the following research results, is lacking. This study aimed to determine some sampling considerations when Cu accumulations in the soils and fruit trees of apple orchards are studied. The study was conducted in three apple orchards from different sites. Each orchard included two different histories of Cu-based fungicides usage, varying from 3 to 28 years. Soil samples were collected from different locations varying with the distances from tree trunk to the canopy drip line. Fruits and leaves from the middle heights of tree canopy at two locations (outer canopy and inner canopy) were collected. The variation in total soil Cu concentrations between orchards was much greater than the variation within orchards. Total soil Cu concentrations had a tendency to increase with the increasing history of Cu-based fungicides usage. Moreover, total soil Cu concentrations had the lowest values at the canopy drip line, while the highest values were found at the half distances between the trunk and the canopy drip line. Additionally, Cu concentrations of leaves and fruits from the outer parts of the canopy were significantly higher than from the inner parts. Depending on the findings of this study, not only the between-orchard variation but also the within-orchard variation should be taken into consideration when conducting future soil and tree samplings in apple orchards.

  2. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz

    2011-01-01

    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  3. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz

    2011-06-01

    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp.domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  4. The Application of Wireless Sensor Networks in Management of Orchard

    Science.gov (United States)

    Zhu, Guizhi

    A monitoring system based on wireless sensor network is established, aiming at the difficulty of information acquisition in the orchard on the hill at present. The temperature and humidity sensors are deployed around fruit trees to gather the real-time environmental parameters, and the wireless communication modules with self-organized form, which transmit the data to a remote central server, can realize the function of monitoring. By setting the parameters of data intelligent analysis judgment, the information on remote diagnosis and decision support can be timely and effectively feed back to users.

  5. Curve numbers for olive orchard catchments in Spain

    Science.gov (United States)

    Taguas, Encarnación; Yuan, Yongping; Licciardello, Feliciana; Gómez, Jose

    2014-05-01

    The Curve Number (CN) method (Soil Conservation Service, 1972) is widely applied around the world to estimate direct runoff and the corresponding hydrograph of a rainfall event. Its efficient and simple computation, its complete parameterization for different soils, uses and managements and its good performance justify its application. Nevertheless, apart from Romero et al. (2007) who calculated CN-values at the plot scale, there is little information on the model performance in olive orchards at the catchment scale. In this work, the CN-model has been applied in three small catchments in Spain ranging between 6 and 8 ha with different soil types (regosol, luvisol and vertisol), topography (mean slopes between 9-15%) and management practices (non-tillage with a spontaneous grass cover, minimum tillage, conventional tillage). A rainfall-runoff dataset of 6 years have been used to test the usefulness of model as well as the accuracy of its reference parameterization (CNs and of initial substraction, Ia). CN-values were adjusted, optimized and compared with reference values for orchard crops while the sensitivity of the goodness of fit to Ia was described for each catchment. Classical equations based on the use of CN-percentiles 50, 10 and 90 for determining the antecedent moisture content (AMC) provided very good results with Nash-Sutcliffe coefficients of efficiency equal to 0.73 and 0.81 in two of the catchments with an annual rainfall higher than 600 mm. The third one -with an annual rainfall lower than 400 mm and spontaneous grass cover- showed a different pattern where a multiple linear regression dependant on precipitation and temperature features, represented notably better the rainfall-runoff relationships. Although fractions of Ia on the storage (S) equal to 0.15 and 0.25 allowed to optimize the adjustments of CN, the usual reference of 0.20 is quite appropriate. Finally, significant deviations were observed on reference-CNs for sandy soils that should be

  6. Estimating Cone and Seed Production and Monitoring Pest Damage in Southern Pine Seed Orchards

    Science.gov (United States)

    Carl W. Fatzinger; H. David Muse; Thomas Miller; Helen T. Bhattacharyya

    1988-01-01

    Field sampling procedures and computer programs are described for monitoring seed production and pest damage in southern pine seed orchards. The system estimates total orchard yields of female strobili and seeds, quantifies pest damage, determines times of year when losses occur, and produces life tables for female strobili. An example is included to illustrate the...

  7. Evaluation of the atoxigenic Aspergillus flavus strain AF36 in pistachio orchards

    Science.gov (United States)

    The atoxigenic strain Aspergillus flavus AF36, which has been extensively used as a biocontrol agent in commercial corn and cotton fields to reduce aflatoxin contamination, was applied in research pistachio orchards from 2002 to 2005 and in commercial pistachio orchards from 2008 to 2011. AF36 was a...

  8. Challenges of managing disease in tall orchard trees – pecan scab, a case study

    Science.gov (United States)

    Managing disease in tall orchard trees presents unique issues not found in relatively shorter horticultural and agronomic crops, simply due to height. Pecan scab (caused by Fusicladium effusum [G. Winter] Seyran et al.) is used as an example of a major disease of one of the tallest orchard crops in ...

  9. Side effects of kaolin particle films on apple orchard bug, beetle and spider communities

    NARCIS (Netherlands)

    Marko, V.; Bogya, S.; Kondorosy, E.; Blommers, L.H.M.

    2010-01-01

    The effects of multiple applications of hydrophobic kaolin particle film on apple orchard bug (Heteroptera), beetle (Coleoptera) and spider (Araneae) assemblages were studied in the Netherlands. Insecticide-free orchard plots served as a control. The kaolin applications significantly reduced the

  10. Apple orchard pest control strategies affect bird communities in southeastern France.

    Science.gov (United States)

    Bouvier, Jean-Charles; Ricci, Benoît; Agerberg, Julia; Lavigne, Claire

    2011-01-01

    Birds are regarded as appropriate biological indicators of how changes in agricultural practices affect the environment. They are also involved in the biocontrol of pests. In the present study, we provide an assessment of the impact of pest control strategies on bird communities in apple orchards in southeastern France. We compared the structure (abundance, species richness, and diversity) of breeding bird communities in 15 orchards under conventional or organic pest control over a three-year period (2003-2005). Pest control strategies and their evolution over time were characterized by analyzing farmers' treatment schedules. The landscape surrounding the orchards was characterized using a Geographic Information System. We observed 30 bird species overall. Bird abundance, species richness, and diversity were all affected by pest control strategies, and were highest in organic orchards and lowest in conventional orchards during the three study years. The pest control strategy affected insectivores more than granivores. We further observed a tendency for bird communities in integrated pest management orchards to change over time and become increasingly different from communities in organic orchards, which also corresponded to changes in treatment schedules. These findings indicate that within-orchard bird communities may respond quickly to changes in pesticide use and may, in turn, influence biocontrol of pests by birds. © 2010 SETAC.

  11. Integrating cellular automata, artificial neural network and fuzzy set theory to simulate threatened orchards: Application to Maragheh, Iran

    NARCIS (Netherlands)

    Azari, M; Tayyebi, A; Helbich, M; Ahadnejad Reveshty, M

    2016-01-01

    Urbanization processes challenge the growth of orchards areas in many cities in Iran. In Maragheh orchards are crucial ecological, economical, and tourist sources. To explore orchards threatened by urban expansion, this study aims, first, to develop a new model by coupling cellular automata and

  12. [Service value assessment of orchard ecosystem: a case of Putian City of Fujian].

    Science.gov (United States)

    Chen, Jing; Wu, Duan-wang

    2011-09-01

    Based on the equivalent weight factor of China terrestrial ecosystem service value, and by using ecosystem service value assessment model, this paper evaluated the orchard ecosystem service value in Putian City. In 2002-2008, the orchard ecosystem service value in the City had an overall increasing trend, among which, the service value of gas regulation and water resource conservation had a fluctuation trend of decreased after an initial increase, and that of other functions increased rapidly in 2002-2006 and then developed mildly. The service value of regulation function was higher than that of direct use function, showing that only on the basis of preserving well the functions of ecosystem, could the orchard ecosystem be claimed and used. As most of the orchards in the City are on hills or mountains, the construction and ecological protection of the orchards are obviously disjointed, making the orchards become bare land or other land-use types, resulting in serious soil erosion and degradation, which not only destroyed the orchard ecology, but also gave negative effects on the production efficiency of agriculture. In the future construction of Putian orchards, it should implement comprehensive planning and management of mountain areas, water regions, farm lands, forest lands, and paths, reduce the orchard construction costs by taking advantage of high and new technologies in light of the local conditions and the demands of domestic and foreign markets, and promote the virtuous circle of ecosystem by comprehensive utilization of resources and regulation of biological interaction to make the structure of the orchard ecosystem approached to scientific and rational.

  13. Effect ofthydiazuron and choline chloride bioregulators on yield and fruit quality ofthree apple (Malus domestica Borkh. varieties Efecto de Thidiazuron y cloruro de colina como biorreguladores sobre el rendimiento y la calidad del fruto en tres variedades de manzano (Malus domestica borkh.

    Directory of Open Access Journals (Sweden)

    Benincore Mauricio

    2000-12-01

    Full Text Available In order to improve yield and quality of Colombian apple fruits, Thydiazuron (TDZ and Choline Chloride (CC biorregulators were evaluated as supposed stimulants of growth and development of 'Princesa', 'Golden Delicious' y 'Gala' varieties in the «La Calera» zone (2650 masl. 50, lOOand 150 mg-L:' of TDZ were sprayed between 30 and 45 days after blooming (dab and 500, 1000 and 1500 mg-L-' of CC 118 dab, using a completely randomized design for 'Princesa' and 'Golden Delicious' and a completely randomized
    block design for 'Gala'. TDZ showed chemical thinning and
    cytokinine activity, decreasing the number and acidity of harvested fruits, but increased mean fruit weight, In 'Gala', TDZ increased the harvested fruit number per tree; with 150 mg-L:' fruit color increased while soluble solids (SS concentration declined. On the other side, in 'Gala' apples, CC applications decreased fruit number per tree and showed higher mean weights, volume and SS content of fruits, especially with 500 mg-L:'. In 'Golden Delicious' CC produced oblong fruits with higher SS content and lower flesh firrnness.
    Con el fin de mejorar rendimiento y calidad del fruto de la manzana nacional, se evaluaron los biorreguladores Thidiazuron (TDZ y Cloruro de Colina (CC como supuestos estimuladores del crecimiento y desarrollo del fruto en las variedades 'Princesa', 'Golden Delicious' y 'Gala' en la zona de «La Calera» (2650 msnm. Para tal fin, se aplicaron 50, 100 y 150 mg-L" de TDZ entre los 30 y 45 días después de floración (ddt y 500, 1000 y 1500 mg-L-' de CC 118 ddf,
    bajo diseño completamente aleatorizado para 'Princesa' y 'Golden Delicious' y bloque completos al azar para 'Gala'. Thidiazuron actuó como agente químico raleante y como citoquinina, disminuyendo en 'Golden Delicious' el número de frutos cosechados y la acidez, pero aumentando el peso promedio del fruto. En 'Gala', TDZ aumentó el número de frutos por árbol, a 150 mg-L-' aumentó la coloración mientras que disminuyó la concentración de sólidos solubles (SS. En la variedad 'Princesa', TDZ solamente incrementó el contenido de sólidos solubles. Por otra parte, en 'Gala', CC disminuyó el número de frutos por árbol, aumentando el peso, el volumen y el contenido de SS de los mismos, especialmente a 500
    mg-L"; igualmente, en 'Golden Delicious' produjo frutos 'más alargados con mayores contenidos de SS y una menor consistencia.

  14. Avaliação de diferentes métodos de sobre-enxertia na substituição da cultivar de macieira (Malus domestica Borkh. Gala por Princesa = Evaluation of different over-grafting techniques to replace 'Gala' for 'Princesa' apple trees (Malus domestica Borkh.

    Directory of Open Access Journals (Sweden)

    Fabiano Simões

    2006-10-01

    Full Text Available Foram comparados quatro métodos de enxertia: garfagem em inglês complicado (GIC; borbulhia lenhosa (BL; garfagem de topo (GT e garfagem meia-fenda esvaziada (GMFE, com o objetivo de avaliar o melhor método para execução da sobre-enxertia na substituição da cultivar de macieira Gala por Princesa. O experimento foi conduzido em São José dos Pinhais – PR, em seis macieiras localizadas em pomar com três anos de idade. As características avaliadas foram: porcentagem de pegamento dos enxertos, porcentagem de enxertos brotados, porcentagem de enxertos dormentes e porcentagem de enxertos mortos. O experimento foi finalizado após 62 dias da instalação. Após esse período conclui-se que a GIC apresentou maiores porcentagens de pegamento e brotação. Esta não se diferenciou da GT em relação à variável pegamento. A BL não é recomendada para a sobre-enxertia em macieiras.Four grafting methods were compared: whip graft, budding graft, cleft graft and the side graft, aiming at evaluating the best techniqueto replace ‘Gala’ for ‘Princesa’ apple trees. The experiment was held in São José dos Pinhais – PR in a 3-year old apple tree yard fruit. Six apple trees were selected for the experiment. The assessed characteristics were carried out by the percentage of grafting success (sprouted, sleeping grafts (no sprouts and dead ones. The experiment was concluded after 62 days of grafting. Results indicated that the budding graft showed to be more effective with a higher index of sprouting. This technique showed no difference concerning the sprouting percentage compared to the whip graft. The budding graft is not recommended to over–graft apple trees.

  15. Photoreactivation of UV-induced pyrimidine dimers and erythema in the marsupial Monodelphis domestica

    International Nuclear Information System (INIS)

    Ley, R.D.

    1985-01-01

    Post-UV treatment of the gray, short-tailed opossum Monodelphis domestica with photoreactivating light (320-400 nm) suppressed the appearance of UV-induced erythema as evidenced by an increase in the dose of UV required to elicit an erythemal response. Pre-UV exposure to photoreactivating light had no effect on the UV induction of erythema. The dose-response for the photoreversal of pyrimidine dimers in epidermal DNA of M. domestica was similar to that for the photoreactivation of erythema induction. These data not only support the notion that DNA is the primary chromophore involved in the induction of erythema but also identify pyrimidine dimers as the major DNA change responsible for its induction. These results also identify M. domestica as a useful whole-animal system with which to determine the role of pyrimidine dimers in other photobiological responses of mammalian skin

  16. Evolution of resistance to pyrethroid insecticides in Musca domestica.

    Science.gov (United States)

    Scott, Jeffrey G

    2017-04-01

    Houseflies, Musca domestica L., are a significant pest because of the numerous diseases they transmit. Control of housefly populations, particularly at animal production facilities, is frequently done using pyrethroid insecticides which kill insects by prolonging the open time of the voltage-sensitive sodium channel (VSSC). Houseflies have evolved resistance to pyrethroids owing to mutations in Vssc and by cytochrome-P450-mediated detoxification. Three Vssc mutations are known: kdr (L1014F), kdr-his (L1014H) and super-kdr (M918T + L1014F). Generally, the levels of resistance conferred by these mutations are kdr-his resistance than kdr. P450-mediated resistance can result from overexpression of CYP6D1 or another P450 (unidentified) whose overexpression is linked to autosomes II or V. The initial use of field-stable pyrethroids resulted in different patterns of evolution across the globe, but with time these mutations have become more widespread in their distribution. What is known about the fitness costs of the resistance alleles in the absence of insecticide is discussed, particularly with respect to the current and future utility of pyrethroid insecticides. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  17. The effect of bonus/malus systems on the sales of new vehicles; Wirkung von Bonus-Malus-Systemen beim Neuwagenkauf

    Energy Technology Data Exchange (ETDEWEB)

    Haan, P. de

    2008-07-01

    This presentation made at the Swiss 2008 research conference on traffic by Peter de Haan from the Institute for Environmental Decisions at the Swiss Federal Institute of Technology ETH in Zurich takes a look at the effects of bonus/malus systems on the sales of new vehicles. The author notes that in spite of technological progress made, increasing car size, weight and mileage along with increased motor power has eaten up two-thirds of energy-efficiency progress made. The effect of the long lifetime of modern vehicles is commented on. The results of a survey made are presented and discussed, as are the results of simulations. Further aspects discussed include effects on the motor trade and road safety and the indirect effects of bonuses. Finally, trends in the area are noted.

  18. Evaluation of yellow sticky traps for monitoring the population of thrips (Thysanoptera) in a mango orchard.

    Science.gov (United States)

    Aliakbarpour, Hamaseh; Rawi, Che Salmah Md

    2011-08-01

    Populations of several thrips species were estimated using yellow sticky traps in an orchard planted with mango, Mangifera indica L. during the dry and wet seasons beginning in late 2008-2009 on Penang Island, Malaysia. To determine the efficacy of using sticky traps to monitor thrips populations, we compared weekly population estimates on yellow sticky traps with thrips population sizes that were determined (using a CO(2) method) directly from mango panicles. Dispersal distance and direction of thrips movement out of the orchard also were studied using yellow sticky traps placed at three distances from the edge of the orchard in four cardinal directions facing into the orchard. The number of thrips associated with the mango panicles was found to be correlated with the number of thrips collected using the sticky trap method. The number of thrips captured by the traps decreased with increasing distance from the mango orchard in all directions. Density of thrips leaving the orchard was related to the surrounding vegetation. Our results demonstrate that sticky traps have the potential to satisfactorily estimate thrips populations in mango orchards and thus they can be effectively employed as a useful tactic for sampling thrips.

  19. Organic, integrated and conventional management in apple orchards: effect on plant species composition, richness and diversity

    Directory of Open Access Journals (Sweden)

    Zdeňka Lososová

    2011-01-01

    Full Text Available The study was conducted to assess the effect of conventional, integrated and organic management on differences in plant species composition, richness and diversity. The plants were studied in triads of orchards situated in three regions of the Czech Republic. Data about species occurrences were collected on 15 permanent plots in the tree rows and 15 plots between tree rows in each of the apple orchards during 2009. A total of 201 vascular plant species (127 native species, 65 archaeophytes, and 9 neophytes were found. Management type and also different regional conditions had a significant effect on plant species composition and on diversity parameters of orchard spontaneous vegetation. Species richness and species pool was significantly higher in the organic orchards than in the differently managed orchards. Management type had significant effect on proportions of archaeophytes, and also neophytes in apple orchards. The results showed that a change from conventional to integrated and organic management in apple orchards lead to higher plant species diversity and to changes in plant species composition.

  20. Maintenance of a living understory enhances soil carbon sequestration in subtropical orchards.

    Science.gov (United States)

    Liu, Zhanfeng; Lin, Yongbiao; Lu, Hongfang; Ding, Mingmao; Tan, Yaowen; Xu, Shejin; Fu, Shenglei

    2013-01-01

    Orchard understory represents an important component of the orchards, performing numerous functions related to soil quality, water relations and microclimate, but little attention has been paid on its effect on soil C sequestration. In the face of global climate change, fruit producers also require techniques that increase carbon (C) sequestration in a cost-effective manner. Here we present a case study to compare the effects of understory management (sod culture vs. clean tillage) on soil C sequestration in four subtropical orchards. The results of a 10-year study indicated that the maintenance of sod significantly enhanced the soil C stock in the top 1 m of orchard soils. Relative to clean tillage, sod culture increased annual soil C sequestration by 2.85 t C ha(-1), suggesting that understory management based on sod culture offers promising potential for soil carbon sequestration. Considering that China has the largest area of orchards in the world and that few of these orchards currently have sod understories, the establishment and maintenance of sod in orchards can help China increase C sequestration and greatly contribute to achieving CO2 reduction targets at a regional scale and potentially at a national scale.

  1. Evaluation of monitoring traps with novel bait for navel orangeworm (Lepidoptera: Pyralidae) in California almond and pistachio orchards.

    Science.gov (United States)

    Nay, Justin E; Peterson, Elonce M; Boyd, Elizabeth A

    2012-08-01

    Experiments conducted in three almond, Prunus dulcis (Rosales: Rosaceae), orchards and three pistachio, Pistacia vera (Sapindales: Anicardiaceae), orchards in 2009 and 2010, and determined that sticky bottom wing traps baited with ground pistachio mummies, or a combination of ground pistachio plus ground almond mummies, trapped more adult female navel orangeworm, Amyelois transitella (Walker) (Lepidoptera: Pyralidae), than did traps baited with ground almond mummies alone. During both years of this study, 2.9 and 1.8 more moths were caught in traps baited with pistachio mummies compared with traps baited with almond mummies in almond orchards and pistachio orchards, respectively. Also, traps located in pistachio orchards caught 5.9 and 8.3 times more navel orangeworm than were trapped from almond orchards in 2009 and 2010, respectively. Implications for use of this novel baited trap in almond and pistachio orchard integrated pest management programs are discussed.

  2. McMYB12 Transcription Factors Co-regulate Proanthocyanidin and Anthocyanin Biosynthesis in Malus Crabapple

    OpenAIRE

    Tian, Ji; Zhang, Jie; Han, Zhen-yun; Song, Ting-ting; Li, Jin-yan; Wang, Ya-ru; Yao, Yun-cong

    2017-01-01

    The flavonoid compounds, proanthocyanidins (PAs), protect plants from biotic stresses, contribute to the taste of many fruits, and are beneficial to human health in the form of dietary antioxidants. In this study, we functionally characterized two Malus crabapple R2R3-MYB transcription factors, McMYB12a and McMYB12b, which co-regulate PAs and anthocyanin biosynthesis. McMYB12a was shown to be mainly responsible for upregulating the expression of anthocyanin biosynthetic genes by binding to th...

  3. Optimal Claiming Strategies in Bonus Malus Systems and Implied Markov Chains

    Directory of Open Access Journals (Sweden)

    Arthur Charpentier

    2017-11-01

    Full Text Available In this paper, we investigate the impact of the accident reporting strategy of drivers, within a Bonus-Malus system. We exhibit the induced modification of the corresponding class level transition matrix and derive the optimal reporting strategy for rational drivers. The hunger for bonuses induces optimal thresholds under which, drivers do not claim their losses. Mathematical properties of the induced level class process are studied. A convergent numerical algorithm is provided for computing such thresholds and realistic numerical applications are discussed.

  4. Drought effects on reproductive and growth characteristics in seed orchards

    International Nuclear Information System (INIS)

    Varol, T.; Ozel, H. B.; Bilir, N.

    2017-01-01

    Global climate change is one of the most important environmental problems, and it is also known that this change will lead to negative effects such as drought and increase in global temperature. This change is also estimated to increase its episodic effects negatively on growth and reproduction of the forest trees. In order to estimate the episodic or continuous effects of the drought, it is necessary to carry out studies based on long-term data. One of these studies are the investigation to be carried out on seed orchards that are one of the most important seed resources in forestry. Within this context, in this study, we determined to the reproductive and growth responses of the clones to the drought that continued in the most drought season (2012) for 2 subsequent years along with 65-year climate data for Red Pine (Pinus brutia Ten.) and Taurus Cedar (Cedrus libani Rich.). The relationships of SPEI values with seed characteristics and cone production were examined by using Spearman Correlation Analysis. According to the results obtained from this study, it was found that the severe drought was effected the reproductive characteristics of both of red pine and cedar. The effect of drought on the number of cone (r=-0.810, P=0.022) in red pine and on the number of 1-year-old cones (r=-0.40, P=0.027) and on cone moisture (r=-0.715, P=0.022) in cedar was quite evident. These results indicate that approximately 65% of the change in number of cone in Red Pine and approximately 51% of the change in moisture content of the cones in cedar can be explained with the drought. From the data, it is clear that the drought is effective on the cone yield and seed characteristics in seed orchards of both of Red Pine and Taurus Cedar species. (author)

  5. [Cloning and characterization of Caveolin-1 gene in pigeon, Columba livia domestica].

    Science.gov (United States)

    Zhang, Ying; Yu, Jian-Feng; Yang, Li; Wang, Xing-Guo; Gu, Zhi-Liang

    2010-10-01

    Caveolins, a class of principal proteins forming the structure of caveolae in plasmalemma, were encoded by caveolins gene family. Caveolin-1 gene is a member of caveolins gene family. In the present study, a full-length of 2605 bp caveolin-1 cDNA sequence in Columba livia domestica, which included a 537 bp complete ORF encoding a 178 amino acids long putative peptide, were obtained by using RT-PCR and RACE technique. The Columba livia domestica caveolin-1 CDS shared 80.1% - 93.4% homology with Bos taurus, Canis lupus familiaris, Gallus gallus and Rattus norvegicus. Meanwhile, the putative amino acid sequence of Columba livia domestica caveolin-1 shared 85.4% - 97.2% homology with the above species. The semi-quantity RT-PCR revealed that Caveolin-1 expressions were detectable in all the Columba livia domestica tissues and the expressional level of caveolin-1 gene was high in adipose, medium in various muscles, low in liver. These results demonstrated that Caveolin-1 gene was potentially involved in some metabolic pathways in adipose and muscle.

  6. Adaptation of Musca domestica L. field population to laboratory breeding causes transcriptional alterations

    DEFF Research Database (Denmark)

    Højland, Dorte H.; Vagn Jensen, Karl-Martin; Kristensen, Michael

    2014-01-01

    The housefly, Musca domestica, has developed resistance to most insecticides applied for its control. Expression of genes coding for detoxification enzymes play a role in the response of the housefly when encountered by a xenobiotic. The highest level of constitutive gene expression of nine P450 ...

  7. Larvicidal potential of essential oils against Musca domestica and Anopheles stephensi.

    Science.gov (United States)

    Chauhan, Nitin; Malik, Anushree; Sharma, Satyawati; Dhiman, R C

    2016-06-01

    The larvicidal activity of Mentha piperita, Cymbopogan citratus (lemongrass), Eucalyptus globulus and Citrus sinensis (orange) essential oils and their combinations was evaluated against Musca domestica (housefly) and Anopheles stephensi (mosquitoes) through contact toxicity assay. Among all the tested essential oils/combinations, Me. piperita was found to be the most effective larvicidal agent against Mu. domestica and An. stephensi with LC50 values of 0.66 μl/cm(2) and 44.66 ppm, respectively, after 48 h. The results clearly highlighted that the addition of mentha oil to other oils (1:1 ratio) improved their larvicidal activity. The order of effectiveness of essential oils/combinations indicated that the pattern for An. stephensi follows the trend as mentha > mentha + lemongrass > lemongrass > mentha + eucalyptus > eucalyptus > mentha + orange > orange and for Mu. domestica as mentha > mentha + lemongrass > lemongrass > mentha + orange > orange > mentha + eucalyptus > eucalyptus. The images obtained from scanning electron microscopy (SEM) analysis indicated the toxic effect of Me. piperita as the treated larvae were observed to be dehydrated and deformed. This study demonstrates the effectiveness of tested essential oils/combinations against the larval stages of Mu. domestica and An. stephensi and has the potential for development of botanical formulations.

  8. Interaction of some organophosphorus compounds in susceptible and resistant houseflies (Musca domestica L.)

    NARCIS (Netherlands)

    Abdallah, M.D.

    1963-01-01

    The effect of tri-ortho-cresylphosphate (TOCP) on poisoning by parathion and paraoxon in susceptible and resistant houseflies (Musca domestica L.) was investigated.

    TOCP influenced the penetration of parathion and paraoxon, and this could explain the contradictory results of both an

  9. Biological changes in Musca domestica L., 1758 (Diptera:Muscidae), induced by gamma radiation (60 Co)

    International Nuclear Information System (INIS)

    Grecchi, M.A.

    1989-01-01

    This work was carried out in the Entomology Section of the Centre of Nuclear Energy in Agriculture (CENA), University of Sao Paulo, Piracicaba, Sao Paulo, Brazil. The objective of the present research work was to investigate some effects of gamma radiation on the various stages of M. domestica life cycle. (author)

  10. Temperature and Population Density Effects on Locomotor Activity of Musca domestica (Diptera: Muscidae)

    DEFF Research Database (Denmark)

    Schou, T. M.; Faurby, S.; Kjærsgaard, A.

    2013-01-01

    The behavior of ectotherm organisms is affected by both abiotic and biotic factors. However, a limited number of studies have investigated the synergistic effects on behavioral traits. This study examined the effect of temperature and density on locomotor activity of Musca domestica (L.). Locomot...

  11. Effect of Triflumuron and Pyriproxyfen on Musca domestica L Larval Stages in the Laboratory

    Directory of Open Access Journals (Sweden)

    S Sulaiman

    2008-08-01

    Full Text Available Background:  The residual effect of triflumuron and pyriproxyfen on Musca domestica L larval stages was studied in the laboratory."n"nMethods: Both IGRs at varying concentrations ranging between 0.5 to 2.5 mg/L were placed inside beakers with mice chow and vitamin B complex and water as food for the 1st, 2nd and 3rd instars M.domestica larvae."n"nResults: Both IGRs inhibit M. domestica adult emergence of 98-98.5% when applied at the lowest concentration of 0.5 mg/L on the 1st instar, 93-97% of adult emergence inhibition on the 2nd instar,and 91-97% of adult emergence inhibi­tion on the 3rd instar larvae respectively. There was no significant difference between triflumuron and pyriproxy­fen on house­fly adult emergence inhibition when fed to the 1st, 2nd and 3rd instars M.domestica larvae (P> 0.05. However, there was a significant difference between the IGRs and the control (P< 0.05."n"nConclusion: Both triflumuron and pyriproxyfen are effective in inhibiting adult emergence of housefly M  domes­tica and therefore should be recommended for fly control particularly in chicken farms and dumping grounds in Malaysia for housefly control activities.

  12. Flavonoid Accumulation Plays an Important Role in the Rust Resistance of Malus Plant Leaves

    Directory of Open Access Journals (Sweden)

    Yanfen Lu

    2017-07-01

    Full Text Available Cedar-apple rust (Gymnosporangium yamadai Miyabe is a fungal disease that causes substantial injury to apple trees and results in fruit with reduced size and quality and a lower commercial value. The molecular mechanisms underlying the primary and secondary metabolic effects of rust spots on the leaves of Malus apple cultivars are poorly understood. Using HPLC, we found that the contents of flavonoid compounds, especially anthocyanin and catechin, were significantly increased in rust-infected symptomatic tissue (RIT. The expression levels of structural genes and MYB transcription factors related to flavonoid biosynthesis were one- to seven-fold higher in the RIT. Among these genes, CHS, DFR, ANS, FLS and MYB10 showed more than a 10-fold increase, suggesting that these genes were expressed at significantly higher levels in the RIT. Hormone concentration assays showed that the levels of abscisic acid (ABA, ethylene (ETH, jasmonate (JA and salicylic acid (SA were higher in the RIT and were consistent with the expression levels of McNCED, McACS, McLOX and McNPR1, respectively. Our study explored the complicated crosstalk of the signal transduction pathways of ABA, ETH, JA and SA; the primary metabolism of glucose, sucrose, fructose and sorbitol; and the secondary metabolism of flavonoids involved in the rust resistance of Malus crabapple leaves.

  13. Characteristics of blooming, floral nectaries and nectar of Malus sargentii Rehd.

    Directory of Open Access Journals (Sweden)

    Elżbieta Weryszko-Chmielewska

    2012-12-01

    Full Text Available In the years 2007-2008, the flowering biology of Malus sargentii, an ornamental apple tree native to Japan, was studied in the conditions of Lublin (Poland. The daily rate of flower opening, flowering duration and flower visitation by insects were determined. The amount of nectar produced per flower and sugar content in the nectar were investigated. The size of nectaries and the micromorphology of their surface were examined using light and scanning electron microscopy. It was found that the greatest amount of flowers opened between 11.00 and 13.00. During this time, the largest number of insects was observed in the flowers. Bees (90% were predominant among the insects, with a much smaller number of bumblebees (6% and butterflies (4%. The flower life span was 5 days. Over this period, the flower produced, on the average, 0.71 mg of nectar with an average sugar content of 32%. The nectaries of Malus sargentii are orange-yellow coloured and they represent the hypanthial type. Due to the protrusion of the nectariferous tissue, they are classified as automorphic nectaries. The surface of the epidermal cells of the nectary was distinguished by distinct cuticle folds. A small number of stomata were located only in the basal part of the nectary. At the beginning of flowering, all stomata were closed, but secretion traces were observed near well-developed outer cuticular ledges.

  14. Alkalization of irrigated soils suitable for orchard growing in steppe Crimea and prospects for their use

    Science.gov (United States)

    Klimenko, O. E.

    2016-10-01

    Data of large-scale soil surveys performed by the Ukrgiprosad Institute (Ukrainian Institute for Orchard Growing) in 1997-2013 on irrigated soils of steppe Crimea reserved for orchards on the area of about 3000 ha are discussed. It is shown that all the studied soils are subjected to alkalization with the presence of soda and with an increase in concentrations of sodium and magnesium bicarbonates up to the values toxic for fruit crops. The concentrations and occurrence frequencies of alkaline salts depend on the soil type, the presence of solonetzic features, the amount of carbonates, the particular depth in the soil profile, the subsoiling, and other factors. Within the studied area, some soils are unsuitable or partly suitable for orchard growing. To improve the soil conditions for orchard growing in the areas subjected to alkalization, alkaline salts should be neutralized to nontoxic level, and the soil alkalinity should be reduced using chemical reclamation methods.

  15. Carnivore use of avocado orchards across an agricultural-wildland gradient.

    Directory of Open Access Journals (Sweden)

    Theresa M Nogeire

    Full Text Available Wide-ranging species cannot persist in reserves alone. Consequently, there is growing interest in the conservation value of agricultural lands that separate or buffer natural areas. The value of agricultural lands for wildlife habitat and connectivity varies as a function of the crop type and landscape context, and quantifying these differences will improve our ability to manage these lands more effectively for animals. In southern California, many species are present in avocado orchards, including mammalian carnivores. We examined occupancy of avocado orchards by mammalian carnivores across agricultural-wildland gradients in southern California with motion-activated cameras. More carnivore species were detected with cameras in orchards than in wildland sites, and for bobcats and gray foxes, orchards were associated with higher occupancy rates. Our results demonstrate that agricultural lands have potential to contribute to conservation by providing habitat or facilitating landscape connectivity.

  16. Carnivore use of avocado orchards across an agricultural-wildland gradient

    Science.gov (United States)

    Nogeire, Theresa M.; Davis, Frank W.; Duggan, Jennifer M.; Crooks, Kevin R.; Boydston, Erin E.

    2013-01-01

    Wide-ranging species cannot persist in reserves alone. Consequently, there is growing interest in the conservation value of agricultural lands that separate or buffer natural areas. The value of agricultural lands for wildlife habitat and connectivity varies as a function of the crop type and landscape context, and quantifying these differences will improve our ability to manage these lands more effectively for animals. In southern California, many species are present in avocado orchards, including mammalian carnivores. We examined occupancy of avocado orchards by mammalian carnivores across agricultural-wildland gradients in southern California with motion-activated cameras. More carnivore species were detected with cameras in orchards than in wildland sites, and for bobcats and gray foxes, orchards were associated with higher occupancy rates. Our results demonstrate that agricultural lands have potential to contribute to conservation by providing habitat or facilitating landscape connectivity.

  17. Patterns and Drivers of Scattered Tree Loss in Agricultural Landscapes: Orchard Meadows in Germany (1968-2009)

    Science.gov (United States)

    Plieninger, Tobias; Levers, Christian; Mantel, Martin; Costa, Augusta; Schaich, Harald; Kuemmerle, Tobias

    2015-01-01

    Scattered trees support high levels of farmland biodiversity and ecosystem services in agricultural landscapes, but they are threatened by agricultural intensification, urbanization, and land abandonment. This study aimed to map and quantify the decline of orchard meadows (scattered fruit trees of high nature conservation value) for a region in Southwestern Germany for the 1968 2009 period and to identify the driving forces of this decline. We derived orchard meadow loss from 1968 and 2009 aerial images and used a boosted regression trees modelling framework to assess the relative importance of 18 environmental, demographic, and socio-economic variables to test five alternative hypothesis explaining orchard meadow loss. We found that orchard meadow loss occurred in flatter areas, in areas where smaller plot sizes and fragmented orchard meadows prevailed, and in areas near settlements and infrastructure. The analysis did not confirm that orchard meadow loss was higher in areas where agricultural intensification was stronger and in areas of lower implementation levels of conservation policies. Our results demonstrated that the influential drivers of orchard meadow loss were those that reduce economic profitability and increase opportunity costs for orchards, providing incentives for converting orchard meadows to other, more profitable land uses. These insights could be taken up by local- and regional-level conservation policies to identify the sites of persistent orchard meadows in agricultural landscapes that would be prioritized in conservation efforts. PMID:25932914

  18. A comparison of the nesting success of mourning doves and American robins in conventionally managed and organic orchards

    Science.gov (United States)

    Fluetsch, K.M.

    1992-01-01

    A comparative study was undertaken to document more closely the effects of operational pesticide use on non-target avian species. Mourning Dove (Zenaida macroura) and American Robin (Turdus migratorius) nesting activity was monitored in three organic and three conventional orchards during two breeding seasons. Surveys were conducted to characterize the avian community within orchards under both management practices. Organophosphorus (OP) and carbamate pesticides, known to be extremely toxic to birds, were repeatedly sprayed during the peaks in dove and robin breeding activity. Spray card tests revealed that OP pesticides were deposited on 85.5% of the nests tested during routine spray operations. The threat of direct pesticide exposure to eggs, nestlings, and adult birds was considerable. Nest daily survival rates (DSRs) for both doves and robins, were significantly higher in the organic orchards than in the conventional orchards in 1991 and years combined (P < 0.05). Species diversity was significantly greater in the organic orchards (H = 2.43) than in the conventional orchards (H = 1.79). Results suggest that repeated applications of pesticides, within the conventional orchards, directly or indirectly, affected the reproductive success of doves and robins, as well as influenced species diversity within the treated orchards. Organic orchards appear to provide more favorable nesting and foraging habitat for birds than conventional orchards.

  19. Science support for evaluating natural recovery of polychlorinated biphenyl concentrations in fish from Crab Orchard Lake, Crab Orchard National Wildlife Refuge, Illinois

    Science.gov (United States)

    Kunz, Bethany K.; Hinck, Jo E.; Calfee, Robin D.; Linder, Greg L.; Little, Edward E.

    2018-05-11

    IntroductionCrab Orchard Lake in southern Illinois is one of the largest and most popular recreational lakes in the state. Construction of the nearly 7,000-acre reservoir in the late 1930s created employment opportunities through the Works Progress Administration, and the lake itself was intended to supply water, control flooding, and provide recreational opportunities for local communities (Stall, 1954). In 1942, the Department of War appropriated or purchased more than 20,000 acres of land around Crab Orchard Lake and constructed the Illinois Ordnance Plant, which manufactured bombs and anti-tank mines during World War II. After the war, an Act of Congress transferred the property to the U.S. Department of the Interior. Crab Orchard National Wildlife Refuge was established on August 5, 1947, for the joint purposes of wildlife conservation, agriculture, recreation, and industry. Production of explosives continued, but new industries also moved onsite. More than 200 tenants have held leases with Crab Orchard National Wildlife Refuge and have operated a variety of manufacturing plants (electrical components, plated metal parts, ink, machined parts, painted products, and boats) on-site. Soils, water, and sediments in several areas of the refuge were contaminated with hazardous substances from handling and disposal methods that are no longer acceptable environmental practice (for example, direct discharge to surface water, use of unlined landfills).Polychlorinated biphenyl (PCB) contamination at the refuge was identified in the 1970s, and a PCB-based fish-consumption advisory has been in effect since 1988 for Crab Orchard Lake. The present advisory covers common carp (Cyprinus carpio) and channel catfish (Ictalurus punctatus); see Illinois Department of Public Health (2017). Some of the most contaminated areas of the refuge were actively remediated, and natural ecosystem recovery processes are expected to further reduce residual PCB concentrations in the lake. The U

  20. Population density of mediterranean fruit fly (Ceratitis capitata) on fruit orchards in south Baghdad

    International Nuclear Information System (INIS)

    Khalaf, M. Z.; Shbar, A. K.; Naher, F. H.; Jabo, N. F.; Abdulhamza, B. H.; Abod, R. S.

    2012-12-01

    In the recent years the mediterranean fruit fly, Ceratitis capitata distributed in the orchards of central Iraq and caused highly economic losses. This study was conducted in orchards in South Baghdad during 2009 and 2010 and made field survey of the insect in four types of orchards (Citrus, Apricot, Figs and Citrus and A mixture of fruit trees) and used for this purpose tephri traps supplied with Q-Lure and dimethyl dichlorovinyl phosphate (DDVP). The present preliminary study has shown that the Mediterranean fruit fly C.capitata has a year round presence in fruit orchards in central Iraq and reached its highest numerical density of the pest in citrus orchards during November and December were 345 and 363 insect / Trap per month in citrus orchards and the least numerical density during of January and February while the highest numerical density of the insect in orchards of orchards of apricot in Mrch 2010, Figs and Citrus in August 2009 and a Mixture of fruit trees in November 2009 were 45, 116, 311 Insect/ trap per month respectively. The population density of the pest was highest beginning 2010 compared with 2009 , but the high temperature degree (46 - o 5 2) in August 2010 caused a decrease in population density of this pest. C.capitata caused highly economic losses in citrus reaching 68, 71, 82% of the Mandarin, Kaki, Apricot fruits respectively. Currently in Iraq no control method to reduce the economic losses caused by this pest except the use of pesticides GF-120. Therefore, results of this study could be of benefit for orcharch owners when applying an integrated program for controlling fruit fly pests. (Author)

  1. The enhancement by caffeine of the frequency of lethal dominant mutation induced by gamma radiation in oocytes of Musca domestica

    International Nuclear Information System (INIS)

    Targa, H.J.; Rogatko, A.

    1982-01-01

    The results obtained, when a new technique for feeding insects is employed, on the effects of caffeine of the radiation - induced breaks of oocyte chromatids of Musca domestica are presented. (M.A.) [pt

  2. Carbon sequestration by fruit trees--Chinese apple orchards as an example.

    Science.gov (United States)

    Wu, Ting; Wang, Yi; Yu, Changjiang; Chiarawipa, Rawee; Zhang, Xinzhong; Han, Zhenhai; Wu, Lianhai

    2012-01-01

    Apple production systems are an important component in the Chinese agricultural sector with 1.99 million ha plantation. The orchards in China could play an important role in the carbon (C) cycle of terrestrial ecosystems and contribute to C sequestration. The carbon sequestration capability in apple orchards was analyzed through identifying a set of potential assessment factors and their weighting factors determined by a field model study and literature. The dynamics of the net C sink in apple orchards in China was estimated based on the apple orchard inventory data from 1990s and the capability analysis. The field study showed that the trees reached the peak of C sequestration capability when they were 18 years old, and then the capability began to decline with age. Carbon emission derived from management practices would not be compensated through C storage in apple trees before reaching the mature stage. The net C sink in apple orchards in China ranged from 14 to 32 Tg C, and C storage in biomass from 230 to 475 Tg C between 1990 and 2010. The estimated net C sequestration in Chinese apple orchards from 1990 to 2010 was equal to 4.5% of the total net C sink in the terrestrial ecosystems in China. Therefore, apple production systems can be potentially considered as C sinks excluding the energy associated with fruit production in addition to provide fruits.

  3. Carbon Sequestration by Fruit Trees - Chinese Apple Orchards as an Example

    Science.gov (United States)

    Wu, Ting; Wang, Yi; Yu, Changjiang; Chiarawipa, Rawee; Zhang, Xinzhong; Han, Zhenhai; Wu, Lianhai

    2012-01-01

    Apple production systems are an important component in the Chinese agricultural sector with 1.99 million ha plantation. The orchards in China could play an important role in the carbon (C) cycle of terrestrial ecosystems and contribute to C sequestration. The carbon sequestration capability in apple orchards was analyzed through identifying a set of potential assessment factors and their weighting factors determined by a field model study and literature. The dynamics of the net C sink in apple orchards in China was estimated based on the apple orchard inventory data from 1990s and the capability analysis. The field study showed that the trees reached the peak of C sequestration capability when they were 18 years old, and then the capability began to decline with age. Carbon emission derived from management practices would not be compensated through C storage in apple trees before reaching the mature stage. The net C sink in apple orchards in China ranged from 14 to 32 Tg C, and C storage in biomass from 230 to 475 Tg C between 1990 and 2010. The estimated net C sequestration in Chinese apple orchards from 1990 to 2010 was equal to 4.5% of the total net C sink in the terrestrial ecosystems in China. Therefore, apple production systems can be potentially considered as C sinks excluding the energy associated with fruit production in addition to provide fruits. PMID:22719974

  4. Carbon sequestration by fruit trees--Chinese apple orchards as an example.

    Directory of Open Access Journals (Sweden)

    Ting Wu

    Full Text Available Apple production systems are an important component in the Chinese agricultural sector with 1.99 million ha plantation. The orchards in China could play an important role in the carbon (C cycle of terrestrial ecosystems and contribute to C sequestration. The carbon sequestration capability in apple orchards was analyzed through identifying a set of potential assessment factors and their weighting factors determined by a field model study and literature. The dynamics of the net C sink in apple orchards in China was estimated based on the apple orchard inventory data from 1990s and the capability analysis. The field study showed that the trees reached the peak of C sequestration capability when they were 18 years old, and then the capability began to decline with age. Carbon emission derived from management practices would not be compensated through C storage in apple trees before reaching the mature stage. The net C sink in apple orchards in China ranged from 14 to 32 Tg C, and C storage in biomass from 230 to 475 Tg C between 1990 and 2010. The estimated net C sequestration in Chinese apple orchards from 1990 to 2010 was equal to 4.5% of the total net C sink in the terrestrial ecosystems in China. Therefore, apple production systems can be potentially considered as C sinks excluding the energy associated with fruit production in addition to provide fruits.

  5. The Effect of Nest Box Distribution on Sustainable Propagation of Osmia lignaria (Hymenoptera: Megachilidae) in Commercial Tart Cherry Orchards

    OpenAIRE

    Boyle, N. K.; Pitts-Singer, T. L.

    2017-01-01

    The blue orchard bee, Osmia lignaria (Say), is a solitary bee that is an excellent pollinator of tree fruit orchards. Due to the annual rising costs of honey bee hive rentals, many orchardists are eager to develop management tools and practices to support O. lignaria as an alternative pollinator. Establishing O. lignaria pollination as a sustainable industry requires careful consideration of both bee and orchard management. Here, we test the effect of artificial nest box distribution on in-or...

  6. The impact of agriculture management on soil quality in citrus orchards in Eastern Spain

    Science.gov (United States)

    Hondebrink, Merel; Cerdà, Artemi; Cammeraat, Erik

    2015-04-01

    Currently, the agricultural management of citrus orchard in the Valencia region in E Spain, is changing from traditionally irrigated and managed orchards to drip irrigated organic managed orchards. It is not known what is the effect of such changes on soil quality and hope to shed some light with this study on this transition. It is known that the drip-irrigated orchards built in sloping terrain increase soil erosion (Cerdà et al., 2009; Li et al., 2014) and that agricultural management such as catch crops and mulches reduce sediment yield and surface runoff (Xu et al., 2012; ), as in other orchards around the world (Wang et al., 2010; Wanshnong et al., 2013; Li et al., 2014; Hazarika et al., 2014): We hypothesize that these changes have an important impact on the soil chemical and physical properties. Therefor we studied the soil quality of 12 citrus orchards, which had different land and irrigation management techniques. We compared organic (OR) and conventional (CO) land management with either drip irrigation (DRP) or flood irrigation (FLD). Soil samples at two depths, 0-1 cm and 5-10 cm, were taken for studying soil quality parameters under the different treatments. These parameters included soil chemical parameters, bulk density, texture, soil surface shear strength and soil aggregation. Half of the studied orchards were organically managed and the other 6 were conventionally managed, and for each of these 6 study sites three fields were flood irrigated plots (FLD) and the other three drip irrigated systems (DRP) In total 108 soil samples were taken as well additional irrigation water samples. We will present the results of this study with regard to the impact of the studied irrigation systems and land management systems with regard to soil quality. This knowledge might help in improving citrus orchard management with respect to maintaining or improving soil quality to ensure sustainable agricultural practices. References Cerdà, A., Giménez-Morera, A. and

  7. Diagnosis of directed pollination services in apple orchards in Brazil

    Directory of Open Access Journals (Sweden)

    Joatan Machado da Rosa

    2018-04-01

    Full Text Available Abstract The pollination services performed by Apis mellifera are essential for the high-quality apple production. The aim of this study was to obtain information about the pollination services used in the municipalities of Vacaria-RS e São Joaquim-SC, the main apple-producing regions in Brazil. Semi-structured interviews were conducted with apple growers and technicians responsible for the orchards during 2013 and 2015. The obtained information was: a cropping systems; b use of pollination services; c number of hives per hectare during flowering; d renting value of hives; e mortality of colonies; f agrochemicals used on flowering; g presence of native bees on flowering. In Vacaria and São Joaquim, respectively, 70% and 68.6% of the apple growers use the integrated apple production as their production model. The directed pollination is used by 100% and 90.0% of respondents respectively, from which, 80% and 47.1% opt for the hive rent. On average, three hives were used per hectare in both regions. The average cost is U$ 17.52 and U$ 17.74 per hive, respectively. During the flowering period, insecticides and fungicides are used by 100% and 97.2% of the apple growers. The highest mean percentage of mortality of colonies during flowering was reported in Vacaria, 11.8%. Native bees are often found in apple flowers. The development of management strategies for the conservation of domestic and wild pollinators is essential.

  8. Atmospheric fluoride levels in some Ontario peach orchards

    Energy Technology Data Exchange (ETDEWEB)

    Drowley, W B; Rayner, A C; Jephcott, C M

    1963-10-01

    As a result of suture injury to peaches, a survey was taken to determine monthly atmospheric fluoride levels in the soft fruit-growing area of the Niagara Peninsula of Ontario. Although the injury was confined to a few orchards, it was found necessary to locate stations for fluoride sampling over a wide area. The limed-paper candle method was used for fluoride collection. Unwashed and washed peach leaves were analyzed for fluoride content. Fluoride was separated from all samples by the Willard-Winter distillation procedure and estimated colorimetrically. It was found that a general background level of atmospheric fluoride existed in the whole surveyed area and that the levels were highest in and near the area of peach injury. The fluoride content of peach leaves was also highest in this area. The coincidence of high fluoride levels and suture injury to peaches suggests that atmospheric fluoride was the causal agent. When lime sprays were applied to peach trees in the damaged area, a reduction in the incidence of suture injury was observed.

  9. Future Climate Forcings and Olive Yield in a Mediterranean Orchard

    Directory of Open Access Journals (Sweden)

    Francesco Viola

    2014-05-01

    Full Text Available The olive tree is one of the most characteristic rainfed trees in the Mediterranean region. Observed and forecasted climate modifications in this region, such as the CO2 concentration and temperature increase and the net radiation, rainfall and wind speed decrease, will likely alter vegetation water stress and modify productivity. In order to simulate how climatic change could alter soil moisture dynamic, biomass growth and fruit productivity, a water-driven crop model has been used in this study. The numerical model, previously calibrated on an olive orchard located in Sicily (Italy with a satisfactory reproduction of historical olive yield data, has been forced with future climate scenarios generated using a stochastic weather generator and a downscaling procedure of an ensemble of climate model outputs. The stochastic downscaling is carried out using simulations of some General Circulation Models adopted in the fourth Intergovernmental Panel on Climate Change (IPCC assessment report (4AR for future scenarios. The outcomes state that climatic forcings driving potential evapotranspiration compensate for each other, resulting in a slight increase of this water demand flux; moreover, the increase of CO2 concentration leads to a potential assimilation increase and, consequently, to an overall productivity increase in spite of the growth of water stress due to the rainfall reduction.

  10. Wildflower Plantings Do Not Compete With Neighboring Almond Orchards for Pollinator Visits.

    Science.gov (United States)

    Lundin, Ola; Ward, Kimiora L; Artz, Derek R; Boyle, Natalie K; Pitts-Singer, Theresa L; Williams, Neal M

    2017-06-01

    The engineering of flowering agricultural field borders has emerged as a research and policy priority to mitigate threats to pollinators. Studies have, however, rarely addressed the potential that flowering field borders might compete with neighboring crops for pollinator visits if they both are in bloom at the same time, despite this being a concern expressed by growers. We evaluated how wildflower plantings added to orchard borders in a large (512 ha) commercial almond orchard affected honey bee and wild bee visitation to orchard borders and the crop. The study was conducted over two consecutive seasons using three large (0.48 ha) wildflower plantings paired with control orchard borders in a highly simplified agricultural landscape in California. Honey bee (Apis mellifera L.) and wild bee visitation to wildflower plots were at least an order of magnitude higher than to control plots, but increased honey bee visitation to wildflower plots did not lead to any detectable shifts in honey bee visitation to almond flowers in the neighboring orchard. Wild bees were rarely observed visiting almond flowers irrespective of border treatment, indicating a limited short-term potential for augmenting crop pollination using wild bees in highly simplified agricultural landscapes. Although further studies are warranted on bee visitation and crop yield from spatially independent orchards, this study indicates that growers can support bees with alternative forage in almond orchards without risking competition between the wildflower plantings and the crop. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Evaluation of Daily Evapotranspiration Over Orchards Using METRIC Approach and Landsat Satellite Observations

    Science.gov (United States)

    He, R.; Jin, Y.; Daniele, Z.; Kandelous, M. M.; Kent, E. R.

    2016-12-01

    The pistachio and almond acreage in California has been rapidly growing in the past 10 years, raising concerns about competition for limited water resources in California. A robust and cost-effective mapping of crop water use, mostly evapotranspiration (ET), by orchards, is needed for improved farm-level irrigation management and regional water planning. METRIC™, a satellite-based surface energy balance approach, has been widely used to map field-scale crop ET, mostly over row crops. We here aim to apply METRIC with Landsat satellite observations over California's orchards and evaluate the ET estimates by comparing with field measurements in South San Joaquin Valley, California. Reference ET of grass (ETo) from California Irrigation Management Information system (CIMIS) stations was used to estimate daily ET of commercial almond and pistachio orchards. Our comparisons showed that METRIC-Landsat ET daily estimates agreed well with ET measured by the eddy covariance and surface renewal stations, with a RMSE of 1.25 and a correlation coefficient of 0.84 for the pistachio orchard. A slight high bias of satellite based ET estimates was found for both pistachio and almond orchards. We also found time series of NDVI was highly correlated with ET temporal dynamics within each field, but the correlation was reduced to 0.56 when all fields were pooled together. Net radiation, however, remained highly correlated with ET across all the fields. The METRIC ET was able to distinguish the differences in ET among salt- and non-salt affected pistachio orchards, e.g., mean daily ET during growing season in salt-affected orchards was lower than that of non-salt affected one by 0.87 mm/day. The remote sensing based ET estimate will support a variety of state and local interests in water use and management, for both planning and regulatory/compliance purposes, and provide the farmers observation-based guidance for site-specific and time-sensitive irrigation management.

  12. Plant parts of the apple tree (Malus spp.) as possible indicators of heavy metal pollution.

    Science.gov (United States)

    Tošić, Snežana; Alagić, Slađana; Dimitrijević, Mile; Pavlović, Aleksandra; Nujkić, Maja

    2016-05-01

    The content of Cu, Zn, Pb, As, Cd, and Ni was determined by ICP-OES in spatial soil and parts (root, branches, leaves, and fruit) of the apple tree (Malus spp.) from polluted sites near The Mining and Smelting Complex Bor (Serbia). The aim of this study was to examine if the obtained results can be used for biomonitoring purposes. Data recorded in plant parts, especially leaves, gave very useful information about the environmental state of the Bor region. Conveniently, these data described well the capability of investigated plant species to assimilate and tolerate severely high concentrations of heavy metals in its tissues, which may further allow the possibility for utilization of the apple tree for phytostabilization.

  13. Modeling and Performance of Bonus-Malus Systems: Stationarity versus Age-Correction

    Directory of Open Access Journals (Sweden)

    Søren Asmussen

    2014-03-01

    Full Text Available In a bonus-malus system in car insurance, the bonus class of a customer is updated from one year to the next as a function of the current class and the number of claims in the year (assumed Poisson. Thus the sequence of classes of a customer in consecutive years forms a Markov chain, and most of the literature measures performance of the system in terms of the stationary characteristics of this Markov chain. However, the rate of convergence to stationarity may be slow in comparison to the typical sojourn time of a customer in the portfolio. We suggest an age-correction to the stationary distribution and present an extensive numerical study of its effects. An important feature of the modeling is a Bayesian view, where the Poisson rate according to which claims are generated for a customer is the outcome of a random variable specific to the customer.

  14. Retracted: Long-term copper toxicity in apple trees (Malus pumila Mill) and bioaccumulation in fruits.

    Science.gov (United States)

    Sun, Bai-Ye; Kan, Shi-Hong; Zhang, Yan-Zong; Wu, Jun; Deng, Shi-Huai; Liu, Chun-Sheng; Yang, Gang

    2010-01-15

    The following article from Environmental Toxicology, 'Long-term Copper Toxicity in Apple Trees (Malus pumila Mill) and Bioaccumulation in Fruits' by Bai-Ye Sun, Shi- Hong Kan, Yan-Zong Zhang, Jun Wu, Shi-Huai Deng, Chun-Sheng Liu and Gang Yang, published online on January 15, 2010 in Wiley InterScience (www.interscience.wiley.com; DOI: 10.1002/tox.20565), has been retracted by agreement between the authors, the journal Editor in Chief, Dr. Paul Tchounwou, and Wiley Periodicals, Inc. The retraction has been agreed at the request of the authors due to overlap with 'Copper Toxicity and Bioaccumulation in Chinese Cabbage (Brassica pekinensis Rupr.)' by Zhi-Ting Xiong and Hai Wang, published in Environmental Toxicology, Volume 20, pages 188-194, 2005.

  15. Uji Aktivitas Ekstrak Etanol Kulit Buah Apel ( Pyrus malus, L Terhadap

    Directory of Open Access Journals (Sweden)

    Suparmia, Khusnul Khotimah Amal Fadho

    2013-08-01

    Full Text Available Apple (Pyrus malus, L is a fruit having much uses for health containing phytochemical and flavonoid substances. One of the substances contained in apple rind is quercetin. Quercetin capable to reduce vascular permeability (Mochizuki et al., 2004. The recent study has an aim to know activity of ethanol extract on apple rind to the reducing of vascular permeability thus it can used as therapies for plasma leakage in curing Dengue Blood Fever. The vascular permeability test it was done an induction method using acetate acid. Testing done on white male mice of the BALB/c strain where the mice were divided into 5 groups. The first and second groups were control groups that are a positive control were given 0.2 mg/20 g standard quersetin suspension and the negative one was given 0.5% Na CMC suspension. The third, fourth and fifth groups were treatment groups where each testing animals were given ethanol extract suspension of apple rind by dosages 0.2, 0.4, and 0.8 mg/20 g of Body Weight mice per oral. Taking data was done by measuring pigment intensities from abdominal cavity liquid had been washed with acetate saline. From percentages of vascular permeability reducing each group then analyzed using statistic analyses those were the one-way anova. If there was found any significant difference then it was continued a Tukey test and bivariate-correlation. From results in the study it was known that percentages of vascular permeability reduces of ethanol extract that were made from apple rind having dosages 0.2, 0.4, and 0.8 mg in sequences as big as 42.15%, 63.28% and 84.19%.Keywords: Pyrus malus, L, kuersetin, vascular permeability

  16. Efficacy and safety of Curcuma domestica extracts compared with ibuprofen in patients with knee osteoarthritis: a multicenter study

    Science.gov (United States)

    Kuptniratsaikul, Vilai; Dajpratham, Piyapat; Taechaarpornkul, Wirat; Buntragulpoontawee, Montana; Lukkanapichonchut, Pranee; Chootip, Chirawan; Saengsuwan, Jittima; Tantayakom, Kesthamrong; Laongpech, Supphalak

    2014-01-01

    Objective To determine the efficacy and safety of Curcuma domestica extracts in pain reduction and functional improvement. Methods 367 primary knee osteoarthritis patients with a pain score of 5 or higher were randomized to receive ibuprofen 1,200 mg/day or C. domestica extracts 1,500 mg/day for 4 weeks. The main outcomes were Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC) total, WOMAC pain, WOMAC stiffness, and WOMAC function scores. Adverse events (AEs) were also recorded. Results 185 and 182 patients were randomly assigned into C. domestica extracts and ibuprofen groups, respectively. The baseline characteristics were no different between groups. The mean of all WOMAC scores at weeks 0, 2, and 4 showed significant improvement when compared with the baseline in both groups. After using the noninferiority test, the mean difference (95% confidence interval) of WOMAC total, WOMAC pain, and WOMAC function scores at week 4 adjusted by values at week 0 of C. domestica extracts were noninferior to those for the ibuprofen group (P=0.010, P=0.018, and P=0.010, respectively), except for the WOMAC stiffness subscale, which showed a trend toward significance (P=0.060). The number of patients who developed AEs was no different between groups. However, the number of events of abdominal pain/discomfort was significantly higher in the ibuprofen group than that in the C. domestica extracts group (P=0.046). Most subjects (96%–97%) were satisfied with the treatment, and two-thirds rated themselves as improved in a global assessment. Conclusion C. domestica extracts are as effective as ibuprofen for the treatment of knee osteoarthritis. The side effect profile was similar but with fewer gastrointestinal AE reports in the C. domestica extracts group. PMID:24672232

  17. Melia azedarach L. extracts and their activity on Musca domestica L. (Diptera: Muscidae

    Directory of Open Access Journals (Sweden)

    Marise M. O. Cabral

    Full Text Available Crudes extracts and fractions from seeds of Melia azedarach L. (Meliaceae have been assayed on Musca domestica Linnaeus, 1758 (Diptera: Muscidae. Thus, the post-embryonic development of the flies was reduced and the delay from newly hatched larvae to adults had significant increase. In addition, the pupal weights were reduced and the sexual ratio altered. Toxicity to fly eggs was also observed.

  18. Survival and Movement of Insect Parasitic Nematodes in Poultry Manure and Their Infectivity Against Musca domestica

    OpenAIRE

    Georgis, Ramon; Mullens, Bradley A.; Meyer, Jeffery A.

    1987-01-01

    Survival, infectivity, and movement of three insect parasitic nematodes (Steinernema feltiae All strain, S. bibionis SN strain, and Heterorhabditis heliothidis NC strain) in poultry manure were tested under laboratory conditions. The majority (70-100%) of the nematodes died within 18 hours after exposure to the manure. Nematodes exposed to manure slurry for 6 hours killed at least 95% of the house fly larvae, Musca domestica, but nematodes exposed for 12 hours achieved less than 40% larval mo...

  19. The development of enamel tubules during the formation of enamel in the marsupial Monodelphis domestica.

    OpenAIRE

    Sasagawa, I; Ferguson, M W

    1991-01-01

    In Monodelphis domestica, although both processes from odontoblasts and projections from ameloblasts were found in developing enamel, the majority of the contents of enamel tubules were probably processes that originated from odontoblasts. Processes from odontoblasts penetrating into enamel touched part of the ameloblasts in the stage of enamel formation. No specialised cell junctions were seen at the adherence between the two. There were no enamel tubules in the aprismatic and pseudoprismati...

  20. Diversity of the Orchard Species in Iran: A Case Study of Khorasan Province

    Directory of Open Access Journals (Sweden)

    alireza koocheki

    2014-09-01

    Full Text Available Agrobiodiversity is an issue that has been considered for the last decade. There are few reports on diversity of orchard species in Iran and some available reports have not mentioned the relevant indices and analysis results. In the current study, based upon data collected from 29 provinces of Iran along with 23 counties of Khorasan provinces, a comprehensive analysis was made and different diversity indices such as Shanon- Weaver, Evenness index, Margalof richness index as well as two dominance indices including Sympson and Berger-Parker were calculated. The results indicated that Kerman, Fars and Khorasan provinces cover 40% of orchard areas in the country. Species richness in all provinces was relatively high but the evenness index was not so (average evenness for all provinces is 0.55. Therefore, in some provinces such as Boshehr and Kerman, species dominance is observed due to Date and Pistachio, respectively. Also, Stone fruits among Khorasan orchards provided the highest richness and diversity. The highest area of orchards in Khorasan are belonged to nuts including Pistachio, Almond, Walnut and Oleaster. Kashmar district has the highest orchards area in Khorasan province. According to the Shanon-Weaver index, the highest and lowest diversity were observed at Nahbandan- Birjand and Fariman counties. Results also indicated that the Berger-Parker dominance index is highest at Fariman and Shirvan districts of Khorasan because of apple and grape species dominance.

  1. Ammonia-oxidizing activity and microbial community structure in acid tea (Camellia sinensis) orchard soil

    Science.gov (United States)

    Okamura, K.; Takanashi, A.; Yamada, T.; Hiraishi, A.

    2012-03-01

    The purpose of this study was to determine the ammonia-oxidizing activity and the phylogentic composition of microorganisms involved in acid tea (Camellia sinensis) orchard soil. All soil samples were collected from three sites located in Tahara and Toyohashi, Aichi Prefecture, Japan. The potential nitrification rate (PNR) was measured by the chlorate inhibition method. The soil pH of tea orchards studied ranged from 2.78 to 4.84, differing significantly from sample to sample, whereas that of meadow and unplanted fields ranged from 5.78 to 6.35. The PNR ranged from 0.050 to 0.193 μg NO2--Ng-1 h-1 and were positively correlated with the soil pH (r2 = 0.382, p<0.001). Bulk DNA was extracted from a tea orchard soil (pH 4.8; PNR, 0.078 μg NO2--Ng-1 h-1) and subjected to PCR-aided clone library analyses targeting archaeal and bacterial amoA genes. The detected archaeal clones separated from the cluster of the 'Soil clones' and tightly clustered with the clones originating from other acidic soil environments including the Chinese tea orchard soil. These results suggest that the specific archaeal populations dominate as the ammonia oxidizers in acid tea-orchard soils and possibly other acid soils, independent of geographic locations, which results from the adaptation to specific ecological niches.

  2. Deep subsoiling of a subsurface-compacted typical hapludult under citrus orchard

    Directory of Open Access Journals (Sweden)

    João Carlos Medeiros

    2013-08-01

    Full Text Available Soil management practices which increase the root depth penetration of citrus are important to the longevity and yield maintenance of this plant, especially in regions where long periods of drought are common, even in soil conventionally subsoiled to a depth of 30-40 cm, when the orchard was first established. The objective of this study was to evaluate the efficiency of subsoiling on the physical and hydric properties of a Typical Hapludult and fruit yield in a 14-year-old citrus orchard located in Piracicaba, SP. The treatments consisted of: no-subsoiling (with no tilling of the soil after the orchard was planted; subsoiling on one side of the plant lines (SUB. 1; and subsoiling on both sides of the plant lines (SUB. 2. The subsoiling treatments were carried out 1.5 m from the plant lines and to a depth of 0.8 m. Soil samples were taken 120 days after this operation, at four depths, in order to determine physical and hydric properties. Fruit yield was evaluated 150 days after subsoiling. Subsoiling between the plant lines of an old established citrus orchard alters the physical and hydric properties of the soil, which is reflected in increased soil macroporosity and unsaturated hydraulic conductivity, and reduced soil bulk density, critical degree-of-compactness and penetration resistance. The improvements in the physical and hydric properties of the soil were related to an increase in fruit number and orchard yield.

  3. Bioaccessibility of Ba, Cu, Pb, and Zn in urban garden and orchard soils

    International Nuclear Information System (INIS)

    Cai, Meifang; McBride, Murray B.; Li, Kaiming

    2016-01-01

    Exposure of young children to toxic metals in urban environments is largely due to soil and dust ingestion. Soil particle size distribution and concentrations of toxic metals in different particle sizes are important risk factors in addition to bioaccessibility of these metals in the particles. Analysis of particle size distribution and metals concentrations for 13 soils, 12 sampled from urban gardens and 1 from orchard found that fine particles (<105 μm) comprised from 22 to 66% by weight of the tested soils, with Ba, Cu, Pb and Zn generally at higher concentrations in the finer particles. However, metal bioaccessibility was generally lower in finer particles, a trend most pronounced for Ba and Pb. Gastric was higher than gastrointestinal bioaccessibility for all metals except Cu. The lower bioaccessibility of Pb in urban garden soils compared to orchard soil is attributable to the higher organic matter content of the garden soils. - Highlights: • The bioaccessibility of metals in urban garden and orchard soils was measured. • Ba, Cu, Pb, Zn were concentrated in fine particles of the soils. • Bioaccessibilities of Ba and Pb were generally lower in fine particles of soils. • Pb bioaccessibility was generally lower in soils with higher organic matter content. • Pb bioaccessibility was lower in urban garden soils than in an orchard soil. - Pb and other trace metals (Ba, Cu, Zn) were concentrated in fine particles of urban and orchard soils, but the bioaccessibility of Ba and Pb was generally lower in finer particles.

  4. Bird use of organic apple orchards: Frugivory, pest control and implications for production.

    Directory of Open Access Journals (Sweden)

    Anna M Mangan

    Full Text Available As the largest terrestrial biomes, crop and pasturelands can have very large positive or negative impacts on biodiversity and human well-being. Understanding how animals use and impact agroecosystems is important for making informed decisions that achieve conservation and production outcomes. Yet, few studies examine the tradeoffs associated with wildlife in agricultural systems. We examined bird use of organic apple orchards as well as how birds influence fruit production positively through control of an economically important insect pest (codling moth (Cydia pomonella and negatively through fruit damage. We conducted transect surveys, observed bird frugivory and assessed bird and insect damage with an exclosure experiment in small organic farms in western Colorado. We found that organic apple orchards in this region provide habitat for a large number of both human-adapted and human-sensitive species and that the species in orchards were relatively similar to adjacent hedgerow habitats. Habitat use did not vary as a function of orchard characteristics, and apple damage by both birds and C. pomonella was consistent within and across apple blocks that varied in size. A small subset of bird species was observed foraging on apples yet the effect of birds as agents of fruit damage appeared rather minor and birds did not reduce C. pomonella damage. Our results demonstrate that organic apple orchards have the potential to provide habitat for diverse bird communities, including species typically sensitive to human activities, with little apparent effect on production.

  5. The effects of cultural practice methods on fruit orchard rehabilitation after flooding crisis in Songkhla province

    Directory of Open Access Journals (Sweden)

    Chanaweerawan, S.

    2004-01-01

    Full Text Available To rehabilitate the fruit orchards exposed to flooding crisis that occurred in year 2000 in Songkhla province, an investigation of the effects of cultural practice methods was done in the farmers’ orchards at 2 experimental sites (at Tumbol Kho Hong and Tumbol Kuan Lang, Amphur Hat Yai. The first site, at Tumbol Kho Hong, was mixed cropping (durian, longkong and mangosteen. The second site, at Tumbol Kuan Lang, was a monocrop of pummelo orchard. The experiment was comprised a stratified sampling method with 3 treatments: 1 control, 2 fertilization (15-15-15, 8-24-24 and 13-13-21 and soil improvement with humic acid (S and 3 foliar application (glucose was applied with 16-12-0+micronutrients+extracted seaweed and 7-13-34+12.5Zn+extracted seaweed+Ca-B spraying with fertilization and soil improvement (F+S. The results from the both experimental sites showed that the F+S treatment exhibited the best result. This promoted the plant growth and yield of fruit trees. In addition, the other orchards surrounding the experimental sites were surveyed. It was noticeable that fruit trees grown in raising-beds could recover and exhibit normal fruit bearing. This pointed out that the impact of flooding on fruit orchards would be possibly alleviated by a drainage system.

  6. [Interspecific polymorphism of the glucosyltransferase domain of the sucrose synthase gene in the genus Malus and related species of Rosaceae].

    Science.gov (United States)

    Boris, K V; Kochieva, E Z; Kudryavtsev, A M

    2014-12-01

    The sequences that encode the main functional glucosyltransferase domain of sucrose synthase genes have been identified for the first time in 14 species of the genus Malus and related species of the family Rosaceae, and their polymorphism was investigated. Single nucleotide substitutions leading to amino acid substitutions in the protein sequence, including the conservative transmembrane motif sequence common to all sucrose synthase genes of higher plants, were detected in the studied sequences.

  7. Effects of Persea americana Mill. seed extracts on the postembryonic development of Musca domestica (Diptera: Muscoide

    Directory of Open Access Journals (Sweden)

    Silvia del C. Molina Bertrán

    2018-04-01

    Full Text Available Context: The synthetic insecticides used to control Diptera are harmful to the environment and humans. Extracts and compounds from plants are a more sustainable source for the development of bio-insecticides. Aims: To evaluate the efficacy of a hydroalcoholic extract of Persea americana Mill seeds as an alternative control of the species Musca domestica. Methods: The extracts were obtained by two methods, the Shaker (S and the Soxhlet extraction (SE method, using 94% ethanol as the solvent. Also, the qualitative chemical composition was determined by phytochemical screening. The effect of the two extracts on the post-embryonic development of the fly as well as the adulticidal effect was evaluated. Results: Phytochemical analysis revealed the presence of metabolites such as alkaloids, coumarins, tannins, flavonoids, sugars and amino acids. The influence on the post-embryonic development of M. domestica was demonstrated, especially on the viability of larvae and neolarvae to adults; however, the effect on the weight and duration of each period was low. The adulticidal effects of the extracts were determined by the lethal concentration 50(LC50 of 2.910 mg/100 mL and 3.944 mg/100 mL for the S and SE extracts, respectively. Conclusions: Both extracts showed their insecticidal effects against Musca domestica, but the extract elaborated by S method showed greater influence diminishing viability and better adulticidal effect.

  8. Mediterranean savanna system: understanding and modeling of olive orchard.

    Science.gov (United States)

    Brilli, Lorenzo; Moriondo, Marco; Bindi, Marco

    2013-04-01

    Nowadays most of the studies on C and N exchange were focused on forest ecosystems and crop systems, while only few studies have been focused on so called "savanna systems". They are long-term agro-ecosystems (fruit trees, grapevines and olive trees, etc.) usually characterized by two different layers (ground vegetation and trees). Generally, there is a lack of knowledge about these systems due to their intrinsic structural complexity (different eco-physiological characteristics so as agricultural practices). However, given their long-term carbon storage capacity, these systems can play a fundamental role in terms of global C cycle. Among all of them, the role that olive trees can play in C sequestration should not be neglected, especially in Mediterranean areas where they typify the rural landscape and are widely cultivated (Loumou and Giourga, 2003). It is therefore fundamental modelling the C-fluxes exchanges coming from these systems through a tool able to well reproduce these dynamics in one of the most exposed areas to the risk of climate change (IPCC, 2007). In this work, 2 years of Net CO2 Ecosystem Exchange (NEE) measures from eddy covariance were used to test the biogeochemistry model DayCent. The study was conducted in a rain-fed olive orchard situated in Follonica, South Tuscany, Italy (42 ° 55'N, 10 ° 45'E), in an agricultural area near the coast. The instrumentation for flux measurement was placed 1.9 m above the canopy top (6.5 m from the ground) so that the footprint area, expressed as the area containing 90% of the observed flux, was almost entirely contained within the olive orchard limits (Brilli et al., in press). Ancillary slow sensors have included soil temperature profiles, global radiation, air temperature and humidity, rain gauge. Fluxes of sensible heat, latent heat, momentum and CO2 as well as ancillary data were derived at half-hourly time resolution. Specific soil (texture, current and historical land use and vegetation cover) and

  9. Towards the onset of fruit tree growing north of the Alps: ancient DNA from waterlogged apple (Malus sp.) seed fragments.

    Science.gov (United States)

    Schlumbaum, Angela; van Glabeke, Sabine; Roldan-Ruiz, Isabel

    2012-01-20

    Wild apples (Malus sp.) have been a major food source in the northern Alpine region since prehistory and their use is well understood. The onset of deliberate fruit tree growing in the area is, however, less clear. It is generally assumed that horticulture was practised in Roman times, but it might be even earlier. In the archaeological record seed testa and pericarp remains are particularly frequent at sites with waterlogged preservation such as lakeshore settlements or wells, pits and ditches, but the distinction between wild and domestic plants is not morphologically possible. With waterlogged remains being one main source of information about past fruit cultivation, we have tested the feasibility of analysing ancient DNA from waterlogged preserved bulk samples of testa fragments. We studied apple seeds from three Neolithic and three Roman sites with waterlogged preservation in the Alpine foreland. Chloroplast markers failed in all samples, but nuclear ITS1 (internal transcribed spacer region 1) of the ribosomal DNA was successfully typed in two Roman samples from the site Oedenburg/Biesheim-Kunheim (Haut-Rhin, F). The retrieved ITS1 sequences are identical to each other and are shared with wild Malus sylvestris and Malus sieversii, and with domestic apple cultivars, supporting the potential of using waterlogged remains for identifying the genetic status of apple diachronically. Copyright © 2011 Elsevier GmbH. All rights reserved.

  10. Tourist orchards: an opportunity for sustainable development tourism in Romanian traditional fruit growing areas

    Directory of Open Access Journals (Sweden)

    Albu, R. G.

    2012-01-01

    Full Text Available The Romanian traditional fruit growing areas are spaces that, given the transition from a centralized economy to a market economy, have accumulated multiple dysfunctions, whose solving requires the identification of viable solutions, matching local potential and preserving traditional specificity at the same time. The article analyzes how the tourist orchard model, developed successfully in China could be implemented in Romanian traditional fruit growing areas. Also the evolution of the Chinese tourist orchard is presented, highlighting the stages of its development and paying special attention to the current stage that witnesses the solid consolidation of the extant niche of tourist orchards, as part of the Chinese tourism. This consolidation has led to several large metropolitan areas (Beijing, Shanghai, Guangzhou and Shenzhen in China standing out on the international market.

  11. Apple biological and physiological disorders in the orchard and in postharvest according to production system

    Directory of Open Access Journals (Sweden)

    Carlos Roberto Martins

    2013-03-01

    Full Text Available The study aimed to evaluate the incidence of biological and physiological disorders in the field and postharvested apples cvs. Gala, Fuji and Catarina grown in four production systems: conventional, organic transition, integrated and organic. Apples were evaluated for damages related to biological and physiological disorders in the orchard and after harvest. The greatest damages were attributed to pests, especially Anastrepha fraterculus in the organic system and Grapholita molesta in the organic transition. Apples produced in organic orchards had higher damage levels caused by postharvest physiological disorders than those grown in other production systems. For apples becoming from organic orchards most of the damage was due to lenticels breakdown and degeneration ('Gala', and bitter pit ('Fuji' and 'Catarina'. The incidence of postharvest rot was not influenced by apple production system.

  12. Effects of capacity constraints on the motion pattern of an autonomous orchard sprayer

    DEFF Research Database (Denmark)

    Bochtis, D.D.; Vougioukas, S.G.; Griepentrog, Hans-Werner

    Orchard farming operations are very promising for automated systems implementation due to the semi-controlled environment that they are executed. Researches on autonomous orchard vehicles have been madden from many research teams the last years. Although, there is a lot of work that has been done...... which computes the routes that the vehicle has to follow as well as the optimal locations of the facilities in order to minimize the total operation's time. An autonomous tractor was used as the test platform. For the off-line testing of the planned operations as well as for the evaluation...... concerning the navigation of these vehicles, there is a lack of efficient mission planning for the operations that they execute. In this paper, orchard operations with capacity restrictions, such us spraying operation, are studied. For this kind of operations, a combinatorial optimization method is used...

  13. Design and construction of a large weighing lysimeter in an almond orchard

    Energy Technology Data Exchange (ETDEWEB)

    Lorite, I. J.; Santos, C.; Testi, L.; Fereres, E.

    2012-11-01

    Effective water management is essential to ensure the sustainability of irrigated agriculture. The accurate determination of crop water requirements is the first step in this task. This paper describes the building of a one-tree weighing lysimeter (3 × 3 m and 2.15 m depth) located in an almond (Prunus dulcis cv. Guara) orchard, inside the experimental farm “Alameda del Obispo” in Córdoba, Spain, to measure orchard evapotranspiration (ETc). Following a review on lysimetry, the description of the construction of the weighing lysimeter is provided in detail, including considerations relative to system resolution and wind effects on the measurements. Finally, some preliminary results of the evaporation and transpiration of young almond trees are presented demonstrating that lysimetry in orchards provides accurate ETc values needed to determine irrigation water requirements. (Author) 72 refs.

  14. Study and identification of dominant Rodents of orchards and farms in West Azerbaijan Province

    Directory of Open Access Journals (Sweden)

    Alireza Khalilaria

    2016-06-01

    Full Text Available 34 individuals (24♂♂10♀♀ were collected from apple orchards, alfalfa fields of Urmia, Salmas, Khoy, Makoo, Miyandoab, Shahindej and Tekab of West Azerbaijan. Different methods as live traps, snap traps and hand were used to collect samples. Morphology, skull and karyotype of live specimens were used for identification of species. Some samples got taxidermy as Museum samples. All samples were belonged to Microtus. Among 53 world species, two species M. arvalis and M. socialis are hazardous in orchards and alfalfa fields of West Azerbaijan province. Two species of Microtus were collected from Salmas and Tekab. Those were new records for this region that are in the process of identification. Ellobius and Mus musculus is the other damaging genera in the orchards and the fields near the mountains and fields.

  15. Proximity to Woodland and Landscape Structure Drive Pollinator Visitation in Apple Orchard Ecosystem

    Directory of Open Access Journals (Sweden)

    Neelendra K Joshi

    2016-04-01

    Full Text Available Landscapes of farms and adjacent areas are known to influence abundance of various arthropods such as pollinators in commercial agricultural ecosystems. In this context, we examined the effect of heterogeneous landscapes surrounding and including commercial apple orchards on pollinator visitation and foraging distance during bloom period from 2011 to 2013 in Pennsylvania. Our results showed that the frequency of feral honeybees and solitary bee visits within an apple orchard depends on the proximity of the orchard to an unmanaged habitat (primarily comprised of forest. At the landscape scale, we found that the Mean Proximity Index, the Largest Patch Index and the Number of Patches positively correlated with the visitation rate of dominant bee taxa (Apis mellifera, Bombus spp. and solitary bees visiting apple flowers at low spatial scales (up to 500 m around the orchards. The Mean Proximity Index at 500 m was related to bee visitation patterns, especially for solitary bees and A. mellifera. Bees in all our study sites preferred to forage in areas with large homogenous patches up to 500 m around an apple orchard. This effect can be attributed to the mass flowering of apples that formed the largest proportion of the 500 m spatial scale. The Number of Patches at 250 m spatial scale was positively correlated with bee visitation, especially Bombus spp., probably because these areas had more habitats and more resources required by these bees. We conclude that retaining unmanaged habitats closer to commercial apple orchards will maintain biodiversity within the landscapes and insure pollination services to apples.

  16. A monitoring study to assess the acute mortality effects of indoxacarb on honey bees (Apis mellifera L.) in flowering apple orchards

    NARCIS (Netherlands)

    Steen, van der J.J.M.; Dinter, A.

    2007-01-01

    To evaluate the effect of the indoxacarb 300 g kg-1 WG, Steward 30WDGTM, on the honey bee (Apis mellifera L.) in apple orchards, a monitoring study was conducted in Dutch apple orchards in April/May 2004. Before apple flowering began, two honey bee colonies were placed in each orchard to investigate

  17. Genetic Diversity of Acacia mangium Seed Orchard in Wonogiri Indonesia Using Microsatellite Markers

    Directory of Open Access Journals (Sweden)

    VIVI YUSKIANTI

    2012-09-01

    Full Text Available Genetic diversity is important in tree improvement programs. To evaluate levels of genetic diversity of first generation Acacia mangium seedling seed orchard in Wonogiri, Central Java, Indonesia, three populations from each region of Papua New Guinea (PNG and Queensland, Australia (QLD were selected and analyzed using 25 microsatellite markers. Statistical analysis showed that PNG populations have higher number of detected alleles and level of genetic diversity than QLD populations. This study provides a basic information about the genetic background of the populations used in the development of an A. mangium seed orchard in Indonesia.

  18. Bidirectional reflectance effects derived from ASAS imagery of a pecan orchard

    Science.gov (United States)

    Staenz, Karl; Gauthier, Robert P.; Teillet, Phil M.; Williams, Daniel J.

    1993-09-01

    Bidirectional reflectance factors (BRF) for a pecan orchard have been studied using Advanced Solid-State Array Spectrometer (ASAS) data acquired in the solar principal plane at altitudes of 2300 m and 5300 m above ground. In particular, the angular dependency of the BRF of different targets such as sunlit and shaded portions of the pecan tree, orchard floor, and soil (road) have been studied for viewing directions between -45 degrees and +45 degrees. The results indicate in general an increasing reflectance from the forward scattering direction to the backscattering direction. In addition, an increase in pixel size has significant effects on the surface BRFs.

  19. Population dynamics and flight phenology model of codling moth differ between commercial and abandoned apple orchard ecosystems

    Directory of Open Access Journals (Sweden)

    Neelendra K Joshi

    2016-09-01

    Full Text Available Apple orchard management practices may affect development and phenology of arthropod pests, such as the codling moth (CM, Cydia pomonella (L. (Lepidoptera: Tortricidae, which is a serious internal fruit-feeding pest of apples worldwide. Estimating population dynamics and accurately predicting the timing of CM development and phenology events (for instance, adult flight and egg-hatch allows growers to understand and control local populations of CM. Studies were conducted to compare the CM flight phenology in commercial and abandoned apple orchard ecosystems using a logistic function model based on degree-days accumulation. The flight models for these orchards were derived from the cumulative percent moth capture using two types of commercially available CM lure baited traps. Models from both types of orchards were also compared to another model known as PETE (prediction extension timing estimator that was developed in 1970s to predict life cycle events for many fruit pests including CM across different fruit growing regions of the United States. We found that the flight phenology of CM was significantly different in commercial and abandoned orchards. CM male flight patterns for first and second generations as predicted by the constrained and unconstrained PCM (Pennsylvania Codling Moth models in commercial and abandoned orchards were different than the flight patterns predicted by the currently used CM model (i.e.,1970’s model. In commercial orchards, during the first and second generations, the PCM unconstrained model predicted delays in moth emergence compared to current model. In addition, the flight patterns of females were different between commercial and abandoned orchards. Such differences in CM flight phenology between commercial and abandoned orchard ecosystems suggest potential impact of orchard environment and crop management practices on CM biology.

  20. How to Plant Apple Trees to Reduce Replant Disease in Apple Orchard: A Study on the Phenolic Acid of the Replanted Apple Orchard

    OpenAIRE

    Yin, Chengmiao; Xiang, Li; Wang, Gongshuai; Wang, Yanfang; Shen, Xiang; Chen, Xuesen; Mao, Zhiquan

    2016-01-01

    Apple replant disease (ARD) is an important problem in the production of apple. The phenolic acid is one of the causes of ARD. How phenolic acid affects the ARD was not well known. In this study, we analyzed the type, concentration and annual dynamic variation of phenolic acid in soil from three replanted apple orchards using an accelerated solvent extraction system with high performance liquid chromatography (ASE-HPLC). We found that the type and concentration of phenolic acid were significa...

  1. How to Plant Apple Trees to Reduce Replant Disease in Apple Orchard: A Study on the Phenolic Acid of the Replanted Apple Orchard.

    Directory of Open Access Journals (Sweden)

    Chengmiao Yin

    Full Text Available Apple replant disease (ARD is an important problem in the production of apple. The phenolic acid is one of the causes of ARD. How phenolic acid affects the ARD was not well known. In this study, we analyzed the type, concentration and annual dynamic variation of phenolic acid in soil from three replanted apple orchards using an accelerated solvent extraction system with high performance liquid chromatography (ASE-HPLC. We found that the type and concentration of phenolic acid were significantly differed among different seasons, different sampling positions and different soil layers. Major types of phenolic acid in three replanted apple orchards were phlorizin, benzoic acid and vanillic aldehyde. The concentration of phenolic acid was highest in the soil of the previous tree holes and it was increased from the spring to autumn. Moreover, phenolic acid was primarily distributed in 30-60 cm soil layer in the autumn, while it was most abundant in 0-30 cm soil layer in the spring. Our results suggest that phlorizin, benzoic acid and vanillic aldehyde may be the key phenolic acid that brought about ARD in the replanted apple orchard.

  2. Leaf Potential Productivity at Different Canopy Levels in Densely-planted and Intermediately-thinned Apple Orchards

    Directory of Open Access Journals (Sweden)

    Ying SUN

    2016-07-01

    Full Text Available Most apple orchards in the apple production districts in China were densely planted with vigorous rootstocks during the 1980s. These orchards have suffered micro-environmental deterioration and loss of fruit quality because of the closed canopy. Modification of the densely-planted orchards is a priority in current apple production. Intermediate thinning is a basic technique used to transform densely-planted apple orchards in China. Our goal was to provide theoretical basis for studying the effect of thinning on the efficiency of photosynthetically active radiation (PAR, fruit quality, and yield. We measured leaf area, solar radiation, and leaf air exchange at different tree canopy levels and by fitting relevant photosynthetic models, vertical distribution characteristics of leaf photosynthetic potentials and PAR were analyzed in various levels within canopies in densely-planted and intermediately-thinned orchards. Intermediate thinning significantly improved the radiant environment inside the canopies. PAR distribution within the canopies in the intermediately-thinned orchard was better distributed than in the densely-planted orchards. The invalid space under 30.0% of relative photosynthetically active radiation (PARr was nearly zero in the intermediately-thinned orchard; but minimum PARr was 17.0% and the space under 0.30 of the relative height of the canopy was invalid for photosynthesis in the densely-planted orchard. The leaf photosynthetic efficiency in the intermediately-thinned orchard was improved. Photosynthetic rates (Pn at the middle and bottom levels of the canopy, respectively, were increased by 7.80% and 10.20% in the intermediately-thinned orchard. Leaf development, which influences photosynthetic potential, was closely related to the surrounding micro-environment, especially light. Leaf photosynthetic potentials were correlated with leaf nitrogen content (Nl and specific leaf weight (Ml at various levels of canopies. Compared

  3. Chemical composition and insecticidal property of Myrsine stolonifera (Koidz.) walker (Family: Myrsinaceae) on Musca domestica (Diptera: Muscidae).

    Science.gov (United States)

    Wang, Xue Gui; Li, Qian; Jiang, Su Rong; Li, Pei; Yang, Ji Zhi

    2017-06-01

    Musca domestica is one of the most important pests of human health, and has developed strong resistance to many chemicals used for its control. One important approach for creating new pesticides is the exploration of novel compounds from plants. During a wide screening of plants with insecticidal properties that grow in southern China, we found that the methanolic extracts of Myrsine stolonifera had insecticidal activity against the adults of M. domestica. However, the insecticidal constituents and mechanisms of the M. stolonifera extracts remain unclear. The insecticidal components of the methanolic extracts of M. stolonifera were isolated with activity-guided fractionation. From the spectra of nuclear magnetic resonance (NMR) and mass spectrometry (MS), the compounds were identified as syringing (1), 2,6-dimethoxy-4-hydroxyphenol-1-O-β-d-glu (2), kaempferol-3-O-glu-rha-glu (3), and quercetin-3-O-glu-rha-glu (4). This study is the first to report the spectral data for compounds 3 and 4, and their LC 50 values were 0.52mg/g sugar and 0.36mg/g sugar 24h after treatment of the adults of M. domestica, respectively. Compounds 3 and 4 (LC 25 ) also inhibited the activities of the enzymes carboxylesterase, glutathione S-transferase, mixed function oxidase, and acetylcholine esterase of adult M. domestica, particularly mixed function oxidase and acetylcholine esterase. The cytotoxic effects of compounds 3 and 4 on cell proliferation, mitochondrial membrane potentials (MMP) and reactive oxygen species (ROS) were demonstrated on SL-1 cells. From the extracts of M. stolonifera, quercetin-3-O-glu-rha-glu and kaempferol-3-O-glu-rha-glu have displayed comparable toxicities to rotenone on M. domestica and also exhibited cytotoxic effects on SL-1 cells; therefore, the extracts of M. stolonifera and their compounds have potential as botanical insecticides to control M. domestica. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Extractability and bioavailability of Pb and As in historically contaminated orchard soil: Effects of compost amendments

    International Nuclear Information System (INIS)

    Fleming, Margaret; Tai, Yiping; Zhuang, Ping; McBride, Murray B.

    2013-01-01

    The availability of Pb and As in an historically contaminated orchard soil, after amendment with compost and aging in the field, was determined by single-step chemical extraction with 1.0 M ammonium acetate at pH 4.8, sequential extraction using the modified BCR test, and a redworm bioassay in the laboratory. The efficiency of soil Pb extraction by ammonium acetate was greater at higher total soil Pb but was reduced by compost amendment. Conversely, the extraction efficiency of total soil As increased with compost amendment, but was not sensitive to total soil As. The redworm bioassay indicated Pb (but not As) bioavailability to be reduced by soil amendment with compost, a result consistent with the ammonium acetate extraction test but not reflected in modified BCR test. Electron microprobe studies of the orchard soil revealed Pb and As to be spatially associated in discrete particles along with phosphorus and iron. -- Highlights: ► Soil Pb and As in an old orchard were concentrated in discrete particles. ► Compost amendment of contaminated soil reduced Pb bioavailability. ► Compost amendment of contaminated soil did not reduce As bioavailability. ► Ammonium acetate extraction test reflected bioavailability of soil Pb and As. -- Remediating metal-contaminated orchard soils with compost reduced lead bioavailability but had little effect on arsenic

  5. Ammonia-oxidizing activity and microbial community structure in acid tea (Camellia sinensis) orchard soil

    International Nuclear Information System (INIS)

    Okamura, K; Yamada, T; Hiraishi, A; Takanashi, A

    2012-01-01

    The purpose of this study was to determine the ammonia-oxidizing activity and the phylogentic composition of microorganisms involved in acid tea (Camellia sinensis) orchard soil. All soil samples were collected from three sites located in Tahara and Toyohashi, Aichi Prefecture, Japan. The potential nitrification rate (PNR) was measured by the chlorate inhibition method. The soil pH of tea orchards studied ranged from 2.78 to 4.84, differing significantly from sample to sample, whereas that of meadow and unplanted fields ranged from 5.78 to 6.35. The PNR ranged from 0.050 to 0.193 μg NO 2 - -Ng -1 h -1 and were positively correlated with the soil pH (r 2 0.382, p 2 - -Ng -1 h -1 ) and subjected to PCR-aided clone library analyses targeting archaeal and bacterial amoA genes. The detected archaeal clones separated from the cluster of the 'Soil clones' and tightly clustered with the clones originating from other acidic soil environments including the Chinese tea orchard soil. These results suggest that the specific archaeal populations dominate as the ammonia oxidizers in acid tea-orchard soils and possibly other acid soils, independent of geographic locations, which results from the adaptation to specific ecological niches.

  6. Involvement of Dactylonectria and Ilyonectria spp. in tree decline affecting multigeneration apple orchards

    Science.gov (United States)

    This study examined the etiology of typical replant disease symptom development, including growth reduction and leaf chlorosis, that was limited to specific foci within three multi-generation apple orchards that overall demonstrated optimal growth and good quality standard production. In bioassays c...

  7. Soil capacitance sensors and stem dendrometers. Useful tools for irrigation scheduling of commercial orchards?

    Energy Technology Data Exchange (ETDEWEB)

    Bonet, L.; Ferrer, P.; Castel, J. R.; Intrigliolo, D. S.

    2010-07-01

    Irrigation scheduling is often performed based on a soil water balance, where orchard evapotranspiration is estimated using the reference evapotranspiration (ETo) times the crop coefficient (Kc). This procedure, despite being widely spread, has some uncertainties. Because of this, plant and soil water status monitoring could be alternatively or complementarity used to schedule irrigation. The usefulness of capacitance probes was evaluated during several seasons in large irrigation districts where irrigation practices were changed over years from the ETo * Kc model to the analysis of soil water status trend. This area corresponds to drip irrigated orchards planted with citrus, peach, nectarine and persimmon. Around 25% less irrigation was applied with no substantial yield penalty when the information provided by capacitance probes was correctly applied for irrigation management. On the other hand, the usefulness of stem dendrometers for continuously monitoring plant water status was evaluated in a young plum experimental orchard. Over two years, irrigation was scheduled using exclusively trunk shrinkage via the signal intensity approach by means of a baseline equation previously obtained in the orchard. Results showed that it was not always possible to schedule irrigation based on the trunk shrinkage signal intensity due to the temporal changes in the reference values that occurred as trees aged. Overall, results obtained are discussed in terms of the possible extrapolation at field level of both capacitance probes and stem dendrometers. Advantages and drawbacks of each technique are analyzed and discussed. (Author) 34 refs.

  8. DETECTION OF POLLEN FLOW IN THE SEEDLING SEED ORCHARD OF Acacia mangium USING DNA MARKER

    Directory of Open Access Journals (Sweden)

    Vivi Yuskianti

    2013-06-01

    Full Text Available Pollen pattern dispersal in seedling seed orchard (SSO is an essential part of a tree-improvement program. Two SSOs of Acacia mangium in South Kalimantan and South Sumatra that represent similar resources in different environments were used in this study.  Genotypes of all trees and seeds from a subset of 10 mother trees in each orchard were determined for 12 microsatellite loci, and parentage analysis was carried out. The results shows that the pollen dispersal pattern in both SSOs decrease with distance from mother tree. Patterns of pollen dispersal, dispersal distance and cumulative frequency of pollen dispersal distance were similar in both SSOs. Random pollen dispersal were found in both SSOs. About 80% of all crosses were found within a 40-m distance range with the most frequent pollination distance between mother tree and male male parents was 0-10 m. No self-pollinated seed was detected. Application of all these aspects found in this study such as random pollen dispersal and the effective pollen dispersal distance can be useful for establishing seedling seed orchard, clonal seed orchard and in other tree improvement activities of A. mangium.

  9. Nutrient Losses by Runoff and Sediment from the Taluses of Orchard Terraces

    NARCIS (Netherlands)

    Duran Zuazo, V.H.; Martinez Ray, A.; Aguilar Ruiz, J.

    2004-01-01

    The nutrient fluxes of nitrate, ammonium, phosphorus and potassium in runoff and sediments were evaluated over a two-year period (1999¿2000) on the taluses of terraces, in a zone of intense subtropical orchard cultivation (SE Spain). The erosion plots were located on a terrace of 214% (65°) slope,

  10. Phytoplasmas in apricot, peach and sour cherry orchards in East Bohemia, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Ludvíková, H.; Fránová, Jana; Suchá, J.

    2011-01-01

    Roč. 64, Suppl. (2011), s. 67-68 ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Candidatus Phytoplasma prunorum * PCR/RFLP * apricot, peach and sour cherry orchards Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

  11. A method for assessing frost damage risk in sweet cherry orchards of South Patagonia

    NARCIS (Netherlands)

    Cittadini, E.D.; Ridder, de N.; Peri, P.L.; Keulen, van H.

    2006-01-01

    Quantification of frost damage risk is important in planning the development of new orchard areas and for decision-making on design and installation of frost control systems. The objective of this study was to develop a comprehensive method to quantify frost damage risk in different sweet cherry

  12. How seed orchard culture affects seed quality: experience with the southern pines

    Science.gov (United States)

    James P. Barnett

    1996-01-01

    Tree improvement programs have influenced significantly the quality of southern pine seeds produced when compared to collections from native stands. Seed orchard management practices such as fertilization can increase seed size and reduce seed dormancy. These result in the need for less complex pregermination treatments. Repeated cone collections from the same clones...

  13. Pest management in Douglas-fir seed orchards: a microcomputer decision method

    Science.gov (United States)

    James B. Hoy; Michael I. Haverty

    1988-01-01

    The computer program described provides a Douglas-fir seed orchard manager (user) with a quantitative method for making insect pest management decisions on a desk-top computer. The decision system uses site-specific information such as estimates of seed crop size, insect attack rates, insecticide efficacy and application costs, weather, and crop value. At sites where...

  14. A foam formulation of an entomopathogenic fungus for control of boring beetles in avocado orchards

    Science.gov (United States)

    A foam formulation of Beauveria bassiana was adapted to control boring beetles in avocado orchards. The two geographically independent avocado growing areas in the United States are threatened by emerging diseases vectored by boring beetles. In the California growing region, Fusarium dieback is vect...

  15. Effects of soil management techniques on soil water erosion in apricot orchards

    NARCIS (Netherlands)

    Keesstra, Saskia; Pereira, Paulo; Novara, Agata; Brevik, Eric C.; Azorin-Molina, Cesar; Parras-Alcántara, Luis; Jordán, Antonio; Cerdà, Artemi

    2016-01-01

    Soil erosion is extreme in Mediterranean orchards due to management impact, high rainfall intensities, steep slopes and erodible parent material. Vall d'Albaida is a traditional fruit production area which, due to the Mediterranean climate and marly soils, produces sweet fruits. However, these

  16. The genetic and economic effect of preliminary culling in the seedling orchard

    Science.gov (United States)

    Don E. Riemenschneider

    1977-01-01

    The genetic and economic effects of two stages of truncation selection in a white spruce seedling orchard were investigated by computer simulation. Genetic effects were computed by assuming a bivariate distribution of juvenile and mature traits and volume was used as the selection criterion. Seed production was assumed to rise in a linear fashion to maturity and then...

  17. Monitoring stink bugs (Hemiptera: Pentatomidae) in mid-Atlantic apple and peach orchards.

    Science.gov (United States)

    Leskey, T C; Hogmire, H W

    2005-02-01

    Pyramid traps coated with "industrial safety yellow" exterior latex gloss enamel paint and baited with Euschistus spp. aggregation pheromone, methyl (2E,4Z)-decadienoate captured more stink bugs than all other baited and unbaited trap types in both apple and peach orchards in 2002 and 2003. Commercial sources of dispensers of methyl (2E,4Z)-decadienoate deployed in association with pyramid traps had a significant impact on trap captures. Captures in pyramid traps were four-fold greater when baited with lures from IPM Technologies, Inc. (Portland, OR) than with lures from Suterra (Bend, OR). Variation in yellow pyramid trap color ("industrial safety yellow" and "standard coroplast yellow") and material (plywood, plastic, and masonite) did not affect trap captures. Brown stink bug was the predominant species captured (58%), followed by dusky stink bug, Euschistus tristigmus (Say) (20%); green stink bug, Acrosternum hilare (Say) (14%); and other stink bugs (Brochymena spp. and unidentified nymphs) (8%). Captures in baited pyramid traps were significantly correlated with tree beating samples in both managed and unmanaged apple orchards and with sweep netting samples in the unmanaged apple orchard. However, problems associated with trapping mechanisms of pyramid trap jar tops and jar traps likely resulted in reduced captures in baited traps. Improved trapping mechanisms must be established to develop an effective monitoring tool for stink bugs in mid-Atlantic orchards.

  18. Cost-benefit trade-offs of bird activity in apple orchards.

    Science.gov (United States)

    Peisley, Rebecca K; Saunders, Manu E; Luck, Gary W

    2016-01-01

    Birds active in apple orchards in south-eastern Australia can contribute positively (e.g., control crop pests) or negatively (e.g., crop damage) to crop yields. Our study is the first to identify net outcomes of these activities, using six apple orchards, varying in management intensity, in south-eastern Australia as a study system. We also conducted a predation experiment using real and artificial codling moth (Cydia pomonella) larvae (a major pest in apple crops). We found that: (1) excluding birds from branches of apple trees resulted in an average of 12.8% more apples damaged by insects; (2) bird damage to apples was low (1.9% of apples); and (3) when trading off the potential benefits (biological control) with costs (bird damage to apples), birds provided an overall net benefit to orchard growers. We found that predation of real codling moth larvae was higher than for plasticine larvae, suggesting that plasticine prey models are not useful for inferring actual predation levels. Our study shows how complex ecological interactions between birds and invertebrates affect crop yield in apples, and provides practical strategies for improving the sustainability of orchard systems.

  19. DNA-based identification of Armillaria isolates from peach orchards in Mexico state

    Science.gov (United States)

    Ruben Damian Elias Roman; Ned B. Klopfenstein; Dionicio Alvarado Rosales; Mee-Sook Kim; Anna E. Case; Sara M. Ashiglar; John W. Hanna; Amy L. Ross-Davis; Remigio A. Guzman Plazola

    2012-01-01

    A collaborative project between the Programa de Fitopatología, Colegio de Postgraduados, Texcoco, Estado de Mexico and the USDA Forest Service - RMRS, Moscow Forest Pathology Laboratory has begun this year (2011) to assess which species of Armillaria are causing widespread and severe damage to the peach orchards from México state, Mexico. We are employing a DNA-based...

  20. Estimating water use of mature pecan orchards: A six stage crop growth curve approach

    CSIR Research Space (South Africa)

    Ibraimo, NA

    2016-11-01

    Full Text Available previous study in New Mexico, revealed that a six stage crop coefficient curve should be considered for pecans, together with higher mid-season crop coefficient (K(subc)) values for mature orchards. More accurate estimates of monthly ET for mature pecan...

  1. Localization in orchards using Extended Kalman Filter for sensor-fusion - A FroboMind component

    DEFF Research Database (Denmark)

    Christiansen, Martin Peter; Jensen, Kjeld; Ellekilde, Lars-Peter

    Using the detected trees seen in gure 4(b) a localised SLAM map of the surroundings area, can be created an used to determine the localisation of the tractor. This kind of sensor-fusion is used, to keep the amount of prior information about outlay of the orchard to a minimum, so it can be used...

  2. Spray deposition and spray drift in orchard spraying by multiple row sprayers

    NARCIS (Netherlands)

    Wenneker, M.; Zande, van de J.C.; Michielsen, J.G.P.; Stallinga, H.; Velde, van P.

    2016-01-01

    The evaluation of the latest data on spray drift in orchard spraying in the Netherlands, and measurements of surface water quality parameters show that the current legislation and measures are insufficient to protect the surface water. To meet the national and European objectives regarding surface

  3. Influence of white plastic and water replacement rates on pomegranate orchard phenology, fruit yield and quality

    Science.gov (United States)

    Currently, 98% of domestic commercial pomegranate fruit (Punica granatum L.) are produced in California on over 13,000 ha. In 2013, a pomegranate orchard, established in 2010 with a density of 558 trees/ha, was irrigated at water replacement rates of 35, 50 and 100% based on rainfall, tree water r...

  4. Pedo-Climatic Risks Over Făllticeni City Related Orchards

    Directory of Open Access Journals (Sweden)

    Jitariu Vasile

    2017-10-01

    Full Text Available Through this study, “Pedo-climatic risks over Fălticeni city related orchards”, we intend to conduct a study that highlights the way that a number of parameters such as climate and soil, through their evolution, may be considered a risk factor for orchards nearby Fălticeni city.

  5. Sources of Neofabraea spp. and Cadophora spp. in Dutch apple and pear orchards

    NARCIS (Netherlands)

    Köhl, J.; Wenneker, M.; Haas, de B.H.; Anbergen, R.; Lombaers-van der Plas, C.H.; Kastelein, P.

    2015-01-01

    Post-harvest diseases of apple and pear result in significant economic losses during long storage. Pathogens causing quiescent infections in the orchard leading to late post-harvest losses in The Netherlands are Neofabraea alba (Lenticel spot disease), N. perennans (Bull eye rot), Neonectria

  6. Great Tits (Parus major) reduce caterpillar damage in commercial apple orchards

    NARCIS (Netherlands)

    Mols, C.M.M.; Visser, M.E.

    2007-01-01

    Alternative ways to control caterpillar pests and reduce the use of pesticides in apple orchards are in the interest of the environment, farmers and the public. Great tits have already been shown to reduce damage under high caterpillar density when breeding in nest boxes in an experimental apple

  7. Cost-benefit trade-offs of bird activity in apple orchards

    Directory of Open Access Journals (Sweden)

    Rebecca K. Peisley

    2016-06-01

    Full Text Available Birds active in apple orchards in south–eastern Australia can contribute positively (e.g., control crop pests or negatively (e.g., crop damage to crop yields. Our study is the first to identify net outcomes of these activities, using six apple orchards, varying in management intensity, in south–eastern Australia as a study system. We also conducted a predation experiment using real and artificial codling moth (Cydia pomonella larvae (a major pest in apple crops. We found that: (1 excluding birds from branches of apple trees resulted in an average of 12.8% more apples damaged by insects; (2 bird damage to apples was low (1.9% of apples; and (3 when trading off the potential benefits (biological control with costs (bird damage to apples, birds provided an overall net benefit to orchard growers. We found that predation of real codling moth larvae was higher than for plasticine larvae, suggesting that plasticine prey models are not useful for inferring actual predation levels. Our study shows how complex ecological interactions between birds and invertebrates affect crop yield in apples, and provides practical strategies for improving the sustainability of orchard systems.

  8. Survey of Trojan fir seed orchard in Edremit-Gurgendag Region of ...

    African Journals Online (AJOL)

    Abies nordmanniana ssp. Equitrojani, with a limited distribution in Northwestern Anatolia (Kazdaglari Mountain ranges), is one of the four Abies taxa naturally grown in Turkey. Regeneration problems are caused when establishing seed orchards for this important conifer. Seed and cone pests are the main problems ...

  9. Phenology, dichogamy, and floral synchronization in a northern red oak (Quercus rubra) seed orchard

    Science.gov (United States)

    Lisa W. Alexander; Keith E. Woeste

    2016-01-01

    We developed a novel scoring system to assess spring phenology in a northern red oak (Quercus rubra L.) clonal seed orchard. The system was used to score from 304 to 364 ramets for three reproductive seasons and to place clones into early, intermediate, and late phenology classes. Although the absolute number of clones in each phenological class...

  10. Detecting moisture status of pecan orchards and the potential of remotely-sensed surface reflectance data

    Science.gov (United States)

    Othman, Yahia Abdelrahman

    Demand for New Mexico's limited water resources coupled with periodic drought has increased the need to schedule irrigation of pecan orchards based on tree water status. The overall goal of this research was to develop advanced tree water status sensing techniques to optimize irrigation scheduling of pecan orchards. To achieve this goal, I conducted three studies in the La Mancha and Leyendecker orchards, both mature pecan orchards located in the Mesilla Valley, New Mexico. In the first study, I screened leaf-level physiological changes that occurred during cyclic irrigation to determine parameters that best represented changes in plant moisture status. Then, I linked plant physiological changes to remotely-sensed surface reflectance data derived from Landsat Thematic Mapper (TM) and Enhanced Thematic Mapper (ETM+). In the second study, I assessed the impact of water deficits that developed during the flood irrigation dry-down cycles on photosynthesis (A) and gas exchange and established preliminary water deficit thresholds of midday stem water potential (Psi smd) critical to A and gas exchange of pecans. In a third study, I investigated whether hyperspectral data obtained from a handheld spectroradiometer and multispectral remotely-sensed data derived from Landsat 7 ETM+ and Landsat 8 Operational Land Imager (OLI) could detect moisture status in pecans during cyclic flood irrigations. I conducted the first study simultaneously in both orchards. Leaf-level physiological responses and remotely-sensed surface reflectance data were collected from trees that were either well watered or in water deficit. Midday stem water potential was the best leaf-level physiological response to detect moisture status in pecans. Multiple linear regression between Psismd and vegetation indices revealed a significant relationship (R 2 = 0.54) in both orchards. Accordingly, I concluded that remotely-sensed multispectral data form Landsat TMETM+ holds promise for detecting the moisture

  11. Genetic gain from present and future seed orchards and clone mixes; Genetiska vinster i nuvarande och framtida froeplantager och klonblandningar

    Energy Technology Data Exchange (ETDEWEB)

    Rosvall, O; Jansson, Gunnar; Andersson, Bengt; Ericsson, Tore; Karlsson, Bo; Sonesson, Johan; Stener, L.G.

    2001-10-01

    This report is intended to be the basis for decisions concerning establishment of the third cycle of seed orchards of Pinus sylvestris, Pinus contorta, Picea abies and Betula pendula in Sweden. First genetic gain is presented for existing seed orchards and clone mixes for vegetative propagation and the additional improvement possible by genetic thinning. Then the potential additional gain is given for the two coming cycles of seed orchards and clone mixes and the point in time when this can bee realised for each seed zone. The calculations were based on genetic parameters summarised from hundreds of genetic tests throughout Sweden. The gain refers to the genetic level of the unimproved source populations and assumes ideal functioning of seed orchards and clone mixes e.g. no background pollination. A simplification is that the gain is presented as if only one character were considered, per hectare production, although in reality an index of many traits is used, including also e.g. survival, stem quality. For Scots pine in harsh areas gain in survival is also given. In general the genetic gain of existing seed orchards is 10-25%, while it can reach 20-25% in all third cycle orchards. The feasible gain from thinning is 2-3%. That is half of the theoretical gain, which can be attained only in the most closely spaced orchards. The next step of improvement will reach 35% for orchard establishment in the period 2015-2020, in some cases already in 2010. Clone mix gains are of the same magnitude as seed orchards, but can be realised in commercial planting stock with less delay. All production populations gain predictions took into account sufficient genetic variability.

  12. Native insect pollinators in Apple orchards under different management practices in the Kashmir Valley

    Directory of Open Access Journals (Sweden)

    Muzaffar Ahmad Ganie

    2013-12-01

    Full Text Available It is now clear that over use of pesticides and intensive management of orchards can lead to drastic declines in apple pollinator abundance and crop failures. During the period of study a grower’s survey was conducted to know about knowledge of farmers on native insect pollinators, pollinator management practices, their perceptions of the importance and utility of native pollinators, and their attitudes regarding pesticide application. Despite of having significant knowledge of managed pollination, only few farmers (2% adopted supplementary methods of pollination (renting honey bee colonies, hand pollination etc.. In Pulwama, 60% of farmers had knowledge about native insect pollinators and 40% did not have any idea of native pollinators and in case of Shopian, the figures were fifty-fifty i.e. 50% had knowledge about native insect pollinators and 50% were unaware. During the period of investigation, native insect pollinators were sampled from different apple orchards under different management systems in early spring during apple flowering. A total of 17 species of insect pollinators belonging to 11 families and 3 orders_ Hymenoptera, Diptera and Lepidoptera registered their occurrence at all the studied apple orchards of the Kashmir Valley. At all the study sites i.e. apple orchards under different management systems, family Halictidae and Empididae registered their presence as dominant groups. The % family contribution of the former at different orchard types decreased with increase in the intensity of the management system and the % family contribution of the later however, showed a direct relationship with the management system found, i.e. the more intense the system, the more abundant was the group. Other groups in general did not show any greater differences in abundances at different sites studied.

  13. Formulation and quality control of Prunus domestica syrup, prepared according to Iranian Traditional Medicine

    Directory of Open Access Journals (Sweden)

    M. Hamzeloo-Moghadam

    2015-05-01

    Full Text Available Background and objectives: Prunus domestica (plum has been considered as a useful remedy for several disorders in Iranian Traditional Medicine (ITM. It has cold and wet temperament and is used as syrup for hot temperament diseases such as hot headache and stomach disorders. In the present study, plum syrup has been formulated according to ITM manuscripts and quality control evaluations have been accomplished to present a suitable formulation. Methods: The fruits of Prunus domestica L. were macerated in water, then decocted. The mixture was filtered. The filtrate was concentrated to have a suitable viscosity. The extract was sweetened by adding sugar (1:2 and heated till sugar was completely dissolved. The final product was evaluated physicochemically and microbiologically according to standard protocols and total phenolics content of the syrup stability was determined. The syrup was assessed in accelerated condition (40 ºC during 6 months. Results: The prepared formulation was a viscose and brown syrup with plum flavor and fragrance. No precipitation and cap locking were observed in the syrup. Dry residue, pH, density, viscosity and total phenolics of the syrup were found 43.1%, 3.49, 1.27 g/ml, 6.5 cP and 152.3 mg/100ml, respectively. No microbial growth was observed in the formulation. In the accelerated stability tests, no remarkable changes were seen in the product. Total phenolics content was decreased 2.2% during 6 months in 40 ºC. Conclusion: The formulated Prunus domestica syrup could be introduced for further mass production after completing the final required evaluations.

  14. Efficacy of Essential Oils from Edible Plants as Insecticides Against the House Fly, Musca Domestica L.

    Directory of Open Access Journals (Sweden)

    Sara M. Palacios

    2009-05-01

    Full Text Available The compositions of 12 essential oils (EOs obtained by hydrodistillation of edible fruits and herbs were analyzed by gas chromatography/mass spectroscopy (GC/MS. The insecticidal activity of each oil against the house fly Musca domestica was evaluated by placing flies in a glass jar with a screw cap that held a piece of EO-treated cotton yarn. The dose necessary to kill 50% of flies (LC50 in 30 min was determined at 26 ± 1°C. Twelve EOs and 17 individual terpenes were assayed against M. domestica, showing LC50 values ranging from 3.9 to 85.2 and from 3.3 to >100 mg/dm3, respectively. EO from Citrus sinensis was the most potent insecticide (LC50 = 3.9 mg/dm3, followed by EOs from C. aurantium (LC50 = 4.8 mg/dm3 and Eucalyptus cinerea (LC50 = 5.5 mg/dm3. According to GC/MS analysis, limonene (92.47%, linalool (1.43%, and b-myrcene (0.88% were the principal components of C. sinensis EO. Limonene was also the principal constituent (94.07% of C. aurantium, while 1,8-cineole (56.86% was the major constituent of E. cinerea EO. 1,8-Cineole was most active against M. domestica (LC50 = 3.3 mg/dm3, while (4R(+-limonene, was moderately active (LC50 = 6.2 mg/dm3. Dimethyl 2,2-dichlorovinyl phosphate (DDVP selected as a positive control, showed an LC50 of 0.5 mg/dm3. EOs from C. sinensis, C. aurantium, and E. cinerea show promise as natural insecticides against houseflies.

  15. The Effect of Ozone Oxydans in Plastic of Polyethylene used for The Storage of Apple Manalagi (malus Sylvestris M)

    International Nuclear Information System (INIS)

    Isyuniarto; Agus-Purwadi

    2007-01-01

    The effect of ozone oxydans in plastic of polyethylene used for the storage of apple Manalagi (malus sylvestris M) have been done. Firstly, apple selected according to form and size then packed into storage of plastic polyethylene 3 and 5 mm in thickness and ozonization process is done from 0, 20, 40 and 60 seconds. The sample is monitored every 7, 14 and 21 days. Parameter perceived is texture of fruit, colour, smell and panelist option to this research. The result is thickly of plastic 3 mm and ozonization time 60 seconds. (author)

  16. Effect of four commercial fungal formulations on mortality and sporulation of house flies (Musca domestica) and stable flies (Stomoxys calcitrans)

    Science.gov (United States)

    House flies (Musca domestica L.) and stable flies (Stomoxys calcitrans (L.)) (Diptera: Muscidae) are major pests of livestock. Biological control is an important tool in an integrated control framework. Increased mortality in filth flies has been documented with entomopathogenic fungi, and several s...

  17. Effects of relative humidity, temperature, and population density on production of cuticular hydrocarbons in housefly Musca domestica L.

    NARCIS (Netherlands)

    Noorman, N; Den Otter, CJ

    The production of cuticular hydrocarbons by both males and females of Musca domestica L. under very wet conditions (90% relative humidity) compared to the production at 50 and 20% relative humidity is delayed up to at least 3 days after emergence from the pupae. Eight days after emergence, however,

  18. Chlamydia psittaci and C. avium in feral pigeon (Columba livia domestica) droppings in two cities in the Netherlands

    NARCIS (Netherlands)

    Burt, Sara A.; Röring, Romy E.; Heijne, Marloes

    2018-01-01

    Background: Feral pigeons (Columba livia domestica) live and breed in many city centres and contact with their droppings can be a hazard for human health if the birds carry Chlamydia psittaci. Objective: The aim of this study was to establish whether pigeon droppings in two Dutch cities (Utrecht and

  19. Evaluation of Beauveria bassiana infection in the hemolymph serum proteins of the housefly, Musca domestica L. (Diptera: Muscidae).

    Science.gov (United States)

    Mishra, Sapna; Kumar, Peeyush; Malik, Anushree

    2017-11-01

    Beauveria bassiana plays a prominent role in biocontrol of houseflies, Musca domestica (L.). Thus, a deeper insight into immune response of M. domestica during B. bassiana infection was warranted to assist the production of more efficient mycoinsecticides. The present study investigates changes in protein profile of M. domestica hemolymph serum post B. bassiana infection using two-dimensional difference gel electrophoresis (2D-DIGE) followed by identification of selected proteins by matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF MS). The non-infected or control group of flies showed an expression of 54 proteins, while M. domestica infected with B. bassiana expressed a total of 68 hemolymph serum proteins. Thirty three proteins were expressed in both groups of houseflies, whereas 35 proteins were exclusively expressed in infected flies and 21 proteins were exclusively expressed in control flies. Among the 33 proteins which were expressed in both groups of houseflies, 17 proteins showed downregulation, while16 proteins were upregulated in the infected flies compared to the non-infected ones. The results from this study are expected to facilitate better understanding of insect's immune response mechanism.

  20. 'HoneySweet' (C5), the first genetically engineered Plum pox virus-resistant plum (Prunus domestica L.) cultivar

    Science.gov (United States)

    ‘HoneySweet’ plum was released by the U.S. Department of Agriculture, Agricultural Research Service, to provide U.S. growers and P. domestica plum breeders with a high fruit quality plum cultivar resistant to Plum pox virus (PPV). ‘HoneySweet’ was developed through genetic engineering utilizing the...

  1. Genome of the house fly, Musca domestica L., a global vector of diseases with adaptations to a septic environment

    NARCIS (Netherlands)

    Scott, Jeffrey G; Warren, Wesley C; Beukeboom, Leo W; Bopp, Daniel; Clark, Andrew G; Giers, Sarah D; Hediger, Monika; Jones, Andrew K; Kasai, Shinji; Leichter, Cheryl A; Li, Ming; Meisel, Richard P; Minx, Patrick; Murphy, Terence D; Nelson, David R; Reid, William R; Rinkevich, Frank D; Robertson, Hugh M; Sackton, Timothy B; Sattelle, David B; Thibaud-Nissen, Francoise; Tomlinson, Chad; van de Zande, Louis; Walden, Kimberly; Wilson, Richard K; Liu, Nannan

    2014-01-01

    BACKGROUND: Adult house flies, Musca domestica L., are mechanical vectors of more than 100 devastating diseases that have severe consequences for human and animal health. House fly larvae play a vital role as decomposers of animal wastes, and thus live in intimate association with many animal

  2. The mitochondrial genomes of the barklice, Lepinotus reticulatus and Dorypteryx domestica (Psocodea: Trogiomorpha): Insight into phylogeny of the order Psocodea.

    Science.gov (United States)

    Feng, Shiqian; Stejskal, Václav; Wang, Yannan; Li, Zhihong

    2018-05-05

    The order Psocodea which has incorporated the two former orders Psocoptera (barklice and booklice) and Phthiraptera (parasitic lice) attracts much attention for its unusual mitochondrial (mt) genome rearrangements. Available phylogenetic analysis for Psocodea is subjected to partial taxa and a complete one is needed. To further explore the genome rearrangement and phylogeny in Psocodea, we sequenced the mt genomes of two barklice, Lepinotus reticulatus (collected from China) and Dorypteryx domestica (collected from Czech Republic). Both of newly sequenced barklice had typical one-chromosome mt genomes and the same mt gene arrangement with the reported Lepidopsocidae sp. The mt genomes of L. reticulatus and D. domestica contained 37 genes typical of bilateral animals. In contrast with the recent report mt genome of D. domestica, our strain was found with many single nucleotide polymorphisms in intra-specific difference. Phylogenetic relationships were inferred from all available mt genomes of Psocodea data using Maximum Likelihood and Bayesian methods. The mt genome of L. reticulatus is the first representative with complete sequences of the family Trogiidae and our D. domestica data enriched the family Psyllipsocidae, which will contribute to the further study of mt gene rearrangement and phylogeny of Psocodea. Copyright © 2018 Elsevier B.V. All rights reserved.

  3. Biological trait analysis and stability of lambda-cyhalothrin resistance in the house fly, Musca domestica L. (Diptera: Muscidae).

    Science.gov (United States)

    Abbas, Naeem; Shah, Rizwan Mustafa; Shad, Sarfraz Ali; Iqbal, Naeem; Razaq, Muhammad

    2016-05-01

    House flies, Musca domestica L., (Diptera: Muscidae), are pests of poultry and have the ability to develop resistance to insecticides. To design a strategy for resistance management, life history traits based on laboratory observations were established for lambda-cyhalothrin-resistant, susceptible and reciprocal crosses of M. domestica strains. Bioassay results showed that the lambda-cyhalothrin-selected strain developed a resistance ratio of 98.34 compared to its susceptible strain. The lambda-cyhalothrin-selected strain had a relative fitness of 0.26 and lower fecundity, hatchability, lower number of next generation larvae, and net reproductive rate compared with its susceptible strain. Mean population growth rates, such as intrinsic rate of population increase, and biotic potential were lower for the lambda-cyhalothrin-selected strain compared to its susceptible strain. Resistance to lambda-cyhalothrin, indoxacarb, and abamectin was unstable while resistance to bifenthrin and methomyl was stable in the lambda-cyhalothrin-selected strain of M. domestica. Development of resistance can cost considerable fitness for the lambda-cyhalothrin-selected strain. The present study provided useful information for making potential management strategies to delay resistance development in M. domestica.

  4. Searching for a manageable pollinator for Acerola orchards: the solitary oil-collecting bee Centris analis (Hymenoptera: Apidae: Centridini).

    Science.gov (United States)

    Oliveira, Reisla; Schlindwein, Clemens

    2009-02-01

    Acerola (Malpighia emarginata DC; Malpighiaceae) is an important fruit crop in Brazil. Among its pollinators, Centris (Heterocentris) analis (F.) stands out due to its abundance at flowers and prompt acceptance of trap-nests. For the first time, we propose the commercial use of Centris bees as orchard pollinators. To develop protocols for rearing and management of these bees, we analyzed trap-nest acceptance, brood-cell construction, and larval diet in Acerola orchards. Although Centris species, in general, use numerous pollen host plants, females of C. analis showed remarkable flower fidelity to Acerola for pollen supply when nesting in the orchard. Such fidelity was previously expected only for floral oil collection. The ease of acceptance of trap-nests by females of C. analis, their prolonged yearly activity period, multivoltine life history, and high pollinator efficiency characterize C. analis as an excellent potentially manageable pollinator in Acerola orchards.

  5. Molecular detection and antimicrobial resistance of Aeromonas from houseflies (Musca domestica in Iran

    Directory of Open Access Journals (Sweden)

    Davood Ommi

    2015-11-01

    Full Text Available Objective. This study aimed to report the molecular detection and antimicrobial resistance of Aeromonas among houseflies (Musca domestica in Shahrekord and Isfahan provinces of Iran. Materials and methods. Flies were caught from household kitchens, cattle farms, animal hospitals, human hospitals, slaughter house and poultry farms and put in collection separate sterile tubes. Isolation was accomplished by culture of flies in alkaline peptone water followed by identification with Aeromonas-specific Polymerase Chain Reaction (PCR. Results. Out of 600 houseflies 73 (12.2% were infected with Aeromonas spp. Significantly higher frequencies of Aeromonas were isolated in Shahrekord province (13.0%; 39/300 than in Isfahan province (11.3%; 34/300. The recovery frequencies of the organisms were significantly lower in kitchens as compared to those in cattle farms and hospital wards which were similar. Higher proportions of infected flies were obtained during summer whereas low proportions were obtained during winter. Conclusions. It is concluded that houseflies do harbor diarrheagenic pathogens, including Aeromonas especially during summer. The carried organisms are resistant to a number of antimicrobials at different levels. Thus, future plans aimed at stemming infections caused by these organisms should take flies into account. Control efforts of infections caused by this particular bacterium should therefore take into account Musca domestica.

  6. UJI EFIKASI LARVASIDA BERBAHAN AKTIF DICHLORVOS TERHADAP LARVA LALAT RUMAH Musca domestica DI LABORATORIUM

    Directory of Open Access Journals (Sweden)

    Hadi Suwasono

    2012-10-01

    Full Text Available The house fly, Musca domestica have been implicated in the mechanical transmission of pathogens causing diseases. Important diseases that may be transmitted under certain conditions include infection of virus, bacterial, protozoan, fungal and helminthic. Therefore control measures should be carried out only when the presence of the house fly is intolerable to humans due to their being a health hazard or nuisance. The larvicide with active ingredient of dichlorvos 250 g/l was applied to the house fly larvae which conducted in the laboratory. There were jive concentrations of larvicides to be tested i.e. 6; 12; 24; 48 and 96 ml by product/ 3 l of water/m2. A dried powder of chicken dung was utilized as larvae medium. The medium was inoculated with the third instar larvae then it sprayed with the larvicide suspension. All larvicidal assays were carried out at 26 - 30°C temperature and 60-80% RH in the laboratory. The results revealed that all of the five tested concentrations yielded between 0 and 5.2 percent larval mortalities.   Keywords: house fly, Musca domestica, larvicide, dichlorvos

  7. Radiation induced cerebellum impairments in Swiss albino mice and its modulation by dietary Prunus domestica

    International Nuclear Information System (INIS)

    Sharma, Garima; Sisodia, Rashmi

    2012-01-01

    To study the biochemical, quantitative histopathological and behavioural changes after 5 Gy whole body irradiation and its modulation by supplementation of Prunus domestica extract (PDE) for 15 consecutive days on male Swiss albino. For this study healthy mice from an inbred colony were divided into five groups: (i) Control; (ii) PDE treated - mice in this group were orally supplemented with PDE (400 mg/kg body weight (bw)/day) once daily for 15 consecutive days; (iii) Irradiated-mice were whole body exposed to 5 Gy irradiated; (iv) PDE + irradiated-mice in this group were orally supplemented PDE for 15 days (once a day) prior to irradiation; and (v) irradiated+PDE -mice in this group were administered PDE orally for 15 days (once a day) consequently after irradiation. Marked radiation induced changes in the amount of cerebellar lipid peroxidation (LPO), glutathione (GSH), protein, superoxide dismutase (SOD), catalase and histopathological changes (molecular layer, granular layer and purkinje cell numbers) could be significantly ameliorated supplementation of PDE prior/post irradiation. Radiation induced deficits in learning and memory were also significantly ameliorated. PDE was found to have strong radical scavenging activity in 2,2-diphenyl-1-picrylhydrazyl (DPPH) and also showed in vitro radioprotective activity. The result of present study showed that prior/post-supplementation of Prunus domestica has radioprotective potential as well as neuroprotective properties against the radiation. (author)

  8. Crystallization, data collection and phasing of two digestive lysozymes from Musca domestica

    Energy Technology Data Exchange (ETDEWEB)

    Marana, S. R.; Cançado, F. C. [Departamento de Bioquímica, Instituto de Química, Universidade de São Paulo, São Paulo (Brazil); Valério, A. A. [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Bioquímica, Universidade Estadual de Campinas, Campinas (Brazil); Ferreira, C.; Terra, W. R. [Departamento de Bioquímica, Instituto de Química, Universidade de São Paulo, São Paulo (Brazil); Barbosa, J. A. R. G., E-mail: joao@lnls.br [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Bioquímica, Universidade Estadual de Campinas, Campinas (Brazil); Departamento de Genética e Evolução, Universidade Estadual de Campinas, Campinas (Brazil); Departamento de Bioquímica, Instituto de Química, Universidade de São Paulo, São Paulo (Brazil)

    2006-08-01

    The digestive lysozymes 1 and 2 from M. domestica were crystallized by vapour diffusion. The crystallographic data were processed to a maximum resolution of 1.9 Å in both cases. Lysozymes are mostly known for their defensive role against bacteria, but in several animals lysozymes have a digestive function. Here, the initial crystallographic characterization of two digestive lysozymes from Musca domestica are presented. The proteins were crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium sulfate or PEG/2-propanol as the precipitant. X-ray diffraction data were collected to a maximum resolution of 1.9 Å using synchrotron radiation. The lysozyme 1 and 2 crystals belong to the monoclinic space group P2{sub 1} (unit-cell parameters a = 36.52, b = 79.44, c = 45.20 Å, β = 102.97°) and the orthorhombic space group P2{sub 1}2{sub 1}2 (unit-cell parameters a = 73.90, b = 96.40, c = 33.27 Å), respectively. The crystal structures were solved by molecular replacement and structure refinement is in progress.

  9. Using the fungus Entomophthora muscae (chon Fresenius to eliminate some larval roles of Musca domestica

    Directory of Open Access Journals (Sweden)

    Walaa Yas Lahmood

    2017-07-01

    Full Text Available Studied effect serial concentrations from spores filtrate of fungus Entomophthora muscae on some larval roles of musca domestica in laboratory. Results were made clear that the insect roles are sensitive to fungus, and treated the food larva of musca domestica and sprinkle it by concentration 2.8×106 , 2.8×107, 2.8×108 (spore/ml has led to get rates of destruction of cumulative faculty certified on the concentration and time its magnitude 16.60 , 47.67, 53.30 % respectively , also recorded some phenotypic distortion infected dead larva represent by contraction and blackening body. The treatment of pupael by sprinkling the previous fungus concentration recorded rate of destruction of accumulative faculty its magnitude 13.33, 26.67, 33.33% respectively, also the rates emergence of adults ranged between 66.67 – 86.67 % in comparison with rates of emergence of adults in control treatment 96.67% The results are made clear that adults treatment by sprinkle with last concentration from fungus spore filtrate recorded rates of distraction its magnitude 46.61, 56.67, 70% respectively after one week from treatment .

  10. The effect of gamma irradiation on curcumin component of Curcuma domestica

    Science.gov (United States)

    Chosdu, R.; Erizal; Iriawan, T.; Hilmy, N.

    1995-02-01

    The effect of gamma irradiation on curcumin component of Curcuma domestica rhizome were investigated. Pure curcumin, sliced and powdered rhizome with 10% of moisture content were irradiated at 0, 10, 30 and 50 kGy (dose rate of 6 kGy/h). Curcumin content was analysed using HPLC method and ESR spectra. Results show that free radicals are already present in unirradiated rhizome. Gamma irradiation at the doses of 10, 30 and 50 kGy induced the free radicals formation of pure curcumin and Curcuma domestica rhizome. The ESR spectra of irradiated rhizome gave a very similar spectra to the signal of irradiated pure curcumin. The percentage of free radicals intensity from pure curcumin was very stable at room temperature up to 670 hours of storage. However, the percentage intensity of free radicals in the irradiated rhizome were decay during storage. Irradiation treatment and storage time did not give a significant change on curcumin content, water activity, pH and moisture content of rhizome investigated.

  11. The effect of gamma irradiation on curcumin component of Curcuma domestica

    Energy Technology Data Exchange (ETDEWEB)

    Chosdu, R.E.; Erizal; Iriawan, T.; Hilmy, N. [National Atomic Energy Agency, Jakarta (Indonesia). Center for Applications of Isotopes and Radiation

    1995-10-01

    The effect of gamma irradiation on curcumin component of Curcuma domestica rhizome were investigated. Pure curcumin, sliced and powdered rhizome with 10% of moisture content were irradiated at 0, 10, 30 and 50 kGy (dose rate of 6 kGy/h). Curcumin content was analysed using HPLC method and ESR spectra. Results show that free radicals are already present in unirradiated rhizome. Gamma irradiation at the doses of 10, 30 and 50 kGy induced the free radicals formation of pure curcumin and curcuma domestica rhizome. The ESR spectra of irradiated rhizome gave a very similar spectra to the signal of irradiated pure curcumin. The percentage of free radicals intensity from pure curcumin was very stable at room temperature up to 670 hours of storage. However, the percentage intensity of free radicals in the irradiated rhizome were decay during storage. Irradiation treatment and storage time did not give a significant change on curcumin content, water activity, pH and moisture content of rhizome investigated. (Author).

  12. Evaluation of the house fly Musca domestica as a mechanical vector for an anthrax.

    Directory of Open Access Journals (Sweden)

    Antonio Fasanella

    Full Text Available Anthrax is a disease of human beings and animals caused by the encapsulated, spore-forming, Bacillus anthracis. The potential role of insects in the spread of B. anthracis to humans and domestic animals during an anthrax outbreak has been confirmed by many studies. Among insect vectors, the house fly Musca domestica is considered a potential agent for disease transmission. In this study, laboratory-bred specimens of Musca domestica were infected by feeding on anthrax-infected rabbit carcass or anthrax contaminated blood, and the presence of anthrax spores in their spots (faeces and vomitus was microbiologically monitored. It was also evaluated if the anthrax spores were able to germinate and replicate in the gut content of insects. These results confirmed the role of insects in spreading anthrax infection. This role, although not major, given the huge size of fly populations often associated with anthrax epidemics in domestic animals, cannot be neglected from an epidemiological point of view and suggest that fly control should be considered as part of anthrax control programs.

  13. The effect of gamma irradiation on curcumin component of Curcuma domestica

    International Nuclear Information System (INIS)

    Chosdu, R.E.; Erizal; Iriawan, T.; Hilmy, N.

    1995-01-01

    The effect of gamma irradiation on curcumin component of Curcuma domestica rhizome were investigated. Pure curcumin, sliced and powdered rhizome with 10% of moisture content were irradiated at 0, 10, 30 and 50 kGy (dose rate of 6 kGy/h). Curcumin content was analysed using HPLC method and ESR spectra. Results show that free radicals are already present in unirradiated rhizome. Gamma irradiation at the doses of 10, 30 and 50 kGy induced the free radicals formation of pure curcumin and curcuma domestica rhizome. The ESR spectra of irradiated rhizome gave a very similar spectra to the signal of irradiated pure curcumin. The percentage of free radicals intensity from pure curcumin was very stable at room temperature up to 670 hours of storage. However, the percentage intensity of free radicals in the irradiated rhizome were decay during storage. Irradiation treatment and storage time did not give a significant change on curcumin content, water activity, pH and moisture content of rhizome investigated. (Author)

  14. Characterisation of Sorbus domestica L. Bark, Fruits and Seeds: Nutrient Composition and Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Boris Majić

    2015-01-01

    Full Text Available The aim of this work is to assess the nutritional value of service tree (Sorbus domestica L. bark, fruit exocarp and mesocarp, and seeds by establishing the levels of macro- and microelements, total phenolics, flavonoids and tannins. Our results revealed that all of the tested service tree samples were rich in potassium. Bark was the best source of calcium and zinc, while seeds were the best source of magnesium. Compared to the bark and seeds, fruit exocarp and mesocarp contained significantly lower amounts of these three elements. Immature exocarp and bark contained the highest amounts of total phenolics and showed the highest antioxidant activity. Maturation significantly decreased the amount of total phenolics in fruits, as well as the antioxidant activity of total phenolics and total tannins from exocarp, but not from mesocarp. Exocarp was the richest in total flavonoids. Based on the obtained data, we have concluded that the under-utilised species S. domestica L. could serve as an important source of mineral elements and antioxidants in the human diet.

  15. Chlorophyll Catabolites in Senescent Leaves of the Plum Tree (Prunus domestica).

    Science.gov (United States)

    Erhart, Theresia; Mittelberger, Cecilia; Vergeiner, Clemens; Scherzer, Gerhard; Holzner, Barbara; Robatscher, Peter; Oberhuber, Michael; Kräutler, Bernhard

    2016-11-01

    In cold extracts of senescent leaves of the plum tree (Prunus domestica ssp. domestica), six colorless non-fluorescent chlorophyll catabolites (NCCs) were characterized, named Pd-NCCs. In addition, several minor NCC fractions were tentatively classified. The structure of the most polar one of the NCCs, named Pd-NCC-32, featured an unprecedented twofold glycosidation pattern. Three of the NCCs are also functionalized at their 3 2 -position by a glucopyranosyl group. In addition, two of these glycosidated NCCs carry a dihydroxyethyl group at their 18-position. In the polar Pd-NCC-32, the latter group is further glycosidated at the terminal 18 2 -position. Four other major Pd-NCCs and one minor Pd-NCC were identified with five NCCs from higher plants known to belong to the 'epi'-series. In addition, tentative structures were derived for two minor fractions, classified as yellow chlorophyll catabolites, which represented (formal) oxidation products of two of the observed Pd-NCCs. The chlorophyll catabolites in leaves of plum feature the same basic structural pattern as those found in leaves of apple and pear trees. © 2016 The Authors. Chemistry & Biodiversity Published by Wiley-VHCA AG, Zurich, Switzerland.

  16. A Southwide Rate Test of Azinphosmethyl (Guthion®) for Cone and Seed Insect Control In Loblolly Pine Seed Orchards

    Science.gov (United States)

    A.C. Mangini; L.R. Barber; R.S. Cameron; G.L. DeBarr; G.R. Hodge; J.B. Jett; W.L. Lowe; J.L. McConnell; J. Nord; J.W. Taylor

    1998-01-01

    A southwide efficiency test of reduced rates of azinphosmethyl (Guthion®) for control of seed and cone insects in loblolly pine seed orchards was conducted in 1992. In each of nine loblolly pine (Pinus taeda L.) seed orchards, an untreated (no protection) check and two of five possible rates of Guthion® (1.0, 1.5, 2.0, 2.5, or 3.0 lb ai/ac/...

  17. Dogwood Borer (Lepidoptera: Sesiidae) Abundance and Seasonal Flight Activity in Apple Orchards, Urban Landscapes, and Woodlands in Five Eastern States

    OpenAIRE

    Bergh, J. C.; Leskey, T. C.; Walgenbach, J. F.; Klingeman, W. E.; Kain, D. P.; Zhang, A.

    2017-01-01

    The relative abundance and seasonal flight activity of dogwood borer, Synanthedon scitula Harris (Lepidoptera: Sesiidae), was measured using weekly records from traps baited with its sex pheromone and deployed in apple orchards, urban landscapes, and native woodland sites in New York, West Virginia, Virginia, North Carolina, and Tennessee in 2005 and 2006. The mean total number of moths captured per site in apple orchards was 3,146 ± 644 and 3095 ± 584 SE in 2005 and 2006, respectively, excee...

  18. Incidence and phylogenetic analyses of Armillaria spp. associated with root disease in peach orchards in the State of Mexico, Mexico

    Science.gov (United States)

    R. D. Elias-Roman; R. A. Guzman-Plazola; N. B. Klopfenstein; D. Alvarado-Rosales; G. Calderon-Zavala; J. A. Mora-Aguilera; M.-S. Kim; R. Garcia-Espinosa

    2013-01-01

    Incidence of peach [Prunus persica (L.) Batsch] tree mortality attributed to Armillaria root disease was assessed from 2009 to 2011 in 15 orchards in the State of Mexico, Mexico. Incidence increased gradually every year of assessment, reaching average values of 9.7, 15.3 and 20.3% tree mortality and 23.2, 24.7 and 28.3% disease-impacted area of the orchards during 2009...

  19. The blow fly, Chrysomya megacephala, and the house fly, Musca domestica, as mechanical vectors of pathogenic bacteria in Northeast Thailand.

    Science.gov (United States)

    Chaiwong, T; Srivoramas, T; Sueabsamran, P; Sukontason, K; Sanford, M R; Sukontason, K L

    2014-06-01

    The Oriental latrine fly, Chrysomya megacephala (Fabricius) (Diptera: Calliphoridae) and the house fly, Musca domestica L., (Diptera: Muscidae) are synanthropic flies which are adapted to live in close association with human habitations, thereby making them likely mechanical vectors of several pathogens to humans. There were two main aims of this study. The first aim was to determine the prevalence of these two fly species from five types of human habitations including: fresh-food markets, garbage piles, restaurants, school cafeterias and paddy fields, in the Muang Ubon Ratchathani and Warinchamrap districts of Ubon Ratchathani province of Northeast Thailand. Flies collection were conducted monthly from September 2010-October 2011 using a reconstructable funnel trap, containing 1 day-tainted beef offal as bait. A total of 7 750 flies (6 401 C. megacephala and 1 349 M.domestica) were collected. The second aim was to examine the potential of these flies to carry pathogenic bacteria. Bacteria were isolated from 994 individual flies collected using a sweep net (555 C. megacephala and 439 M. domestica). A total of 15 bacterial genera were isolated from the external surfaces, comprising ten genera of gram-negative bacteria and five gram-positive bacteria. The most common bacteria isolated from both species were coagulase-negative staphylococci, followed by Streptococcus group D non-enterococci. Human pathogenic enteric bacteria isolated were Salmonella sp., Shigella sp., Escherichia coli O157:H7, Salmonella typhi, Bacillus sp., and Enterococcus sp., of which S. typhi is the first report of isolation from these fly species. Other human pathogens included Staphylococcus aureus and Pseudomonas aeruginosa. Not only were the number of C. megacephala positive for bacteria significantly higher than for M. domestica, but they were also carrying ~11-12 times greater bacterial load than M. domestica. These data suggest that both fly species should be considered potential

  20. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies.

    Science.gov (United States)

    Jung, Sook; Cestaro, Alessandro; Troggio, Michela; Main, Dorrie; Zheng, Ping; Cho, Ilhyung; Folta, Kevin M; Sosinski, Bryon; Abbott, Albert; Celton, Jean-Marc; Arús, Pere; Shulaev, Vladimir; Verde, Ignazio; Morgante, Michele; Rokhsar, Daniel; Velasco, Riccardo; Sargent, Daniel James

    2012-04-04

    Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA) algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  1. A Malus crabapple chalcone synthase gene, McCHS, regulates red petal color and flavonoid biosynthesis.

    Directory of Open Access Journals (Sweden)

    Deqiang Tai

    Full Text Available Chalcone synthase is a key and often rate-limiting enzyme in the biosynthesis of anthocyanin pigments that accumulate in plant organs such as flowers and fruits, but the relationship between CHS expression and the petal coloration level in different cultivars is still unclear. In this study, three typical crabapple cultivars were chosen based on different petal colors and coloration patterns. The two extreme color cultivars, 'Royalty' and 'Flame', have dark red and white petals respectively, while the intermediate cultivar 'Radiant' has pink petals. We detected the flavoniods accumulation and the expression levels of McCHS during petals expansion process in different cultivars. The results showed McCHS have their special expression patterns in each tested cultivars, and is responsible for the red coloration and color variation in crabapple petals, especially for color fade process in 'Radiant'. Furthermore, tobacco plants constitutively expressing McCHS displayed a higher anthocyanins accumulation and a deeper red petal color compared with control untransformed lines. Moreover, the expression levels of several anthocyanin biosynthetic genes were higher in the transgenic McCHS overexpressing tobacco lines than in the control plants. A close relationship was observed between the expression of McCHS and the transcription factors McMYB4 and McMYB5 during petals development in different crabapple cultivars, suggesting that the expression of McCHS was regulated by these transcription factors. We conclude that the endogenous McCHS gene is a critical factor in the regulation of anthocyanin biosynthesis during petal coloration in Malus crabapple.

  2. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies

    Directory of Open Access Journals (Sweden)

    Jung Sook

    2012-04-01

    Full Text Available Abstract Background Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Results Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Conclusion Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  3. Efecto de la aplicación de aceite esencial de orégano mexicano (Lippia graveolens y tomillo (Thymus vulgaris en factores de calidad de rodajas de manzana (Malus domestica

    Directory of Open Access Journals (Sweden)

    Carlos Enrique Ochoa Velasco

    2012-12-01

    Full Text Available El objetivo de este estudio fue evaluar algunos factores de calidad de rodajas de manzana sumergidas en soluciones de aceite esencial (AE de orégano y tomillo. Rodajas de manzana fueron sumergidas en diferentes soluciones de AE: 100 ppm de AE de orégano (T1, 100 ppm de AE de tomillo (T2, 75:25 ppm de AE de orégano:tomillo (T3, 50:50 ppm de AE de orégano:tomillo (T4, 25:75 ppm de AE de orégano:tomillo (T5; 100 ppm de ácido ascórbico (T6 y agua destilada estéril (T7 que se utilizó como control. Las rodajas de manzana fueron empacadas y almacenadas a 5 ºC. Se evaluó el pH, sólidos solubles totales, acidez titulable, color, actividad de la polifenoloxidasa, compuestos fenólicos, actividad antioxidante, bacterias aerobias mesófilas, mohos y levaduras durante 9 días y atributos sensoriales. Después de 9 días de almacenamiento las rodajas de manzana sumergidas en los tratamientos T1 y T3 presentaron menor valor de pH y menos oscurecimiento. T1 y T5 mostraron el menor cambio neto de color, esto se vio reflejado en una baja actividad de la polifenoloxidasa. La aplicación de AE incrementó significativamente (p < 0,05 los compuestos fenólicos y la actividad antioxidante en los tratamientos T2, T3, T4, T5 y T6. Sin embargo, este incremento se redujo drásticamente después de 9 días de almacenamiento, obteniéndose una actividad antioxidante del 32,1 y 35,2 % (respecto al inicio en los tratamientos T6 y T4, respectivamente. Las bacterias aerobias mesófilas se inhibieron durante 3 días en las rodajas de manzana sumergidas en solución T1, mientras que después de 9 días las que presentaron la menor carga de bacterias fueron las rodajas de manzana sumergidas en T2 y T5. Los mohos y levaduras se inhibieron en los tratamientos T1, T2 y T5. Las rodajas de manzana con mayor aceptación sensorial por parte de los jueces fueron las de los tratamientos T4, T6 y T7 al inicio del almacenamiento y de los tratamientos T4, T5 y T6 después de 6 días.

  4. Predisposição de macieiras (Malus domestica Borkh.) com infecções virais a Cryptosporiopsis perennans (Zeller & Childs) Wollenweber em frutos e Colletotrichum gloeosporioides (Penzig. & Sacc. em folhas

    OpenAIRE

    Denis Salvati Guerra

    2007-01-01

    A cultura da macieira no Brasil ocupa cerca de 35 mil hectares com uma produção que chega, em alguns anos, a 1 milhão de toneladas. Dentre os principais vírus que infectam as plantas estão os chamados latentes Apple stem grooving virus (ASGV), Apple chlorotic leaf spot virus (ACLSV) e Apple stem pitting virus (ASPV) como também o Apple mosaic virus (ApMV). Atualmente, entre as doenças fúngicas mais importantes estão à podridão de olho de boi causadas por Cryptosporiopsis perennans e a mancha ...

  5. Serpins in fruit and vegetative tissues of apple (Malus domestica): expression of four serpins with distinct reactive centres and characterisation of a major inhibitory seed form, MdZ1b

    DEFF Research Database (Denmark)

    Hejgaard, Jørn; Laing, W.A.; Marttila, S.

    2005-01-01

    in a wide variety of tissues, including developing and mature fruits, seeds and vegetative buds as well as developing, mature and senescing leaves. Analysis of 46 sequences, most full-length, identified serpins with four distinct reactive centres belonging to two subfamilies (MdZ1 and MdZ2) with similar...

  6. In situ net N mineralisation and nitrification under organic and conventionally managed olive oil orchards

    DEFF Research Database (Denmark)

    Gomez Muñoz, Beatriz; Hinojosa, M. B.; García-Ruiz, R.

    2015-01-01

    Olive oil orchard occupies a great percentage of the cropland in southern Spain. Thus, changes in nitrogen (N) fertilization might have a great effect on N dynamics at least at regional scale, which should be investigated for a sustainable N fertilization program. In situ net N mineralization (NM......) and nitrification (NN) were investigated during a year in comparable organic (OR) and conventional (CV) olive oil orchards of two locations differing their N input. Soil samples were collected in two soil positions (under and between trees canopy) and both buried-bags and soil core techniques were used to quantify...... soil TN. Soil TN and PMN explained together a 50 % of the variability in soil N availability, which suggests that these two variables are good predictors of the potential of a soil to provide available N. The highest rates of soil N availability were found in spring, when olive tree demand for N...

  7. SEPERATION OF COST AND EXPENDITURES IN ORCHARDS AND THE ADVANTAGES OF COST ACCOUNTING

    Directory of Open Access Journals (Sweden)

    Ali Deran

    2013-07-01

    Full Text Available Strategic importance of agriculture sector has been increased by the recent developments in economics as well as changes in climate and accordingly the capital flow to the sector has increased. Today, it is well known that owners of large capitals have been invested on orchards. In the world and Turkey, international companies run many orchards in different countries at the same time. Many of these companies’ shares operated in stock exchange markets. In this context of these developments, the importance of agriculture accounting for agriculture and especially cost agriculture for agriculture has been increased. Furthermore, this importance is expected to increase in accordance with the process of world markets and Turkey’s accession process to European Union. In this study, cost and expenditure which are the main concepts of agricultural cost accounting and their advantages will be discussed.

  8. Pesticide residues in orange fruit from citrus orchards in Nuevo Leon State, Mexico.

    Science.gov (United States)

    Suárez-Jacobo, Angela; Alcantar-Rosales, Victor Manuel; Alonso-Segura, Diana; Heras-Ramírez, Maria; Elizarragaz-De La Rosa, Dalau; Lugo-Melchor, Ofelia; Gaspar-Ramirez, Octavio

    2017-09-01

    Some international organisations established maximum residue limits (MRLs) in food to protect human health. Mexico lacks regulations in this matter, affecting national and international trade from agroindustry. The aim of this study was to diagnose pesticide residues in oranges from Nuevo Leon, México, in citrus orchards. In May 2014, 100 orange fruit samples were taken randomly from orchards and subjected to analysis for 93 pesticides at residual level by GC/QQQ-MS and LCQ-TOF-MS. Results showed the presence of 15 pesticide residues in the samples. The comparison of the residual levels of pesticides found in orange samples among the MRLs allowed by USA, EU and Japanese regulations demonstrated that all samples were below MRLs issued by USA and Japan. Some orange samples were above MRLs issued by the EU. This provides a basis to establish strategies in order to satisfy International Standards to protect human health and encourage Food Safety in Mexico.

  9. Soil erosion as a consequence of wildfires on recently abandoned citrus orchards in eastern Spain

    Directory of Open Access Journals (Sweden)

    A.Cerdà

    2013-05-01

    Full Text Available Fire is a natural factor in the evolution of Earth ecosystems. Due to land abandonment wildfire are widespread in Mediterranean Type Ecosystems, which contribute to increase the soil erosion rates. Fire is also found in recently abandoned citrus orchards due to the quick vegetation recovery and the dry biomass found after 2 years of abandonment. Rainfall simulation experiments (1 hour at 45 mm h-1 in a plot of 0.25 m2 show that although land abandonment on irrigated citrus orchards reduces the soil losses to very low values, the fire increase runoff and soil erosion. Water and soil losses are much lower in the fire-affected plots than on the cultivated ones due to the use of herbicides.

  10. Outcrossing rates in a natural stand and in a seed orchard of Pinus peuce

    Directory of Open Access Journals (Sweden)

    P. Zhelev

    2013-12-01

    Full Text Available The mating system parameters were studied in a natural stand and in a seed orchard of the Balkan endemic, Pinus peuce Griseb. bymeans of isozyme gene markers. The results indicate that the multilocus estimates of the outcrossing rates are low relative to otherwidespread conifers but concord to these reported for other pine species with limited area of distribution. No significant differenceswere detected between the natural stand and the seed orchard estimates. Multilocus estimates of outcrossing rate were within the range0.77-0.79, while mean single-locus estimates were lower (0.69-0.73. The results indicate that at least 20% of the progeny of Pinus peuceis due to self-fertilization. Possible reasons for the results observed and the implications for tree breeding and gene conservation are discussed.

  11. Acorn fall and weeviling in a northern red oak seedling orchard

    Science.gov (United States)

    Daniel R. Miller; Scott E. Schlarbaum

    2005-01-01

    In 2000, we determined levels of damage by acorn weevils (Curculio spp.) and patterns of acorn fall in a northern red oak (Quercus rubra L.) seedling orchard in eastern Tennessee. The mean (±SE) production of acorns among 43 selected trees was 5,930 ± 586 acorns per tree with a maximum production level of 16,969 acorns for one tree...

  12. Fault-tolerant 3D Mapping with Application to an Orchard Robot

    DEFF Research Database (Denmark)

    Blas, Morten Rufus; Blanke, Mogens; Rusu, Radu Bogan

    2009-01-01

    In this paper we present a geometric reasoning method for dealing with noise as well as faults present in 3D depth maps. These maps are acquired using stereo-vision sensors, but our framework makes no assumption about the origin of the underlying data. The method is based on observations made on ...... of comprehensive 3D maps for an agricultural robot operating in an orchard....

  13. Combining Stochastic Automata and Classication Techniques for Supervision and Safe Orchard Navigation

    DEFF Research Database (Denmark)

    Caponetti, Fabio; Blanke, Mogens

    2009-01-01

    Cost drivers in commercial orchards are time-consuming tasks as the drive through rows for spraying, cutting grass or collecting fruit. An automated tractor can be an answer to enhance production efficiency. For this to be acceptable by public and authorities, safety and reliability are crucial...... estimate relying only on laser perception. Results demonstrate the feasibility of implementation in an autonomous tractor that use diagnosis and active fault-tolerant control to enhance availability and safety...

  14. THE PRODUCTION COSTS OF CONVENTIONAL AND ORGANIC APPLE ORCHARDS IN THE VENETO REGION (ITALY)

    OpenAIRE

    CIMPAN Oana; BEGALLI Diego; CODURRI Stefano

    2012-01-01

    In times of crisis people are thinking how to make the best choice to be more profitable. Both the manufacturers and the consumers must choose the best solutions for them and their businesses. Making a choice between organic and conventional methods in times of crisis is even more difficult considering production costs and consumption patterns. What is the composition of production costs for an apple orchard, how they can be divided into homogeneous categories and why to choose green are the ...

  15. Interactions between leaf macro, micronutrients and soil properties in pistachio (Pistacia vera L.) orchards

    OpenAIRE

    Koukoulakis, Prodromos; Chatzissavvidis, Christos; Papadopoulos, Aristotelis; Pontikis, Dimitrios

    2013-01-01

    The interactions between: (i) leaf dry matter macronutrients, micronutrients and soil chemical properties, (ii) leaf macro- and micronutrients, (iii) soil macro- and micronutrients and (iv) soil chemical properties, and soil micro- and macronutrients in 50 pistachio orchards were investigated in leaves and soils by means of regression analysis. Most of the soils were deficient in plant-available P, Zn, Mn, Fe, and B, while they were excessively supplied with Cu. Leaf analysis showed that most...

  16. The Inventory of Phytoseiid Mite on Apple Orchards in Durrës, Albania

    OpenAIRE

    AURELA SUPARAKU; ARIS HUQI; NATASHA HAKA (DURAJ)

    2014-01-01

    A survey to determine the presence and abundance of phytoseiid mite on apple orchards has been conducted in Durres (Shena-Vlash), Albania. Leaf samples were taken from five apple varieties: Pink Lady, Golden, Starking, Fuji, Gala and the phytoseiid were then extracted. As the result of the survey, two species belonging to the Phytoseiidae family were identified: Amblyseius andersoni (Chant) and Typhlodromus pyri (Scheuten). Amblyseius andersoni was found in all apple varieties analyzed in thi...

  17. Geostatistical interpolation of available copper in orchard soil as influenced by planting duration.

    Science.gov (United States)

    Fu, Chuancheng; Zhang, Haibo; Tu, Chen; Li, Lianzhen; Luo, Yongming

    2018-01-01

    Mapping the spatial distribution of available copper (A-Cu) in orchard soils is important in agriculture and environmental management. However, data on the distribution of A-Cu in orchard soils is usually highly variable and severely skewed due to the continuous input of fungicides. In this study, ordinary kriging combined with planting duration (OK_PD) is proposed as a method for improving the interpolation of soil A-Cu. Four normal distribution transformation methods, namely, the Box-Cox, Johnson, rank order, and normal score methods, were utilized prior to interpolation. A total of 317 soil samples were collected in the orchards of the Northeast Jiaodong Peninsula. Moreover, 1472 orchards were investigated to obtain a map of planting duration using Voronoi tessellations. The soil A-Cu content ranged from 0.09 to 106.05 with a mean of 18.10 mg kg -1 , reflecting the high availability of Cu in the soils. Soil A-Cu concentrations exhibited a moderate spatial dependency and increased significantly with increasing planting duration. All the normal transformation methods successfully decreased the skewness and kurtosis of the soil A-Cu and the associated residuals, and also computed more robust variograms. OK_PD could generate better spatial prediction accuracy than ordinary kriging (OK) for all transformation methods tested, and it also provided a more detailed map of soil A-Cu. Normal score transformation produced satisfactory accuracy and showed an advantage in ameliorating smoothing effect derived from the interpolation methods. Thus, normal score transformation prior to kriging combined with planting duration (NSOK_PD) is recommended for the interpolation of soil A-Cu in this area.

  18. Does Passive Sampling Accurately Reflect the Bee (Apoidea: Anthophila) Communities Pollinating Apple and Sour Cherry Orchards?

    Science.gov (United States)

    Gibbs, Jason; Joshi, Neelendra K; Wilson, Julianna K; Rothwell, Nikki L; Powers, Karen; Haas, Mike; Gut, Larry; Biddinger, David J; Isaacs, Rufus

    2017-06-01

    During bloom of spring orchard crops, bees are the primary providers of pollination service. Monitoring these insects for research projects is often done by timed observations or by direct aerial netting, but there has been increasing interest in blue vane traps as an efficient passive approach to collecting bees. Over multiple spring seasons in Michigan and Pennsylvania, orchards were monitored for wild bees using timed netting from crop flowers and blue vane traps. This revealed a distinctly different community of wild bees captured using the two methods, suggesting that blue vane traps can complement but cannot replace direct aerial netting. The bee community in blue vane traps was generally composed of nonpollinating species, which can be of interest for broader biodiversity studies. In particular, blue vane traps caught Eucera atriventris (Smith), Eucera hamata (Bradley), Bombus fervidus (F.), and Agapostemon virescens (F.) that were never collected from the orchard crop flowers during the study period. Captures of bee species in nets was generally stable across the 3 yr, whereas we observed significant declines in the abundance of Lasioglossum pilosum (Smith) and Eucera spp. trapped using blue vane traps during the project, suggesting local overtrapping of reproductive individuals. We conclude that blue vane traps are a useful tool for expanding insights into bee communities within orchard crop systems, but they should be used with great caution to avoid local extirpation of these important insects. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Energy consumption in the management of avocado orchards in Michoacán, Mexico

    OpenAIRE

    Anaya, Carlos A.; Burgos, Ana Laura

    2015-01-01

    Efficient fossil energy consumption in agricultural systems is a prerequisite for sustainable agricultural production. Fossil energy consumption (EC) in avocado orchard production in Michoacán, Mexico was analyzed. Process analysis was used to estimate both direct and indirect energy required for the various agricultural operations. Data on fuel and inputs used in production were obtained from structured questionnaires completed by 455 growers. Average annual EC was 28,880 MJ∙ha-1, but the da...

  20. Are biodiversity indices of spontaneous grass covers in olive orchards good indicators of soil degradation?

    Science.gov (United States)

    Taguas, E. V.; Arroyo, C.; Lora, A.; Guzmán, G.; Vanderlinden, K.; Gómez, J. A.

    2015-03-01

    Spontaneous grass covers are an inexpensive soil erosion control measure in olive orchards. Olive farmers allow grass to grow on sloping terrain to comply with the basic environmental standards derived from the Common Agricultural Policy (CAP). However, to date there are very few studies assessing the environmental quality and extent of such covers. In this study, we described and compared the biodiversity indicators associated to herbaceous vegetation in two contrasting olive orchards in order to evaluate its relevance and quality. In addition, biodiversity patterns and their relationships with environmental factors such as soil type and properties, precipitation, topography and soil management were analyzed. Different grass cover biodiversity indices were evaluated in two olive orchard catchments under conventional tillage and no tillage with grass cover, during 3 hydrological years (2011-2013). Seasonal samples of vegetal material and pictures in a permanent grid (4 samples ha-1) were taken to characterize the temporal variations of the number of species, frequency, diversity and transformed Shannon's and Pielou's indices. Sorensen's index obtained in the two olive orchard catchments showed notable differences in composition, probably linked with the different site conditions. The catchment with the best site conditions (deeper soil and higher precipitation), with average annual soil losses over 10 t ha-1 and a more intense management, presented the highest biodiversity indices. In absolute terms, the diversity indices were reasonably high in both catchments, despite the fact that agricultural activity usually severely limits the landscape and the variety of species. Finally, a significantly higher content of organic matter in the first 10 cm of soil was found in the catchment with the worst site conditions, average annual soil losses of 2 t ha-1 and the least intense management. Therefore, the biodiversity indicators associated to weeds were not found to be

  1. Short communication. Harvest time in hedgerow Arbequina olive orchards in areas with early frosts

    Energy Technology Data Exchange (ETDEWEB)

    Gracia, P.; Sanchez-Gimeno, A. C.; Benito, M.; Oria, R.; Lasa, J. M.

    2012-11-01

    The shortening of harvest time attained in hedgerow olive (Olea europaea L.) orchards represents an advantage for the adoption of this cropping system in areas that are prone to suffer frost during the harvest period. To establish an optimal harvesting window, we carried out a study of the fruit ripening process on a hedgerow orchard of Arbequina olive trees, located in Zaragoza (Spain). From 2007 to 2009, oil accumulation on the fruit (% of dry weight) and oil yield (grams of oil per 100 fruits) were monitored, from early September to late November. Over the three years both variables peaked around November 15th, indicating that Arbequina reached full ripening earlier than has been reported previously for this variety. In two of the three seasons the orchard suffered several frosts during November. Long term climatic data from this area indicated that the risk of early frosts (< -2 degree centigrade) increases as November progresses with a high risk after November 20{sup t}h. In conclusion, the optimal harvesting period for Arbequina in this area should not extend beyond November 20{sup t}h. A rapid harvesting before this date is advisable to avoid the risk of damage caused by early frost in Zaragoza. Hedgerow planting provides an additional advantage in frost-prone areas, because mechanization of operations permits a short harvest period, easier to fit into the optimal harvesting window. (Author) 20 refs.

  2. Several New Aspects of the Foraging Behavior of Osmia cornifrons in an Apple Orchard

    Directory of Open Access Journals (Sweden)

    Shogo Matsumoto

    2010-01-01

    Full Text Available We investigated the foraging behavior of Osmia cornifrons Radoszkowski, which is a useful pollinator in apple orchards consisting of only one kind of commercial cultivars such as “Fuji”, and of different types of pollinizers, such as the red petal type, “Maypole” or “Makamik”. It was confirmed that, in terms of the number of foraging flowers per day, visiting flowers during low temperatures, strong wind, and reduced sunshine in an apple orchard, O. cornifrons were superior to honeybees. We indicated that O. cornifrons seemed to use both petals and anthers as foraging indicator, and that not only female, but also males contributed to apple pollination and fertilization by the pollen grains attached to them from visiting flowers, including those at the balloon stage. It was confirmed that O. cornifrons acts as a useful pollinator in an apple orchard consisting of one kind of cultivar with pollinizers planted not more than 10 m from commercial cultivars.

  3. Cadmium contamination in orchard soils and fruit trees and its potential health risk in Guangzhou, China.

    Science.gov (United States)

    Li, J T; Qiu, J W; Wang, X W; Zhong, Y; Lan, C Y; Shu, W S

    2006-09-01

    This study examines cadmium (Cd) contamination in orchard soils and fruit trees in Guangzhou, China, and assesses its potential health risk. Soils and tissues samples of three species of fruit trees were collected from three orchards. The average soil Cd concentration was 1.27, 1.84 and 0.68 mg/kg in orchards I, II, and III, respectively. The carambola (Averrhoa carambola) accumulated exceptionally high concentrations of Cd (7.57, 10.84, 9.01 and 2.15 mg/kg dw in root, twig, leaf and fruit, respectively), being 6.0-24 times and 4.0-10 times the corresponding tissue Cd in the longan (Dimocarpus longan) and wampee (Clausena lansium), respectively. Furthermore, all Cd concentrations (0.04-0.25 mg Cd/kg fw) of the fruits exceeded the tolerance limit of cadmium in foods of PR China (0.03 mg/kg fw). Our results indicate that the carambola tree has high Cd accumulation capacity and might be a Cd accumulator; and its fruit, among the three species of fruits studied, also poses the highest potential health risk to local residents.

  4. Cadmium contamination in orchard soils and fruit trees and its potential health risk in Guangzhou, China

    Energy Technology Data Exchange (ETDEWEB)

    Li, J.T. [School of Life Sciences and State Key Laboratory of Biocontrol, Sun Yat-sen (Zhongshan) University, Guangzhou 510275 (China); Qiu, J.W. [Department of Biology, Hong Kong Baptist University, Kowloon, Hong Kong (China); Wang, X.W. [School of Life Sciences and State Key Laboratory of Biocontrol, Sun Yat-sen (Zhongshan) University, Guangzhou 510275 (China); Zhong, Y. [School of Life Sciences and State Key Laboratory of Biocontrol, Sun Yat-sen (Zhongshan) University, Guangzhou 510275 (China); Lan, C.Y. [School of Life Sciences and State Key Laboratory of Biocontrol, Sun Yat-sen (Zhongshan) University, Guangzhou 510275 (China)]. E-mail: ls04@zsu.edu.cn; Shu, W.S. [School of Life Sciences and State Key Laboratory of Biocontrol, Sun Yat-sen (Zhongshan) University, Guangzhou 510275 (China)]. E-mail: ls53@zsu.edu.cn

    2006-09-15

    This study examines cadmium (Cd) contamination in orchard soils and fruit trees in Guangzhou, China, and assesses its potential health risk. Soils and tissues samples of three species of fruit trees were collected from three orchards. The average soil Cd concentration was 1.27, 1.84 and 0.68 mg/kg in orchards I, II, and III, respectively. The carambola (Averrhoa carambola) accumulated exceptionally high concentrations of Cd (7.57, 10.84, 9.01 and 2.15 mg/kg dw in root, twig, leaf and fruit, respectively), being 6.0-24 times and 4.0-10 times the corresponding tissue Cd in the longan (Dimocarpus longan) and wampee (Clausena lansium), respectively. Furthermore, all Cd concentrations (0.04-0.25 mg Cd/kg fw) of the fruits exceeded the tolerance limit of cadmium in foods of PR China (0.03 mg/kg fw). Our results indicate that the carambola tree has high Cd accumulation capacity and might be a Cd accumulator; and its fruit, among the three species of fruits studied, also poses the highest potential health risk to local residents. - Carambola fruit can accumulate high levels of cadmium and may be a health risk for humans.

  5. A Computational Model for Path Loss in Wireless Sensor Networks in Orchard Environments

    Directory of Open Access Journals (Sweden)

    Hristos T. Anastassiu

    2014-03-01

    Full Text Available A computational model for radio wave propagation through tree orchards is presented. Trees are modeled as collections of branches, geometrically approximated by cylinders, whose dimensions are determined on the basis of measurements in a cherry orchard. Tree canopies are modeled as dielectric spheres of appropriate size. A single row of trees was modeled by creating copies of a representative tree model positioned on top of a rectangular, lossy dielectric slab that simulated the ground. The complete scattering model, including soil and trees, enhanced by periodicity conditions corresponding to the array, was characterized via a commercial computational software tool for simulating the wave propagation by means of the Finite Element Method. The attenuation of the simulated signal was compared to measurements taken in the cherry orchard, using two ZigBee receiver-transmitter modules. Near the top of the tree canopies (at 3 m, the predicted attenuation was close to the measured one—just slightly underestimated. However, at 1.5 m the solver underestimated the measured attenuation significantly, especially when leaves were present and, as distances grew longer. This suggests that the effects of scattering from neighboring tree rows need to be incorporated into the model. However, complex geometries result in ill conditioned linear systems that affect the solver’s convergence.

  6. Cadmium contamination in orchard soils and fruit trees and its potential health risk in Guangzhou, China

    International Nuclear Information System (INIS)

    Li, J.T.; Qiu, J.W.; Wang, X.W.; Zhong, Y.; Lan, C.Y.; Shu, W.S.

    2006-01-01

    This study examines cadmium (Cd) contamination in orchard soils and fruit trees in Guangzhou, China, and assesses its potential health risk. Soils and tissues samples of three species of fruit trees were collected from three orchards. The average soil Cd concentration was 1.27, 1.84 and 0.68 mg/kg in orchards I, II, and III, respectively. The carambola (Averrhoa carambola) accumulated exceptionally high concentrations of Cd (7.57, 10.84, 9.01 and 2.15 mg/kg dw in root, twig, leaf and fruit, respectively), being 6.0-24 times and 4.0-10 times the corresponding tissue Cd in the longan (Dimocarpus longan) and wampee (Clausena lansium), respectively. Furthermore, all Cd concentrations (0.04-0.25 mg Cd/kg fw) of the fruits exceeded the tolerance limit of cadmium in foods of PR China (0.03 mg/kg fw). Our results indicate that the carambola tree has high Cd accumulation capacity and might be a Cd accumulator; and its fruit, among the three species of fruits studied, also poses the highest potential health risk to local residents. - Carambola fruit can accumulate high levels of cadmium and may be a health risk for humans

  7. Design development and testing of a solar PV pump based drip system for orchards

    Energy Technology Data Exchange (ETDEWEB)

    Pande, P.C.; Singh, A.K.; Ansari, S.; Vyas, S.K.; Dave, B.K. [Central Arid Zone Research Inst., Jodhpur (India)

    2003-03-01

    A Solar Photovoltaic (PV) pump operated drip irrigation system has been designed and developed for growing orchards in arid region considering different design parameters like pumps size, water requirements, the diurnal variation in the pressure of the pump due to change in irradiance and pressure compensation in the drippers. The system comprising a PV pump with 900 W{sub p} PV array and 800 W dc motor-pump mono-block, microfilter, main and sub-mains and three open-able low-pressure compensating drippers on each plant was field tested. The emission uniformity was observed to be 92-94% with discharge of 3.8 l/h in the pressure range of 70-100 kPa provided by the pump and thus the system could irrigate some 1 ha area within 2 h. Based on the performance of the PV pump and the drip system, it was inferred that about 5 ha area of orchard could be covered. The projected benefit-cost ratio for growing pomegranate orchards with such a system was evaluated to be above 2 even with the costly PV pump and therefore the system was considered to be an appropriate technology for the development of arid region. (Author)

  8. Reproductive potential of a vole pest (Arvicola scherman) in Spanish apple orchards

    Energy Technology Data Exchange (ETDEWEB)

    Somoano, A.; Miñarro, M.; Ventura, J.

    2016-07-01

    Fossorial water voles, Arvicola scherman, feed on tree roots causing important damages in European apple orchards. Since the intensity of crop damage produced by rodents ultimately depends on their inherent capacity to increase their population, the main goal of this study was to determine the reproductive potential of the subspecies A. scherman cantabriae in apple orchards from Asturias (NW Spain), where voles breed over the whole year. Our results were compared with those reported for the subspecies A. scherman monticola from the Spanish Pyrenees (where reproduction ceases in winter). Sexual characteristics, body condition, relative age class and number of embryos were recorded from 422 females caught in apple orchards along two years. We found pregnant females all along the year, which were able to produce a high number of litters per year (7.30) although litter size was relatively moderate (first year: 3.87 embryos/female; second year: 3.63 embryos/females). The potential number of pups per female and year (first year: 28.25; second year: 26.50) was substantially higher than that reported for Pyrenean voles, what is probably related with differences in the length of the breeding season and in life histories between subspecies. In our population, the number of implanted embryos correlated positively with the body condition of the mother. Our results reveal that management efforts should not be seasonal as they used to be so far and invite to explore the physiological consequences of management practices.

  9. Evaluation of Different Irrigation Methods for an Apple Orchard Using an Aerial Imaging System

    Directory of Open Access Journals (Sweden)

    Duke M. Bulanon

    2016-06-01

    Full Text Available Regular monitoring and assessment of crops is one of the keys to optimal crop production. This research presents the development of a monitoring system called the Crop Monitoring and Assessment Platform (C-MAP. The C-MAP is composed of an image acquisition unit which is an off-the-shelf unmanned aerial vehicle (UAV equipped with a multispectral camera (near-infrared, green, blue, and an image processing and analysis component. The experimental apple orchard at the Parma Research and Extension Center of the University of Idaho was used as the target for monitoring and evaluation. Five experimental rows of the orchard were randomly treated with five different irrigation methods. An image processing algorithm to detect individual trees was developed to facilitate the analysis of the rows and it was able to detect over 90% of the trees. The image analysis of the experimental rows was based on vegetation indices and results showed that there was a significant difference in the Enhanced Normalized Difference Vegetation Index (ENDVI among the five different irrigation methods. This demonstrates that the C-MAP has very good potential as a monitoring tool for orchard management.

  10. Relationships between spur- and orchard-level fruit bearing in almond (Prunus dulcis).

    Science.gov (United States)

    Tombesi, Sergio; Lampinen, Bruce D; Metcalf, Samuel; DeJong, Theodore M

    2011-12-01

    Almond is often considered to be a moderately alternate-bearing species but historical yield data typically do not exhibit clear patterns of alternate bearing at the orchard level, while research has indicated that spurs (the main fruit bearing unit in almond trees) rarely produce fruit in two subsequent years. The objective of the present work was to analyze the bearing behavior of almond trees at both the orchard level and the individual spur level over multiple years to explain this apparent paradox. The 10-year yield patterns of three almond cultivars grown at three different sites within California were analyzed for tendencies of alternate bearing at the orchard level. At the individual spur level, data on spur viability, and number of flowers and fruits per spur were collected on 2400 individually tagged spurs that were observed over 6 years to characterize bearing at that level. At the orchard level one cultivar (Nonpareil) did exhibit a tendency for alternate bearing at one site (Kern) but other cultivars and sites did not. The orchard and the individual trees in which the spur population study was conducted showed tendencies for alternate bearing but the spur population did not. Only a relatively small percentage of the total tagged spur population bore fruit in any given year and therefore while individual fruiting spurs exhibited a high level of non-bearing after fruiting the previous year the spurs that did produce fruit in any year generally did not constitute enough of the total spur population to exhibit alternate bearing at the whole population level. Our results suggest that annual bearing fluctuations in almond are probably mainly due to year-to-year variations of parameters affecting fruit set and that high rates of fruit set in a given year may involve a larger-than-normal percentage of a spur population in fruit bearing. This would limit the size of the spur population available for flowering in the subsequent year and could cause alternate

  11. Helminth-bacteria interaction in the gut of domestic pigeon Columba livia domestica.

    Science.gov (United States)

    Biswal, Debraj; Nandi, Anadi Prasad; Chatterjee, Soumendranath

    2016-03-01

    The present paper is an attempt to study the interaction between the helminth parasite and bacteria residing in the gut of domestic pigeon, Columba livia domestica. Biochemical and molecular characterization of the gut bacterial isolate were done and the isolate was identified as Staphylococcus sp. DB1 (JX442510). The interaction of Staphylococcus sp. with Cotugnia cuneata, an intestinal helminth parasite of domestic pigeon was studied on the basis of the difference between 'mean worm burden' of antibiotic treated infected pigeons and infected pigeons without any antibiotic treatment. The ANOVA and Tukey tests of the data obtained showed that antibiotic treatment reduced the mean worm burden significantly. The biochemical properties of Staphylococcus sp. DB1 (JX442510) also showed a mutualistic relationship with the physiology of C. cuneata.

  12. Unusual behavior of growing pollen tubes in the ovary of plum culture (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Đorđević Milena

    2010-01-01

    Full Text Available Unusual behavior of growing pollen tubes in different combinations of pollination was observed in the ovary of the plum (Prunus domestica L. cv 'Čačanska Lepotica'. It primarily refers to several issues, i.e. the curling up of pollen tubes within the micropyle, the growth of two pollen tubes into the nucellus of an ovule, the occurrence of a bundle above the nucellar cap and fluorescence of the part of the embryo sac containing the egg apparatus. Upon the growth of pollen tubes into the nucellus of the ovule, subsequently penetrating pollen tubes form a bundle either above the micropyle entrance or above the nucellus. Branching and bending of pollen tubes by 180o upon their growth into the micropyle was also observed.

  13. Plasticity in behavioural responses and resistance to temperature stress in Musca domestica

    DEFF Research Database (Denmark)

    Kjaersgaard, Anders; Blackenhorn, Wolf U.; Pertoldi, Cino

    2015-01-01

    , at the stressful high temperature Spanish flies flew the furthest and Danish flies the shortest distance. Neither body size nor wing loading affected flight performance, although flies with narrower wings tended to fly further (wing shape effect). Swiss flies were most active in terms of locomotor activity......Organisms can respond to and cope with stressful environments in a number of ways including behavioural, morphological and physiological adjustments. To understand the role of behavioural traits in thermal adaptations we compared heat resistance, locomotor (walking and flying) activity, flight...... performance and morphology of three European populations of Musca domestica (Diptera: Muscidae) originating from different thermal conditions (Spain, Switzerland and Denmark) at benign and stressful high temperatures. Spanish flies showed greater heat resistance than Swiss and Danish flies. Similarly...

  14. Caffeoyl glucosides from Nandina domestica inhibit LPS-induced endothelial inflammatory responses.

    Science.gov (United States)

    Kulkarni, Roshan R; Lee, Wonhwa; Jang, Tae Su; Lee, JungIn; Kwak, Soyoung; Park, Mi Seon; Lee, Hyun-Shik; Bae, Jong-Sup; Na, MinKyun

    2015-11-15

    Endothelial dysfunction is a key pathological feature of many inflammatory diseases, including sepsis. In the present study, a new caffeoyl glucoside (1) and two known caffeoylated compounds (2 and 3) were isolated from the fruits of Nandina domestica Thunb. (Berberidaceae). The compounds were investigated for their effects against lipopolysaccharide (LPS)-mediated endothelial inflammatory responses. At 20 μM, 1 and 2 inhibited LPS-induced hyperpermeability, adhesion, and migration of leukocytes across a human endothelial cell monolayer in a dose-dependent manner suggesting that 1 and 2 may serve as potential scaffolds for the development of therapeutic agents to treat vascular inflammatory disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Ophthalmomyiasis externa by Musca domestica in a case of orbital metastasis

    Directory of Open Access Journals (Sweden)

    Rose Mary Tomy

    2013-01-01

    Full Text Available Infestation of the living tissues of the eye, ocular adnexae or orbit by larvae of flies of the order Diptera is known as ophthalmomyiasis. Ophthalmomyiasis externa is a limited superficial infestation of external ocular structures such as conjunctiva and adnexae. A case of follicular carcinoma thyroid with orbital metastasis presenting as ophthalmomyiasis externa is reported. The patient presented with foul smelling ulcers of the medial and lateral orbital walls of the right eye extending into the lids and nose, teeming with maggots. Computerized Tomography (CT showed widespread bone destruction with extension into surrounding sinuses. Over 200 maggots were manually removed after immobilisation with turpentine oil instillation. Entomological examination showed it to be a case of accidental myiasis caused by the common housefly Musca domestica. The patient was managed conservatively and the ulcer cavities filled up with healthy granulation tissue. This case is presented on account of its rarity.

  16. Variation of Musca domestica L. acetylcholinesterase in Danish housefly populations

    DEFF Research Database (Denmark)

    Kristensen, Michael; Huang, Jing; Qiao, Chuan-Ling

    2006-01-01

    Anti-cholinesterase resistance is in many cases caused by modified acetylcholinesterase (MACE). A comparison was made of toxicological data and AChE activity gathered from 21 field populations and nine laboratory strains of houseflies, Musca domestica L., to elucidate the best way of generating...... data to provide advice for management strategies and gathering information for resistance risk assessment on the organophosphates azamethiphos and dimethoate and the carbamate methomyl, which have been the primary insecticides used against adult houseflies in Denmark. Cluster analysis was performed...... and > 2000 houseflies were assigned to one of three phenotypes based on total acetylcholinesterase activity as well as inhibition by azamethiphos, methomyl or omethoate. A cluster, i.e. a phenotype, with high total AChE activity and high sensitivity to azamethiphos and less sensitivity to inhibition...

  17. Biologically based machine vision: signal analysis of monopolar cells in the visual system of Musca domestica.

    Science.gov (United States)

    Newton, Jenny; Barrett, Steven F; Wilcox, Michael J; Popp, Stephanie

    2002-01-01

    Machine vision for navigational purposes is a rapidly growing field. Many abilities such as object recognition and target tracking rely on vision. Autonomous vehicles must be able to navigate in dynamic enviroments and simultaneously locate a target position. Traditional machine vision often fails to react in real time because of large computational requirements whereas the fly achieves complex orientation and navigation with a relatively small and simple brain. Understanding how the fly extracts visual information and how neurons encode and process information could lead us to a new approach for machine vision applications. Photoreceptors in the Musca domestica eye that share the same spatial information converge into a structure called the cartridge. The cartridge consists of the photoreceptor axon terminals and monopolar cells L1, L2, and L4. It is thought that L1 and L2 cells encode edge related information relative to a single cartridge. These cells are thought to be equivalent to vertebrate bipolar cells, producing contrast enhancement and reduction of information sent to L4. Monopolar cell L4 is thought to perform image segmentation on the information input from L1 and L2 and also enhance edge detection. A mesh of interconnected L4's would correlate the output from L1 and L2 cells of adjacent cartridges and provide a parallel network for segmenting an object's edges. The focus of this research is to excite photoreceptors of the common housefly, Musca domestica, with different visual patterns. The electrical response of monopolar cells L1, L2, and L4 will be recorded using intracellular recording techniques. Signal analysis will determine the neurocircuitry to detect and segment images.

  18. Ganancia de peso del depredador Podisus distinctus (Heteroptera: Pentatomidae en combinaciones de las presas Tenebrio molitor (Coleoptera: Tenebrionidae y Musca domestica (Diptera: Muscidae

    Directory of Open Access Journals (Sweden)

    Fausto da Costa Matos Neto

    2004-03-01

    Full Text Available Entre las ninfas de los asopíneos usados para el control de gusanos desfoliadores en plantaciones de eucalipto, Podisus distinctus (Stal (Heteroptera: Pentatomidae representa un potencial agente de control biológico, sin embargo esta especie ha sido poco estudiada. El presente trabajo evaluó el efecto de las diferentes combinaciones de las presas Musca domestica L. (Diptera: Muscidae y Tenebrio molitor L. (Coleoptera: Tenebrionidae sobre el peso de ninfas de P. distinctus. El experimento se realizó en laboratorio do "Instituto de Biotecnologia Aplicada à Agropecuaria (BIOAGRO", a 25 ± 0.5ºC, 60 ± 10% de humedad relativa y 14 horas de fotoperiodo. Las ninfas de P. distinctus fueron individualizadas en cajas de Petri y alimentadas de acuerdo con los siguientes tratamientos: T1- larvas de M. domestica durante toda la fase ninfal; T2- larvas de M. domestica en el II estadio y de T. molitor en los III, IV y V estadios; T3- larvas de M. domestica en el II y III estadios y de T. molitor en los IV y V estadios; T4- larvas de M. domestica en el II, III y IV estadios y de T. molitor en el V estadio; T5- larvas de T. molitor en todos los estadios. Los mejores resultados de peso y ganancia de peso fueron encontrados cuando P. distinctus fue alimentado alternadamente con larvas de M. domestica y T. molitor. Cuando esse depredador fue solamente alimentado con larvas de M. domestica, presentó pesos menoresLitlle is known about Podisus distinctus (Stal (Heteroptera: Pentatomidae one of the Asopinae species with good possibilities for mass rearing and releasing against defoliator caterpillars in eucalyptus reforested areas in Brazil. We evaluated the impact of prey combinations on weight of nymphs and adults of P. distinctus. The prey were Musca domestica L. (Diptera: Muscidae and Tenebrio molitor L. (Coleoptera: Tenebrionidae. The experiment was developed under 25 ± 0.5ºC, 60 ± 10% R.H. and photophase of 14 hr, with nymphs of P. distinctus

  19. The effects of sex-ratio and density on locomotor activity in the house fly, Musca domestica

    DEFF Research Database (Denmark)

    Bahrndorff, Simon; Kjaersgaard, Anders; Pertoldi, Cino

    2012-01-01

    Although locomotor activity is involved in almost all behavioral traits, there is a lack of knowledge on what factors affect it. This study examined the effects of sex-ratio and density on the circadian rhythm of locomotor activity of adult Musca domestica L. (Diptera: Muscidae) using an infra......-red light system. Sex-ratio significantly affected locomotor activity, increasing with the percentage of males in the vials. In accordance with other studies, males were more active than females, but the circadian rhythm of the two sexes was not constant over time and changed during the light period...... of the behavioral interactions between houseflies and highlight the importance of these factors when designing behavioral experiments using M. domestica....

  20. Efficacy and safety of Curcuma domestica extracts compared with ibuprofen in patients with knee osteoarthritis: a multicenter study

    Directory of Open Access Journals (Sweden)

    Kuptniratsaikul V

    2014-03-01

    Full Text Available Vilai Kuptniratsaikul,1 Piyapat Dajpratham,1 Wirat Taechaarpornkul,2 Montana Buntragulpoontawee,3 Pranee Lukkanapichonchut,4 Chirawan Chootip,5 Jittima Saengsuwan,6 Kesthamrong Tantayakom,7 Supphalak Laongpech8 1Department of Rehabilitation Medicine, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok, Thailand; 2Sirindhorn National Medical Rehabilitation Center, Ministry of Public Health, Nonthaburi, Thailand; 3Department of Rehabilitation Medicine, Faculty of Medicine, Chiang Mai University, Chiang Mai, Thailand; 4Department of Rehabilitation Medicine, Ratchaburi Hospital, Ministry of Public Health, Ratchaburi, Thailand; 5Department of Rehabilitation Medicine, Songkhla Hospital, Ministry of Public Health, Songkhla, Thailand; 6Department of Rehabilitation Medicine, Faculty of Medicine, Khon Kaen University, Khon Kaen, Thailand; 7Department of Rehabilitation Medicine, Rajvithi Hospital, Ministry of Public Health, Bangkok, Thailand; 8Department of Rehabilitation Medicine, Vachira Phuket Hospital, Ministry of Public Health, Phuket, Thailand Objective: To determine the efficacy and safety of Curcuma domestica extracts in pain reduction and functional improvement. Methods: 367 primary knee osteoarthritis patients with a pain score of 5 or higher were randomized to receive ibuprofen 1,200 mg/day or C. domestica extracts 1,500 mg/day for 4 weeks. The main outcomes were Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC total, WOMAC pain, WOMAC stiffness, and WOMAC function scores. Adverse events (AEs were also recorded. Results: 185 and 182 patients were randomly assigned into C. domestica extracts and ibuprofen groups, respectively. The baseline characteristics were no different between groups. The mean of all WOMAC scores at weeks 0, 2, and 4 showed significant improvement when compared with the baseline in both groups. After using the noninferiority test, the mean difference (95% confidence interval of WOMAC total

  1. Stability in and correlation between factors influencing genetic quality of seed lots in seed orchard of Pinus tabuliformis Carr. over a 12-year span.

    Directory of Open Access Journals (Sweden)

    Wei Li

    Full Text Available Coniferous seed orchards require a long period from initial seed harvest to stable seed production. Differential reproductive success and asynchrony are among the main factors for orchard crops year-to-year variation in terms of parental gametic contribution and ultimately the genetic gain. It is fundamental in both making predictions about the genetic composition of the seed crop and decisions about orchard roguing and improved seed orchard establishment. In this paper, a primary Chinese pine seed orchard with 49 clones is investigated for stability, variation and correlation analysis of factors which influence genetic quality of the seed lots from initial seed harvest to the stable seed production over a 12 years span. Results indicated that the reproductive synchrony index of pollen shedding has shown to be higher than that of the strobili receptivity, and both can be drastically influenced by the ambient climate factors. Reproductive synchrony index of the clones has certain relative stability and it could be used as an indication of the seed orchard status during maturity stage; clones in the studied orchard have shown extreme differences in terms of the gametic and genetic contribution to the seed crop at the orchard's early production phase specifically when they severe as either female or male parents. Those differences are closely related to clonal sex tendency at the time of orchard's initial reproduction. Clonal gamete contribution as male and female parent often has a negative correlation. Clone utilization as pollen, seed or both pollen and seed donors should consider the role it would play in the seed crop; due to numerous factors influencing on the mating system in seed orchards, clonal genetic contribution as male parent is uncertain, and it has major influence on the genetic composition in the seed orchard during the initial reproductive and seed production phase.

  2. Acetylcholinesterase activity in the terrestrial snail Xeropicta derbentina transplanted in apple orchards with different pesticide management strategies

    Energy Technology Data Exchange (ETDEWEB)

    Mazzia, Christophe, E-mail: christophe.mazzia@univ-avignon.f [Universite d' Avignon et des Pays de Vaucluse, Laboratoire de Toxicologie Environnementale, UMR 406 UAPV/INRA, ' Abeilles et Environnement' , Domaine St Paul, Site Agroparc, 84914 Avignon Cedex 9 France (France); Capowiez, Yvan [INRA, UR 1115 ' Plante et Systemes Horticoles' , Domaine St Paul, Site Agroparc, 84914 Avignon Cedex 9 France (France); Sanchez-Hernandez, Juan C. [Laboratory of Ecotoxicology, Faculty of Environmental Science, University of Castilla-La Mancha, Avda. Carlos III s/n, 45071 Toledo (Spain); Koehler, Heinz-R. [Animal Physiological Ecology, Institute for Evolution and Ecology, University of Tuebingen, Konrad-Adenauer-Str. 20, D-72072 Tuebingen (Germany); Triebskorn, Rita [Animal Physiological Ecology, Institute for Evolution and Ecology, University of Tuebingen, Konrad-Adenauer-Str. 20, D-72072 Tuebingen (Germany); Steinbeis-Transfer Center for Ecotoxicology and Ecophysiology, Blumenstrasse 13, D-72108 Rottenburg (Germany); Rault, Magali [Universite d' Avignon et des Pays de Vaucluse, Laboratoire de Toxicologie Environnementale, UMR 406 UAPV/INRA, ' Abeilles et Environnement' , Domaine St Paul, Site Agroparc, 84914 Avignon Cedex 9 France (France)

    2011-01-15

    Apple orchards are highly manipulated crops in which large amounts of pesticides are used. Some of these pesticides lack target specificity and can cause adverse effects in non-target organisms. In order to evaluate the environmental risk of these products, the use of transplanted sentinel organisms avoids side-effects from past events and facilitate comparison of multiple sites in a short time. We released specimens of the terrestrial snail Xeropicta derbentina in each 5 of two kinds of apple orchards with either conventional or organic management strategies plus in a single abandoned orchard. After one month, individuals were retrieved in order to measure acetylcholinesterase (AChE) activity. Mean values of AChE activity were significantly reduced in all conventional apple orchards compared to the others. Results show that the measurement of biomarkers such as AChE inhibition in transplated X. derbentina could be useful in the environmental risk assessment of post-authorized pesticides. - Snails as sentinel species to evaluate insecticide impacts in apple orchards.

  3. Acetylcholinesterase activity in the terrestrial snail Xeropicta derbentina transplanted in apple orchards with different pesticide management strategies

    International Nuclear Information System (INIS)

    Mazzia, Christophe; Capowiez, Yvan; Sanchez-Hernandez, Juan C.; Koehler, Heinz-R.; Triebskorn, Rita; Rault, Magali

    2011-01-01

    Apple orchards are highly manipulated crops in which large amounts of pesticides are used. Some of these pesticides lack target specificity and can cause adverse effects in non-target organisms. In order to evaluate the environmental risk of these products, the use of transplanted sentinel organisms avoids side-effects from past events and facilitate comparison of multiple sites in a short time. We released specimens of the terrestrial snail Xeropicta derbentina in each 5 of two kinds of apple orchards with either conventional or organic management strategies plus in a single abandoned orchard. After one month, individuals were retrieved in order to measure acetylcholinesterase (AChE) activity. Mean values of AChE activity were significantly reduced in all conventional apple orchards compared to the others. Results show that the measurement of biomarkers such as AChE inhibition in transplated X. derbentina could be useful in the environmental risk assessment of post-authorized pesticides. - Snails as sentinel species to evaluate insecticide impacts in apple orchards.

  4. The Effects of Sex-Ratio and Density on Locomotor Activity in the House Fly, Musca domestica

    OpenAIRE

    Bahrndorff, Simon; Kjærsgaard, Anders; Pertoldi, Cino; Loeschcke, Volker; Schou, Toke M.; Skovgård, Henrik; Hald, Birthe

    2012-01-01

    Although locomotor activity is involved in almost all behavioral traits, there is a lack of knowledge on what factors affect it. This study examined the effects of sex-ratio and density on the circadian rhythm of locomotor activity of adult Musca domestica L. (Diptera: Muscidae) using an infra-red light system. Sex-ratio significantly affected locomotor activity, increasing with the percentage of males in the vials. In accordance with other studies, males were more active than females, but th...

  5. Mortality Due to Porcine Reproductive and Respiratory Syndrome Virus in Immunocompromised G?ttingen Minipigs (Sus scrofa domestica)

    OpenAIRE

    Pils, Marina C; Dreckmann, Karla; Jansson, Katharina; Glage, Silke; Held, Nadine; Sommer, Wiebke; L?nger, Florian; Avsar, Murat; Warnecke, Gregor; Bleich, Andr?

    2016-01-01

    Porcine reproductive and respiratory syndrome virus (PRRSV) infection was diagnosed in 6 G?ttingen minipigs (Sus scrofa domestica) with severe interstitial pneumonia. The virus was defined as a North American (NA) subtype virus, which is common in the commercial pig population and might be derived from a widely used attenuated live-virus vaccine in Europe. The ORF5 sequence of the isolated PRRSV was 98% identical to the vaccine virus. The affected pigs were part of a lung transplantation mode...

  6. The effects of exogenous hormones on rooting process and the activities of key enzymes of Malus hupehensis stem cuttings.

    Science.gov (United States)

    Zhang, Wangxiang; Fan, Junjun; Tan, Qianqian; Zhao, Mingming; Zhou, Ting; Cao, Fuliang

    2017-01-01

    Malus hupehensis is an excellent Malus rootstock species, known for its strong adverse-resistance and apomixes. In the present study, stem cuttings of M. hupehensis were treated with three types of exogenous hormones, including indole acetic acid (IAA), naphthalene acetic acid (NAA), or green growth regulator (GGR). The effects and mechanisms of exogenous hormone treatment and antioxidant enzyme activity on adventitious root formation were investigated. The results showed that the apparent morphology of the adventitious root had four stages, including root pre-emergence stage (S0), early stage of root formation (S1), massive root formation stage (S2), and later stage of root formation (S3). The suitable concentrations of the three exogenous hormones, IAA, NAA and GGR, were 100 mg·L-1, 300 mg·L-1, and 300 mg·L-1, respectively. They shortened the rooting time by 25-47.4% and increased the rooting percentages of cuttings by 0.9-1.3 times, compared with that in the control. The dispersion in S0 stage was 3.6 times of that in the S1 stage after exogenous hormone application. The earlier the third critical point (P3) appeared, the shorter the rooting time and the greater the rooting percentage of the cuttings. During rhizogenesis, the activities of three antioxidant enzymes (POD, SOD, and PPO) showed an A-shaped trend. However, peak values of enzyme activity appeared at different points, which were 9 d before the P3, P3, and the fourth critical point (P4), respectively. Exogenous hormone treatment reduced the time to reach the peak value by 18 days, although the peak values of the enzymatic activities did not significantly changed. Our results suggested that exogenous hormone treatment mainly acted during the root pre-emergence stage, accelerated the synthesis of antioxidant enzymes, reduced the rooting time, and consequently promoted root formation. The three kinds of antioxidant enzymes acted on different stages of rooting.

  7. The Effects of Sex-Ratio and Density on Locomotor Activity in the House Fly, Musca domestica

    Science.gov (United States)

    Bahrndorff, Simon; Kjærsgaard, Anders; Pertoldi, Cino; Loeschcke, Volker; Schou, Toke M.; Skovgård, Henrik; Hald, Birthe

    2012-01-01

    Although locomotor activity is involved in almost all behavioral traits, there is a lack of knowledge on what factors affect it. This study examined the effects of sex—ratio and density on the circadian rhythm of locomotor activity of adult Musca domestica L. (Diptera: Muscidae) using an infra—red light system. Sex—ratio significantly affected locomotor activity, increasing with the percentage of males in the vials. In accordance with other studies, males were more active than females, but the circadian rhythm of the two sexes was not constant over time and changed during the light period. There was also an effect of density on locomotor activity, where males at intermediate densities showed higher activity. Further, the predictability of the locomotor activity, estimated as the degree of autocorrelation of the activity data, increased with the number of males present in the vials both with and without the presence of females. Overall, this study demonstrates that locomotor activity in M. domestica is affected by sex—ratio and density. Furthermore, the predictability of locomotor activity is affected by both sex—ratio, density, and circadian rhythm. These results add to our understanding of the behavioral interactions between houseflies and highlight the importance of these factors when designing behavioral experiments using M. domestica.

  8. Estimating Evapotranspiration of an Apple Orchard Using a Remote Sensing-Based Soil Water Balance

    Directory of Open Access Journals (Sweden)

    Magali Odi-Lara

    2016-03-01

    Full Text Available The main goal of this research was to estimate the actual evapotranspiration (ETc of a drip-irrigated apple orchard located in the semi-arid region of Talca Valley (Chile using a remote sensing-based soil water balance model. The methodology to estimate ETc is a modified version of the Food and Agriculture Organization of the United Nations (FAO dual crop coefficient approach, in which the basal crop coefficient (Kcb was derived from the soil adjusted vegetation index (SAVI calculated from satellite images and incorporated into a daily soil water balance in the root zone. A linear relationship between the Kcb and SAVI was developed for the apple orchard Kcb = 1.82·SAVI − 0.07 (R2 = 0.95. The methodology was applied during two growing seasons (2010–2011 and 2012–2013, and ETc was evaluated using latent heat fluxes (LE from an eddy covariance system. The results indicate that the remote sensing-based soil water balance estimated ETc reasonably well over two growing seasons. The root mean square error (RMSE between the measured and simulated ETc values during 2010–2011 and 2012–2013 were, respectively, 0.78 and 0.74 mm·day−1, which mean a relative error of 25%. The index of agreement (d values were, respectively, 0.73 and 0.90. In addition, the weekly ETc showed better agreement. The proposed methodology could be considered as a useful tool for scheduling irrigation and driving the estimation of water requirements over large areas for apple orchards.

  9. Exposure of free-flying birds to anticholinesterase insecticides in two conventionally managed fruit orchards

    Science.gov (United States)

    Borges, S.L.

    2002-01-01

    Conventionally managed orchards receive extensive applications of anticholinesterase (anti-ChE) insecticides throughout the growing season. Because many avian species make use of these environments for nesting and foraging, they may receive substantial exposure to anti-ChEs. The model used to assess avian risk in these environments is highly simplified, and indicator species used in risk studies may misrepresent the risk of the species in the field. A better understanding of avian risk is needed, and should begin with a closer examination o# their exposure in these environments. Exposure of free-flying birds was examined in two conventional orchards during the nesting seasons of 1999 and 2000. Our goal was to demonstrate the influences of species and chemical differences on the exposure we observed. Plasma ChE activity and ChE reactivation were used to identify exposure in multiple species following anti-ChE applications (applied singly and in mixtures). Chipping sparrows (Spizella passerina), American goldfinches (Carduelis tristis), and American robins (Turdus migratorius) demonstrated significant ChE activity depression in 1999 (p 0.005), and only chipping sparrows demonstrated significant depression in 2000 (p = 0.0002). These three species demonstrated the highest proportion of exposed individuals among all species examined in both years. Because many chemicals were simultaneously present in each orchard, chemical influences on the exposure we observed could not be discerned. This work does demonstrate, however, that avian species differ significantly in their exposure, and that chipping sparrows demonstrated the greatest exposure among the species analyzed. These results underscore the need for multiple species studies and for choosing indicator species on a biologically relevant basis.

  10. Assessment of trace element accumulation by earthworms in an orchard soil remediation study using soil amendments

    Science.gov (United States)

    Centofantia, Tiziana; Chaney, Rufus L.; Beyer, W. Nelson; McConnell, Laura L.; Davis, A. P.; Jackson, Dana

    2016-01-01

    This study assessed potential bioaccumulation of various trace elements in grasses and earthworms as a consequence of soil incorporation of organic amendments for in situ remediation of an orchard field soil contaminated with organochlorine and Pb pesticide residues. In this experiment, four organic amendments of differing total organic carbon content and quality (two types of composted manure, composted biosolids, and biochar) were added to a contaminated orchard field soil, planted with two types of grasses, and tested for their ability to reduce bioaccumulation of organochlorine pesticides and metals in earthworms. The experiment was carried out in 4-L soil microcosms in a controlled environment for 90 days. After 45 days of orchardgrass or perennial ryegrass growth, Lumbricus terrestris L. were introduced to the microcosms and exposed to the experimental soils for 45 days before the experiment was ended. Total trace element concentrations in the added organic amendments were below recommended safe levels and their phytoavailablity and earthworm availability remained low during a 90-day bioremediation study. At the end of the experiment, total tissue concentrations of Cu, Cd, Mn, Pb, and Zn in earthworms and grasses were below recommended safe levels. Total concentrations of Pb in test soil were similar to maximum background levels of Pb recorded in soils in the Eastern USA (100 mg kg−1 d.w.) because of previous application of orchard pesticides. Addition of aged dairy manure compost and presence of grasses was effective in reducing the accumulation of soil-derived Pb in earthworms, thus reducing the risk of soil Pb entry into wildlife food chains.

  11. Comparative toxicities and synergism of apple orchard pesticides to Apis mellifera (L. and Osmia cornifrons (Radoszkowski.

    Directory of Open Access Journals (Sweden)

    David J Biddinger

    Full Text Available The topical toxicities of five commercial grade pesticides commonly sprayed in apple orchards were estimated on adult worker honey bees, Apis mellifera (L. (Hymenoptera: Apidae and Japanese orchard bees, Osmia cornifrons (Radoszkowski (Hymenoptera: Megachilidae. The pesticides were acetamiprid (Assail 30SG, λ-cyhalothrin (Warrior II, dimethoate (Dimethoate 4EC, phosmet (Imidan 70W, and imidacloprid (Provado 1.6F. At least 5 doses of each chemical, diluted in distilled water, were applied to freshly-eclosed adult bees. Mortality was assessed after 48 hr. Dose-mortality regressions were analyzed by probit analysis to test the hypotheses of parallelism and equality by likelihood ratio tests. For A. mellifera, the decreasing order of toxicity at LD₅₀ was imidacloprid, λ-cyhalothrin, dimethoate, phosmet, and acetamiprid. For O. cornifrons, the decreasing order of toxicity at LD₅₀ was dimethoate, λ-cyhalothrin, imidacloprid, acetamiprid, and phosmet. Interaction of imidacloprid or acetamiprid with the fungicide fenbuconazole (Indar 2F was also tested in a 1∶1 proportion for each species. Estimates of response parameters for each mixture component applied to each species were compared with dose-response data for each mixture in statistical tests of the hypothesis of independent joint action. For each mixture, the interaction of fenbuconazole (a material non-toxic to both species was significant and positive along the entire line for the pesticide. Our results clearly show that responses of A. mellifera cannot be extrapolated to responses of O.cornifrons, and that synergism of neonicotinoid insecticides and fungicides occurs using formulated product in mixtures as they are commonly applied in apple orchards.

  12. Potential Dermal Exposure to Flonicamid and Risk Assessment of Applicators During Treatment in Apple Orchards.

    Science.gov (United States)

    Zhao, Mei-Ai; Yu, Aili; Zhu, Yong-Zhe; Kim, Jeong-Han

    2015-01-01

    Exposure and risk assessments of flonicamid for applicators were performed in apple orchards in Korea. Fifteen experiments were done with two experienced applicators under typical field conditions using a speed sprayer. In this study, cotton gloves, socks, masks, and dermal patches were used to monitor potential dermal exposure to flonicamid, and personal air samplers with XAD-2 resin and glass fiber filter were used to monitor potential inhalation exposure. The analytical methods were validated for the limit of detection, limit of quantitation, reproducibility, linearity of the calibration curve, and recovery of flonicamid from various exposure matrices. The results were encouraging and acceptable for an exposure study. The applicability of XAD-2 resin was evaluated via a trapping efficiency and breakthrough test. During the mixing/loading, the average total dermal exposure was 22.6 μg of flonicamid, corresponding to 4.5×10(-5)% of the prepared amount. For the spraying, the potential dermal exposure was 9.32 mg, and the ratio to applied amount was 1.9 × 10(-2%). The primary exposed body parts were the thigh (2.90 mg), upper arm (1.75 mg), and lower leg (1.66 mg). By comparison, absorbable quantity of exposure was small, only 1.62 μg (3.2×10(-6)%). The margin of safety (MOS) were calculated for risk assessment, in all sets of trials, MOS > 1, indicating the exposure level of flonicamid was considered to be safe in apple orchards. Although this was a limited study, it provided a good estimate of flonicamid exposure for orchard applicators.

  13. Geologic map of the Orchard 7.5' quadrangle, Morgan County, Colorado

    Science.gov (United States)

    Berry, Margaret E.; Slate, Janet L.; Hanson, Paul R.; Brandt, Theodore R.

    2015-01-01

    The Orchard 7.5' quadrangle is located along the South Platte River corridor on the semi-arid plains of eastern Colorado, and contains surficial deposits that record alluvial, eolian, and hillslope processes that have operated through environmental changes from the Pleistocene to the present. The South Platte River, originating high in the Colorado Front Range, has played a major role in shaping the geology of the quadrangle, which is situated downstream of where the last of the major headwater tributaries (St. Vrain, Big Thompson, and Cache la Poudre) join the river. Recurrent glaciation (and deglaciation) of basin headwaters affected river discharge and sediment supply far downstream, influencing alluvium deposition and terrace formation in the Orchard quadrangle. Kiowa and Bijou Creeks, unglaciated tributaries originating east of the Front Range also have played a major role by periodically delivering large volumes of sediment to the river during flood events, which may have temporarily dammed the river. Eolian sand deposits of the Greeley (north of river) and Fort Morgan (south of river) dune fields cover much of the quadrangle and record past episodes of sand mobilization during times of drought. With the onset of irrigation during historic times, the South Platte River has changed from a broad, shallow, and sandy braided river with highly seasonal discharge to a much narrower, deeper river with braided-meandering transition morphology and more uniform discharge. Along this reach, the river has incised into Upper Cretaceous Pierre Shale, which, although buried by alluvial deposits in Orchard quadrangle, is locally exposed downstream along the South Platte River bluff near the Bijou Creek confluence, in some of the larger draws, and along Wildcat Creek.

  14. The weed composition in an orchard as a result of long-term foliar herbicide application

    Directory of Open Access Journals (Sweden)

    Maria Licznar-Małańczuk

    2016-09-01

    Full Text Available The weed composition and the dominance of individual species occurring in an orchard were assessed at the Research Station of the Wrocław University of Environmental and Life Sciences, Poland, during the first 10 years after orchard establishment. ‘Ligol’ apple trees were planted in the spring of 2004 (3.5 × 1.2 m. Foliar herbicides were applied in 1 m wide tree rows twice or three times per each vegetation period. In the inter-row spaces, perennial grass was maintained. Ten years of maintenance of herbicide fallow contributed to a change in the weed composition in the orchard. It changed as a result of different responses of the most important weed species to the foliar herbicides. Total suppression of Elymus repens was observed in the first year after planting the trees. Convolvulus arvensis, Cirsium arvense, and other perennial weeds, completely disappeared in the succeeding periods. The maintenance of herbicide fallow did not affect the abundance of Taraxacum officinale. The percentage of the soil surface covered by Trifolium repens and Epilobium adenocaulon, perennial weeds with considerable tolerance to post-emergence herbicides, increased during the fruit-bearing period of the trees. The abundance of these weeds was significantly reduced only in the rows with the stronger growing trees on the semi-dwarf P 2 rootstock. Stellaria media was the dominant annual weed. Senecio vulgaris, Poa annua, Capsella bursa-pastoris, and Lamium spp. were also frequently observed. A significant increase in the abundance of annual and perennial weeds was found in the tree rows as a result of improved water availability after a period of high precipitation.

  15. Spray pesticide applications in Mediterranean citrus orchards: Canopy deposition and off-target losses.

    Science.gov (United States)

    Garcerá, Cruz; Moltó, Enrique; Chueca, Patricia

    2017-12-01

    Only a portion of the water volume sprayed is deposited on the target when applying plant protection products with air-assisted axial-fan airblast sprayers in high growing crops. A fraction of the off-target losses deposits on the ground, but droplets also drift away from the site. This work aimed at assessing the spray distribution to different compartments (tree canopy, ground and air) during pesticide applications in a Mediterranean citrus orchard. Standard cone nozzles (Teejet D3 DC35) and venturi drift reducing nozzles (Albuz TVI 80 03) were compared. Applications were performed with a conventional air-assisted sprayer, with a spray volume of around 3000lha -1 in a Navel orange orchard. Brilliant Sulfoflavine (BSF) was used as a tracer. Results showed that only around 46% of the applied spray was deposited on the target trees and around 4% of the spray was deposited on adjacent trees from adjoining rows independently of the nozzle type. Applications with standard nozzles produced more potential airborne spray drift (23%) than those with the drift reducing nozzles (17%) but fewer direct losses to the ground (22% vs. 27%). Indirect losses (sedimenting spray drift) to the ground of adjacent paths were around 7-9% in both cases. The important data set of spray distribution in the different compartments around sprayed orchard (air, ground, vegetation) generated in this work is highly useful as input source of exposure to take into account for the risk assessment in Mediterranean citrus scenario. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Clonal Variations in Flower Production at the Anatolian Black Pine (Pinus nigra Arnold.subsp. pallasiana Seed Orchard

    Directory of Open Access Journals (Sweden)

    Murat ERTEKİN, Korhan TUNÇTANER

    2009-01-01

    Full Text Available This study was conducted for three years (2002-2004 in a black pine seed orchard established with 30 clonesoriginating from the forest of Yenice-Bakraz in Bartın, 1990. During the research, the variations between theclones in the seed orchard were determined based on the number of male and female flowers. According to theresults, the average values of flower production in three years at seed orchard showed considerable variations. Itwas determined that the number of the male and female flowers were 817,2 and 99,3 respectively. 62% ofaverage number of male flowers and 49% of female flowers were produced by 10 clones in 3 years. It was alsodetermined that the amount of the flowers for the clones showed significant differences within the years.

  17. Water distribution in an orchard irrigated by perforated distributors in stony ground

    International Nuclear Information System (INIS)

    Decroix, M.; Marcesse, J.; Normand, M.

    1975-01-01

    In the context of new irrigation techniques the Compagnie Nationale d'Amenagement du Bas-Rhone et du Languedoc (B.Rh.L.) has developed a process of localized irrigation by perforated distributors. Conditions were defined for the optimum use of this process, especially the distribution of water in the ground. The study was carried out in a peach orchard in stony ground. The neutronic method was used to measure the soil moisture content. Because of the heterogeneous stone size distribution it was necessary for the specific humidity determination to take into account the dry apparent density. This parameter was measured by gammametry [fr

  18. Biodiversity management of organic orchard enhances both ecological and economic profitability

    Directory of Open Access Journals (Sweden)

    Jie Meng

    2016-06-01

    Full Text Available Organic farming has been regarded as an alternative solution for both agricultural sustainability and human health maintenance. Few researches have concentrated on the differences of biodiversity and eco-economic benefits between organic and conventional orchards. Organic management (OM of orchards mainly includes taking advantage of natural enemies and beneficial weeds as well as soil organisms and controlling harmful pests. Here we conducted a three-year experiment on the effects of managing biodiversity in an organic apple orchard, using cattle manure to enrich soil biota, propagating native plant to suppress weeds and applying ecological pest management to control pests. The effect was assessed against the conventional management (CM model. We found that OM enhanced soil organic carbon, total nitrogen, microbial biomass carbon and nitrogen. The 16S rDNA high-throughput sequencing results indicated that the dominant bacterial phyla of the top soil were Proteobacteria and Actinobacteria, and OM had richer bacteria diversity with a 7% higher Shannon’s index than the CM. In particular, the relative abundance of rhizobium in the OM was higher than that of the CM. For OM, Duchesnea indica was an ideal ground-cover plant to control weeds through winning the niche competition and thus decreased weeds’ Simpson, Shannon–Wiener and Pielou index by 38.2%, 53.8% and 16.9% separately. The phototactic pests’ weight and scarab beetle’s population were effectively decreased by 35% and 86% respectively through long time control and prevention. OM had an average of 20 times more earthworms than CM, and the maximum density had reached 369 m−2 (0–20 cm soil. The dominant earthworm species of the OM were detritivores which preferring soil with high organic matter content. Due to no synthetic chemicals being used, the OM produced much safer apple fruits which were sold at high prices. Economically, up to a 103% increase of output–input ratio had

  19. Management of agricultural area in preindustrial economies. The case of olive orchards in southern Spain

    Directory of Open Access Journals (Sweden)

    Juan Infante Amate

    2012-06-01

    Full Text Available In recent decades it has been developed a specialized literature on the study of particular features of preindustrial agricultures. This paper, in base to such research line, analyzes the case of olive orchards in southern Spain, which today represent the largest tree concentration in Europe, right in the previous moment to its great expansion (mid 18th Century. We seek to understand the geography of its spreading, its low expansion before industrialization and the why only few territories on Andalusia appeared like premature focus of specialization.

  20. Biodiversity management of organic orchard enhances both ecological and economic profitability.

    Science.gov (United States)

    Meng, Jie; Li, Lijun; Liu, Haitao; Li, Yong; Li, Caihong; Wu, Guanglei; Yu, Xiaofan; Guo, Liyue; Cheng, Da; Muminov, Mahmud A; Liang, Xiaotian; Jiang, Gaoming

    2016-01-01

    Organic farming has been regarded as an alternative solution for both agricultural sustainability and human health maintenance. Few researches have concentrated on the differences of biodiversity and eco-economic benefits between organic and conventional orchards. Organic management (OM) of orchards mainly includes taking advantage of natural enemies and beneficial weeds as well as soil organisms and controlling harmful pests. Here we conducted a three-year experiment on the effects of managing biodiversity in an organic apple orchard, using cattle manure to enrich soil biota, propagating native plant to suppress weeds and applying ecological pest management to control pests. The effect was assessed against the conventional management (CM) model. We found that OM enhanced soil organic carbon, total nitrogen, microbial biomass carbon and nitrogen. The 16S rDNA high-throughput sequencing results indicated that the dominant bacterial phyla of the top soil were Proteobacteria and Actinobacteria, and OM had richer bacteria diversity with a 7% higher Shannon's index than the CM. In particular, the relative abundance of rhizobium in the OM was higher than that of the CM. For OM, Duchesnea indica was an ideal ground-cover plant to control weeds through winning the niche competition and thus decreased weeds' Simpson, Shannon-Wiener and Pielou index by 38.2%, 53.8% and 16.9% separately. The phototactic pests' weight and scarab beetle's population were effectively decreased by 35% and 86% respectively through long time control and prevention. OM had an average of 20 times more earthworms than CM, and the maximum density had reached 369 m(-2) (0-20 cm soil). The dominant earthworm species of the OM were detritivores which preferring soil with high organic matter content. Due to no synthetic chemicals being used, the OM produced much safer apple fruits which were sold at high prices. Economically, up to a 103% increase of output-input ratio had been achieved in the OM. Our

  1. Diversity and flight activity of Staphylinidae in a citrus orchard of the Catania Plain (Sicily)

    OpenAIRE

    Adorno, Antonio Salvatore Maria

    2013-01-01

    The present study aims to investigate the diversity and flight activity of Staphylinidae in a citrus orchard of the Catania Plain (Sicily) using different sampling methods (car-net, window traps and pit-fall traps). The study looks at the complex of flying rove beetles with the aim of defining preliminarily the faunistic and zoogeographical structure of this family in the study area. A second aim of the study is to investigate, using window-traps and pit-fall traps, the spatial distribution ...

  2. Spatial distribution of parasitism on Phyllocnistis citrella Stainton, 1856 (Lepidoptera: Gracillariidae in citrus orchards

    Directory of Open Access Journals (Sweden)

    SM. Jahnke

    Full Text Available Many species of microhymenopterous parasitoids have been registered on Phyllocnistis citrella, the citrus leafminer. The present study aimed to identify the spatial distribution pattern of the native and introduced parasitoids of P. citrella in two citrus orchards in Montenegro, RS. The new shoots from 24 randomly selected trees in each orchard were inspected at the bottom (0-1.5 m and top (1.5-2.5 m stratum and had their position relative to the quadrants (North, South, East and West registered at every 15 days from July/2002 to June/2003. The leaves with pupae were collected and kept isolated until the emergence of parasitoids or of the leaf miner; so, the sampling was biased towards parasitoids that emerge in the host pupal phase. The horizontal spatial distribution was evaluated testing the fitness of data to the Poisson and negative binomial distributions. In Montenegrina, there was no significant difference in the number of parasitoids and in the mean number of pupae found in the top and bottom strata (χ2 = 0.66; df = 1; P > 0.05 (χ2 = 0.27; df =1; P > 0.05, respectively. In relation to the quadrants, the highest average numbers of the leafminer pupae and of parasitoids were registered at the East quadrant (χ2 = 11.81; df = 3; P < 0.05, (χ2 = 10.36; df = 3; P < 0.05. In the Murcott orchard, a higher number of parasitoids was found at the top stratum (63.5% (χ2 = 7.24; df =1 P < 0.05, the same occurring with the average number of P. citrella pupae (62.9% (χ2 = 6.66; df = 1; P < 0.05. The highest number of parasitoids and of miners was registered at the North quadrant (χ2 = 19. 29; df = 3; P < 0.05, (χ2 = 4.39; df = 3; P < 0.05. In both orchards, there was no difference between the numbers of shoots either relative to the strata as well as to the quadrants. As the number of shoots did not varied much relative to the quadrants, it is possible that the higher number of miners and parasitoids in the East and West quadrants would be

  3. 100-OL-1 Operable Unit Pilot Study: XRF Evaluation of Select Pre-Hanford Orchards

    Energy Technology Data Exchange (ETDEWEB)

    Bunn, Amoret L.; Fritz, Brad G.; Pulsipher, Brent A.; Gorton, Alicia M.; Bisping, Lynn E.; Brandenberger, Jill M.; Pino, Christian; Martinez, Dominique M.; Rana, Komal; Wellman, Dawn M.

    2014-11-20

    Prior to the acquisition of land by the U.S. Department of War in February 1943 and the creation of the Hanford Site, the land along the Columbia River was home to over 1000 people. Farming and orchard operations by both homesteaders and commercial organizations were prevalent. Orchard activities and the associated application of lead arsenate pesticide ceased in 1943, when residents were moved from the Hanford Site at the beginning of the Manhattan Project. Today, the residues from historical application of lead arsenate pesticide persist in some locations on the Hanford Site. In 2012, the U.S. Department of Energy, U.S. Environmental Protection Agency, and Washington State Department of Ecology established the 100-OL-1 Operable Unit (OU) through the Hanford Federal Facility Agreement and Consent Order, known as the Tri-Party Agreement. The pre-Hanford orchard lands identified as the 100-OL-1 OU are located south of the Columbia River and east of the present-day Vernita Bridge, and extend southeast to the former Hanford townsite. The discontinuous orchard lands within 100-OL-1 OU are approximately 20 km2 (5000 ac). A pilot study was conducted to support the approval of the remedial investigation/feasibility study work plan to evaluate the 100-OL-1 OU. This pilot study evaluated the use of a field portable X-ray fluorescence (XRF) analyzer for evaluating lead and arsenic concentrations on the soil surface as an indicator of lead arsenate pesticide residues in the OU. The objectives of the pilot study included evaluating a field portable XRF analyzer as the analytical method for decision making, estimating the nature and extent of lead and arsenic in surface soils in four decision units, evaluating the results for the purpose of optimizing the sampling approach implemented in the remedial investigation, and collecting information to improve the cost estimate and planning the cultural resources review for sampling activities in the remedial investigation. Based on

  4. Pollen gene flow, male reproductive success, and genetic correlations among offspring in a northern red oak (Quercus rubra L.) seed orchard

    Science.gov (United States)

    Lisa Alexander; Keith Woeste

    2017-01-01

    Northern red oak is a high-value hardwood used for lumber, furniture and veneer. Intensively managed northern red oak seed orchards are required to obtain genetic gain for trait improvement. Data from conifer seed orchards and natural and managed stands of hardwood trees have shed light on the distance over which pollen can move, and underscore the need for managerial...

  5. Semiochemicals to monitor insect pests – future opportunities for an effective host plant volatile blend to attract navel orangeworm in pistachio orchards

    Science.gov (United States)

    The navel orangeworm (Amyelois transitella) has been a major insect pest of California tree nut orchards for the past five decades. In particular, almond and pistachio orchards suffer major annual economic damage due to both physical and associated fungal damage caused by navel orangeworm larvae. Un...

  6. Preliminary evidence that copper inhibits the degradation of DDT to DDE in pip and stonefruit orchard soils in the Auckland region, New Zealand

    International Nuclear Information System (INIS)

    Gaw, S.K.; Palmer, G.; Kim, N.D.; Wilkins, A.L.

    2003-01-01

    Studies in New Zealand orchard soils indicate that elevated Cu concentrations have reduced the ability of the indigenous soil microbial community to degrade DDT to DDE. - Orchards (n=13) were sampled as part of a larger survey investigating agrichemical residues (pesticides and trace elements) in cropping soils in the Auckland region, New Zealand. ΣDDT concentrations in orchard soils ranged from -1 . DDT (o,p'- and p,p'-) comprised at least 40% of the ΣDDT residues in 67% of orchards in which DDT residues were detected. There was a highly significant negative correlation (-0.924, P -1 ) and the ratio of DDE:DDT (0.4-5.2) in pip and stonefruit orchard soils. In further investigations involving five pip and stone fruit orchard sites and one grazing paddock it was found that soil respiration and the ratio of soil microbial carbon to soil carbon (%C mic /Org-C) in orchard soils decreased with increasing copper concentration. These findings are consistent with the conclusion that elevated soil copper concentrations in pip and stone fruit orchard soils in the Auckland region may have reduced the ability of the indigenous soil microbial community to degrade DDT to DDE

  7. Mass release of Trichogramma evanescens and T. cacoeciae can reduce damage by the apple codling moth Cydia pomonella in organic orchards under pheromone disruption

    DEFF Research Database (Denmark)

    Sigsgaard, Lene; Herz, Annette; Korsgaard, Maren

    2017-01-01

    of the two species were evaluated for mass-release to control C. pomonella in two commercial organic apple orchards, one in 2012 and one in 2013, using a complete randomized block design. Pheromone disruption was used in both orchards, making the study one of the first to evaluate Trichogramma release under...

  8. Updates on Water Use of Pistachio Orchards Grown in the San Joaquin Valley of California on Saline Soils

    Science.gov (United States)

    Zaccaria, Daniele; Marino, Giulia; Whiting, Michael; Sanden, Blake; Ferguson, Louise; Lampinen, Bruce; Kent, Eric; Snyder, Richard; Grattan, Stephen; Little, Cayle

    2017-04-01

    Pistachio acreage is rapidly expanding in California thanks to its economic profitability and capacity to grow and produce in salt-affected soils. Our team at University of California is updating information on actual water use (ET) of mature pistachio orchards grown on saline soils under micro-irrigation methods. Actual Evapotranspiration (ETa) and Crop Coefficients (Ka) were determined for the 2015 and 2016 crop seasons on four pistachio orchards grown in the San Joaquin Valley (SJV) on grounds with increasing levels of soil-water salinity, using the residual of energy balance method with a combination of eddy covariance and surface renewal equipment. Tree canopy cover, light interception, and plant water status across the orchards were also measured and evaluated. Our preliminary results show that salinity strongly affects the tree water use, resulting in 10-30% less ET for medium to high salt-affected soils. Salinity also showed a strong effect on tree water status and light interception, as suggested by values of the Midday Stem Water Potential (ΨSWP) around 10 to 15-bar lower in salt-affected than in the control orchard, and by the intercepted Photosynthetic Active Radiation (PAR) decreasing from 75% in the control orchard to 25% in the severely salt affected grounds. The crop coefficient values we observed in this study are lower than those commonly used for irrigation scheduling in the SJV, suggesting that pistachio growers could better tailor irrigation management to the actual site-specific orchard conditions (e.g. canopy features and soil-water salinity) if they are provided updated information. Improved irrigation practices could likely lead to significant water savings and thus improve the resource-efficiency and competitiveness of pistachio production in the SJV. Keywords: Pistacia vera L., salinity, stem water potential, surface renewal, canopy cover.

  9. Evaluation of Bee Diversity within Different Sweet Cherry Orchards in the Sultandaği Reservoir (Turkey

    Directory of Open Access Journals (Sweden)

    Güler Yasemin

    2015-12-01

    Full Text Available Many varieties of sweet cherry are self-incompatible. Therefore, sweet cherry orchards require a huge population of pollinator bees to carry out an adequate amount of pollen transfer between the different varieties. Our study was conducted to evaluate the differences in the richness and diversity of these pollinators within very closely located sweet cherry orchards, and to understand the underlying effects causing these differences. The study was conducted in the Sultandağı Reservoir (Turkey which covers the towns of Sultandağı (Afyonkarahisar and Akşehir (Konya. In order to avoid a sampling bias, Malaise traps were used to collect bee samples. Sampling collections were repeated for three years; from 2007 to 2009, between April and May. The traps were set in the bud-swell period and lifted in the green-fruit period. Climatic data were taken from meteorology stations near the orchards. Vegetation in the surrounding areas was also inspected. The composition of pollinator bee species was determined and compared between orchards. In total, 83 bee species and 38 plant species were recorded. It was found that Halictidae is the most abundant and richest group among the pollinator bees. The effects of the quantity of the Malaise traps on bee sampling success were also tested. It was found that one trap per 325 trees is enough for an adequate sampling. Apart from the annual fluctuations of bee richness in the orchards, general differences in the bee diversity among orchards might be affected by the surrounding vegetation and especially from different agricultural practices such as tilling the ground.

  10. Communities of arbuscular mycorrhizal fungi in the roots of Pyrus pyrifolia var. culta (Japanese pear) in orchards with variable amounts of soil-available phosphorus.

    Science.gov (United States)

    Yoshimura, Yuko; Ido, Akifumi; Iwase, Koji; Matsumoto, Teruyuki; Yamato, Masahide

    2013-01-01

    We examined the colonization rate and communities of arbuscular mycorrhizal fungi (AMF) in the roots of Pyrus pyrifolia var. culta (Japanese pear) in orchards to investigate the effect of phosphorus (P) fertilization on AMF. Soil cores containing the roots of Japanese pear were collected from 13 orchards in Tottori Prefecture, Japan. Soil-available P in the examined orchards was 75.7 to 1,200 mg kg(-1), showing the extreme accumulation of soil P in many orchards. The AMF colonization rate was negatively correlated with soil-available P (P soil-available P (P fungi may be adapted to high soil-available P conditions. Redundancy analysis showed the significant effects of soil pH, available P in soil, and P content in leaves of P. pyrifolia var. culta trees on AMF distribution. These results suggested that the accumulation of soil-available P affected AMF communities in the roots of Japanese pear in the orchard environment.

  11. Development and evaluation of a targeted orchard sprayer using machine vision technology

    Directory of Open Access Journals (Sweden)

    H Asaei

    2016-09-01

    Full Text Available Introduction In conventional methods of spraying in orchards, the amount of pesticide sprayed, is not targeted. The pesticide consumption data indicates that the application rate of pesticide in greenhouses and orchards is more than required. Less than 30% of pesticide sprayed actually reaches nursery canopies while the rest are lost and wasted. Nowadays, variable rate spray applicators using intelligent control systems can greatly reduce pesticide use and off-target contamination of environment in nurseries and orchards. In this research a prototype orchard sprayer based on machine vision technology was developed and evaluated. This sprayer performs real-time spraying based on the tree canopy structure and its greenness extent which improves the efficiency of spraying operation in orchards. Materials and Methods The equipment used in this study comprised of three main parts generally: 1- Mechanical Equipment 2- Data collection and image processing system 3- Electronic control system Two booms were designed to support the spray nozzles and to provide flexibility in directing the spray nozzles to the target. The boom comprised two parts, the vertical part and inclined part. The vertical part of the boom was used to spray one side of the trees during forward movement of the tractor and inclined part of the boom was designed to spray the upper half of the tree canopy. Three nozzles were considered on each boom. On the vertical part of the boom, two nozzles were placed, whereas one other nozzle was mounted on the inclined part of the boom. To achieve different tree heights, the vertical part of the boom was able to slide up and down. Labview (version 2011 was used for real time image processing. Images were captured through RGB cameras mounted on a horizontal bar attached on top of the tractor to take images separately for each side of the sprayer. Images were captured from the top of the canopies looking downward. The triggering signal for

  12. Cover crops impact on excess rainfall and soil erosion rates in orchards and potato fields, Israel

    Science.gov (United States)

    Egozi, Roey; Gil, Eshel

    2015-04-01

    Bare soil and high drainage densities are common characteristics of intensive agriculture land. The couplings of these characteristics lead to high runoff and eroded soil volumes leaving the field or the orchard via the local drainage system into the fluvial system. This process increase flood risk due to massive deposition of the coarse fraction of the eroded soil and therefore reduces channel capacity to discharge the increase volumes of concentrated runoff. As a result drainage basin authorities are forced to invest large amount of money in maintaining and enlarging the drainage network. However this approach is un-sustainable. On the other hand, implementing cover crops (CC) and modification to current agricultural practices over the contributing area of the watershed seems to have more benefits and provide sustainable solution. A multi-disciplinary approach applied in commercial potatoes fields and orchards that utilize the benefit of CC shows great success as means of soil and water conservation and weed disinfestation without reduction in the yield, its quality or its profitability. The results indicate that it is possible to grow potatoes and citrus trees under CC with no reduction in yield or nutrient uptake, with more than 95% reduction in soil loss and more than 60% in runoff volumes and peak discharges.

  13. Nitrogen replenishment using variable rate application technique in a small hand-harvested pear orchard

    International Nuclear Information System (INIS)

    Vatsanidou, A.; Nanos, G.D.; Fountas, S.; Baras, J.; Castrignano, A.; Gemtos, T.A.

    2017-01-01

    Precision agriculture is a management approach for sustainable agriculture. It can be applied even in small fields. It aims to optimize inputs, improve profits, and reduce adverse environmental impacts. In this study, a series of measurements were conducted over three growing seasons to assess variability in a 0.55 ha pear orchard located in central Greece. Soil ECa was measured using EM38 sensor, while soil samples were taken from a grid 17 × 8 m and analysed for texture, pH, P, K, Mg, CaCO3, and organic matter content. Data analysis indicated that most of the nutrients were at sufficient levels. Soil and yield maps showed considerable variability while fruit quality presented small variations across the orchard. Yield fluctuations were observed, possibly due to climatic conditions. Prescription maps were developed for nitrogen variable rate application (VRA) for two years based on the replacement of the nutrients removed by the crop. VRA application resulted in 56% and 50% reduction of N fertiliser compared to uniform application.

  14. Nitrogen replenishment using variable rate application technique in a small hand-harvested pear orchard

    Energy Technology Data Exchange (ETDEWEB)

    Vatsanidou, A.; Nanos, G.D.; Fountas, S.; Baras, J.; Castrignano, A.; Gemtos, T.A.

    2017-07-01

    Precision agriculture is a management approach for sustainable agriculture. It can be applied even in small fields. It aims to optimize inputs, improve profits, and reduce adverse environmental impacts. In this study, a series of measurements were conducted over three growing seasons to assess variability in a 0.55 ha pear orchard located in central Greece. Soil ECa was measured using EM38 sensor, while soil samples were taken from a grid 17 × 8 m and analysed for texture, pH, P, K, Mg, CaCO3, and organic matter content. Data analysis indicated that most of the nutrients were at sufficient levels. Soil and yield maps showed considerable variability while fruit quality presented small variations across the orchard. Yield fluctuations were observed, possibly due to climatic conditions. Prescription maps were developed for nitrogen variable rate application (VRA) for two years based on the replacement of the nutrients removed by the crop. VRA application resulted in 56% and 50% reduction of N fertiliser compared to uniform application.

  15. AGROECOSYSTEMS OF FAMILIAR ORCHARDS AT SUBTROPICAL MEXICAN HIGHLANDS. A SYSTEMIC VISION

    Directory of Open Access Journals (Sweden)

    Jesús Gastón Gutiérrez Cedillo

    2015-12-01

    Full Text Available This study is aimed to evaluate the traditional knowledge applied at agroecosystems of familiar orchards in San Nicolas, at southwest of the State of Mexico, in the Subtropical Central Highlands of Mexico generated by the Balsas River Depression; the selection of properties and informers was by means of intention. Were analyzed fourteen systems between march 2011 and april 2012.  Was elaborated the geographic, phyto geographic and agro ecological characterizations; the geographic characterization included physical, biotic and socio cultural aspects, mean by photo interpretation, localization through global positional systems, analysis of social statistics, in field observation about cultural outlines and elaboration of digital cartography. Related to phyto geographic characterization, was realized a floristically inventory, that included from de approach of Ethnobotanics the management and functionality of vegetal resources employed at the familiar orchards agroecosystems, based on the local inhabitants traditional knowledge; were realized collections of wild and cultivated botanical specimens. The agro ecological characterization was elaborated mean by in field work and interviews realized to the terrains owners, the obtained information was processed by means of data bases. The theoretical basis of the study was sustained on Agroecology, Cultural Ecology and Ethno botanical. These allows to evaluate the ecological importance, and to determinate the cultural and socioeconomic impacts of the familiar agroecosystems from a systemic point of view.

  16. Results of the radiological survey at 90 Orchard Place Maywood, New Jersey (MJ023)

    International Nuclear Information System (INIS)

    Foley, R.D.; Carrier, R.F.

    1989-10-01

    Maywood Chemical Works (MCW) of Maywood, New Jersey, generated process wastes and residues associated with the production and refining of thorium and thorium compounds from monazite ores from 1916 to 1956. MCW supplied rare earth metals and thorium compounds to the Atomic Energy Commission and various other government agencies from the late 1940s to the mid-1950s. Area residents used the sandlike waste from this thorium extraction process mixed with tea and cocoa leaves as mulch in their yards. Some of these contaminated wastes were also eroded from the site into Lodi Brook. At the request of the US Department of Energy (DOE), a group from Oak Ridge National Laboratory conducts investigative radiological surveys of properties in the vicinity of MCW to determine whether a property is contaminated with radioactive residues, principally 233 Th, derived from the MCW site. The surveys typically includes direct measurement of gamma radiation levels and soil sampling for radionuclide analyses. The survey of this site, 90 Orchard Place, Maywood, New Jersey (MJ023), was conducted during 1987. While some radiological measurements taken at 90 Orchard Place were slightly greater than typical background levels encountered in the northern New Jersey area, no radionuclide concentrations nor radiation levels exceeded the applicable federal criteria. Based on the survey data it is recommended that this site be eliminated from consideration for inclusion in the DOE remedial action program. 5 refs., 2 figs., 3 tabs

  17. Breeding biology of the European Blackbird Turdus merula in orange orchards

    Directory of Open Access Journals (Sweden)

    Ali Zeraoula

    2016-10-01

    Full Text Available During two successive years (2013–2014, we studied the breeding ecology of the European Blackbird Turdus merula in Guelma province, north-east of Algeria. The study was carried out in orange orchards of the region. We investigated nest placement in the orange trees and determined the factors of reproductive failure at this study area. Nests were placed at low height (mean ± SD = 1.42 ± 0.04 m and located near the trunk (mean ± SD = 0.61 ± 0.04 m. The breeding season occurred between mid-May and mid-June and the peak of egg laying took place during the first half of May. The mean clutch size was 2.96 ± 0.05, density of breeding pairs was 0.83 ± 0.30 p/ha. The breeding success reported in the present study was higher than that recorded in other studies. Predation was the leading cause of nest failure of the population under investigation. The present study shows that the orange orchards appear to be the preferred breeding area for Blackbird population.

  18. Chemical, Biochemical, and Microbiological Properties of Soils from Abandoned and Extensively Cultivated Olive Orchards

    Directory of Open Access Journals (Sweden)

    A. M. Palese

    2013-01-01

    Full Text Available The abandonment of olive orchards is a phenomenon of great importance triggered mainly by economic and social causes. The aim of this study was to investigate some chemical, biochemical, and microbiological properties in a soil of a southern olive grove abandoned for 25 years. In order to define the effect of the long-term land abandonment on soil properties, an adjacent olive grove managed according to extensive practices was taken as reference (essentially minimum tillage and no fertilization. Soil organic matter, total nitrogen, and pH were significantly higher in the abandoned olive grove due to the absence of tillage and the natural inputs of organic matter at high C/N ratio which, inter alia, increased the number of cellulolytic bacteria and stimulated the activity of β-glucosidase, an indicator of a more advanced stage of soil evolution. The soil of the abandoned olive orchard showed a lower number of total bacteria and fungi and a lower microbial diversity, measured by means of the Biolog method, as a result of a sort of specialization trend towards low quality organic substrates. From this point of view, the extensive cultivation management seemed to not induce a disturbance to microbiological communities.

  19. Trap Height Affects Capture of Lady Beetles (Coleoptera: Coccinellidae) in Pecan Orchards.

    Science.gov (United States)

    Cottrell, T E

    2017-04-01

    There is scarce information regarding the vertical stratification of predaceous Coccinellidae in tall trees. Although numerous studies have been done in orchards and forests, very few studies have assessed the occurrence of predaceous Coccinellidae high in tree canopies. The objective of this study was to examine the abundance of Coccinellidae at different heights in mature pecan, Carya illinoinensis (Wangenh.) K. Koch, orchards with tall trees. From spring through late fall during 2013 and 2014, yellow pyramidal Tedders traps were suspended in the pecan canopy at 6.1 and 12.2 m, in addition to being placed on the ground (0 m). The exotic species Harmonia axyridis and Coccinella septempunctata accounted for a high percentage of trap capture during this study. Except for Olla v-nigrum, low numbers of native species (Hippodamia convergens, Coleomegilla maculata, Cycloneda munda, Scymnus spp., and Hyperaspis spp.) were captured. However, significantly more were captured in ground traps rather than in canopy traps with the exception of O. v-nigrum. Similar to most native species, significantly more C. septempunctata were captured in ground traps than canopy traps. This contrasts sharply with H. axyridis captured similarly at all trap heights. The ability to exploit resources across vertical strata, unlike many intraguild predators, may be an underestimated factor helping to explain the invasiveness of H. axyridis. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by a US Government employee and is in the public domain in the US.

  20. Ectomycorrhizal fungal diversity in orchards of cultivated pecan (Carya illinoinensis; Juglandaceae).

    Science.gov (United States)

    Bonito, Gregory; Brenneman, Timothy; Vilgalys, Rytas

    2011-10-01

    Carya illinoinensis (pecan) belongs to the Juglandaceae (walnut family) and is a major economic nut crop in the southern USA. Although evidence suggests that some species in the Juglandaceae are ectomycorrhizal, investigations on their ectomycorrhizal fungal symbionts are quite limited. Here we assessed the ectomycorrhizal fungal diversity in cultivated orchards of C. illinoinensis. Five pecan orchards in southern Georgia, USA, were studied, three of which were known to fruit the native edible truffle species Tuber lyonii. We sequenced rDNA from single ectomycorrhizal root tips sampled from a total of 50 individual trees. Mycorrhizae were identified by ITS and LSU rDNA sequence-based methods. Forty-four distinct ectomycorrhizal taxa were detected. Sequestrate taxa including Tuber and Scleroderma were particularly abundant. The two most abundant sequence types belonged to T. lyonii (17%) and an undescribed Tuber species (~20%). Because of our interest in the ecology of T. lyonii, we also conducted greenhouse studies to determine whether this species would colonize and form ectomycorrhizae on roots of pecan, oak, or pine species endemic to the region. T. lyonii ectomycorrhizae were formed on pecan and oak seedlings, but not pine, when these were inoculated with spores. That oak and pecan seedling roots were receptive to truffle spores indicates that spore slurry inoculation could be a suitable method for commercial use and that, ecologically, T. lyonii may function as a pioneer ectomycorrhizal species for these hosts. © Springer-Verlag 2011

  1. The spectrum and occurrence of entomopathogenic fungi in soils from apple orchards

    Directory of Open Access Journals (Sweden)

    Barbara Marjańska-Cichoń

    2012-12-01

    Full Text Available The spectrum and occurrence of entomopathogenic fungi in orchard soil and arable soil were evaluated using an "insect bait method". Soil samples taken in autumn and spring from sward, herbicides fallow and arable soil were baited with Galleria mellonella larvae. Entomopathogenic fungi Beauveria bassiana (Bals. Vuill., Metarhizium anisopliae (Metsch. Sorok. and Paecilomyces fumosoroseus (Wize Brown et Smith were isolated from three species of orchards soil and adjacent arable soil. Infection levels of G. mellonella larvae were depended from species of soil . M. anisoopliae caused most frequent infections of bait insects in light loamy sand and P. fumosoroseus in alluvial silt and coarse sand. B. bassiana was dominated in alluvial silt. It was established that M. anisopliae and B. bassiana infected more larvae in autumn than in spring. In case of P. fumosoroseus an opposite tendency was observed. Generaly in arable soil and sward number of infected larvae was higher than other stands. In case of light loamy sand more infections of G. mellonella larvae were found in samples from herbicides fallow. Irrespective of soil type B. bassiana was the dominated species isolated from herbicides fallow, M. anisopliae from sward and P. fumosoroseus - from arable soil.

  2. Chemical, Biochemical, and Microbiological Properties of Soils from Abandoned and Extensively Cultivated Olive Orchards

    Science.gov (United States)

    Palese, A. M.; Magno, R.; Casacchia, T.; Curci, M.; Baronti, S.; Miglietta, F.; Crecchio, C.; Xiloyannis, C.; Sofo, A.

    2013-01-01

    The abandonment of olive orchards is a phenomenon of great importance triggered mainly by economic and social causes. The aim of this study was to investigate some chemical, biochemical, and microbiological properties in a soil of a southern olive grove abandoned for 25 years. In order to define the effect of the long-term land abandonment on soil properties, an adjacent olive grove managed according to extensive practices was taken as reference (essentially minimum tillage and no fertilization). Soil organic matter, total nitrogen, and pH were significantly higher in the abandoned olive grove due to the absence of tillage and the natural inputs of organic matter at high C/N ratio which, inter alia, increased the number of cellulolytic bacteria and stimulated the activity of β-glucosidase, an indicator of a more advanced stage of soil evolution. The soil of the abandoned olive orchard showed a lower number of total bacteria and fungi and a lower microbial diversity, measured by means of the Biolog method, as a result of a sort of specialization trend towards low quality organic substrates. From this point of view, the extensive cultivation management seemed to not induce a disturbance to microbiological communities. PMID:24348166

  3. The challenge of accurately documenting bee species richness in agroecosystems: bee diversity in eastern apple orchards

    Science.gov (United States)

    Russo, Laura; Park, Mia; Gibbs, Jason; Danforth, Bryan

    2015-01-01

    Bees are important pollinators of agricultural crops, and bee diversity has been shown to be closely associated with pollination, a valuable ecosystem service. Higher functional diversity and species richness of bees have been shown to lead to higher crop yield. Bees simultaneously represent a mega-diverse taxon that is extremely challenging to sample thoroughly and an important group to understand because of pollination services. We sampled bees visiting apple blossoms in 28 orchards over 6 years. We used species rarefaction analyses to test for the completeness of sampling and the relationship between species richness and sampling effort, orchard size, and percent agriculture in the surrounding landscape. We performed more than 190 h of sampling, collecting 11,219 specimens representing 104 species. Despite the sampling intensity, we captured wild bees did not appear to be a factor, as we found no correlation between honeybee and wild bee abundance. Our study shows that the pollinator fauna of agroecosystems can be diverse and challenging to thoroughly sample. We demonstrate that there is high temporal variation in community composition and that sites vary widely in the sampling effort required to fully describe their diversity. In order to maximize pollination services provided by wild bee species, we must first accurately estimate species richness. For researchers interested in providing this estimate, we recommend multiyear studies and rarefaction analyses to quantify the gap between observed and expected species richness. PMID:26380684

  4. Nitrogen replenishment using variable rate application technique in a small hand-harvested pear orchard

    Directory of Open Access Journals (Sweden)

    Anna Vatsanidou

    2018-02-01

    Full Text Available Precision agriculture is a management approach for sustainable agriculture. It can be applied even in small fields. It aims to optimize inputs, improve profits, and reduce adverse environmental impacts. In this study, a series of measurements were conducted over three growing seasons to assess variability in a 0.55 ha pear orchard located in central Greece. Soil ECa was measured using EM38 sensor, while soil samples were taken from a grid 17 × 8 m and analysed for texture, pH, P, K, Mg, CaCO3, and organic matter content. Data analysis indicated that most of the nutrients were at sufficient levels. Soil and yield maps showed considerable variability while fruit quality presented small variations across the orchard. Yield fluctuations were observed, possibly due to climatic conditions. Prescription maps were developed for nitrogen variable rate application (VRA for two years based on the replacement of the nutrients removed by the crop. VRA application resulted in 56% and 50% reduction of N fertiliser compared to uniform application.

  5. INTERSPECIFIC COMPETITION BETWEEN NATIVE AND EXOTIC FRUIT FLY PARASITOIDSIN MIXED ORCHARDS IN MACEIO, ALAGOAS, BRAZIL

    Directory of Open Access Journals (Sweden)

    JAKELINE MARIA DOS SANTOS

    2016-01-01

    Full Text Available The objective of this work was to assess the effects of the release and establishment of the exotic parasitoid Diachasmimorpha longicaudata (Ashmead, 1905 (Hymenoptera: Braconidae and its interspecific competitive relationship with native fruit fly parasitoids in organic and conventional orchards in Maceio, State of Alagoas, Brazil. The exotic parasitoids were reared in the Radio - Entomology Laboratory of the Center for Nuclear Energy in Agriculture, University of São Paulo, Piracicaba, São Paulo, and released (112,350 individuals between five and eight days old in orchards from June 8 to July12, 2013.Fruit samples were collected randomly every week during one year to assess the D. longicaudata recaptured from plants and fallen fruits on the ground, which were taken to the Entomology Laboratory of the CECA - UFAL, classified and individually placed in plastic containers, containing a layer of 1 cm of sand for pupation of the host larvae. The pupae, obtained after 10 days, were placed in Petri dishes with a layer of sand until the emergence of adults, which were then kept in plastic microtubes, containing ethanol 70%. The release of exotic parasitoids did not displace native species. The same species were found before and after the release in both cultures: Doryctobracon areolatus , Asobara anastrephae , Utetes anastrephae and Opius bellus (Braconidae, Aganaspis pelleranoi (Figitidae and individuals of the Pteromalidae family. One year after the last release, 44 individuals of the exotic parasitoid were found, showing its establishment in the studied areas.

  6. Development of a dense SNP-based linkage map of an apple rootstock progeny using the Malus Infinium whole genome genotyping array.

    Science.gov (United States)

    Antanaviciute, Laima; Fernández-Fernández, Felicidad; Jansen, Johannes; Banchi, Elisa; Evans, Katherine M; Viola, Roberto; Velasco, Riccardo; Dunwell, Jim M; Troggio, Michela; Sargent, Daniel J

    2012-05-25

    A whole-genome genotyping array has previously been developed for Malus using SNP data from 28 Malus genotypes. This array offers the prospect of high throughput genotyping and linkage map development for any given Malus progeny. To test the applicability of the array for mapping in diverse Malus genotypes, we applied the array to the construction of a SNP-based linkage map of an apple rootstock progeny. Of the 7,867 Malus SNP markers on the array, 1,823 (23.2%) were heterozygous in one of the two parents of the progeny, 1,007 (12.8%) were heterozygous in both parental genotypes, whilst just 2.8% of the 921 Pyrus SNPs were heterozygous. A linkage map spanning 1,282.2 cM was produced comprising 2,272 SNP markers, 306 SSR markers and the S-locus. The length of the M432 linkage map was increased by 52.7 cM with the addition of the SNP markers, whilst marker density increased from 3.8 cM/marker to 0.5 cM/marker. Just three regions in excess of 10 cM remain where no markers were mapped. We compared the positions of the mapped SNP markers on the M432 map with their predicted positions on the 'Golden Delicious' genome sequence. A total of 311 markers (13.7% of all mapped markers) mapped to positions that conflicted with their predicted positions on the 'Golden Delicious' pseudo-chromosomes, indicating the presence of paralogous genomic regions or mis-assignments of genome sequence contigs during the assembly and anchoring of the genome sequence. We incorporated data for the 2,272 SNP markers onto the map of the M432 progeny and have presented the most complete and saturated map of the full 17 linkage groups of M. pumila to date. The data were generated rapidly in a high-throughput semi-automated pipeline, permitting significant savings in time and cost over linkage map construction using microsatellites. The application of the array will permit linkage maps to be developed for QTL analyses in a cost-effective manner, and the identification of SNPs that have been

  7. Microscopic investigation to determine the effect of Beauveria bassiana (Bals.) Vuill. and Cymbopogon citratus (DC.) Stapf. treatment on different life stages of Musca domestica (L.).

    Science.gov (United States)

    Mishra, Sapna; Kumar, Peeyush; Malik, Anushree

    2017-06-01

    Microscopic investigation was done to determine the effect of entomopathogenic fungi, Beauveria bassiana and essential oil of Cymbopogon citratus on different life stages of Musca domestica . Scanning electron microscopy investigation of fungal infected larvae showed sluggish movement, rigor, and failure of body to balance in water. Treated larvae also revealed varied level of cuticle shrinkage and extreme dehydration. Surface of B. bassiana infected pupae showed varied stage of mycelial growth, while the cadaver of adult fly was observed to have extensive fungal growth covering their entire body surface. The application of C. citratus oils on M. domestica larvae resulted in skin shrinkage, spinous cells proliferation and bleb formation, while the treated pupae showed high incidence of incomplete emergence and malformation in emerged adult flies. The current study establishes effect of C. citratus essential oil and B. bassiana infection on different life stages of M. domestica .

  8. Musca domestica Salivary Gland Hypertrophy Virus, a Globally Distributed Insect Virus That Infects and Sterilizes Female Houseflies

    DEFF Research Database (Denmark)

    Prompiboon, Pannipa; Lietze, Verena-Ulrike; Denton, John S S

    2010-01-01

    The housefly, Musca domestica, is a cosmopolitan pest of livestock and poultry and is of economic, veterinary, and public health importance. Populations of M. domestica are naturally infected with M. domestica salivary gland hypertrophy virus (MdSGHV), a nonoccluded double-stranded DNA virus...... that inhibits egg production in infected females and is characterized by salivary gland hypertrophy (SGH) symptoms. MdSGHV has been detected in housefly samples from North America, Europe, Asia, the Caribbean, and the southwestern Pacific. In this study, houseflies were collected from various locations......, and the polymorphism detected was correlated with geographic source. The virulence of the geographic MdSGHV isolates was evaluated by per os treatment of newly emerged and 24-h-old houseflies with homogenates of infected salivary glands. In all cases, 24-h-old flies displayed a resistance to oral infection...

  9. Dogwood borer (Lepidoptera: Sesiidae) abundance and seasonal flight activity in apple orchards, urban landscapes, and woodlands in five eastern states.

    Science.gov (United States)

    Bergh, J C; Leskey, T C; Walgenbach, J F; Klingeman, W E; Kain, D P; Zhang, A

    2009-06-01

    The relative abundance and seasonal flight activity of dogwood borer, Synanthedon scitula Harris (Lepidoptera: Sesiidae), was measured using weekly records from traps baited with its sex pheromone and deployed in apple orchards, urban landscapes, and native woodland sites in New York, West Virginia, Virginia, North Carolina, and Tennessee in 2005 and 2006. The mean total number of moths captured per site in apple orchards was 3,146 +/- 644 and 3095 +/- 584 SE in 2005 and 2006, respectively, exceeding captures at urban sites by 16 and 13 times and at woodland sites by 210 and 206 times in 2005 and 2006, respectively. Mean total captures at urban sites exceeded those in woodland habitats by 13 and 16 times in 2005 and 2006, respectively. The mean duration (wk) of the flight period did not differ significantly between apple orchards (22.6 +/- 0.6 SE) and urban sites (20.3 +/- 1.2 SE). The onset of flight was somewhat later in New York (around early June) than further south (around early to mid-May), but moth captures continued into October in all states. Captures in apple orchards and at urban sites with higher populations were essentially continuous throughout the flight period, with substantial weekly fluctuations, and tended to show a bimodal pattern with peaks from late May through mid-July and from late August through mid-September. Captures at woodland sites tended to occur predominantly from mid-May through about mid-June and were very sporadic thereafter.

  10. Degree-day model for timing insecticide applications to control Dioryctria amatella (Lepidoptera: Pyralidae) in loblolly pine seed orchards

    Science.gov (United States)

    James L. Hanula; Gary L. DeBarr; Julie C. Weatherby; Larry R. Barber; C. Wayne Berisford

    2002-01-01

    Because Dioryctria amatella (Hulst) is a key pest in loblolly pine, Pinus taeda L. (Pinaceac), seed orchards in the southeastern United States, improved timing of insecticide applications would be valuable for its control. To time two fenvalerate (Pydrin® 2.4 EC) applications we tested four variations of a degree day model that...

  11. Five methods to interpret field measurements of energy fluxes over a micro-sprinkler-irrigated mango orchard

    NARCIS (Netherlands)

    De C. Teixeira, A.H.; Bastiaanssen, W.G.M.

    2010-01-01

    Energy balance measurements were carried out in a mango orchard during two growing seasons in the semi-arid region of Brazil. The actual evapotranspiration (ET) was acquired by eddy correlation (EC) and Bowen ratio energy balance (BR) techniques. The daily energy balance closure in the EC

  12. Heavy metals in apple orchard soils and fruits and their health risks in Liaodong Peninsula, Northeast China.

    Science.gov (United States)

    Wang, Quanying; Liu, Jingshuang; Cheng, Shuai

    2015-01-01

    This study aimed to assess the heavy metal concentrations in soils and fruits and their possible human health risk in apple orchards of Liaodong Peninsula-a well-known fruit-producing area of China. The soil pollution index (PI) and health risk assessment methods (daily intake of metals (DIM) and health risk index (HRI)) were employed to explore the soil pollution levels and the potential health hazards of heavy metals in fruits. The results showed that all orchard soils were with low PI values (PI ≤1) for Cd and Zn, while 2.78 and 5.56% of the soil samples exceeded the allowable levels of Cr and Cu for orchard soil, respectively. The Cd, Cu, and Zn concentrations for the apple flesh samples were all lower than the national maximum permissible concentrations. While 6.34% of apple peel samples for Cd, 76.5% of apple peel samples and 65.6% of apple flesh samples for Cr, and 28.1% of apple peel samples for Zn exceeded the national maximum permissible levels, respectively. Furthermore, both the DIM and the HRI values for all the apple flesh samples were within the safe limits, indicating that no health risk was found for heavy metals in the fruits of the study area. In order to protect the consumers from fruits that might cause health risks, results from this study suggested that the regular survey of heavy metal pollution levels should be conducted for the orchards of Liaodong Peninsula.

  13. Compaction of loamy soils due to tractor traffic in vineyards and orchards and its effect on infiltration in southern France

    NARCIS (Netherlands)

    Dijck, van S.J.E.; Asch, van T.W.J.

    2002-01-01

    Viticulture and fruit culture in Mediterranean areas demand frequent tractor traffic in vineyards and orchards for tillage and for the application of herbicides and pesticides, resulting in soil compaction. The aim of this study was to investigate theextent of soil compaction and its effect on

  14. Soil acidification increases metal extractability and bioavailability in old orchard soils of Northeast Jiaodong Peninsula in China

    NARCIS (Netherlands)

    Li, Lianzhen; Wu, Huifeng; van Gestel, C.A.M.; Peijnenburg, W.J.G.M.; Allen, Herbert E.

    2014-01-01

    The bioavailability of Cu, Zn, Pb and Cd from field-aged orchard soils in a certified fruit plantation area of the Northeast Jiaodong Peninsula in China was assessed using bioassays with earthworms (Eisenia fetida) and chemical assays. Soil acidity increased with increasing fruit cultivation periods

  15. Cover crops for managing weeds, soil chemical fertility and nutritional status of organically grown orange orchard in Sicily

    Directory of Open Access Journals (Sweden)

    Rosario Paolo Mauro

    2015-06-01

    Full Text Available Cover crops can offer significant advantages in the agronomic management of citrus orchards in Mediterranean environments. Therefore, a three-year research was conducted in eastern Sicily aimed at studying the effects of four cover crop sequences (Sinapis arvensis-Trigonella foenum-graecum-T. foenum-graecum; Medicago scutellata-Avena sativa-Lolium perenne; Vicia faba minor-A. sativa-A. sativa; A. sativa-V. faba. minor-L. perenne on weeds, major soil chemical properties and nutritional status of an organically grown orange orchard. The results highlighted that, among the studied cover crop sequences, Vicia faba-Avena-Avena was the most beneficial for weeds control within the orchard (92%, of cover crop cover, and 586 and 89 g DW m–2 of cover crop aboveground biomass and weeds aboveground biomass, respectively. Overall, the chemical fertility of the soil was positively influenced. In particular, it was observed an increase of the content of total nitrogen and available phosphorus in the soil by both Sinapis-Trigonella-Trigonella (0.75 g kg–1 and 59.0 mg kg–1, respectively and Vicia faba-Avena-Avena (0.70 g kg–1 and 56.0 mg kg–1, respectively cover crop sequences. Medicago-Avena-Lolium sequence seemed to be the most useful to ensure a better nutritional status of the orange orchard.

  16. Interspecific hybridization and inbreeding effect in seed from a Eucalyptus grandis x E. urophylla clonal orchard in Brazil

    Directory of Open Access Journals (Sweden)

    Campinhos Eduardo N.

    1998-01-01

    Full Text Available We used allozyme markers to estimate the amount of natural hybridization between Eucalyptus grandis and E. urophylla in a 7.4-hectare commercial hybrid-seed orchard planted in Espírito Santo, Brazil. This orchard was planted in 1982 using a honeycomb design, with each hexagonal plot containing one E. grandis tree surrounded by six E. urophylla trees. There were 267 replicated hexagonal plots in the orchard. Seeds were harvested from the E. grandis clone only. The multilocus outcrossing rate estimated for the E. grandis clone averaged 70.2%, ranging from 33.0 to 99.0% among individual trees. Contaminant pollination, inferred from progeny genotypes containing alleles not present in the seven parental clones, accounted for 14.4% of the hybrid seed. Contaminant pollen was attributed to neighboring eucalyptus stands isolated from the orchard by a 400-m wide belt of native forest. Inbred and hybrid progenies were identified by their allozyme genotypes and transplanted to the field. Field growth of inbred progeny was 30% lower than that of hybrid plants at two and three years of age.

  17. Environmental impact of introducing plant covers in the taluses of orchard terraces: implications for erosion and agricultural runoff control

    NARCIS (Netherlands)

    Rodriguez Pleguezuelo, C.R.; Duran Zuazo, V.H.; Francia Martinez, J.R.; Martin Peinado, F.J.; Graaff, de J.; Muriel Fernandez, J.L.

    2011-01-01

    South-eastern Spain, and in particular the coastal areas of Granada and Malaga, feature a large area under subtropical crops, with orchards established on terraces built along the slopes of the mountainous areas. The climate, characterized by periodically heavy rainfall, variable in space and time,

  18. Energetic Materials Effects on Essential Soil Processes: Decomposition of Orchard Grass (Dactylis glomerata) Litter in Soil Contaminated with Energetic Materials

    Science.gov (United States)

    2014-02-01

    availabilities of their respective food sources (bacteria and fungi ), were also unaffected-or-increasing in soil with CL-20 treatments. This is...ENERGETIC MATERIALS EFFECTS ON ESSENTIAL SOIL PROCESSES: DECOMPOSITION OF ORCHARD...GRASS (DACTYLIS GLOMERATA) LITTER IN SOIL CONTAMINATED WITH ENERGETIC MATERIALS ECBC-TR-1199 Roman G. Kuperman Ronald T. Checkai Michael Simini

  19. Association of Xylella fastidiosa with Yield Loss and Altered Fruit Quality in a Naturally Infected Rabbiteye Blueberry Orchard

    Science.gov (United States)

    Xylella fastidiosa causes disease in a number of plants in the southeastern United States, including southern highbush blueberry, but little was known concerning its potential impact in rabbiteye blueberry (Vaccinium virgatum). In a naturally infected orchard in Louisiana, mean yields of X. fastidi...

  20. Impact of pest control strategies on the arthropodofauna living in bird nests built in nestboxes in pear and apple orchards.

    Science.gov (United States)

    Roy, Lise; Bouvier, Jean-Charles; Lavigne, Claire; Galès, Mathieu; Buronfosse, Thierry

    2013-08-01

    Pesticide applications have a strong impact on biodiversity in agroecosystems. The present study aimed to assess the impact of pest control strategies on the arthropodofauna of Parus major nests built within nestboxes installed in orchards. Unlike many studied groups, these arthropod communities are not in direct contact with pesticide sprays (on account of their being sheltered by nestboxes) and are also unable to move away from the treated area. In this pilot study, we estimated the prevalence and the taxonomic and ecological diversities of arthropodofauna sampled in the nests and assessed the extent to which the whole and nest-specific arthropodofauna were affected by pest control strategies. Sixteen different insect and arachnid Primary Taxonomic Groups (PTGs, order level or below) were found in nests. The best represented PTGs (≥10% occurrence in years 2007 and 2008) were Psocoptera (Insecta, detritivorous/saprophagous), detritivorous/saprophagous Astigmata (Acari) and hematophagous Mesostigmata (Acari). Pest control strategies had a large impact on the prevalence of arthropods in nests, with higher proportions of nests hosting arthropods in organic orchards than in conventional orchards and with intermediate proportions in nests in Integrated Pest Management orchards. In contrast, pest control strategies had no significant effect on the composition of the arthropod communities when only nests hosting nidicolous arthropods were considered.