The completion of the Mammalian Gene Collection (MGC)
Temple, Gary; Gerhard, Daniela S.; Rasooly, Rebekah; Feingold, Elise A.; Good, Peter J.; Robinson, Cristen; Mandich, Allison; Derge, Jeffrey G.; Lewis, Jeanne; Shoaf, Debonny; Collins, Francis S.; Jang, Wonhee; Wagner, Lukas; Shenmen, Carolyn M.; Misquitta, Leonie; Schaefer, Carl F.; Buetow, Kenneth H.; Bonner, Tom I.; Yankie, Linda; Ward, Ming; Phan, Lon; Astashyn, Alex; Brown, Garth; Farrell, Catherine; Hart, Jennifer; Landrum, Melissa; Maidak, Bonnie L.; Murphy, Michael; Murphy, Terence; Rajput, Bhanu; Riddick, Lillian; Webb, David; Weber, Janet; Wu, Wendy; Pruitt, Kim D.; Maglott, Donna; Siepel, Adam; Brejova, Brona; Diekhans, Mark; Harte, Rachel; Baertsch, Robert; Kent, Jim; Haussler, David; Brent, Michael; Langton, Laura; Comstock, Charles L.G.; Stevens, Michael; Wei, Chaochun; van Baren, Marijke J.; Salehi-Ashtiani, Kourosh; Murray, Ryan R.; Ghamsari, Lila; Mello, Elizabeth; Lin, Chenwei; Pennacchio, Christa; Schreiber, Kirsten; Shapiro, Nicole; Marsh, Amber; Pardes, Elizabeth; Moore, Troy; Lebeau, Anita; Muratet, Mike; Simmons, Blake; Kloske, David; Sieja, Stephanie; Hudson, James; Sethupathy, Praveen; Brownstein, Michael; Bhat, Narayan; Lazar, Joseph; Jacob, Howard; Gruber, Chris E.; Smith, Mark R.; McPherson, John; Garcia, Angela M.; Gunaratne, Preethi H.; Wu, Jiaqian; Muzny, Donna; Gibbs, Richard A.; Young, Alice C.; Bouffard, Gerard G.; Blakesley, Robert W.; Mullikin, Jim; Green, Eric D.; Dickson, Mark C.; Rodriguez, Alex C.; Grimwood, Jane; Schmutz, Jeremy; Myers, Richard M.; Hirst, Martin; Zeng, Thomas; Tse, Kane; Moksa, Michelle; Deng, Merinda; Ma, Kevin; Mah, Diana; Pang, Johnson; Taylor, Greg; Chuah, Eric; Deng, Athena; Fichter, Keith; Go, Anne; Lee, Stephanie; Wang, Jing; Griffith, Malachi; Morin, Ryan; Moore, Richard A.; Mayo, Michael; Munro, Sarah; Wagner, Susan; Jones, Steven J.M.; Holt, Robert A.; Marra, Marco A.; Lu, Sun; Yang, Shuwei; Hartigan, James; Graf, Marcus; Wagner, Ralf; Letovksy, Stanley; Pulido, Jacqueline C.; Robison, Keith; Esposito, Dominic; Hartley, James; Wall, Vanessa E.; Hopkins, Ralph F.; Ohara, Osamu; Wiemann, Stefan
2009-01-01
Since its start, the Mammalian Gene Collection (MGC) has sought to provide at least one full-protein-coding sequence cDNA clone for every human and mouse gene with a RefSeq transcript, and at least 6200 rat genes. The MGC cloning effort initially relied on random expressed sequence tag screening of cDNA libraries. Here, we summarize our recent progress using directed RT-PCR cloning and DNA synthesis. The MGC now contains clones with the entire protein-coding sequence for 92% of human and 89% of mouse genes with curated RefSeq (NM-accession) transcripts, and for 97% of human and 96% of mouse genes with curated RefSeq transcripts that have one or more PubMed publications, in addition to clones for more than 6300 rat genes. These high-quality MGC clones and their sequences are accessible without restriction to researchers worldwide. PMID:19767417
Allied, MGC link on cyanate esters
International Nuclear Information System (INIS)
Wood, A.
1993-01-01
In the latest of a line of joint ventures in its plastics business, Allied Signal has reached agreement with Mitsubishi Gas Chemical (MGC) to jointly develop thermoset cyanate ester resins and blends. The deal will involve further development of Allied Signal's Primaset phenol-formaldehyde cyanate ester resins, a new entrant in the thermoset arena. Although the Primaset resins were discovered in the 1960s, this would be the first time they are available commercially. The deal will marry Primaset technology with MGC's Skylex bisphenol A cyanate ester resins, says Fred DiAntonis, director/advanced materials at Allied Signal. The two firms are looking at marketing blends of the two materials. The potential market for these resins, used commercially by the electronics industry in printed circuit boards and by the aerospace industry in composites, is significant, says Robert P. Viarengo, Allied Signal president/performance materials. By aligning ourselves with MGC, the world leader in cyanate ester resin, we anticipate moving forward aggressively. The main competitor is Ciba, which acquired bisphenol A cyanate ester resins with its purchase of Rhone-Poulenc's high temperature resins business. DiAntonis estimates the market for cyanate ester resins could be worth $150 million by the end of the decade, although development costs have been in the tens of millions of dollars range
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
The R and D were conducted with the aim of using melt-growth composite materials (MGC) as structural members of the gas turbine system for power generation, etc., and the results of the FY 2000 results were summed up. As to the heightening of performance of MGC materials, improvement in high temperature strength, fracture toughness and thermal shock resistance was obtained by making the material structure minute by increasing the mold descending speed in ternary system MGC materials. Concerning the enlarging technology, trially manufactured were a large sample of 53mm diameter and a thin plate of 40mm width x 80mm height x 6mm thickness. In the study of evaluation of mechanical/physical characteristics of MGC materials, the following were indicated: AYZ ternary system MGC materials were twice higher in bending strength than Al{sub 2}O{sub 3}/YAG binary system, and were equal in creep characteristics at 1,700 degrees C to Al{sub 2}O{sub 3}/YAG. The applicability to turbine stationary blade was shown. In the system study, by applying MGC materials to gas turbine stationary blade, small- and medium-size gas turbine cycles were set up which have plant gross thermal efficiency of 38% at turbine inlet temperature of 1,700 degrees C. (NEDO)
10Gbps 2D MGC OCDMA Code over FSO Communication System
Professor Urmila Bhanja, Associate, Dr.; Khuntia, Arpita; Alamasety Swati, (Student
2017-08-01
Currently, wide bandwidth signal dissemination along with low latency is a leading requisite in various applications. Free space optical wireless communication has introduced as a realistic technology for bridging the gap in present high data transmission fiber connectivity and as a provisional backbone for rapidly deployable wireless communication infrastructure. The manuscript highlights on the implementation of 10Gbps SAC-OCDMA FSO communications using modified two dimensional Golomb code (2D MGC) that possesses better auto correlation, minimum cross correlation and high cardinality. A comparison based on pseudo orthogonal (PSO) matrix code and modified two dimensional Golomb code (2D MGC) is developed in the proposed SAC OCDMA-FSO communication module taking different parameters into account. The simulative outcome signifies that the communication radius is bounded by the multiple access interference (MAI). In this work, a comparison is made in terms of bit error rate (BER), and quality factor (Q) based on modified two dimensional Golomb code (2D MGC) and PSO matrix code. It is observed that the 2D MGC yields better results compared to the PSO matrix code. The simulation results are validated using optisystem version 14.
Mammalian cDNA Library from the NIH Mammalian Gene Collection (MGC) | Office of Cancer Genomics
The MGC provides the research community full-length clones for most of the defined (as of 2006) human and mouse genes, along with selected clones of cow and rat genes. Clones were designed to allow easy transfer of the ORF sequences into nearly any type of expression vector. MGC provides protein ‘expression-ready’ clones for each of the included human genes. MGC is part of the ORFeome Collaboration (OC).
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
One of the main subjects for further conserving energy by enhancing efficiency of gas turbine system for power generation, etc. is the heightening of operation temperature. The development is urgently needed of heat-resistant ultra-high temperature members which make high-reliable operation under ultra-high temperature possible. Therefore, an introductory study was made aiming at using MGC materials which does not reduce strength even at high temperature and also has plastic deformability as large-size structure members of gas turbine system for power generation use. In FY 1998, the following were studied: (1) basic study to get material design guidelines for making efficiency of MGC materials higher; (2) construction of the basic data for elucidating the manifestation mechanism of high temperature characteristics of MGC materials; (3) setting of gas turbine specifications which are to be the basis of study work in and after FY 1999; (4) setting of parameters to be evaluated, evaluation criteria, etc., and definition of the evaluation criteria for possibility of establishing an MGC ultra-high efficiency gas turbine system. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
For the purpose of using MGC which maintain the strength even at high temperature and also have plastic deformability as power generation use gas turbine system structural member, a leading research is conducted from FY 1998 to FY 2000. Based on the results of the FY 1998 research, the following were conducted in FY 1999: study through the trial manufacturing test to obtain the material design guide related to the heightening of efficiency of MGC and improvement of production process technology of MGC; evaluation from various angles of the data needed to elucidate the mechanism to manifest high-temperature characteristics of MGC. Further, through the following, a draft was drawn up for the developmental plan on the MGC ultra-high efficiency turbine system technology: establishment of gas turbine cycle (secondary draft); definition of developmental targets in the full-scale R and D after the leading research; extraction of technical subjects and study of contents of the R and D. The 5-year R and D plan was able to be worked out by setting up an R and D target that the generating end efficiency is 38% at turbine inlet temperature of 1,700 degrees C. (NEDO)
Zhang, Xiu-Zhen; Wang, Ling; Liu, Dong-Wu; Tang, Guang-Yan; Zhang, Hong-Yu
2014-09-01
This study aims at evaluating the anticancer effects of berberine hydrochloride (berberine) and d-limonene, alone and in combination, on human gastric carcinoma cell line MGC803 to determine whether berberine and d-limonene work synergistically and elucidate their mechanisms. MGC803 cells were treated with berberine and d-limonene, alone and in combination, for 24-48 h. The inhibitory effects of these drugs on growth were determined by MTT assay. The combination index and drug reduction index were calculated with the Chou-Talalay method based on the median-effect principle. Flow cytometry and laser scanning confocal microscopy were employed to evaluate the effects of both drugs on cell-cycle perturbation and apoptosis, generation of reactive oxygen species (ROS), mitochondrial membrane potential, and expression of Bcl-2 and caspase-3 in MGC803 cells. Berberine or d-limonene alone can inhibit the growth of MGC803 cells in a dose- and time-dependent manner. Berberine and d-limonene at a combination ratio of 1:4 exhibited a synergistic effect on anti-MGC803 cells. The two drugs distinctly induced intracellular ROS generation, reduced the mitochondrial transmembrane potential (ΔΨm), enhanced the expression of caspase-3, and decreased the expression of Bcl-2. The combination of berberine and d-limonene showed more remarkable effects compared with drugs used singly in MGC803 cells. The combination of berberine and d-limonene exerted synergistic anticancer effects on MGC803 cells by cell-cycle arrest, ROS production, and apoptosis induction through the mitochondria-mediated intrinsic pathway.
Dupuy, Fabienne; Rouyar, Angéla; Deisig, Nina; Bourgeois, Thomas; Limousin, Denis; Wycke, Marie-Anne; Anton, Sylvia; Renou, Michel
2017-01-01
Recognition of intra-specific olfactory signals within a complex environment of plant-related volatiles is crucial for reproduction in male moths. Sex pheromone information is detected by specific olfactory receptor neurons (Phe-ORNs), highly abundant on the male antenna. The information is then transmitted to the pheromone processing macroglomerular complex (MGC) within the primary olfactory center, the antennal lobe, where it is processed by local interneurons and projection neurons. Ultimately a behavioral response, orientation toward the pheromone source, is elicited. Volatile plant compounds (VPCs) are detected by other functional types of olfactory receptor neurons (ORNs) projecting in another area of the antennal lobe. However, Phe-ORNs also respond to some VPCs. Female-produced sex pheromones are emitted within a rich environment of VPCs, some of which have been shown to interfere with the detection and processing of sex pheromone information. As interference between the different odor sources might depend on the spatial and temporal features of the two types of stimuli, we investigated here behavioral and neuronal responses to a brief sex pheromone blend pulse in a VPC background as compared to a control background in the male noctuid moth Agrotis ipsilon . We observed male orientation behavior in a wind tunnel and recorded responses of Phe-ORNs and MGC neurons to a brief sex pheromone pulse within a background of individual VPCs. We also recorded the global input signal to the MGC using in vivo calcium imaging with the same stimulation protocol. We found that VPCs eliciting a response in Phe-ORNs and MGC neurons masked responses to the pheromone and decreased the contrast between background odor and the sex pheromone at both levels, whereas α-pinene did not interfere with first order processing. The calcium signal produced in response to a VPC background was tonic, lasting longer than the VPC stimulus duration, and masked entirely the pheromone response
Directory of Open Access Journals (Sweden)
Wu Jian
2012-08-01
Full Text Available Abstract Background Buddleja davidii is widely distributed in the southwestern region of China. We have undertaken a systematic analysis of B. davidii as a Chinese traditional medicine with anticancer activity by isolating natural products for their activity against the human gastric cancer cell line Mgc-803 and the human breast cancer cell line Bcap-37. Results Ten compounds were extracted and isolated from B. davidii, among which colchicine was identified in B. davidii for the first time. The inhibitory activities of these compounds were investigated in Mgc-803, Bcap-37 cells in vitro by MTT [3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide] assay, and the results showed that luteolin and colchicine had potent inhibitory activities against the growth of Mgc-803 cells. Subsequent fluorescence staining and flow cytometry analysis indicated that these two compounds could induce apoptosis in Mgc-803 cells. The results also showed that the percentages of early apoptotic cells (Annexin V+/PI-, where PI is propidium iodide and late apoptotic cells (Annexin V+/PI+ increased in a dose- and time-dependent manner. After 36 h of incubation with luteolin at 20 μM, the percentages of cells were approximately 15.4% in early apoptosis and 43.7% in late apoptosis; after 36 h of incubation with colchicine at 20 μM, the corresponding values were 7.7% and 35.2%, respectively. Conclusions Colchicine and luteolin from B. davidii have potential applications as adjuvant therapies for treating human carcinoma cells. These compounds could also induce apoptosis in tumor cells.
Wu, Jian; Yi, Wenshi; Jin, Linhong; Hu, Deyu; Song, Baoan
2012-08-31
Buddleja davidii is widely distributed in the southwestern region of China. We have undertaken a systematic analysis of B. davidii as a Chinese traditional medicine with anticancer activity by isolating natural products for their activity against the human gastric cancer cell line Mgc-803 and the human breast cancer cell line Bcap-37. Ten compounds were extracted and isolated from B. davidii, among which colchicine was identified in B. davidii for the first time. The inhibitory activities of these compounds were investigated in Mgc-803, Bcap-37 cells in vitro by MTT [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] assay, and the results showed that luteolin and colchicine had potent inhibitory activities against the growth of Mgc-803 cells. Subsequent fluorescence staining and flow cytometry analysis indicated that these two compounds could induce apoptosis in Mgc-803 cells. The results also showed that the percentages of early apoptotic cells (Annexin V+/PI-, where PI is propidium iodide) and late apoptotic cells (Annexin V+/PI+) increased in a dose- and time-dependent manner. After 36 h of incubation with luteolin at 20 μM, the percentages of cells were approximately 15.4% in early apoptosis and 43.7% in late apoptosis; after 36 h of incubation with colchicine at 20 μM, the corresponding values were 7.7% and 35.2%, respectively. Colchicine and luteolin from B. davidii have potential applications as adjuvant therapies for treating human carcinoma cells. These compounds could also induce apoptosis in tumor cells.
Hydrogen sorption properties of ball-milled Mg-C nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Spassov, Tony; Zlatanova, Zlatina; Spassova, Maya; Todorova, Stanislava [Faculty of Chemistry, University of Sofia ' ' St.Kl.Ohridski' ' , 1 James Bourchier str. 1164 Sofia (Bulgaria)
2010-10-15
MgH{sub 2} 75 at.%-C 25 at.% composites are synthesized by ball milling using different kinds of carbon additives: carbon black (CB), nanodiamonds (ND) and amorphous carbon soot (AC). X-ray diffraction analysis showed that the MgH{sub 2} phase in the as-obtained composite powders is nanocrystalline (80-100 nm). The SEM observations revealed that the samples consist of 5-15 {mu}m MgH{sub 2} particles, surrounded and in some cases coated by carbon flakes. The composite containing nanodiamonds revealed strong decrease of the MgH{sub 2} decomposition temperature with more than 100 C, compared to ball-milled pure MgH{sub 2}. Important issue of the present study is also the low temperature hydriding of the ball-milled Mg-C nanocomposites, investigated by high-pressure DSC. The process starts at about 200 C for all materials studied, but the hydriding mechanism looks different for the composites with different kinds of carbon additives. Whereas for Mg-carbon black it takes place in a relatively narrow temperature range, expressed by a single exothermic peak (200-300 C) for the other two composites the hydriding is a multi-step process, featured by two overlapped exothermic peaks for Mg-nanodiamonds and by two well separated exothermic effects (at about 300 C and 400 C) for Mg-amorphous carbon soot. The observed difference in the hydriding behavior of the Mg-C composites is attributed to the different kind of carbon component, which is supposed to play a catalytic role as well as protects magnesium from oxidation. The incorporation of carbon into the MgH{sub 2} particles results in the formation of high density of defects (dislocations and grain boundaries), which is supposed to be among the most possible reasons for the decreased hydride decomposition temperature. The Mg-C nanocomposites show reproducible hydriding/dehydriding behavior (thermodynamics and kinetics) during multiple cycling. Among the composites in the present study ''Mg-carbon black
study of the magnetic field of the MGC-20 cyclotron accelerator magent
International Nuclear Information System (INIS)
Gad, K.M.M.
2007-01-01
studies of the magent of the MGC-20 cyclotron were carried out. measurements of the magnetic field were done in the cyclotron project, EAEA. calculations of the magnetic field were carried out using Poisson's 2D code, which was developed in Los Alamos laboratories in the USA. we developed a new calculation method for the magnetic field which is the independent layer method. a comparison between the measured and the calculated values for the magnetic field was done, we found good agreement between them, also we calculated the averaged magnetic field and found that the calculations show good isochronous magnetic field which is important in the focusing of the ion beam . study of the poisson code is presented as a target of the master plane to have a good understanding of the code as a step to develop the program or to do another one, this new calculation method proved to give good results for the magnetic field of a complicated magnet such as that of the MGC-20 magnet
Approximations for the waiting time distribution in an M/G/c priority queue
Al Hanbali, Ahmad; Alvarez, Elisa; van der Heijden, Matthijs C.
2013-01-01
We investigate the use of priority mechanisms when assigning service engineers to customers as a tool for service differentiation. To this end, we analyze a non-preemptive M/G/c priority queue with various customer classes. For this queue, we present various accurate and fast methods to estimate the
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
To further enhance energy efficiency by improving on the gas turbine system, it is necessary, first of all, to develop superhigh-temperature materials to allow the system to operate at higher temperatures. Described in this report are studies on the application of MGC (melt-growth composite) materials which retain strength and plastic deformation capability even at high temperatures. Various compositions are explored for improvement on fracture toughness and thermal shock resistance. The Al{sub 2}O{sub 3}/YAG system is investigated for the study of relations between microstructural control and fracture toughness. Literature on the development of nanocomposites is surveyed, and a preliminary experiment is discussed for improvement on purity by zone melting crystallization. In a study for an advanced manufacture of larger crystals, technologies of crystal growth condition setting and optimization, quality stabilization, productivity improvement, and crystal size enlargement are taken up. Casting and machining technologies are studied to enable crystals to assume complicated shapes. For the purpose of elucidating the mechanism of the occurrence of properties proper to high temperatures, a study is made on the evaluation of mechanical and physical properties and on the mechanism and control of crystal growth. Also studied are systems (gas turbine cycle, combustor, etc.) to which MGC materials may be applied. (NEDO)
Unexpected plant odor responses in a moth pheromone system
Directory of Open Access Journals (Sweden)
Angéla eRouyar
2015-05-01
Full Text Available Male moths rely on olfactory cues to find females for reproduction. Males also use volatile plant compounds (VPCs to find food sources and might use host-plant odor cues to identify the habitat of calling females. Both the sex pheromone released by conspecific females and VPCs trigger well-described oriented flight behavior towards the odor source. Whereas detection and central processing of pheromones and VPCs have been thought for a long time to be highly separated from each other, recent studies have shown that interactions of both types of odors occur already early at the periphery of the olfactory pathway. Here we show that detection and early processing of VPCs and pheromone can overlap between the two sub-systems. Using complementary approaches, i.e. single-sensillum recording of olfactory receptor neurons, in vivo calcium imaging in the antennal lobe, intracellular recordings of neurons in the macroglomerular complex (MGC and flight tracking in a wind tunnel, we show that some plant odorants alone, such as heptanal, activate the pheromone-specific pathway in male Agrotis ipsilon at peripheral and central levels. To our knowledge, this is the first report of a plant odorant with no chemical similarity to the molecular structure of the pheromone, acting as a partial agonist of a moth sex pheromone.
Seniuk, Olga F; Gorovoj, Leontiy F; Beketova, Galina V; Savichuk, Hatalia O; Rytik, Petr G; Kucherov, Igor I; Prilutskay, Alla B; Prilutsky, Alexandr I
2011-01-01
The goal of this investigation was to comparatively study the efficiency of traditionally used anti-infective drugs and biopolymer complexes originated from the medicinal mushroom Fomes fomentarius (L.:Fr.) Fr.: 1) water-soluble melanin-glucan complex (MGC; -80% melanins and -20% beta-glucans) and 2) insoluble chitin-glucan-melanin complex (ChGMC; -70% chitin, -20% beta-glucans, and -10% melanins). Infectious materials (Helicobacter pylori, Candida albicans, and Herpes vulgaris I and HIV-1(zmb) were used in pure cultures of in vitro and in vivo models on experimental animals. Comparison studies of fungal biopolymers and effective modern antifungal, antibacterial, and antiviral drugs were used in in vitro models. The comparative clinical efficiency of ChGMC and of etiotropic pharmaceuticals in models of H. pylori, C. albicans, and H. vulgaris I infection contamination were studied. Using in vitro models, it was established that MGC completely depresses growth of C. albicans. MGC had an antimicrobial effect on H. pylori identical to erythromycin in all concentrations, and had a stronger action on this bacterium than other tested antibiotics. Tested MGC possesses simultaneously weak toxicity and high anti-HIV-1 activity in comparison with zidovudine (Retrovir). The obtained results show that CLUDDT therapy in Wistar rats with the application of ChGMC is, on average, 1.35-1.43 times as effective as a traditional one. Considering the absence of MGC and ChGMC toxic properties on blood cells even in very high concentrations, these complexes may be used as a source of biopolymers for the creation of essentially new agents for wide application in infectious pathology.
Guo, Junfu; Bian, Yue; Wang, Yu; Chen, Lisha; Yu, Aiwen; Sun, Xiuju
2017-10-01
FAM107B expression was decreased in stomach cancer and many other kinds of cancer. The forced expression of FAM107B in HeLa cells diminished proliferation in response to growth factors, suggesting that FAM107B might play important roles in many types of cancers. But the mechanisms underlying the decreased expression of FAM107B in cancers are not clear, the functional significance needs to be further clarified. Our previous findings from cDNA microarray showed that there are 179 differentially expressed genes after S100A4 inhibition in gastric cancer cells MGC803. FAM107B was an upregulated one among them. In the present study, we confirmed that FAM107B expression was upregulated in MGC803 cells after S100A4 inhibition by qRT-PCR. We demonstrated for the first time that FAM107B was downregulated by S100A4. The results from CCK-8 and transwell assay showed that FAM107B inhibition by siRNA led to significantly increased proliferation and migrating abilities of MGC803 cells, respectively, indicating that FAM107B plays important roles in inhibiting the proliferation and migration of MGC803 cells. The rescue experiment showed that FAM107B-siRNA transfection reversed the reduced proliferation and migration abilities induced by S100A4 inhibition in the cells. These findings suggest that, as a downstream effector, FAM107B at least partly mediates the effect of S100A4 on the proliferation and migration of MGC803 cells. In conclusion, we first provide experimental evidence suggesting that FAM107B was downregulated by S100A4 in gastric cancer MGC803 cells. And FAM107B at least partially mediates the biological effect of S100A4 in the cells. © 2017 International Federation for Cell Biology.
Improving the performance of the power supply of the MGC-20 cyclotron harmonic coils
International Nuclear Information System (INIS)
Hagras, A.A.M
2008-01-01
Correction of lower harmonics of the MGC-20 cyclotron magnetic field is of great importance for its operation. Actually, stability of the acceleration process, attainment of the final energy of the accelerated beam and efficiency of the beam extraction system depend on the lower harmonics control. Error in the magnetic field lower harmonics can reduce the efficiency of the beam extraction resulting in complete disappearance of the extracted beam of the cyclotron. For control of the cyclotron MGC-20 magnetic field lower harmonics, the so called inner and outer harmonic coils are provided.These harmonic coils must be fed by a very high accuracy current source power supply. This power supply must be equipped with a high resolution measurement and control scheme to achieve the imposed requirements of adjustment of the first harmonic magnetic field.Harmonic coils are supplied with conventional SCR controlled converters with analog control strategy. Frequent interruption of operation and difficulties in the adjustment of harmonic coil current lead to economical and research - time losses.This research project aims to replace this conventional system with a more effective, accurate and less complicated digital control system based on Motorola DSP56F807 and high switching frequency power circuit. Actually all the bulky modules including the analog integrator, the signal monitoring and protection, the pulse phase modulator and the comparator are all replaced by a single module circuit.
Directory of Open Access Journals (Sweden)
O. F. Seniuk
2014-06-01
Full Text Available Protective effect of melanin-glucan complex from F. fomentarius (MGC and Russian armed forces radiopro-tector indralin in the model of acute exposure by dose of 5.95 Gy/8.5min care is compared. Obtained results indi-cate availabi¬lity at MGC and indralin both direct and indirect "bystander effect” of DNA-protective properties, as well as severe anxiolytic activity. Thus for indralin protection factor was 0.33 when in MGC it was 2.3 times higher (0.75.
Zhou, Donghui; Zhou, Yong; Li, Chao; Yang, Lina
2018-04-01
B7-H4 is a transmembrane protein which is a member of the B7 superfamily. It is overexpressed in various types of cancer, including gastric cancer. However, the effects of B7-H4 on the tumorigenicity of gastric cancer and the underlying mechanisms have not yet been fully explored. Thus, the aim of this study was to examine the effects of B7-H4 on the tumorigenicity of gastric cancer cells and to elucidate the underlying mechanisms. For this purpose, B7-H4 expression in gastric cancer tissues was detected by immunohistochemical staining. The effects of B7-H4 on the biological behavior of the MGC-803 human gastric cancer cell line were examined by Cell Counting kit-8 (CCK-8) assay, cell cycle analysis, wound healing assay, Annexin V/propidium iodide staining and terminal deoxynucleotidyl transferase dUTP nick-end labeling (TUNEL) assay. Moreover, the expression levels of apoptotic markers, such as cleaved caspase‑3, cleaved caspase‑9, Bcl-2 and Bax were examined by western blot analysis. Immunohistochemical staining revealed that a high expression of B7-H4 was found in about 41.8% of tissues obtained from patients with gastric cancer. Comparative analysis revealed that B7-H4 expression significantly correlated with lymph node metastasis and the TNM stage. The results of CCK-8 assay, cell cycle analysis, wound healing assay, Annexin V/propidium iodide staining assay and TUNEL assay all demonstrated that the silencing of B7-H4 by small interfering RNA decreased cell proliferation, suppressed cell motility, and induced cell cycle arrest and the apoptosis of MGC-803 human gastric cancer cells. Furthermore, the results of western blot analysis indicated that the downregulation of B7-H4 induced the apoptosis of the MGC-803 cells via the mitochondrial signaling pathway through the activation of caspase‑3 and caspase‑9, and by altering the Bax/Bcl-2 ratio in a manner that favored apoptosis. Based on the findings on human gastric cancer cell line MGC-803, the
Improving the thermal performance of the MGC-20 cyclotron accelerator ion source
International Nuclear Information System (INIS)
Azab, A.M.N
2010-01-01
The ion source is the heart of the cyclotron accelerator machine. It feeds the electrons to start the plasma generation, and consequently the formation of the ions to be accelerated in the cyclotron's chamber. In addition, it controls the ion beam current and intensity. The performance of the ion source is one of the important factors, which determines the durability, and the production efficiency of the cyclotron. The ion source should have a long stable working life in order to provide particles for isotope production.The regular isotope production program in Egypt's cyclotron facility has been interrupted several times by the sudden break down of the traditional tantalum filament cathode of the ion source. This has been the cause of equipment downtime, for filament replacement. A study for the improvement of the ion source lifetime of the MGC-20 cyclotron accelerator has been carried out by selecting three suitable materials for the ion source filament and compare between them. The cathode material plays a very important role for the production of intense ion beams; hence investigation on other low work-function materials is needed to further enhance the source performance. Two materials were selected for the filament, namely tungsten and molybdenum, in addition to the original tantalum filament. The selected materials for the filament have a high melting point and give low wearing rate during the plasma production, since the filament lifetime of the Livingston source, which is the type used in Egypt's Cyclotron, is usually limited due to the high plasma densities near the filament. In the present work, the effect of the normal operation parameters of the MGC-20 cyclotron on the filament's lifetime is studied for solving the lifetime problem of the MGC-20 cyclotron's ion source.The new types of the filaments were machined from wires, 2.5 mm in diameter, to take the same shape and dimensions as the original tantalum (Ta) filament. The three types of filaments
Design features of isotope production facility at Inshas cyclotron complex. Vol. 1
Energy Technology Data Exchange (ETDEWEB)
Comsan, M N [Nuclear Research Center, Atomic Energy Aurhority, Cairo, (Egypt)
1996-03-01
The nuclear research center, AEA, Egypt is erecting at its Inshas campus cyclotron complex for multidisciplinary use for research and application. The complex is to utilize a russian made AVF cyclotron accelerator of the type MGC-20 with MeV protons. Among its applications, the accelerator will be used for the production of short lived cyclotron isotopes. This article presents a concise description of the design features of isotope production facility to be annexed to the complex layout, schemes for radio waste, ventilation, and air conditioning systems. 2 figs., 2 tabs.
Guo, Xingyu; Zhang, Xiaodong; Wang, Tingan; Xian, Shulin; Lu, Yunfei
2016-06-17
Cancer cells are mainly dependent on glycolysis to generate adenosine triphosphate (ATP) and intermediates required for cell growth and proliferation. Thus, inhibition of glycolysis might be of therapeutic value in antitumor treatment. Our previously studies had found that both 3-bromopyruvate (BP) and sodium citrate (SCT) can inhibit tumor growth and proliferation in vitro and in vivo. However, the mechanism involved in the BP and SCT mediated antitumor activity is not entirely clear. In this work, it is demonstrated that BP inhibits the enzyme hexokinase (HK) activity and SCT suppresses the phosphofructokinase (PFK) activity respectively, both the two agents decrease viability, ATP generation and lactate content in the human gastric cancer cell line MGC-803. These effects are directly correlated with blockage of glycolysis. Furthermore, BP and SCT can induce the characteristic manifestations of mitochondria-regulated apoptosis, such as down-regulation of anti-apoptosis proteins Bcl-2 and Survivin, up-regulation of pro-apoptosis protein Bax, activation of caspase-3, as well as leakage of cytochrome c (Cyt-c). In summary, our results provided evidences that BP and SCT inhibit the MGC-803 cells growth and proliferation might be correlated with inhibiting glycolysis and promoting mitochondria-regulated apoptosis. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Differential senescence capacities in meibomian gland carcinoma and basal cell carcinoma.
Zhang, Leilei; Huang, Xiaolin; Zhu, Xiaowei; Ge, Shengfang; Gilson, Eric; Jia, Renbing; Ye, Jing; Fan, Xianqun
2016-03-15
Meibomian gland carcinoma (MGC) and basal cell carcinoma (BCC) are common eyelid carcinomas that exhibit highly dissimilar degrees of proliferation and prognoses. We address here the question of the differential mechanisms between these two eyelid cancers that explain their different outcome. A total of 102 confirmed MGC and 175 diagnosed BCC cases were analyzed. Twenty confirmed MGC and twenty diagnosed BCC cases were collected to determine the telomere length, the presence of senescent cells, and the expression levels of the telomere capping shelterin complex, P53, and the E3 ubiquitin ligase Siah1. Decreased protein levels of the shelterin subunits, shortened telomere length, over-expressed Ki-67, and Bcl2 as well as mutations in P53 were detected both in MGC and BCC. It suggests that the decreased protein levels of the shelterin complex and the shortened telomere length contribute to the tumorigenesis of MGC and BCC. However, several parameters distinguish MGC from BCC samples: (i) the mRNA level of the shelterin subunits decreased in MGC but it increased in BCC; (ii) P53 was more highly mutated in MGC; (iii) Siah1 mRNA was over-expressed in BCC; (iv) BCC samples contain a higher level of senescent cells; (v) Ki-67 and Bcl2 expression were lower in BCC. These results support a model where a preserved P53 checkpoint in BCC leads to cellular senescence and reduced tumor proliferation as compared to MGC. © 2015 UICC.
Li, Mei; kong, Lin Lin; Gou, Yi; Yang, Feng; Liang, Hong
2014-07-01
A novel binuclear copper(II) complex (complex 1) with taurine Schiff base and imidazole has been synthesized and structurally characterized by single crystal X-ray diffraction, elemental analysis, ESI-MS spectrometry, UV-vis and IR spectroscopy. Single-crystal analysis revealed that 1 displays the sulfonate-bridged dinuclear copper(II) centers. Both copper atoms are five-coordinated and exhibit slightly distorted square pyramidal geometries. Each of copper atom is surrounded by three oxygen atoms and one nitrogen atom from different taurine Schiff base ligands, and one nitrogen atom from one imidazole ligand. The interaction between 1 and calf thymus DNA (CT-DNA) was investigated by UV-vis, fluorescence, circular dichroism (CD) spectra and agarose gel electrophoresis. The experimental results indicated that 1 could bind to CT-DNA via an intercalative mode and show efficient cleavage activity. In addition, 1 showed an antitumor effect on cell cycle and apoptosis. Flow cytometric analysis revealed that MGC-803 cells were arrested in the S phase after treatment with 1. Fluorescence microscopic observation indicated that 1 could induce apoptosis of MGC-803 cells.
Energy Technology Data Exchange (ETDEWEB)
Guo, Xingyu; Zhang, Xiaodong; Wang, Tingan, E-mail: moonsonlife@yahoo.com; Xian, Shulin; Lu, Yunfei, E-mail: doctorlife@126.com
2016-06-17
Cancer cells are mainly dependent on glycolysis to generate adenosine triphosphate (ATP) and intermediates required for cell growth and proliferation. Thus, inhibition of glycolysis might be of therapeutic value in antitumor treatment. Our previously studies had found that both 3-bromopyruvate (BP) and sodium citrate (SCT) can inhibit tumor growth and proliferation in vitro and in vivo. However, the mechanism involved in the BP and SCT mediated antitumor activity is not entirely clear. In this work, it is demonstrated that BP inhibits the enzyme hexokinase (HK) activity and SCT suppresses the phosphofructokinase (PFK) activity respectively, both the two agents decrease viability, ATP generation and lactate content in the human gastric cancer cell line MGC-803. These effects are directly correlated with blockage of glycolysis. Furthermore, BP and SCT can induce the characteristic manifestations of mitochondria-regulated apoptosis, such as down-regulation of anti-apoptosis proteins Bcl-2 and Survivin, up-regulation of pro-apoptosis protein Bax, activation of caspase-3, as well as leakage of cytochrome c (Cyt-c). In summary, our results provided evidences that BP and SCT inhibit the MGC-803 cells growth and proliferation might be correlated with inhibiting glycolysis and promoting mitochondria-regulated apoptosis. -- Highlights: •Blockage of glycolysis might be a novel way to anticancer. •Both 3-bromopyruvate and sodium citrate could inhibit glycolysis and regulate mitochondrial pathway in cancer cells. •Both 3-bromopyruvate and sodium citrate would be the novel agents on treatment of gastric cancer.
International Nuclear Information System (INIS)
Guo, Xingyu; Zhang, Xiaodong; Wang, Tingan; Xian, Shulin; Lu, Yunfei
2016-01-01
Cancer cells are mainly dependent on glycolysis to generate adenosine triphosphate (ATP) and intermediates required for cell growth and proliferation. Thus, inhibition of glycolysis might be of therapeutic value in antitumor treatment. Our previously studies had found that both 3-bromopyruvate (BP) and sodium citrate (SCT) can inhibit tumor growth and proliferation in vitro and in vivo. However, the mechanism involved in the BP and SCT mediated antitumor activity is not entirely clear. In this work, it is demonstrated that BP inhibits the enzyme hexokinase (HK) activity and SCT suppresses the phosphofructokinase (PFK) activity respectively, both the two agents decrease viability, ATP generation and lactate content in the human gastric cancer cell line MGC-803. These effects are directly correlated with blockage of glycolysis. Furthermore, BP and SCT can induce the characteristic manifestations of mitochondria-regulated apoptosis, such as down-regulation of anti-apoptosis proteins Bcl-2 and Survivin, up-regulation of pro-apoptosis protein Bax, activation of caspase-3, as well as leakage of cytochrome c (Cyt-c). In summary, our results provided evidences that BP and SCT inhibit the MGC-803 cells growth and proliferation might be correlated with inhibiting glycolysis and promoting mitochondria-regulated apoptosis. -- Highlights: •Blockage of glycolysis might be a novel way to anticancer. •Both 3-bromopyruvate and sodium citrate could inhibit glycolysis and regulate mitochondrial pathway in cancer cells. •Both 3-bromopyruvate and sodium citrate would be the novel agents on treatment of gastric cancer.
The role of sialomucin CD164 (MGC-24v or endolyn) in prostate cancer metastasis
International Nuclear Information System (INIS)
Havens, AM; Jung, Y; Sun, YX; Wang, J; Shah, RB; Bühring, HJ; Pienta, KJ; Taichman, RS
2006-01-01
The chemokine stromal derived factor-1 (SDF-1 or CXCL12) and its receptor CXCR4 have been demonstrated to be crucial for the homing of stem cells and prostate cancers to the marrow. While screening prostate cancers for CXCL12-responsive adhesion molecules, we identified CD164 (MGC-24) as a potential regulator of homing. CD164 is known to function as a receptor that regulates stem cell localization to the bone marrow. Using prostate cancer cell lines, it was demonstrated that CXCL12 induced both the expression of CD164 mRNA and protein. Functional studies demonstrated that blocking CD164 on prostate cancer cell lines reduced the ability of these cells to adhere to human bone marrow endothelial cells, and invade into extracellular matrices. Human tissue microarrays stained for CD164 demonstrated a positive correlation with prostate-specific antigen levels, while its expression was negatively correlated with the expression of androgen receptor. Our findings suggest that CD164 may participate in the localization of prostate cancer cells to the marrow and is further evidence that tumor metastasis and hematopoietic stem cell trafficking may involve similar processes
Photodissociation spectroscopy of the Mg+-acetic acid complex
Abate, Yohannes; Kleiber, P. D.
2006-11-01
We have studied the structure and photodissociation of Mg+-acetic acid clusters. Ab initio calculations suggest four relatively strongly bound ground state isomers for the [MgC2H4O2]+ complex. These isomers include the cis and trans forms of the Mg+-acetic acid association complex with Mg+ bonded to the carbonyl O atom of acetic acid, the Mg+-acetic acid association complex with Mg+ bonded to the hydroxyl O atom of acetic acid, or to a Mg+-ethenediol association complex. Photodissociation through the Mg+-based 3p←3s absorption bands in the near UV leads to direct (nonreactive) and reactive dissociation products: Mg+, MgOH+, Mg(H2O )+, CH3CO+, and MgCH3+. At low energies the dominant reactive quenching pathway is through dehydration to Mg(H2O)+, but additional reaction channels involving C-H and C-C bond activation are also open at higher energies.
Lu, Xing; Wu, Yi-Ming; Yang, Jing-Mei; Ma, Feng-E; Li, Liang-Ping; Chen, Sheng; Zhang, Ye; Ni, Qing-Ling; Pan, Ying-Ming; Hong, Xue; Peng, Yan
2018-05-10
A series of 2(1H)-quinolinone derivatives and their rhodium (III) complexes were designed and synthesized. All the rhodium (III) complexes exhibited higher in vitro cytotoxicity for Hep G2, HeLa 229, MGC80-3, and NCI-H460 human tumor cell lines than their ligands and cisplatin, and among them complex 9 was found to be selectively cytotoxic to tumor cells. Further investigation revealed that complex 9 caused cell cycle arrest at the G2/M phase and induced apoptosis, and inhibited the proliferation of Hep G2 cells by impeding the phosphorylation of epidermal growth factor receptor (EGFR) and its downstream enzymes. Complex 9 also up-regulated the proapoptotic proteins Bak, Bax, and Bim, which altogether activated caspase-3/9 to initiate cell apoptosis. Notably, complex 9 effectively inhibited tumor growth in the NCI-H460 xenograft mouse model with less adverse effect than cisplatin. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Mycobacteria exploit nitric oxide-induced transformation of macrophages into permissive giant cells.
Gharun, Kourosh; Senges, Julia; Seidl, Maximilian; Lösslein, Anne; Kolter, Julia; Lohrmann, Florens; Fliegauf, Manfred; Elgizouli, Magdeldin; Vavra, Martina; Schachtrup, Kristina; Illert, Anna L; Gilleron, Martine; Kirschning, Carsten J; Triantafyllopoulou, Antigoni; Henneke, Philipp
2017-12-01
Immunity to mycobacteria involves the formation of granulomas, characterized by a unique macrophage (MΦ) species, so-called multinucleated giant cells (MGC). It remains unresolved whether MGC are beneficial to the host, that is, by prevention of bacterial spread, or whether they promote mycobacterial persistence. Here, we show that the prototypical antimycobacterial molecule nitric oxide (NO), which is produced by MGC in excessive amounts, is a double-edged sword. Next to its antibacterial capacity, NO propagates the transformation of MΦ into MGC, which are relatively permissive for mycobacterial persistence. The mechanism underlying MGC formation involves NO-induced DNA damage and impairment of p53 function. Moreover, MGC have an unsurpassed potential to engulf mycobacteria-infected apoptotic cells, which adds a further burden to their antimycobacterial capacity. Accordingly, mycobacteria take paradoxical advantage of antimicrobial cellular efforts by driving effector MΦ into a permissive MGC state. © 2017 The Authors.
Directory of Open Access Journals (Sweden)
Magda Paula Pereira do Nascimento
2011-09-01
Full Text Available Multinucleated giant cells (MGC are cells present in characteristic granulomatous inflammation induced by intracellular infectious agents or foreign materials. The present study evaluated the modulatory effect of granulocyte macrophage colony-stimulating factor (GM-CSF in association with other cytokines such as interferon-gamma (IFN-γ, tumour necrosis factor-alpha, interleukin (IL-10 or transforming growth factor beta (TGF-β1 on the formation of MGC from human peripheral blood monocytes stimulated with Paracoccidioides brasiliensis antigen (PbAg. The generation of MGC was determined by fusion index (FI and the fungicidal activity of these cells was evaluated after 4 h of MGC co-cultured with viable yeast cells of P. brasiliensis strain 18 (Pb18. The results showed that monocytes incubated with PbAg and GM-CSF plus IFN-γ had a significantly higher FI than in all the other cultures, while the addition of IL-10 or TGF-β1 had a suppressive effect on MGC generation. Monocytes incubated with both pro and anti-inflammatory cytokines had a higher induction of foreign body-type MGC rather than Langhans-type MGC. MGC stimulated with PbAg and GM-CSF in association with the other cytokines had increased fungicidal activity and the presence of GM-CSF also partially inhibited the suppressive effects of IL-10 and TGF-β1. Together, these results suggest that GM-CSF is a positive modulator of PbAg-stimulated MGC generation and on the fungicidal activity against Pb18.
Zhou, Yiheng; Kou, Baoquan; Liu, Peng; Zhang, He; Xing, Feng; Yang, Xiaobao
2018-05-01
Magnetic levitation positioning system (MLPS) is considered to be the state of the art in inspection and manufacturing systems in vacuum. In this paper, a magnetic gravity compensator with annular magnet array (AMA-MGC) for MLPS is proposed. Benefiting from the double-layer annular Halbach magnet array on the stator, the proposed AMA-MGC possesses the advantages of symmetrical force, high force density and small force fluctuation. Firstly, the basic structure and operation principle of the AMA-MGC are introduced. Secondly, the basic characteristics of the AMA-MGC such as magnetic field distribution, levitation force, parasitic force and parasitic torque are analyzed by the three-dimensional finite element analysis (3-D FEA). Thirdly, the influence of structural parameters on force density and force fluctuation is investigated, which is conductive to the design and optimization of the AMA-MGC. Finally, a prototype of the AMA-MGC is constructed, and the experiment shows good agreement with the 3-D FEA results.
Freire, Eleonora; Vega, Daniel R; Baggio, Ricardo
2010-06-01
Diaquabis[dihydrogen 1-hydroxy-2-(imidazol-3-ium-1-yl)ethylidene-1,1-diphosphonato-kappa(2)O,O']magnesium(II), [Mg(C(5)H(9)N(2)O(7)P(2))(2)(H(2)O)(2)], consists of isolated dimeric units built up around an inversion centre and tightly interconnected by hydrogen bonding. The Mg(II) cation resides at the symmetry centre, surrounded in a rather regular octahedral geometry by two chelating zwitterionic zoledronate(1-) [or dihydrogen 1-hydroxy-2-(imidazol-3-ium-1-yl)ethylidene-1,1-diphosphonate] anions and two water molecules, in a pattern already found in a few reported isologues where the anion is bound to transition metals (Co, Zn and Ni). catena-Poly[[aquacalcium(II)]-mu(3)-[hydrogen 1-hydroxy-2-(imidazol-3-ium-1-yl)ethylidene-1,1-diphosphonato]-kappa(5)O:O,O':O',O''], [Ca(C(5)H(8)N(2)O(7)P(2))(H(2)O)](n), consists instead of a Ca(II) cation in a general position, a zwitterionic zoledronate(2-) anion and a coordinated water molecule. The geometry around the Ca(II) atom, provided by six bisphosphonate O atoms and one water ligand, is that of a pentagonal bipyramid with the Ca(II) atom displaced by 0.19 A out of the equatorial plane. These Ca(II) coordination polyhedra are ;threaded' by the 2(1) axis so that successive polyhedra share edges of their pentagonal basal planes. This results in a strongly coupled rhomboidal Ca(2)-O(2) chain which runs along [010]. These chains are in turn linked by an apical O atom from a -PO(3) group in a neighbouring chain. This O-atom, shared between chains, generates strong covalently bonded planar arrays parallel to (100). Finally, these sheets are linked by hydrogen bonds into a three-dimensional structure. Owing to the extreme affinity of zoledronic acid for bone tissue, in general, and with calcium as one of the major constituents of bone, it is expected that this structure will be useful in modelling some of the biologically interesting processes in which the drug takes part.
Focus measure method based on the modulus of the gradient of the color planes for digital microscopy
Hurtado-Pérez, Román; Toxqui-Quitl, Carina; Padilla-Vivanco, Alfonso; Aguilar-Valdez, J. Félix; Ortega-Mendoza, Gabriel
2018-02-01
The modulus of the gradient of the color planes (MGC) is implemented to transform multichannel information to a grayscale image. This digital technique is used in two applications: (a) focus measurements during autofocusing (AF) process and (b) extending the depth of field (EDoF) by means of multifocus image fusion. In the first case, the MGC procedure is based on an edge detection technique and is implemented in over 15 focus metrics that are typically handled in digital microscopy. The MGC approach is tested on color images of histological sections for the selection of in-focus images. An appealing attribute of all the AF metrics working in the MGC space is their monotonic behavior even up to a magnification of 100×. An advantage of the MGC method is its computational simplicity and inherent parallelism. In the second application, a multifocus image fusion algorithm based on the MGC approach has been implemented on graphics processing units (GPUs). The resulting fused images are evaluated using a nonreference image quality metric. The proposed fusion method reveals a high-quality image independently of faulty illumination during the image acquisition. Finally, the three-dimensional visualization of the in-focus image is shown.
Cheng, Zhiguo; Zhang, Zhaochong; Hou, Tong; Santosh, M.; Chen, Lili; Ke, Shan; Xu, Lijuan
2017-04-01
The Tarim Large Igneous Province in NW China hosts numerous magmatic carbonatite dikes along its northern margin. The carbonatites are composed mainly of dolomite (90 vol.%) and minor calcite (5 vol.%), with apatite, barite, celestine, aegirine, monazite and bastnaesite as accessory minerals. The rocks correspond to magnesiocarbonatites with a compositional range of 13.73-19.59 wt.% MgO, and 20.03-30.11 wt.% CaO, along with 1.65-3.31 wt.% total Fe2O3, 0.02-2.39 wt.% SiO2 and other minor elements, such as P2O5, Na2O and K2O. These magnesiocarbonatites are characterized by extreme enrichment in incompatible elements with high total rare earth element (REE) contents of 372-36965 ppm. The strontium [(87Sr/86Sr)i = 0.70378-0.70386], neodymium [εNd(t) = +2.51 - +3.59] and oxygen (δ18OV-SMOW = 5.9‰-8.0‰) isotope values of these rocks are consistent with a mantle origin, whereas the magnesium (δ26Mg = -1.09‰ to -0.85‰) and carbon (δ13CV-PDB = -4.1‰ to -5.9‰) isotopes are decoupled from mantle values and reflect signature of recycled sedimentary carbonates. Global plate tectonic models predict that sedimentary carbonates in convergent margins are subducted to deep domains in the mantle, with phase transitions from calcite/dolomite to magnesite, and eventually to periclase/perovskite. The involvement of a mantle plume enhances the normal mantle geotherms and promotes decomposition reactions of magnesite. The decoupling of Mg-C and Sr-Nd-O isotopes in the mangesiocarbonatites provides insights on the origin of carbonatites, and also illustrates a case of interaction between mantle plume and subduction-related components.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Saiyang; Li, Tingyu; Zhang, Yanbing; Xu, Hongde; Li, Yongchun [School of Pharmaceutical Sciences, Key Laboratory of State Ministry of Education, Key Laboratory of Henan province for Drug Quality Control and Evaluation, Collaborative Innovation Center of New Drug Research and Safety Evaluation, Zhengzhou University, 100 Kexue Avenue, Zhengzhou, Henan 450001 (China); Zi, Xiaolin [Department of Urology, University of California, Irvine, Orange (United States); Department of Pharmacology, University of California, Irvine, Orange (United States); Department of Pharmaceutical Sciences, University of California, Irvine, Orange (United States); Yu, Haiyang [Tianjin State Key Laboratory of Modern Chinese Medicine, Tianjin Key Laboratory of TCM Chemistry and Analysis, Institute of Traditional Chinese Medicine, Tianjin University of Traditional Chinese Medicine, 312 Anshanxi Road, Nankai District, Tianjin 300193 (China); Li, Jinfeng [Kidney Transplantation, The First Affiliated Hospital of Zhengzhou University, No. 1 Jianshe Road, Erqi District, Zhengzhou, Henan 450001 (China); Jin, Cheng-Yun, E-mail: cyjin@zzu.edu.cn [School of Pharmaceutical Sciences, Key Laboratory of State Ministry of Education, Key Laboratory of Henan province for Drug Quality Control and Evaluation, Collaborative Innovation Center of New Drug Research and Safety Evaluation, Zhengzhou University, 100 Kexue Avenue, Zhengzhou, Henan 450001 (China); Liu, Hong-Min, E-mail: liuhm@zzu.edu.cn [School of Pharmaceutical Sciences, Key Laboratory of State Ministry of Education, Key Laboratory of Henan province for Drug Quality Control and Evaluation, Collaborative Innovation Center of New Drug Research and Safety Evaluation, Zhengzhou University, 100 Kexue Avenue, Zhengzhou, Henan 450001 (China)
2016-10-15
A new series of 20 brominated chalcone derivatives were designed, synthesized, and investigated for their effects against the growth of four cancer cell lines (EC109, SKNSH, HepG2, MGC803). Among them, compound 19 which given chemical name of H72, was the most potent one on gastric cancer cell lines (i.e. MGC803, HGC27, SGC7901) with IC{sub 50s} ranged from 3.57 to 5.61 μM. H72 exhibited less cytotoxicity to non-malignant gastric epithelial cells GES-1. H72 treatment of MGC803 and HGC27 induced generation of reactive oxygen species (ROS) leading to activation of caspase 9/3 cascade and mitochondria mediated apoptosis. H72 also up-regulated the expression of DR5, DR4 and Bim{sub EL}, and down-regulated the expression of Bid, Bcl-xL, and XIAP. N-acetyl cysteine (NAC), a ROS scavenger completely blocked these effects of H72 in MGC803 cells. Intraperitoneal administration of H72 significantly inhibited the growth of MGC803 cells in vivo in a xenograft mouse model without observed toxicity. These results indicated that H72 is a lead brominated chalcone derivate and deserves further investigation for prevention and treatment of gastric cancer. - Highlights: • 20 brominated chalcone derivatives were designed and synthesized. • H72 caused potent cytotoxic activity against MGC803 and less against GES1. • H72 led to activation of caspase 9/3 cascade and mitochondria mediated apoptosis. • H72 induced generation of reactive oxygen species (ROS). • H72 significantly inhibited the growth of MGC803 cells in vivo.
International Nuclear Information System (INIS)
Bannas, P.; Bakke, J.; Munoz del Rio, A.; Pickhardt, P.J.
2014-01-01
Aim: To perform an objective, intra-individual comparison of residual colonic fluid volume and attenuation associated with the current front-line laxative magnesium citrate (MgC) versus the former front-line laxative sodium phosphate (NaP) at CT colonography (CTC). Materials and methods: This retrospective Health Insurance and Portability and Accountability Act-compliant study had institutional review board approval; informed consent was waived. The study cohort included 250 asymptomatic adults (mean age at index 56.1 years; 124 male/126 female) who underwent CTC screening twice over a 5 year interval. Colon catharsis at initial and follow-up screening employed single-dose NaP and double-dose MgC, respectively, allowing for intra-patient comparison. Automated volumetric analysis of residual colonic fluid volume and attenuation was performed on all 500 CTC studies. Colonic fluid volume <200 ml and mean attenuation between 300–900 HU were considered optimal. Paired t-test and McNemar's test were used to compare differences. Results: Residual fluid volumes <200 ml were recorded in 192 examinations (76.8%) following MgC and in 204 examinations (81.6%) following NaP (p = 0.23). The mean total residual fluid volume was 155 ± 114 ml for MgC and 143 ± 100 ml for NaP (p = 0.01). The attenuation range of 300–900 HU was significantly more frequent for MgC (n = 220, 88%) than for NaP (n = 127, 50.8%; p < 0.001). Mean fluid attenuation was significantly lower for MgC (700 ± 165 HU) than for NaP (878 ± 155 HU; p < 0.001). Concomitant presence of both optimal fluid volume and attenuation was significantly more frequent for MgC 65.2% than for NaP (38%; p < 0.001). Conclusions: Objective intra-individual comparison using automated volumetric analysis suggests that the replacement of NaP by MgC as the front-line laxative for CTC has not compromised overall examination quality. - Highlights: • Automated volumetric analysis provides
Main gas circulator for VG-400 reactor plant
International Nuclear Information System (INIS)
Mitenkov, F.M.; Kostin, V.I.; Novinskij, E.G.; Kuropatov, A.I.; Protsenko, A.N.; Smirnov, V.P.; Stolyarevskij, A.Ya.
1988-01-01
Principle parameters and operating conditions of the main gas circulator (MGC) in VG-400 reactor plant are presented. Brief MGC design description and experimental work scope are given. (author). 4 refs, 4 figs, 1 tab
Directory of Open Access Journals (Sweden)
Ariel Apaoblaza
2014-03-01
Full Text Available Insufficient glycogen content in bovine muscle at slaughter produces meat with high final pH (> 5.8 which is undesirable. The objective of this study was to determine through biopsies the live changes in muscle glycogen concentration (MGC of housed steers fed on hay or hay plus energy concentrate for 30 d and then determine the effect of food deprivation (fasting for 24 h on the same variable. Ten steers of similar age, weight, and phenotypic characteristics were housed in individual pens and randomly assigned to two feeding treatments: ad libitum hay only (H, n = 5 and ad libitum hay plus flaked corn (Zea mays L. (HC, n = 5. Biopsies (B were taken from the Longissimus dorsi muscle at four occasions: the day before the start of experiment (B0, after 15 d (Bl, after 30 d (B2, and fasted for 24 h after B2 (B3. Before each biopsy, steers were sedated with xylazine (0.03 mL kg-1 and lidocaine was applied locally; samples were frozen in liquid nitrogen to determine MGC. Results showed a significant (P H and also of time (B2 > Bl on MGC; the decrease in MGC of steers due to fasting (B2 vs. B3 was not significant (P > 0.05. It was concluded that muscle biopsies allowed to detect a difference in the increase of MGC in steers fed an energy supplementation compared to steers fed hay only, and that fasting for 24 h tended to reduce MGC in both groups.
DEFF Research Database (Denmark)
Grøndahl, M L; Andersen, C Yding; Bogstad, J
2012-01-01
and MGC suggesting specialized function in these compartments, e.g. pepsinogen-A was selectively expressed in MGC, while ryanodine-receptor-2 (RYR2) was selectively expressed in CC. Positive correlations were present between expression levels of RYR2 and the amphiregulin and gap-junction proteins...
Liu, Xiyao; Shi, Xiaoliang; Huang, Yuchun; Deng, Xiaobin; Lu, Guanchen; Yan, Zhao; Zhou, Hongyan; Xue, Bing
2018-03-01
M50 steel is widely applied to manufacture aircraft bearings where service lives are mainly determined by the friction and wear behaviors. The main purpose of this study is to investigate the tribological behaviors and wear mechanisms of M50-1.5 wt.% graphene composites (MGC) prepared by laser additive manufacturing (LAM) (MGC-LAM) sliding against Si3N4 ball from 25 to 550 °C at 18 N-0.2 m/s. XRD, EPMA, FESEM, and EDS mapping were conducted to understand the major mechanisms leading to the improvement in the sliding behavior of MGC-LAM. The results indicated that MGC-LAM showed the excellent friction and wear performance at 25-550 °C for the lower friction coefficient of 0.16-0.52 and less wear rate of 6.1-9.5 × 10-7 mm3 N-1 m-1. Especially at 350 °C, MGC-LAM obtained the best tribological performance (0.16, 6.1 × 10-7mm3 N-1 m-1). It was attributed to the dense coral-like microstructure, as well as the formed surface lubricating structure which is composed of the upper uniform lubricating film with massive graphene and the underneath compacted layer.
DEFF Research Database (Denmark)
Davidson, Alice E; Cheong, Sek-Shir; Hysi, Pirro G
2014-01-01
We describe novel CHRDL1 mutations in ten families with X-linked megalocornea (MGC1). Our mutation-positive cohort enabled us to establish ultrasonography as a reliable clinical diagnostic tool to distinguish between MGC1 and primary congenital glaucoma (PCG). Megalocornea is also a feature of Ne...
Intense blooms of Trichodesmium erythraeum (Cyanophyta) in the open waters along east coast of India
Digital Repository Service at National Institute of Oceanography (India)
Jyothibabu, R.; Madhu, N.V.; Murukesh, N.; Haridas, P.; Nair, K.K.C.; Venugopal, P.
° 44'N, 89° 04'), both along east coast of India. Nutrients (nitrate, phosphate, silicate) concentration in the upper 30 m of the water column showed very low values. High-integrated primary production (Bloom 1- 2160 mgC m-2 d-1, Bloom 2-1740 mgC m-2 d...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Electrochemical behaviour of platinum at polymer-modified glassy carbon electrodes · Carmem L P S Zanta C A Martínez-Huitle · More Details Abstract Fulltext PDF. In this paper, the preparations and voltammetric characteristics of chitosan-modified glassy carbon (Ct-MGC) and platinum electrodes are studied. Ct-MGC can ...
Vitamin C and endogenous cortisol in foreign-body inflammatory response in pacus
Directory of Open Access Journals (Sweden)
Marco Antonio de Andrade Belo
2012-07-01
Full Text Available The objective of this work was to evaluate the effect of food supplementation with vitamin C on macrophage and multinucleated giant cell (MGC activities of pacus at two stocking densities. The experiment was carried out in a 2x2x3 split-plot factorial arrangement with: 0 and 500 mg kg-1 vitamin C; 5 and 20 kg m-3 stocking densities; and evaluation times at 3, 6, and 12 days after the subcutaneous implantation of glass coverslips (DPI. The number of macrophages and MGC, as well as cortisol and glucose plasma levels were determined. The number of macrophages and MGC with two to five nuclei was significantly greater in fish supplemented with vitamin C at 5 kg m-3 stocking density at 3 DPI in comparison to nonsupplemented ones. The macrophage and MGC counts were lower in fish with high-plasma cortisol concentration. Supplementation with 500 mg vitamin C benefits macrophage activity on foreign-body inflammation, and high-cortisol concentration has suppressive effects on this response.
Glioblastoma Cell Malignancy and Drug Sensitivity Are Affected by the Cell of Origin
Directory of Open Access Journals (Sweden)
Yiwen Jiang
2017-01-01
Full Text Available The identity of the glioblastoma (GBM cell of origin and its contributions to disease progression and treatment response remain largely unknown. We have analyzed how the phenotypic state of the initially transformed cell affects mouse GBM development and essential GBM cell (GC properties. We find that GBM induced in neural stem-cell-like glial fibrillary acidic protein (GFAP-expressing cells in the subventricular zone of adult mice shows accelerated tumor development and produces more malignant GCs (mGC1GFAP that are less resistant to cancer drugs, compared with those originating from more differentiated nestin- (mGC2NES or 2,′3′-cyclic nucleotide 3′-phosphodiesterase (mGC3CNP-expressing cells. Transcriptome analysis of mouse GCs identified a 196 mouse cell origin (MCO gene signature that was used to partition 61 patient-derived GC lines. Human GC lines that clustered with the mGC1GFAP cells were also significantly more self-renewing, tumorigenic, and sensitive to cancer drugs compared with those that clustered with mouse GCs of more differentiated origin.
High-energy MnO2 nanowire/graphene and graphene asymmetric electrochemical capacitors.
Wu, Zhong-Shuai; Ren, Wencai; Wang, Da-Wei; Li, Feng; Liu, Bilu; Cheng, Hui-Ming
2010-10-26
In order to achieve high energy and power densities, we developed a high-voltage asymmetric electrochemical capacitor (EC) based on graphene as negative electrode and a MnO(2) nanowire/graphene composite (MGC) as positive electrode in a neutral aqueous Na(2)SO(4) solution as electrolyte. MGC was prepared by solution-phase assembly of graphene sheets and α-MnO(2) nanowires. Such aqueous electrolyte-based asymmetric ECs can be cycled reversibly in the high-voltage region of 0-2.0 V and exhibit a superior energy density of 30.4 Wh kg(-1), which is much higher than those of symmetric ECs based on graphene//graphene (2.8 Wh kg(-1)) and MGC//MGC (5.2 Wh kg(-1)). Moreover, they present a high power density (5000 W kg(-1) at 7.0 Wh kg(-1)) and acceptable cycling performance of ∼79% retention after 1000 cycles. These findings open up the possibility of graphene-based composites for applications in safe aqueous electrolyte-based high-voltage asymmetric ECs with high energy and power densities.
Roth, Lawrence M; Lyu, Bingjian; Cheng, Liang
2017-07-01
Sex cord-stromal tumors (SCSTs) are the second most frequent category of testicular neoplasms, accounting for approximately 2% to 5% of cases. Both genetic and epigenetic factors account for the differences in frequency and histologic composition between testicular and ovarian SCSTs. For example, large cell calcifying Sertoli cell tumor and intratubular large cell hyalinizing Sertoli cell neoplasia occur in the testis but have not been described in the ovary. In this article, we discuss recently described diagnostic entities as well as inconsistencies in nomenclature used in the recent World Health Organization classifications of SCSTs in the testis and ovary. We also thoroughly review the topic of neoplasms composed of both germ cells and sex cord derivatives with an emphasis on controversial aspects. These include "dissecting gonadoblastoma" and testicular mixed germ cell-sex cord stromal tumor (MGC-SCST). The former is a recently described variant of gonadoblastoma that sometimes is an immediate precursor of germinoma in the dysgenetic gonads of patients with a disorder of sex development. Although the relationship of dissecting gonadoblastoma to the previously described undifferentiated gonadal tissue is complex and not entirely resolved, we believe that it is preferable to continue to use the term undifferentiated gonadal tissue for those cases that are not neoplastic and are considered to be the precursor of classical gonadoblastoma. Although the existence of testicular MGC-SCST has been challenged, the most recent evidence supports its existence; however, testicular MGC-SCST differs significantly from ovarian examples due to both genetic and epigenetic factors. Copyright © 2017 Elsevier Inc. All rights reserved.
The Oncogenic Role of RhoGAPs in Basal-Like Breast Cancer
2016-04-01
mouse models . c) In vivo tumorigenesis and metastasis assays. Milestones: Identify whether ArhGAP11A and RacGAP1 can promote tumor growth and/or...proteins. RacGAP1 is a component of the centralspindlin complex during mitosis and cytokinesis, but its function during interphase is not well...switches: Rho GTPase regulation during animal cell mitosis . Cell Signal 2014;26:2998-3006. 30. Zhao WM, Fang G. MgcRacGAP controls the assembly of the
High resolution X radiography imaging detector-micro gap chamber
International Nuclear Information System (INIS)
Long Huqiang; Wang Yun; Xu Dong; Xie Kuanzhong; Bian Jianjiang
2007-01-01
Micro gap chamber (MGC) is a new type of Two-Dimensional position sensitive detector having excellent properties on the space and time resolution, counting rate, 2D compact structure and the flexible of application. It will become a candidate of a new tracking detector for high energy physics experiment. The basic structure and properties of MGC as well as its main research subjects are presented in this paper. Furthermore, the feasibility and validity of utilizing diamond films as the MGC gap material were also discussed in detail. So, a potential radiography imaging detector is provided in order to realize X image and X ray diffraction experiment having very good spatial and time resolution in the 3rd Generation of Synchrotron Radiation Facility. (authors)
Dwivedi, R.; McIntosh, J. C.; Meixner, T.; Ferré, T. P. A.; Chorover, J.
2016-12-01
Mountain systems are critical sources of recharge to adjacent alluvial basins in dryland regions. Yet, mountain systems face poorly defined threats due to climate change in terms of reduced snowpack, precipitation changes, and increased temperatures. Fundamentally, the climate risks to mountain systems are uncertain due to our limited understanding of natural recharge processes. Our goal is to combine measurements and models to provide improved spatial and temporal descriptions of groundwater flow paths and transit times in a headwater catchment located in a sub-humid region. This information is important to quantifying groundwater age and, thereby, to providing more accurate assessments of the vulnerability of these systems to climate change. We are using: (a) combination of geochemical composition, along with 2H/18O and 3H isotopes to improve an existing conceptual model for mountain block recharge (MBR) for the Marshall Gulch Catchment (MGC) located within the Santa Catalina Mountains. The current model only focuses on shallow flow paths through the upper unconfined aquifer with no representation of the catchment's fractured-bedrock aquifer. Groundwater flow, solute transport, and groundwater age will be modeled throughout MGC using COMSOL Multiphysics® software. Competing models in terms of spatial distribution of required hydrologic parameters, e.g. hydraulic conductivity and porosity, will be proposed and these models will be used to design discriminatory data collection efforts based on multi-tracer methods. Initial end-member mixing results indicate that baseflow in MGC, if considered the same as the streamflow during the dry periods, is not represented by the chemistry of deep groundwater in the mountain system. In the ternary mixing space, most of the samples plot outside the mixing curve. Therefore, to further constrain the contributions of water from various reservoirs we are collecting stable water isotopes, tritium, and solute chemistry of
Directory of Open Access Journals (Sweden)
Claudio Casella
2015-01-01
Full Text Available Background. A proper localisation of pathological parathyroid glands is essential for a minimally invasive approach in the surgical treatment of primary hyperparathyroidism (PHP. The recent introduction of portable mini gamma-cameras (pMGCs enabled intraoperative scintigraphic scanning. The aim of our study is to evaluate the efficacy of this new method and compare it with the preoperative localisation surveys. Methods. 20 patients were studied; they were evaluated preoperatively by neck ultrasound and Tc-sestaMIBI-scintigraphy and intraoperatively with the pMGC IP Guardian 2. The results obtained from the three evaluations were compared. Results. The pMGC presented a sensitivity of 95%, a specificity of 98.89%, and a diagnostic accuracy of 98.18%, which were higher than those of preoperative ultrasound (sensitivity 55%; specificity 95%; diagnostic accuracy 87% and scintigraphy with Tc-sestaMIBI (sensitivity 73.68%; specificity 96.05%; diagnostic accuracy 91.58%. Conclusions. The pMGC can be used effectively as an intraoperative method to find the correct location of the pathological parathyroid glands. The pMGC is more reliable than the currently used preoperative and intraoperative localisation techniques.
Energy Technology Data Exchange (ETDEWEB)
Ortega, Joaquin; Lledo, Salvador [University of Valencia, Clinic University Hospital, Department of Surgery, Valencia (Spain); Ferrer-Rebolleda, Jose [Clinic University Hospital, Department of Nuclear Medicine, Valencia (Spain); Cassinello, Norberto [Clinic University Hospital, Unit of Endocrinologic and Bariatric Surgery, Valencia (Spain)
2007-02-15
Sestamibi scans have increased the use of minimally invasive parathyroidectomy (MIP) to treat primary hyperparathyroidism (PHPT) when caused by a parathyroid single adenoma. The greatest concern for surgeons remains the proper identification of pathological glands in a limited surgical field. We have studied the usefulness of a new hand-held miniature gamma camera (MGC) when used intraoperatively to locate parathyroid adenomas. To our knowledge this is the first report published on this subject in the scientific literature. Five patients with PHPT secondary to a single adenoma, positively diagnosed by preoperative sestamibi scans, underwent a MIP. A gamma probe for radioguided surgery and the new hand-held MGC were used consecutively to locate the pathological glands. This new MGC has a module composed of a high-resolution interchangeable collimator and a CsI(Na) scintillating crystal. It has dimensions of around 15 cm x 8 cm x 9 cm and weighs 1 kg. The intraoperative assay of PTH (ioPTH) was used to confirm the complete resection of pathological tissue. All cases were operated on successfully by a MIP. The ioPTH confirmed the excision of all pathological tissues. The MGC proved its usefulness in all patients, even in a difficult case in which the first attempt with the gamma probe failed. In all cases it offered real-time accurate intraoperative images. The hand-held MGC is a useful instrument in MIP for PHPT. It may be used to complement the standard tools used to date, or may even replace them, at least in selected cases of single adenomas. (orig.)
International Nuclear Information System (INIS)
Ortega, Joaquin; Lledo, Salvador; Ferrer-Rebolleda, Jose; Cassinello, Norberto
2007-01-01
Sestamibi scans have increased the use of minimally invasive parathyroidectomy (MIP) to treat primary hyperparathyroidism (PHPT) when caused by a parathyroid single adenoma. The greatest concern for surgeons remains the proper identification of pathological glands in a limited surgical field. We have studied the usefulness of a new hand-held miniature gamma camera (MGC) when used intraoperatively to locate parathyroid adenomas. To our knowledge this is the first report published on this subject in the scientific literature. Five patients with PHPT secondary to a single adenoma, positively diagnosed by preoperative sestamibi scans, underwent a MIP. A gamma probe for radioguided surgery and the new hand-held MGC were used consecutively to locate the pathological glands. This new MGC has a module composed of a high-resolution interchangeable collimator and a CsI(Na) scintillating crystal. It has dimensions of around 15 cm x 8 cm x 9 cm and weighs 1 kg. The intraoperative assay of PTH (ioPTH) was used to confirm the complete resection of pathological tissue. All cases were operated on successfully by a MIP. The ioPTH confirmed the excision of all pathological tissues. The MGC proved its usefulness in all patients, even in a difficult case in which the first attempt with the gamma probe failed. In all cases it offered real-time accurate intraoperative images. The hand-held MGC is a useful instrument in MIP for PHPT. It may be used to complement the standard tools used to date, or may even replace them, at least in selected cases of single adenomas. (orig.)
Controlled antiseptic/eosin release from chitosan-based hydrogel modified fibrous substrates.
Romano, Ilaria; Ayadi, Farouk; Rizzello, Loris; Summa, Maria; Bertorelli, Rosalia; Pompa, Pier Paolo; Brandi, Fernando; Bayer, Ilker S; Athanassiou, Athanassia
2015-10-20
Fibers of cellulose networks were stably coated with N-methacrylate glycol chitosan (MGC) shells using subsequent steps of dip coating and photo-curing. The photo-crosslinked MGC-coated cellulose networks preserved their fibrous structure. A model hydrophilic antiseptic solution containing eosin, chloroxylenol and propylene glycol was incorporated into the shells to study the drug release dynamics. Detailed drug release mechanism into phosphate buffered saline (PBS) solutions from coated and pristine fibers loaded with the antiseptic was investigated. The results show that the MGC-coated cellulose fibers enable the controlled gradual release of the drug for four days, as opposed to fast, instantaneous release from eosin coated pristine fibers. This release behavior was found to affect the antibacterial efficiency of the fibrous cellulose sheets significantly against Staphylococcus aureus and Candida albicans. In the case of the MGC-eosin functionalized system the antibacterial efficiency was as high as 85% and 90%, respectively, while for the eosin coated pristine cellulose system the efficiency was negative, indicating bacterial proliferation. Furthermore, the MGC-eosin system was shown to be efficacious in a model of wound healing in mice, reducing the levels of various pro-inflammatory cytokines that modulate early inflammatory phase responses. The results demonstrate good potential of these coated fibers for wound dressing and healing applications. Due to its easy application on common passive commercial fibrous dressings such as gauzes and cotton fibers, the method can render them active dressings in a cost effective way. Copyright © 2015. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Sarangan Ravichandran
2017-06-01
Full Text Available Membrane guanylate cyclase (MGC is a ubiquitous multi-switching cyclic GMP generating signaling machine linked with countless physiological processes. In mammals it is encoded by seven distinct homologous genes. It is a single transmembrane spanning multi-modular protein; composed of integrated blocks and existing in homo-dimeric form. Its core catalytic domain (CCD module is a common transduction center where all incoming signals are translated into the production of cyclic GMP, a cellular signal second messenger. Crystal structure of the MGC’s CCD does not exist and its precise identity is ill-defined. Here, we define it at a sub-molecular level for the phototransduction-linked MGC, the rod outer segment guanylate cyclase type 1, ROS-GC1. (1 The CCD is a conserved 145-residue structural unit, represented by the segment V820-P964. (2 It exists as a homo-dimer and contains seven conserved catalytic elements (CEs wedged into seven conserved motifs. (3 It also contains a conserved 21-residue neurocalcin δ-modulated structural domain, V836-L857. (4 Site-directed mutagenesis documents that each of the seven CEs governs the cyclase’s catalytic activity. (5 In contrast to the soluble and the bacterium MGC which use Mn2+-GTP substrate for catalysis, MGC CCD uses the natural Mg2+-GTP substrate. (6 Strikingly, the MGC CCD requires anchoring by the Transmembrane Domain (TMD to exhibit its major (∼92% catalytic activity; in isolated form the activity is only marginal. This feature is not linked with any unique sequence of the TMD; there is minimal conservation in TMD. Finally, (7 the seven CEs control each of four phototransduction pathways- -two Ca2+-sensor GCAPs-, one Ca2+-sensor, S100B-, and one bicarbonate-modulated. The findings disclose that the CCD of ROS-GC1 has built-in regulatory elements that control its signal translational activity. Due to conservation of these regulatory elements, it is proposed that these elements also control the
Walter, Michele K. C.; Marinho, Mara de A.; Denardin, José E.; Zullo, Jurandir, Jr.; Paz-González, Antonio
2013-04-01
Soil and vegetation constitute respectively the third and the fourth terrestrial reservoirs of Carbon (C) on Earth. C sequestration in these reservoirs includes the capture of the CO2 from the atmosphere by photosynthesis and its storage as organic C. Consequently, changes in land use and agricultural practices affect directly the emissions of the greenhouse gases and the C sequestration. Several studies have already demonstrated that conservation agriculture, and particularly zero tillage (ZT), has a positive effect on soil C sequestration. The Brazilian federal program ABC (Agriculture of Low Carbon Emission) was conceived to promote agricultural production with environmental protection and represents an instrument to achieve voluntary targets to mitigate emissions or NAMAS (National Appropriated Mitigation Actions). With financial resources of about US 1.0 billion until 2020 the ABC Program has a target of expand ZT in 8 million hectares of land, with reduction of 16 to 20 million of CO2eq. Our objective was to quantify the C stocks in soil, plants and litter of representative grain crops systems under ZT in Rio Grande do Sul State, Brazil. Two treatments of a long term experimental essay (> 20 years) were evaluated: 1) Crop succession with wheat (Triticum aestivum L.)/soybean (Glycine max (L.) Merril); 2) Crop rotation with wheat/soybean (1st year), vetch (Vicia sativa L.)/soybean (2nd year), and white oat (Avena sativa L.)/sorghum (Sorghum bicolor L.) (3rd year). C quantification in plants and in litter was performed using the direct method of biomass quantification. The soil type evaluated was a Humic Rhodic Hapludox, and C quantification was executed employing the method referred by "C mass by unit area". Results showed that soybean plants under crop succession presented greater C stock (4.31MgC ha-1) comparing with soybean plants cultivated under crop rotation (3.59 MgC ha-1). For wheat, however, greater C stock was quantified in plants under rotation
[Anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines in vitro].
Gu, Jun; Li, Maolan; Wu, Xiangsong; Wu, Wenguang; Zhang, Lin; Ding, Qichen; Yang, Jiahua; Weng, Hao; Ding, Qian; Bao, Runfa; Shu, Yijun; Liu, Yingbin
2014-04-01
To prepare cisPLLAtin-loaded polylactic acid/cnts, and to study the anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines(MGC803 and MNK45). 5-FU-PLLA-CNTs were prepared with ultrasound emulsification. The morphology of 5-FU-PLLA-CNTs was determined by scanning electron microscope(SEM), and its drug loading and drug release curve in vitro were detected by UV-Vis-NIR spectrophotometer. Cells were divided into experiment, positive control and negative control groups. CCK8 method was used to test the cytotoxic effect of 5-FU-PLLA-CNTs in different concentrations on MGC803 and MNK45 cell proliferation. Flow cytometry was employed to measure the apoptotic rate of MGC803 and MNK45 cells before and after the intervention of 5-FU-PLLA-CNTs. Deep layer film of 5-FU-PLLA-CNTs was successfully established, whose drug-load rate was(4.54±0.43)%, entrapment rate was(21.56±2.36)%. In vitro release test showed release rate within 24 h of 5-FU-PLLA-CNTs was 23.9% in a as lowly increasing manner, and accumulating release rate was 85.3% at day 31. CCk8 experiment revealed, as compared to control group, 5-FU-PLLA-CNTs significantly inhibited the proliferation of two cell lines in dose-dependent and time-dependent manner. The best 5-FU-PLLA-CNTs concentration of inhibition for human gastric cancer cell lines was 1 mg/well. Flow cytometry indicated the apoptotic rate of MGC803 and MNK45 cells in experiment group treated by 1 mg/well 5-FU-PLLA-CNTs significantly increased as compared to negative control group (P0.05). The 5-FU-PLLA-CNTs has good drug sustained-release capacity, and can significantly kill and inhibit the proliferation of MGC803 and MNK45 cell lines.
Herbarium of the university of malaga (Spain): vascular plants collection.
García-Sánchez, José; Cabezudo, Baltasar
2013-01-01
The herbarium of University of Málaga (MGC Herbarium) is formed by four biological collections. The vascular plants collection (MGC-Cormof) is the main collection of the herbarium. MGC-Cormof dataset aims to digitize and publish data associated with over 76.000 specimens deposited in the collection, of which 97.2% of the specimens are identified at species level. Since 2011, the University of Malaga's Central Research Service (SCAI) has been responsible for maintaining the herbariums and the dataset. The collection is growing continuously, with an annual intake of about 1.500 specimens. Nearly 96% of the collection is digitized, by Herbar v3.7.1 software (F. Pando et al. 1996-2011), making over 73.000 specimens accessible through the GBIF network (http://data.gbif.org/datasets/resource/8105/). At present, 247 families and 8.110 taxa, distributed in angiosperms (93.97%), ferns and fern allies (4.89%) and gymnosperms (1.14%), constitute the MGC-Cormof collection. The families and genera best represented in the collection are Compositae, Leguminosae, Gramineae, Labiatae, Caryophyllaceae, Teucrium, Silene, Asplenium, Linaria and Quercus. Most of the specimens are from the Western Mediterranean Region, fundamentally Southern Spain (Andalusia: 82% of specimens) and Northern Morocco (2.17%). Approximately, 63% of the specimens are georeferenced. The identification of the specimens in the collection has been carried out by the plant biology department at the University of Malaga and plus 40% of the specimens has been reviewed by experts. The MGC-Cormof dataset has been revised by DarwinTest v3.2 tool (Ortega-Maqueda and Pando 2008) before being published in GBIF. The data included in this database are important for conservation works, taxonomy, flora, cartography, phenology, palynology, among others. El Herbario de la Universidad de Málaga (Herbario MGC) está constituido por cuatro colecciones biológicas. La colección de plantas vasculares (MGC Cormof) es la colecci
Herbarium of the University of Malaga (Spain: Vascular Plants Collection
Directory of Open Access Journals (Sweden)
Jose García Sánchez
2013-09-01
Full Text Available The herbarium of University of Málaga (MGC Herbarium is formed by four biological collections. The vascular plants collection (MGC-Cormof is the main collection of the herbarium. MGC-Cormof dataset aims to digitize and publish data associated with over 76.000 specimens deposited in the collection, of which 97.2% of the specimens are identified at species level. Since 2011, the University of Malaga’s Central Research Service (SCAI has been responsible for maintaining the herbariums and the dataset. The collection is growing continuously, with an annual intake of about 1.500 specimens. Nearly 96% of the collection is digitized, by Herbar v3.7.1 software (F. Pando et al. 1996–2011, making over 73.000 specimens accessible through the GBIF network (http://data.gbif.org/datasets/resource/8105/. At present, 247 families and 8.110 taxa, distributed in angiosperms (93.97%, ferns and fern allies (4.89% and gymnosperms (1.14%, constitute the MGC-Cormof collection. The families and genera best represented in the collection are Compositae, Leguminosae, Gramineae, Labiatae, Caryophyllaceae, Teucrium, Silene, Asplenium, Linaria and Quercus. Most of the specimens are from the Western Mediterranean Region, fundamentally Southern Spain (Andalusia: 82% of specimens and Northern Morocco (2.17%. Approximately, 63% of the specimens are georeferenced. The identification of the specimens in the collection has been carried out by the plant biology department at the University of Malaga and plus 40% of the specimens has been reviewed by experts. The MGC-Cormof dataset has been revised by DarwinTest v3.2 tool (Ortega-Maqueda and Pando 2008 before being published in GBIF. The data included in this database are important for conservation works, taxonomy, flora, cartography, phenology, palynology, among others.El Herbario de la Universidad de Málaga (Herbario MGC está constituido por cuatro colecciones biológicas. La colección de plantas vasculares (MGC Cormof es la
Turkish Music Genre Classification using Audio and Lyrics Features
Directory of Open Access Journals (Sweden)
Önder ÇOBAN
2017-05-01
Full Text Available Music Information Retrieval (MIR has become a popular research area in recent years. In this context, researchers have developed music information systems to find solutions for such major problems as automatic playlist creation, hit song detection, and music genre or mood classification. Meta-data information, lyrics, or melodic content of music are used as feature resource in previous works. However, lyrics do not often used in MIR systems and the number of works in this field is not enough especially for Turkish. In this paper, firstly, we have extended our previously created Turkish MIR (TMIR dataset, which comprises of Turkish lyrics, by including the audio file of each song. Secondly, we have investigated the effect of using audio and textual features together or separately on automatic Music Genre Classification (MGC. We have extracted textual features from lyrics using different feature extraction models such as word2vec and traditional Bag of Words. We have conducted our experiments on Support Vector Machine (SVM algorithm and analysed the impact of feature selection and different feature groups on MGC. We have considered lyrics based MGC as a text classification task and also investigated the effect of term weighting method. Experimental results show that textual features can also be effective as well as audio features for Turkish MGC, especially when a supervised term weighting method is employed. We have achieved the highest success rate as 99,12\\% by using both audio and textual features together.
Directory of Open Access Journals (Sweden)
Xiaoqian Zhou
2017-12-01
Full Text Available When several microgrids (MG are interconnected into microgrid clusters (MGC, they have great potential to improve their reliability. Traditional droop control tends to make the total operating costs higher as the power is distributed by capacity ratios of distributed energy resources (DERs. This paper proposes an adaptive distributed economic control for islanded microgrids which considers line loss, specifically, an interesting marginal costs-based economic droop control is proposed, and consensus-based adaptive controller is applied, to deal with power limits and capacity constraints for storage. The whole expense can be effectively lowered by achieving identical marginal costs for DERs in MGC. Specially, the capacity constraints only for storages are also included to do further optimization. Moreover, consensus-based distributed secondary controllers are used to rapidly restore system frequency and voltage magnitudes. The above controllers only need to interact with neighbor DERs by a sparse communication network, eliminating the necessity of a central controller and enhancing the stability. A MGC, incorporating three microgrids, is used to verify the effectiveness of the proposed methods.
The development and application of a Mycoplasma gallisepticum sequence database.
Armour, Natalie K; Laibinis, Victoria A; Collett, Stephen R; Ferguson-Noel, Naola
2013-01-01
Molecular analysis was conducted on 36 Mycoplasma gallisepticum DNA extracts from tracheal swab samples of commercial poultry in seven South African provinces between 2009 and 2012. Twelve unique M. gallisepticum genotypes were identified by polymerase chain reaction and sequence analysis of the 16S-23S rRNA intergenic spacer region (IGSR), M. gallisepticum cytadhesin 2 (mgc2), MGA_0319 and gapA genetic regions. The DNA sequences of these genotypes were distinct from those of M. gallisepticum isolates in a database composed of sequences from other countries, vaccine and reference strains. The most prevalent genotype (SA-WT#7) was detected in samples from commercial broilers, broiler breeders and layers in five provinces. South African M. gallisepticum sequences were more similar to those of the live vaccines commercially available in South Africa, but were distinct from that of F strain vaccine, which is not registered for use in South Africa. The IGSR, mgc2 or MGA_0319 sequences of three South African genotypes were identical to those of the ts-11 vaccine strain, necessitating a combination of mgc2 and IGSR targeted sequencing to differentiate South African wild-type genotypes from ts-11 vaccine. To identify and differentiate all 12 wild-types, mgc2, IGSR and MGA_0319 sequencing was required. Sequencing of gapA was least effective at strain differentiation. This research serves as a model for the development of an M. gallisepticum sequence database, and illustrates its application to characterize M. gallisepticum genotypes, select diagnostic tests and better understand the epidemiology of M. gallisepticum.
Madhu, N V; Jyothibabu, R; Balachandran, K K
2010-07-01
Changes in the autotrophic pico- (0.2-2 microm), nano- (2-20 microm), and microplankton (>20 microm) biomass (chlorophyll a) and primary production were measured in the estuarine and coastal waters off Cochin, southwest coast of India during the onset and establishment of a monsoon. During this period, the estuary was dominated by nutrient-rich freshwater, whereas the coastal waters were characterized with higher salinity values (>30 psu) and less nutrients. The average surface chlorophyll a concentrations and primary production rates were higher in the estuary (average 13.7 mg m(-3) and 432 mgC m(-3) day(-1)) as compared to the coastal waters (5.3 mg m(-3) and 224 mgC m(-3) day(-1)). The nanoplankton community formed the major fraction of chlorophyll a and primary production, both in the estuary (average 85 +/- SD 8.3% and 81.2 +/- SD 3.2%) and the coastal waters (average 73.2 +/- SD 17.2% and 81.9 +/- 15.7%). Nanoplankton had the maximum photosynthetic efficiency in the coastal waters (average 4.8 +/- SD 3.9 mgC mgChl a m(-3) h(-1)), whereas in the estuary, the microplankton had higher photosynthetic efficiency (average 7.4 +/- 7 mgC mgChl a m(-3) h(-1)). The heavy cloud cover and increased water column turbidity not only limit the growth of large-sized phytoplankton in the Cochin estuary and coastal waters but also support the proliferation of nanoplankton community during the monsoon season, even though large variation in nanoplankton chlorophyll a and production exists between these two areas.
Training Program in the Molecular Basis of Breast Cancer Research
2000-08-01
BRCA1 protein and the product was purified by electrophoresis on a 15% polyacryl - interact with the importin-a subunit of the nuclear transport signal...40 mM potassium phos- the 2.0-kb DNA fragment containing the complete ORF of scHEC] was inserted phate [pH 6.5] containing 0.5 M MgC12 and 4...with a mM potassium HEPES [pH 7.7], 0.1 M KCI, 10% glycerol, 2 mM MgC12, 5 mM number of proteins important for GV/M progression and chro- EGTA), 0.5 ml
International Nuclear Information System (INIS)
Nöckel, Jessica; Engel, Natasja K van den; Winter, Hauke; Hatz, Rudolf A; Zimmermann, Wolfgang; Kammerer, Robert
2006-01-01
Gastric carcinoma is one of the most frequent cancers worldwide. Patients with gastric cancer at an advanced disease stage have a poor prognosis, due to the limited efficacy of available therapies. Therefore, the development of new therapies, like immunotherapy for the treatment of gastric cancer is of utmost importance. Since the usability of existing preclinical models for the evaluation of immunotherapies for gastric adenocarcinomas is limited, the goal of the present study was to establish murine in vivo models which allow the stepwise improvement of immunotherapies for gastric cancer. Since no murine gastric adenocarcinoma cell lines are available we established four cell lines (424GC, mGC3, mGC5, mGC8) from spontaneously developing tumors of CEA424/SV40 T antigen (CEA424/Tag) mice and three cell lines derived from double-transgenic offsprings of CEA424/Tag mice mated with human carcinoembryonic antigen (CEA)-transgenic (CEA424/Tag-CEA) mice (mGC2 CEA , mGC4 CEA , mGC11 CEA ). CEA424/Tag is a transgenic C57BL/6 mouse strain harboring the Tag under the control of a -424/-8 bp CEA gene promoter which leads to the development of invasive adenocarcinoma in the glandular stomach. Tumor cell lines established from CEA424/Tag-CEA mice express the well defined tumor antigen CEA under the control of its natural regulatory elements. The epithelial origin of the tumor cells was proven by morphological criteria including the presence of mucin within the cells and the expression of the cell adhesion molecules EpCAM and CEACAM1. All cell lines consistently express the transgenes CEA and/or Tag and MHC class I molecules leading to their susceptibility to lysis by Tag-specific CTL in vitro. Despite the presentation of CTL-epitopes derived from the transgene products the tumor cell lines were tumorigenic when grafted into C57BL/6, CEA424/Tag or CEA424/Tag-CEA-transgenic hosts and no significant differences in tumor take and tumor growth were observed in the different hosts
Directory of Open Access Journals (Sweden)
Inokuchi M
2014-04-01
Full Text Available Mikito Inokuchi,1 Keiji Kato,1 Kazuyuki Kojima,2 Kenichi Sugihara1 1Department of Surgical Oncology, 2Department of Minimally Invasive Surgery, Tokyo Medical and Dental University, Tokyo, Japan Abstract: Multidisciplinary treatment including chemotherapy has become the global standard of care for patients with metastatic gastric cancer (mGC; nonetheless, survival remains poor. Although many molecular-targeted therapies have been developed for various cancers, only anti-HER2 treatment has produced promising results in patients with mGC. Mammalian target of rapamycin (mTOR plays a key role in cell proliferation, antiapoptosis, and metastasis in signaling pathways from the tyrosine kinase receptor, and its activation has been demonstrated in gastric cancer (GC cells. This review discusses the clinical relevance of mTOR in GC and examines its potential as a therapeutic target in patients with mGC. Preclinical studies in animal models suggest that suppression of the mTOR pathway inhibits the proliferation of GC cells and delays tumor progression. The mTOR inhibitor everolimus has been evaluated as second- or third-line treatment in clinical trials. Adverse events were well tolerated although the effectiveness of everolimus alone was limited. Everolimus is now being evaluated in combination with chemotherapy in Phase III clinical studies in this subgroup of patients. Two Phase III studies include exploratory biomarker research designed to evaluate the predictive value of the expression or mutation of molecules related to the Akt/mTOR signaling pathway. These biomarker studies may lead to the realization of targeted therapy for selected patients with mGC in the future. Keywords: gastric cancer, mTOR, everolimus
Characterizing Metastatic HER2-Positive Gastric Cancer at the CDH1 Haplotype
Caggiari, Laura; Miolo, Gianmaria; Buonadonna, Angela; Basile, Debora; Santeufemia, Davide A.; De Zorzi, Mariangela; Fornasarig, Mara; Alessandrini, Lara; Lo Re, Giovanni; Puglisi, Fabio; Steffan, Agostino
2017-01-01
The CDH1 gene, coding for the E-cadherin protein, is linked to gastric cancer (GC) susceptibility and tumor invasion. The human epidermal growth factor receptor 2 (HER2) is amplified and overexpressed in a portion of GC. HER2 is an established therapeutic target in metastatic GC (mGC). Trastuzumab, in combination with various chemotherapeutic agents, is a standard treatment for these tumors leading to outcome improvement. Unfortunately, the survival benefit is limited to a fraction of patients. The aim of this study was to improve knowledge of the HER2 and the E-cadherin alterations in the context of GC to characterize subtypes of patients that could better benefit from targeted therapy. An association between the P7-CDH1 haplotype, including two polymorphisms (rs16260A-rs1801552T) and a subset of HER2-positive mGC with better prognosis was observed. Results indicated the potential evaluation of CDH1 haplotypes in mGC to stratify patients that will benefit from trastuzumab-based treatments. Moreover, data may have implications to understanding the HER2 and the E-cadherin interactions in vivo and in response to treatments. PMID:29295527
Lifescience Database Archive (English)
Full Text Available MGC80045 protein OS=Xenopus laevis GN=MGC... 95 2e-18 tr|Q6AZL1|Q6AZL1_XENTR Finkel-Biskis-Reilly murine sar...t) OS=Mus musculus GN... 95 2e-18 tr|Q642K5|Q642K5_MOUSE Finkel-Biskis-Reilly murine sarcoma virus... 95 2e-...-like/S30 ribosomal fusion prote... 95 2e-18 tr|Q3SZG2|Q3SZG2_BOVIN Finkel-Biskis-Reilly murine sarcoma viru...18 tr|Q5BJN7|Q5BJN7_RAT Finkel-Biskis-Reilly murine sarcoma virus (... 95 2e-18 t
Lifescience Database Archive (English)
Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla
Energy Technology Data Exchange (ETDEWEB)
Cui, Xinhui [State Key Laboratory of Bioreactor Engineering, East China University of Science and Technology, Shanghai 200237 (China); Liang, Tong [Engineering Research Center for Biomedical Materials of Ministry of Education, East China University of Science and Technology, Shanghai 200237 (China); Liu, Changsheng [State Key Laboratory of Bioreactor Engineering, East China University of Science and Technology, Shanghai 200237 (China); Engineering Research Center for Biomedical Materials of Ministry of Education, East China University of Science and Technology, Shanghai 200237 (China); Yuan, Yuan, E-mail: yyuan@ecust.edu.cn [Engineering Research Center for Biomedical Materials of Ministry of Education, East China University of Science and Technology, Shanghai 200237 (China); Qian, Jiangchao, E-mail: jiangchaoqian@ecust.edu.cn [State Key Laboratory of Bioreactor Engineering, East China University of Science and Technology, Shanghai 200237 (China)
2016-10-01
Three types of hydroxyapatite nanoparticles (HAPNs) were synthesized employing a sonochemistry-assisted microwave method by changing microwave power (from 200 to 300 W) or using calcination treatment: L200 (200 W, lyophilization), L300 (300 W, lyophilization) and C200 (200 W, lyophilization & calcination). Their physiochemical properties were characterized and correlated with cytotoxicity to human gastric cancer cells (MGC80-3). The major differences among these HAPN preparations were their size and specific surface area, with the L200 showing a smaller size and higher specific surface area. Although all HAPNs inhibited cell proliferation and induced apoptosis of cancer cells, L200 exhibited the greatest toxicity. All types of HAPNs were internalized through energy-dependent pathways, but the L200 nanoparticles were more efficiently uptaken by MGC80-3 cells. Inhibitor studies with dynasore and methyl-β-cyclodextrin suggested that caveolae-mediated endocytosis and, to a much lesser extent, clathrin-mediated endocytosis, were involved in cellular uptake of the various preparations, whereas the inhibition of endocytosis was more obvious for L200. Using fluorescein isothiocyanate-labeled HAPNs and laser-scanning confocal microscopy, we found that all forms of nanoparticles were present in the cytoplasm, and some L200 HAPNs were even found within nuclei. Treatment with all HAPN preparations led to the increase in the intracellular calcium level with the highest level detected for L200. - Highlights: • Three types of HAPNs (L200, L300 and C200) were synthesized employing a sonochemistry-assisted microwave method. • L200 exhibited the greatest cytotoxicity to human gastric cancer (MGC80-3) cells. • L200 showed a smaller size and higher specific surface area. • The L200 nanoparticles were more efficiently uptaken by MGC80-3 cells through energy-dependent pathways. • L200 caused the most significant increase in the intracellular calcium level.
Thorhaug, Anitra; Poulos, Helen M; López-Portillo, Jorge; Ku, Timothy C W; Berlyn, Graeme P
2017-12-15
Seagrasses comprise a substantive North American and Caribbean Sea blue carbon sink. Yet fine-scale estimates of seagrass carbon stocks, fluxes from anthropogenic disturbances, and potential gains in sedimentary carbon from seagrass restoration are lacking for most of the Western Hemisphere. To begin to fill this knowledge gap in the subtropics and tropics, we quantified organic carbon (C org ) stocks, losses, and gains from restorations at 8 previously-disturbed seagrass sites around the Gulf of Mexico (GoM) (n=128 cores). Mean natural seagrass C org stocks were 25.7±6.7MgC org ha -1 around the GoM, while mean C org stocks at adjacent barren sites that had previously hosted seagrass were 17.8MgC org ha -1 . Restored seagrass beds contained a mean of 38.7±13.1MgC org ha -1 . Mean C org losses differed by anthropogenic impact type, but averaged 20.98±7.14MgC org ha -1 . C org gains from seagrass restoration averaged 20.96±8.59Mgha -1 . These results, when combined with the similarity between natural and restored C org content, highlight the potential of seagrass restoration for mitigating seagrass C org losses from prior impact events. Our GoM basin-wide estimates of natural C org totaled ~36.4Tg for the 947,327ha for the USA-GoM. Including Mexico, the total basin contained an estimated 37.2-37.5Tg C org . Regional US-GoM losses totaled 21.69Tg C org . C org losses differed significantly among anthropogenic impacts. Yet, seagrass restoration appears to be an important climate change mitigation strategy that could be implemented elsewhere throughout the tropics and subtropics. Copyright © 2017 Elsevier B.V. All rights reserved.
Neural network based expert system for fault diagnosis of particle accelerators
International Nuclear Information System (INIS)
Dewidar, M.M.
1997-01-01
Particle accelerators are generators that produce beams of charged particles, acquiring different energies, depending on the accelerator type. The MGC-20 cyclotron is a cyclic particle accelerator used for accelerating protons, deuterons, alpha particles, and helium-3 to different energies. Its applications include isotope production, nuclear reaction, and mass spectroscopy studies. It is a complicated machine, it consists of five main parts, the ion source, the deflector, the beam transport system, the concentric and harmonic coils, and the radio frequency system. The diagnosis of this device is a very complex task. it depends on the conditions of 27 indicators of the control panel of the device. The accurate diagnosis can lead to a high system reliability and save maintenance costs. so an expert system for the cyclotron fault diagnosis is necessary to be built. In this thesis , a hybrid expert system was developed for the fault diagnosis of the MGC-20 cyclotron. Two intelligent techniques, multilayer feed forward back propagation neural network and the rule based expert system, are integrated as a pre-processor loosely coupled model to build the proposed hybrid expert system. The architecture of the developed hybrid expert system consists of two levels. The first level is two feed forward back propagation neural networks, used for isolating the faulty part of the cyclotron. The second level is the rule based expert system, used for troubleshooting the faults inside the isolated faulty part. 4-6 tabs., 4-5 figs., 36 refs
Chenu, Claire; Angers, Denis; Métay, Aurélie; Colnenne, Caroline; Klumpp, Katja; Bamière, Laure; Pardon, Lenaic; Pellerin, Sylvain
2014-05-01
Though large progress has been achieved in the last decades, net GHG emissions from the agricultural sector are still more poorly quantified than in other sectors. In this study, we examined i) technical mitigation options likely to store carbon in agricultural soils, ii) their potential of additional C storage per unit surface area and iii) applicable areas in mainland France. We considered only agricultural practices being technically feasible by farmers and involving no major change in either production systems or production levels. Moreover, only currently available techniques with validated efficiencies and presenting no major negative environmental impacts were taken into account. Four measures were expected to store additional C in agricultural soils: - Reducing tillage: either a switch to continuous direct seeding, direct seeding with occasional tillage once every five years, or continuous superficial (20yrs) C storage rates (MgC ha-1 y-1,) of cropping systems with and without the proposed practice. Then we analysed the conditions for potential application, in terms of feasibility, acceptance, limitation of yield losses and of other GHG emissions. According to the literature, additional C storage rates were 0.15 (0-0.3) MgC ha-1 y-1 for continuous direct seeding, 0.10 (0-0.2) MgC ha-1 y-1for occasional tillage one year in five, and 0.0 MgC ha-1 y-1 for superficial tillage. Cover crops were estimated to store 0.24 (0.13-0.37) MgC ha-1 y-1 between cash crops and 0.49 (0.23-0.72) MgC ha-1 y-1 when associated with vineyards. Hedges (i.e 60 m ha-1) stored 0.15 (0.05-0.26) Mg C ha-1 y-1. Very few estimates were available for temperate agroforestry system, and we proposed a value of 1.01 (0.11-1.36) Mg C ha-1 y-1for C stored in soil and in the tree biomass for systems comprising 30-50 trees ha-1. Increasing the life time of temporary sown grassland increased C stocls by 0.11 (0.07-0.22) Mg C ha-1 y-1. In general, practices with increased C inputs to soil through
Yan, Saisai; Hu, Fan; Hong, Xia; Shuai, Qi
2018-09-01
Silica-encapsulated nanospheres of water-soluble ferrocene complexes WFCs@SiO 2 and WFCs@SiO 2 @glutaraldehyde (GA) were first synthesized by a facile inverse-microemulsion method. The surface functional groups, particle size, and morphologies of nanospheres were characterized by IR spectra, UV-vis absorption spectra, dynamic light scattering (DLS) and SEM images. Single-crystal X-ray diffraction was used to confirm the molecular structure of free ferrocenyl-pyrazol ligand (L) and three WFCs, namely, [Ni(C 22 H 14 F 6 FeN 4 O 4 )(H 2 O) 4 ] (5a), [Mg(C 22 H 14 F 6 FeN 4 O 4 )(H 2 O) 4 ]·3H 2 O (5b), and [Ba(C 22 H 14 F 6 FeN 4 O 4 )(H 2 O) 3 ] (5c). The electrochemical properties of 5a-5c were explored by cyclic voltammetry. The WFCs-loading capacities of 5a-5c in WFCs@SiO 2 were found to be 38.4, 38.2, and 38.1 μg/mg, respectively. Cell studies under two drug delivery modes (free diffusion and endocytosis) were carried out by MTT cell-survival assays and morphological observation of HepG2 cells. It's interesting that the cytotoxicity of WFCs against HepG2 was increased by applying silica nanocarriers. Compared to WFCs@SiO 2 , the modification of GA on the spherical surface provided not only the better water-dispersity but also additional functional groups for further modification of other pharmacophores. The novel nanocarrier system for WFC delivery present a novel concept-of-proof method to protect varieties of affordable metal-based anticancer agents in physiological conditions and provided experimental basis for future studies focusing on drug delivery of other WFCs. Copyright © 2018 Elsevier B.V. All rights reserved.
7 CFR 37.4 - How to apply for service.
2010-01-01
... REGULATIONS PROGRAM TO ASSESS ORGANIC CERTIFYING AGENCIES § 37.4 How to apply for service. (a) Application. Any organic certifying agency may apply to the Branch Chief, Meat Grading and Certification (MGC...
Directory of Open Access Journals (Sweden)
Gisely Hijar G
2002-07-01
Full Text Available Objetivo: Determinar la diversidad genética del gen que codifica la proteína rica en glutamato (GLURP de Plasmodium falciparum en pacientes con malaria complicada y no complicada circulante en un área del departamento de Loreto, distrito de Maynas. Materiales y métodos: La diversidad genética fue analizada usando reacción en cadena de la polimerasa (PCR en 30 muestras sanguíneas de pacientes con malaria no complicada (MNC y 46 con malaria grave complicada (MGC. Resultados: Ocho genotipos fueron detectados en pacientes con MNC (Genotipo I,II,III, IV,V, VI,VII y VIII y cuatro genotipos en los pacientes con MGC (Genotipo V,VI,VII,VIII. Asimismo, en 50% de las muestras con MNC fueron detectadas infecciones múltiples, a diferencia de las muestras de MGC en donde no se detectó infecciones múltiples. Conclusión: Existe una diversidad genética en esta región del gen GLURP de P. falciparum, para esa época (marzo 1998 - abril 1999 y esa área del país. En tal sentido, nuestros resultados podrían servir de base para llevar a cabo estudios epidemiológicos posteriores, ya que permitiría conocer la distribución de las cepas circulantes en nuestro país.
Van Haren, J. L. M.; Cadillo-Quiroz, H.
2015-12-01
Methane (CH4) emissions through plants have long been known in wetlands. However, most measurements have focused on stem tops and leaves. Recently, measurements at the lower parts of stems have shown that stem emissions can exceed soil CH4 emissions in Asian peatlands (Pangala et al. 2013). The addition of stem fluxes to soil fluxes for total ecosystem fluxes has the potential to bridge the discrepancy between modeled to measured and bottom-up to top-down flux estimates. Our measurements in peatlands of Peru show that especially Mauritia flexuosa, a palm species, can emit very large quantities of CH4, although most trees emitted at least some CH4. We used flexible stem chambers to adapt to stems of any size above 5cm in diameter. The chambers were sampled in closed loop with a Gasmet DX4015 for flux measurements, which lasted ~5 minutes after flushing with ambient air. We found that M. flexuosa stem fluxes decrease with height along the stem and were positively correlated with soil fluxes. Most likely CH4 is transported up the stem with the xylem water. Measured M. flexuosa stem fluxes below 1.5m averaged 11.2±1.5 mg-C m-2 h-1 (±95% CI) with a maximum of 123±3.5 mg-C m-2 h-1 (±SE), whereas soil fluxes averaged 6.7±1.7 mg-C m-2 h-1 (±95% CI) with a maximum of 31.6±0.4 mg-C m-2 h-1 (±SE). Significant CH4 fluxes were measured up to 5 m height along the stems. Combined with the high density of ~150 M. flexuosa individuals per hectare in these peatlands and the consistent diameter of ~30cm, the high flux rates add ~20% to the soil flux. With anywhere between 1 and 5 billion M. flexuosa stems across Amazon basin wetlands, stem fluxes from this palm species could represent a major addition to the overall Amazon basin CH4 flux.
Directory of Open Access Journals (Sweden)
Rehannah Borup
Full Text Available By focussing on differences in the mural granulosa cell (MGC and cumulus cell (CC transcriptomes from follicles resulting in competent (live birth and non-competent (no pregnancy oocytes the study aims on defining a competence classifier expression profile in the two cellular compartments.A case-control study.University based facilities for clinical services and research.MGC and CC samples from 60 women undergoing IVF treatment following the long GnRH-agonist protocol were collected. Samples from 16 oocytes where live birth was achieved and 16 age- and embryo morphology matched incompetent oocytes were included in the study.MGC and CC were isolated immediately after oocyte retrieval. From the 16 competent and non-competent follicles, mRNA was extracted and expression profile generated on the Human Gene 1.0 ST Affymetrix array. Live birth prediction analysis using machine learning algorithms (support vector machines with performance estimation by leave-one-out cross validation and independent validation on an external data set.We defined a signature of 30 genes expressed in CC predictive of live birth. This live birth prediction model had an accuracy of 81%, a sensitivity of 0.83, a specificity of 0.80, a positive predictive value of 0.77, and a negative predictive value of 0.86. Receiver operating characteristic analysis found an area under the curve of 0.86, significantly greater than random chance. When applied on 3 external data sets with the end-point outcome measure of blastocyst formation, the signature resulted in 62%, 75% and 88% accuracy, respectively. The genes in the classifier are primarily connected to apoptosis and involvement in formation of extracellular matrix. We were not able to define a robust MGC classifier signature that could classify live birth with accuracy above random chance level.We have developed a cumulus cell classifier, which showed a promising performance on external data. This suggests that the gene signature at
Frank, J. M.; Massman, W. J.
2010-12-01
The GLEES-AmeriFlux site is located in the Snowy Range Mountains, Medicine Bow National Forest, southeastern Wyoming [41o21’52” N, 106o14’22” W; 3190 m MSL]. Since November 1999, measurements of surface energy balance, momentum, CO2, and water vapor eddy-covariance fluxes have been made at the subalpine site which is dominated by an Engelmann spruce (Picea engelmannii) and subalpine fir (Abies lasiocarpa) forest. An ongoing spruce beetle (Dendroctonus rufipennis) outbreak has caused significant tree mortality in the forest over the past few years. In this study we investigate the impact of this bark beetle epidemic on the net ecosystem exchange of carbon (NEE) and evapotranspiration (ET); to achieve this goal we quantify the impact of significant eddy-covariance measurement issues. From 2006 to 2009 the magnitude of NEE decreased steadily by an average of 0.8 MgC ha-1 yr-1, which resulted in the reduction of the annual C sink from 2.9 to 0.6 MgC ha-1 yr-1. Over this time ET decreased steadily from 72.2 to 58.3 cm yr-1. The importance of the Webb-Pearman-Leuning (WPL) correction due to self-heating associated with open-path CO2/H2O analyzers was quantified by applying a thermodynamic model based on (1) a generalized model for instrument surface temperatures and (2) measured and site-specific modeled surface temperatures. The increase in measured NEE (towards being a net C source) due to the generalized model (1) was 2.2 MgC ha-1 yr-1, while the site specific corrections (2) accounted for an increase of 2.8 MgC ha-1 yr-1. The self-heating correction was much less important with ET measurements, increasing the measured flux by 0.5 cm yr-1, regardless of which method of determining surface temperature was used.
González, H. E.; Castro, L.; Daneri, G.; Iriarte, J. L.; Silva, N.; Vargas, C. A.; Giesecke, R.; Sánchez, N.
2011-03-01
Two research cruises ( CIMAR 13 Fiordos) were conducted in the N-S oriented macrobasin of the Moraleda Channel (42-47°S), which includes the E-W oriented Puyuhuapi Channel and Aysen Fjord, during two contrasting productive seasons: austral winter (27 July-7 August 2007) and spring (2-12 November 2007). These campaigns set out to assess the spatio-temporal variability, defined by the local topography along Moraleda Channel, in the biological, physical, and chemical oceanographic characteristics of different microbasins and to quantify the carbon budget of the pelagic trophic webs of Aysen Fjord. Seasonal carbon fluxes and fjord-system functioning vary widely in our study area. In terms of spatial topography, two constriction sills (Meninea and Elefantes) define three microbasins along Moraleda Channel, herein the (1) north (Guafo-Meninea), (2) central (Meninea-Elefantes), and (3) south (Elefantes-San Rafael Lagoon) microbasins. In winter, nutrient concentrations were high (i.e. nitrate range: 21-14 μM) and primary production was low (153-310 mgC m -2 d -1), suggesting that reduced light radiation depressed the plankton dynamics throughout Moraleda Channel. In spring, primary production followed a conspicuous N-S gradient, which was the highest (5167 mgC m -2 d -1) in the north microbasin and the lowest (742 mgC m -2 d -1) in the south microbasin. The seasonal pattern of the semi-enclosed Puyuhuapi Channel and Aysen Fjord, however, revealed no significant differences in primary production (˜800 mgC m -2 d -1), and vertical fluxes of particulate organic carbon were nearly twice as high in spring as in winter (266 vs. 168 mgC m -2 d -1). At the time-series station (St. 79), the lithogenic fraction dominated the total sedimented matter (seston). The role of euphausiids in the biological carbon pump of the Patagonian fjords was evident, given the predominance of zooplankton fecal material, mostly euphausiid fecal strings (46% of all fecal material), among the
Antiproliferative Activity of Phenylpropanoids Isolated from Lagotis brevituba Maxim.
Xiang, Yuan; Jing, Zhao; Haixia, Wang; Ruitao, Yu; Huaixiu, Wen; Zenggen, Liu; Lijuan, Mei; Yiping, Wang; Yanduo, Tao
2017-10-01
The aim of the present study was to evaluate the antiproliferative effect of phenylpropanoids isolated from the n-BuOH-soluble fraction of an ethanolic extract of Lagotis brevituba Maxim. The phenylpropanoids were identified as echinacoside, lagotioside, glucopyranosyl(1-6)martynoside, plantamoside, and verbascoside. Three of the compounds, lagotioside, glucopyranosyl(1-6)martynoside, and plantamoside, were isolated from L. brevituba for the first time. The antiproliferative activity of the isolates was evaluated in human gastric carcinoma (MGC-803), human colorectal carcinoma (HCT116), human hepatocellar carcinoma (HepG2), and human lung cancer (HCT116) cells using an 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Plantamoside showed promising activity against MGC-803 cells, with a half maximal inhibitory concentration value of 37.09 μM. The mechanism of the pro-apoptosis effect of plantamoside was then evaluated in MGC-803 cells. Changes in cell morphology, including disorganization of the architecture of actin microfilaments and formation of apoptotic bodies, together with cell cycle arrest in G2/M phases, were observed after treatment of plantamoside. The antiproliferative and pro-apoptotic effects were associated with a decrease in the ratio of Bcl-2/Bax and reduced mitochondrial membrane potential, which was accompanied by the release of reactive oxygen species and Ca 2+ into the cytoplasm. Taken together, the results indicated that plantamoside promotes apoptosis via a mitochondria-dependent mechanism. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.
Lifescience Database Archive (English)
Full Text Available is GN=MGC... 96 1e-18 tr|Q4KLF0|Q4KLF0_XENLA MGC116435 protein OS=Xenopus laevis GN=MG... 96 1e-18 tr|Q6AZL1|Q6AZL1_XENTR Fink...8 tr|Q91V99|Q91V99_MOUSE Fau protein (Fragment) OS=Mus musculus GN... 95 3e-18 tr|Q642K5|Q642K5_MOUSE Finkel...-Biskis-Reilly murine sarcoma virus... 95 3e-18 tr|Q5BJN7|Q5BJN7_RAT Finkel-Biskis-Reilly murine sarcoma vir...... 95 3e-18 tr|Q56JV7|Q56JV7_BOVIN Ubiquitin-like/S30 ribosomal fusion prote... 95 3e-18 tr|Q3SZG2|Q3SZG2_BOVIN Fink
Small-mass AMS radiocarbon analysis at Nagoya University
Energy Technology Data Exchange (ETDEWEB)
Minami, Masayo, E-mail: minami@nendai.nagoya-u.ac.jp [Center for Chronological Research, Nagoya University, Chikusa, Nagoya 464-8602 (Japan); Kato, Tomomi [Faculty of Science, Nagoya University, Nagoya 464-8602 (Japan); Miyata, Yoshiki; Nakamura, Toshio [Center for Chronological Research, Nagoya University, Chikusa, Nagoya 464-8602 (Japan); Hua Quan [Australian Nuclear Science and Technology Organization, Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia)
2013-01-15
As part of the ongoing development at the AMS facility of the Center for Chronological Research at Nagoya University to radiocarbon ({sup 14}C) analyze samples smaller than 0.5 mg carbon (mgC), a compact graphitization manifold has been built. Tests with various reference materials show it performs well for samples as small as 0.1 mgC. Preparation with this new system is compared with the performance of the older protocol for regular-sized samples. Furthermore, it is shown that the addition of Cu and Ag before and stepwise heating during sealed-tube combustion of samples with high S content improve the degree of conversion to CO{sub 2} without having to resort to special purification measures such as the use of Co{sub 3}O{sub 4} + Ag reagent and an n-pentane/LN{sub 2} trap before graphitization.
2012-04-06
... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35612] Manning Grain Company; Acquisition and Operation Exemption; Fillmore Western Railway Company Manning Grain Company (MGC... Docket No. FD 35607, Manning Rail, Inc.--Acquisition and Operation Exemption--Manning Grain Company...
Unigene BLAST: CBRC-XTRO-01-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available or protein (peptidase nexin-2, Alzheimer disease), mRNA (cDNA clone MGC:88882 IMAGE:6998307), complete cds /cds=p(99,2351) /gb=BC075266 /gi=49522953 /ug=Str.67411 /len=3137 5e-07 41% ...
GenBank blastx search result: AK288647 [KOME
Lifescience Database Archive (English)
Full Text Available AK288647 J090056K16 BC096137.1 BC096137 Homo sapiens transition protein 2 (during histone to protamine repla...cement), mRNA (cDNA clone MGC:116785 IMAGE:40002553), complete cds. PRI 0.0 0 ...
GenBank blastx search result: AK288647 [KOME
Lifescience Database Archive (English)
Full Text Available AK288647 J090056K16 BC096135.3 BC096135 Homo sapiens transition protein 2 (during histone to protamine repla...cement), mRNA (cDNA clone MGC:116782 IMAGE:40002547), complete cds. PRI 0.0 0 ...
GenBank blastx search result: AK288647 [KOME
Lifescience Database Archive (English)
Full Text Available AK288647 J090056K16 BC096136.3 BC096136 Homo sapiens transition protein 2 (during histone to protamine repla...cement), mRNA (cDNA clone MGC:116783 IMAGE:40002550), complete cds. PRI 0.0 0 ...
Sherr, Barry F.; Sherr, Evelyn B.
2003-04-01
Community metabolism (respiration and production) and bacterial activity were assessed in the upper water column of the central Arctic Ocean during the SHEBA/JOIS ice camp experiment, October 1997-September 1998. In the upper 50 m, decrease in integrated dissolved oxygen (DO) stocks over a period of 124 d in mid-winter suggested a respiration rate of ˜3.3 nM O 2 h -1 and a carbon demand of ˜4.5 gC m -2. Increase in 0-50 m integrated stocks of DO during summer implied a net community production of ˜20 gC m -2. Community respiration rates were directly measured via rate of decrease in DO in whole seawater during 72-h dark incubation experiments. Incubation-based respiration rates were on average 3-fold lower during winter (11.0±10.6 nM O 2 h -1) compared to summer (35.3±24.8 nM O 2 h -1). Bacterial heterotrophic activity responded strongly, without noticeable lag, to phytoplankton growth. Rate of leucine incorporation by bacteria (a proxy for protein synthesis and cell growth) increased ˜10-fold, and the cell-specific rate of leucine incorporation ˜5-fold, from winter to summer. Rates of production of bacterial biomass in the upper 50 m were, however, low compared to other oceanic regions, averaging 0.52±0.47 ngC l -1 h -1 during winter and 5.1±3.1 ngC l -1 h -1 during summer. Total carbon demand based on respiration experiments averaged 2.4±2.3 mgC m -3 d -1 in winter and 7.8±5.5 mgC m -3 d -1 in summer. Estimated bacterial carbon demand based on bacterial productivity and an assumed 10% gross growth efficiency was much lower, averaging about 0.12±0.12 mgC m -3 d -1 in winter and 1.3±0.7 mgC m -3 d -1 in summer. Our estimates of bacterial activity during summer were an order of magnitude less than rates reported from a summer 1994 study in the central Arctic Ocean, implying significant inter-annual variability of microbial processes in this region.
GenBank blastx search result: AK110605 [KOME
Lifescience Database Archive (English)
Full Text Available AK110605 002-168-G09 BC097157.1 Danio rerio similar to Myeloid leukemia factor 2 (Myelodysplasia-myeloid leu...kemia factor 2), mRNA (cDNA clone MGC:114097 IMAGE:7448089), complete cds.|VRT VRT 6e-15 +3 ...
Stull, Mamie C; Strilka, Richard J; Clemens, Michael S; Armen, Scott B
2015-06-30
Optimal management of non-critically ill patients with diabetes maintained on continuous enteral feeding (CEN) is poorly defined. Subcutaneous (SQ) lispro and SQ regular insulin were compared in a simulated type 1 and type 2 diabetic patient receiving CEN. A glucose-insulin feedback mathematical model was employed to simulate type 1 and type 2 diabetic patients on CEN. Each patient received 25 SQ injections of regular insulin or insulin lispro, ranging from 0-6 U. Primary endpoints were the change in mean glucose concentration (MGC) and change in glucose variability (GV); hypoglycemic episodes were also reported. The model was first validated against patient data. Both SQ insulin preparations linearly decreased MGC, however, SQ regular insulin decreased GV whereas SQ lispro tended to increase GV. Hourly glucose concentration measurements were needed to capture the increase in GV. In the type 2 diabetic patient, "rebound hyperglycemia" occurred after SQ lispro was rapidly metabolized. Although neither SQ insulin preparation caused hypoglycemia, SQ lispro significantly lowered MGC compared to SQ regular insulin. Thus, it may be more likely to cause hypoglycemia. Analyses of the detailed glucose concentration versus time data suggest that the inferior performance of lispro resulted from its shorter duration of action. Finally, the effects of both insulin preparations persisted beyond their duration of actions in the type 2 diabetic patient. Subcutaneous regular insulin may be the short-acting insulin preparation of choice for this subset of diabetic patients. Clinical trial is required before a definitive recommendation can be made. © 2015 Diabetes Technology Society.
Stull, Mamie C.; Strilka, Richard J.; Clemens, Michael S.; Armen, Scott B.
2015-01-01
Background: Optimal management of non–critically ill patients with diabetes maintained on continuous enteral feeding (CEN) is poorly defined. Subcutaneous (SQ) lispro and SQ regular insulin were compared in a simulated type 1 and type 2 diabetic patient receiving CEN. Method: A glucose-insulin feedback mathematical model was employed to simulate type 1 and type 2 diabetic patients on CEN. Each patient received 25 SQ injections of regular insulin or insulin lispro, ranging from 0-6 U. Primary endpoints were the change in mean glucose concentration (MGC) and change in glucose variability (GV); hypoglycemic episodes were also reported. The model was first validated against patient data. Results: Both SQ insulin preparations linearly decreased MGC, however, SQ regular insulin decreased GV whereas SQ lispro tended to increase GV. Hourly glucose concentration measurements were needed to capture the increase in GV. In the type 2 diabetic patient, “rebound hyperglycemia” occurred after SQ lispro was rapidly metabolized. Although neither SQ insulin preparation caused hypoglycemia, SQ lispro significantly lowered MGC compared to SQ regular insulin. Thus, it may be more likely to cause hypoglycemia. Analyses of the detailed glucose concentration versus time data suggest that the inferior performance of lispro resulted from its shorter duration of action. Finally, the effects of both insulin preparations persisted beyond their duration of actions in the type 2 diabetic patient. Conclusions: Subcutaneous regular insulin may be the short-acting insulin preparation of choice for this subset of diabetic patients. Clinical trial is required before a definitive recommendation can be made. PMID:26134836
GenBank blastx search result: AK062242 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:14115 IMAGE:3938510), complete cds.|PRI PRI 3e-31 +1 ... ...AK062242 001-047-E10 BC007878.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK110760 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:14115 IMAGE:3938510), complete cds.|PRI PRI 1e-100 +1 ... ...AK110760 002-170-H05 BC007878.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK060732 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:22893 IMAGE:4065221), complete cds.|PRI PRI 1e-113 +3 ... ...AK060732 001-032-A05 BC023983.1 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK062242 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:22893 IMAGE:4065221), complete cds.|PRI PRI 3e-31 +1 ... ...AK062242 001-047-E10 BC023983.1 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK104686 [KOME
Lifescience Database Archive (English)
Full Text Available AK104686 001-036-C11 BC034481.1 Homo sapiens branched chain keto acid dehydrogenase... E1, beta polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:26350 IMAGE:4824846), complete cds.|PRI PRI 3e-20 +1 ...
GenBank blastx search result: AK060732 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:14115 IMAGE:3938510), complete cds.|PRI PRI 1e-113 +3 ... ...AK060732 001-032-A05 BC007878.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK061863 [KOME
Lifescience Database Archive (English)
Full Text Available AK061863 001-040-H03 BC034481.1 Homo sapiens branched chain keto acid dehydrogenase... E1, beta polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:26350 IMAGE:4824846), complete cds.|PRI PRI 2e-18 +2 ...
GenBank blastx search result: AK110760 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:2355 IMAGE:2822372), complete cds.|PRI PRI 1e-100 +1 ... ...AK110760 002-170-H05 BC008933.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK060732 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:2355 IMAGE:2822372), complete cds.|PRI PRI 1e-113 +3 ... ...AK060732 001-032-A05 BC008933.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK105105 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:22893 IMAGE:4065221), complete cds.|PRI PRI 2e-26 +3 ... ...AK105105 001-100-E08 BC023983.1 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK105105 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:14115 IMAGE:3938510), complete cds.|PRI PRI 2e-26 +3 ... ...AK105105 001-100-E08 BC007878.2 Homo sapiens branched chain keto acid dehydrogenase
GenBank blastx search result: AK062242 [KOME
Lifescience Database Archive (English)
Full Text Available E1, alpha polypeptide (maple syrup urine disease), mRNA (cDNA clone MGC:2355 IMAGE:2822372), complete cds.|PRI PRI 3e-31 +1 ... ...AK062242 001-047-E10 BC008933.2 Homo sapiens branched chain keto acid dehydrogenase
Communication complexity and information complexity
Pankratov, Denis
Information complexity enables the use of information-theoretic tools in communication complexity theory. Prior to the results presented in this thesis, information complexity was mainly used for proving lower bounds and direct-sum theorems in the setting of communication complexity. We present three results that demonstrate new connections between information complexity and communication complexity. In the first contribution we thoroughly study the information complexity of the smallest nontrivial two-party function: the AND function. While computing the communication complexity of AND is trivial, computing its exact information complexity presents a major technical challenge. In overcoming this challenge, we reveal that information complexity gives rise to rich geometrical structures. Our analysis of information complexity relies on new analytic techniques and new characterizations of communication protocols. We also uncover a connection of information complexity to the theory of elliptic partial differential equations. Once we compute the exact information complexity of AND, we can compute exact communication complexity of several related functions on n-bit inputs with some additional technical work. Previous combinatorial and algebraic techniques could only prove bounds of the form theta( n). Interestingly, this level of precision is typical in the area of information theory, so our result demonstrates that this meta-property of precise bounds carries over to information complexity and in certain cases even to communication complexity. Our result does not only strengthen the lower bound on communication complexity of disjointness by making it more exact, but it also shows that information complexity provides the exact upper bound on communication complexity. In fact, this result is more general and applies to a whole class of communication problems. In the second contribution, we use self-reduction methods to prove strong lower bounds on the information
Directory of Open Access Journals (Sweden)
Antoine eAbrieux
2014-09-01
Full Text Available Olfactory information mediating sexual behavior is crucial for reproduction in many animals, including insects. In male moths, the macroglomerular complex of the primary olfactory center, the antennal lobe (AL is specialized in the treatment of information on the female-emitted sex pheromone. Evidence is accumulating that modulation of behavioral pheromone responses occurs through neuronal plasticity via the action of hormones and/or catecholamines. We recently showed that a G-protein-coupled receptor (GPCR, AipsDopEcR, with its homologue known in Drosophila for its double affinity to the main insect steroid hormone 20-hydroxyecdysone (20E, and dopamine (DA, present in the ALs, is involved in the behavioral response to pheromone in the moth, Agrotis ipsilon. Here we tested the role of AipsDopEcR as compared to nuclear 20E receptors in central pheromone processing combining receptor inhibition with intracellular recordings of AL neurons. We show that the sensitivity of AL neurons for the pheromone in males decreases strongly after AipsDopEcR-dsRNA injection but also after inhibition of nuclear 20E receptors. Moreover we tested the involvement of 20E and DA in the receptor-mediated behavioral modulation in wind tunnel experiments, using ligand applications and receptor inhibition treatments. We show that both ligands are necessary and act on AipsDopEcR-mediated behavior. Altogether these results indicate that the GPCR membrane receptor, AipsDopEcR, controls sex pheromone perception through the action of both 20E and DA in the central nervous system, probably in concert with 20E action through nuclear receptors.
Digital Repository Service at National Institute of Oceanography (India)
Madhu, N.V.; Jyothibabu, R.; Maheswaran, P.A.; Jayaraj, K.A.; Achuthankutty, C.T.
The surface waters of the northeastern Arabian Sea sustained relatively high chlorophyll a (average 0.81+ or -0.80 mg m sup(-3)) and primary production (average 29.5+ or -23.6 mgC m sup(-3)d sup(-1)) during the early spring intermonsoon 2000...
77 FR 23806 - Manning Rail, Inc.-Acquisition and Operation Exemption-Manning Grain Company
2012-04-20
... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35607] Manning Rail, Inc.--Acquisition and Operation Exemption--Manning Grain Company Manning Rail, Inc. (MRI), a noncarrier, has filed a verified notice of exemption \\1\\ under 49 CFR 1150.31 to acquire from Manning Grain Company (MGC) and...
GenBank blastx search result: AK105761 [KOME
Lifescience Database Archive (English)
Full Text Available AK105761 001-202-D07 BC040139.2 Homo sapiens branched chain keto acid dehydrogenase... E1, beta polypeptide (maple syrup urine disease), transcript variant 1, mRNA (cDNA clone MGC:48849 IMAGE:5493159), complete cds.|PRI PRI 1e-115 +2 ...
GenBank blastx search result: AK104686 [KOME
Lifescience Database Archive (English)
Full Text Available AK104686 001-036-C11 BC040139.2 Homo sapiens branched chain keto acid dehydrogenase... E1, beta polypeptide (maple syrup urine disease), transcript variant 1, mRNA (cDNA clone MGC:48849 IMAGE:5493159), complete cds.|PRI PRI 1e-48 +1 ...
GenBank blastx search result: AK061863 [KOME
Lifescience Database Archive (English)
Full Text Available AK061863 001-040-H03 BC040139.2 Homo sapiens branched chain keto acid dehydrogenase... E1, beta polypeptide (maple syrup urine disease), transcript variant 1, mRNA (cDNA clone MGC:48849 IMAGE:5493159), complete cds.|PRI PRI 2e-47 +2 ...
Bacterial lipopolysaccharide induces osteoclast formation in RAW 264.7 macrophage cells
International Nuclear Information System (INIS)
Islam, Shamima; Hassan, Ferdaus; Tumurkhuu, Gantsetseg; Dagvadorj, Jargalsaikhan; Koide, Naoki; Naiki, Yoshikazu; Mori, Isamu; Yoshida, Tomoaki; Yokochi, Takashi
2007-01-01
Lipopolysaccharide (LPS) is a potent bone resorbing factor. The effect of LPS on osteoclast formation was examined by using murine RAW 264.7 macrophage cells. LPS-induced the formation of multinucleated giant cells (MGC) in RAW 264.7 cells 3 days after the exposure. MGCs were positive for tartrate-resistant acid phosphatase (TRAP) activity. Further, MGC formed resorption pits on calcium-phosphate thin film that is a substrate for osteoclasts. Therefore, LPS was suggested to induce osteoclast formation in RAW 264.7 cells. LPS-induced osteoclast formation was abolished by anti-tumor necrosis factor (TNF)-α antibody, but not antibodies to macrophage-colony stimulating factor (M-CSF) and receptor activator of nuclear factor (NF)-κB ligand (RANKL). TNF-α might play a critical role in LPS-induced osteoclast formation in RAW 264.7 cells. Inhibitors of NF-κB and stress activated protein kinase (SAPK/JNK) prevented the LPS-induced osteoclast formation. The detailed mechanism of LPS-induced osteoclast formation is discussed
Directory of Open Access Journals (Sweden)
Pablo I. Fragoso-López
2017-11-01
Full Text Available The effects of global climate change have highlighted forest ecosystems as a key element in reducing the amount of atmospheric carbon through photosynthesis. The objective of this study was to estimate the amount of carbon content and its percentage capture in a protected Abies religiosa forest in which the study area was zoned with satellite image analysis. Dendrometric and epidometric variables were used to determine the volume and increase of aerial biomass, and stored carbon and its capture rate using equations. The results indicate that this forest contains an average of 105.72 MgC ha−1, with an estimated sequestration rate of 1.03 MgC ha−1 yr−1. The results show that carbon capture increasing depends on the increase in volume. Therefore, in order to achieve the maximum yield in a forest, it is necessary to implement sustainable forest management that favors the sustained use of soil productivity.
Oxygen uptake and haemocyanin oxygen affinity
African Journals Online (AJOL)
1990-04-17
Apr 17, 1990 ... reni showed that the two different gas exchange processes operating in water and in .... CaCl2 20 mmol rl; MgC~ 10 mmol rl; flow rate 7 ml h-I) at different pH values. ... on the moving canvas. In their behaviour on the treadmill,.
Present status of oceanographic studies and characteristics of the Exclusive Economic Zone of India
Digital Repository Service at National Institute of Oceanography (India)
Desai, B.N.; Bhargava, R.M.S.; Sarupria, J.S.; Reddy, G.V.
production varied from 0.3 to 86.7 mgc/mu3/day. The surface production per unit area is marginally higher along the west coast waters than in the east coast waters whereas column production is much higher in the waters of the eastern coast than the western...
Seasonal variations and trophic ecology of microzooplankton in the southeastern Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
AshaDevi, C.R.; Jyothibabu, R.; Sabu, P.; Jacob, J.; Habeebrehman, H.; Prabhakaran, M.P.; Jayalakshmi, K.J.; Achuthankutty, C.T.
integrated chlorophyll a (av. 19 plus of minus 11.3 mg m sup(-2)) and primary production (av. 164 plus or minus 91 mgC m sup(-2) d sup(-1)). On the other hand, nutrient enrichment associated with coastal upwelling and river influx during the onset and peak...
Treatment patterns in patients with advanced gastric cancer in Taiwan.
Cuyun Carter, Gebra; Kaltenboeck, Anna; Ivanova, Jasmina; Liepa, Astra M; San Roman, Alexandra; Koh, Maria; Rajan, Narayan; Cheng, Rebecca; Birnbaum, Howard; Chen, Jen-Shi
2017-06-01
To describe treatment patterns, outcomes and healthcare resource use in patients with metastatic and/or locally recurrent, unresectable gastric cancer (MGC) in Taiwan. Patients who had received first-line therapy (platinum and/or fluoropyrimidine) followed by second-line therapy or best supportive care (BSC) only were eligible. Participating physicians provided de-identified information from patient charts. Data were summarized descriptively and Kaplan-Meier analysis was used to describe time to events. Overall, 37 physicians contributed 122 patient charts. Of the 122 patients (median age, 61 years; 62% male), 43 (35%) received BSC only following first-line therapy, whereas 79 (65%) received second-line therapy. There was heterogeneity in second-line treatment, although fluoropyrimidine with or without a platinum agent was most frequently used. Median survival was 12.5 (interquartile range [IQR], 8.2-20.8) months from MGC diagnosis for patients receiving second-line therapy and 8.0 (IQR, 5.6-not reached) months for patients receiving BSC only. The most common treatment-related symptoms were nausea/vomiting (58%); the most common cancer-related symptoms were pain (61%), ascites (35%) and nausea/vomiting (33%). Inpatient and outpatient hospitalizations were numerically more common for patients receiving second-line therapy than for those receiving BSC only; the prevalence of hospice and skilled nursing facility stays were numerically more common for patients receiving BSC only. In this Taiwanese MGC population, 65% received active second-line therapy with heterogeneity seen in the regimen used. Clinical outcomes suggest an unmet medical need in this population. This study may help inform clinical practice and future research to ultimately improve patient outcomes in Taiwan. © 2016 John Wiley & Sons Australia, Ltd.
Gene : CBRC-HSAP-02-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-02-0021 Novel 2 B UNKNOWN ZNF99_HUMAN 2e-13 48% gb|EAX02144.1| hCG1991981 [Homo sapi...ens] 2e-18 68% gnl|UG|Hs#S6686832 Homo sapiens hypothetical LOC387790, mRNA (cDNA clone MGC:42208...SRLRPSVRFCFFLQISLIVNIFFPGILSCLHCERNALLLYSPNCHSSLLTGEPIVCDPWASTELHKMIYKNVHVSGFSVEKTMHAAPI
A comparative study of anti-gastric cancer activity between aqueous ...
African Journals Online (AJOL)
... activity at a low concentration (32.5 mg/ml), which was remained at about 20%. After being affected by two types of extracts, cells had uneven sizes, with very low brightness, while the normal cells presented a uniform full form, with high definition. Keywords: Folium Cordylines Fruticosae Anti-gastric Cancer MGC-803 cell ...
Directory of Open Access Journals (Sweden)
Barbara Urban-Malinga
2003-12-01
Full Text Available The microphytobenthic primary production and chlorophyll a content were studied over the annual cycle (May 1998 - May 1999 on a non-tidal Baltic sandy beach at three stations along the beach gradient: littoral, waterline and splash zone. The chlorophyll a concentrations varied between 0.88 and 12.18 µg cm-3. Net and gross primary production rates respectively lay within the ranges 0.1-31.4 mgC m-2 h-1 and 0.2-41.8 mgC m-2 h-1. The highest values of both Chl a content and primary production were noted at the littoral station, the lowest ones at the waterline. The mean annual P/B ratio was highest at the waterline. The differences in Chl a content between stations were statistically significant and may be related to water dynamics, resuspension and water content. Production rates were highly variable on monthly time scales, and the highest results at all the study locations were noted in July. The gross photosynthetic rates were significantly correlated with water temperature.
Design and characterization of a biodegradable composite scaffold for ligament tissue engineering.
Hayami, James W S; Surrao, Denver C; Waldman, Stephen D; Amsden, Brian G
2010-03-15
Herein we report on the development and characterization of a biodegradable composite scaffold for ligament tissue engineering based on the fundamental morphological features of the native ligament. An aligned fibrous component was used to mimic the fibrous collagen network and a hydrogel component to mimic the proteoglycan-water matrix of the ligament. The composite scaffold was constructed from cell-adherent, base-etched, electrospun poly(epsilon-caprolactone-co-D,L-lactide) (PCLDLLA) fibers embedded in a noncell-adherent photocrosslinked N-methacrylated glycol chitosan (MGC) hydrogel seeded with primary ligament fibroblasts. Base etching improved cellular adhesion to the PCLDLLA material. Cells within the MGC hydrogel remained viable (72 +/- 4%) during the 4-week culture period. Immunohistochemistry staining revealed ligament ECM markers collagen type I, collagen type III, and decorin organizing and accumulating along the PCLDLLA fibers within the composite scaffolds. On the basis of these results, it was determined that the composite scaffold design was a viable alternative to the current approaches used for ligament tissue engineering and merits further study. (c) 2009 Wiley Periodicals, Inc.
Lapointe, Brian E.
1986-03-01
Growth enrichment studies utilizing in vitu cage cultures and a shipboard flowing seawater culture system were conducted with whole-plant populations of pelagic Sargassum-S. natans and S. fluitans (Phaeophyceaa)-in the western Sargasso Sea and at Looe Key Marine Sanctuary adjacent to the Straits of Florida. Growth rates of both species ranged from 0.03 to 0.04 doublings d -1 in control cultures receiving no enrichment and in cultures receiving either NO 3- or NH 4+ enrichment; in contrast, growth rates ranged from 0.05 to 0.08 doublings d -1 in cultures receiving PO 43- enrichment. Midday photosynthetic rates of S. natans and S. fluitans were also two-fold higher with PO 43- enrichment, ca. 2.3 mgC g dryw-1 h -1 compared to 1.0 to 1.5 mgC g dry wt -1 h -1 in the NH 4+, NO 3-, and control treatments. These data suggest the pelagic Sargassum may grow faster than previously thought and that phosphorus, rather than nitroge, may be the primary nutrient limiting growth and productivity of these plants.
21 CFR 184.1426 - Magnesium chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium chloride. 184.1426 Section 184.1426 Food... Specific Substances Affirmed as GRAS § 184.1426 Magnesium chloride. (a) Magnesium chloride (MgC12·6H2O, CAS... hydrochloric acid solution and crystallizing out magnesium chloride hexahydrate. (b) The ingredient meets the...
Smallman, Thomas Luke; Exbrayat, Jean-François; Bloom, Anthony; Williams, Mathew
2017-04-01
Forests are a critical component of the global carbon cycle, storing significant amounts of carbon, split between living biomass and dead organic matter. The carbon budget of forests is the most uncertain component of the global carbon cycle - it is currently impossible to quantify accurately the carbon source/sink strength of forest biomes due to their heterogeneity and complex dynamics. It has been a major challenge to generate robust carbon budgets across landscapes due to data scarcity. Models have been used for estimating carbon budgets, but outputs have lacked an assessment of uncertainty, making a robust assessment of their reliability and accuracy challenging. Here a Metropolis Hastings - Markov Chain Monte Carlo (MH-MCMC) data assimilation framework has been used to combine remotely sensed leaf area index (MODIS), biomass (where available) and deforestation estimates, in addition to forest planting information from the UK's national forest inventory, an estimate of soil carbon from the Harmonized World Database (HWSD) and plant trait information with a process model (DALEC) to produce a constrained analysis with a robust estimate of uncertainty of the UK forestry carbon budget between 2000 and 2010. Our analysis estimates the mean annual UK forest carbon sink at -3.9 MgC ha-1 yr-1 with a 95 % confidence interval between -4.0 and -3.1 MgC ha-1yr-1. The UK national forest inventory (NFI) estimates the mean UK forest carbon sink to be between -1.4 and -5.5 MgC ha-1 yr-1. The analysis estimate for total forest biomass stock in 2010 is estimated at 229 (177/232) TgC, while the NFI an estimated total forest biomass carbon stock of 216 TgC. Leaf carbon area (LCA) is a key plant trait which we are able to estimate using our analysis. Comparison of median estimates for (LCA) retrieved from the analysis and a UK land cover map show higher and lower values for LCA are estimated areas dominated by needle leaf and broad leaf forests forest respectively, consistent with
Ecosystem-Level Carbon Stocks in Costa Rican Mangrove Forests
Cifuentes, M.
2012-12-01
Tropical mangroves provide a wide variety of ecosystem services, including atmospheric carbon sequestration. Because of their high rates of carbon accumulation, the large expected size of their total stocks (from 2 to 5 times greater than those of upland tropical forests), and the alarming rates at which they are being converted to other uses (releasing globally from 0.02 to 0.12 Pg C yr-1), mangroves are receiving increasing attention as additional tools to mitigate climate change. However, data on whole ecosystem-level carbon in tropical mangroves is limited. Here I present the first estimate of ecosystem level carbon stocks in mangrove forests of Central America. I established 28, 125 m-long, sampling transects along the 4 main rivers draining the Térraba-Sierpe National Wetland in the southern Pacific coast of Costa Rica. This area represents 39% of all remaining mangroves in the country (48300 ha). A circular nested plot was placed every 25 m along each transect. Carbon stocks of standing trees, regeneration, the herbaceous layer, litter, and downed wood were measured following internationally-developed methods compatible with IPCC "Good Practice Guidelines". In addition, total soil carbon stocks were determined down to 1 m depth. Together, these carbon estimates represent the ecosystem-carbon stocks of these forests. The average aboveground carbon stocks were 72.5 ± 3.2 MgC ha-1 (range: 9 - 241 MgC ha-1), consistent with results elsewhere in the world. Between 74 and 92% of the aboveground carbon is stored in trees ≥ 5cm dbh. I found a significant correlation between basal area of trees ≥ 5cm dbh and total aboveground carbon. Soil carbon stocks to 1 m depth ranged between 141 y 593 MgC ha-1. Ecosystem-level carbon stocks ranged from 391 MgC ha-1 to 438 MgC ha-1, with a slight increase from south to north locations. Soil carbon stocks represent an average 76% of total ecosystem carbon stocks, while trees represent only 20%. These Costa Rican mangroves
International Nuclear Information System (INIS)
Kim, Bong Gon; Kim, Jae Sang; Kim, Jin Eun; Lee, Boo Yeon
2006-06-01
This book introduces complex chemistry with ten chapters, which include development of complex chemistry on history coordination theory and Warner's coordination theory and new development of complex chemistry, nomenclature on complex with conception and define, chemical formula on coordination compound, symbol of stereochemistry, stereo structure and isomerism, electron structure and bond theory on complex, structure of complex like NMR and XAFS, balance and reaction on solution, an organo-metallic chemistry, biology inorganic chemistry, material chemistry of complex, design of complex and calculation chemistry.
Dicty_cDB: Contig-U15484-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FI687.fwd CAFI Pichia stipitis aerobic dextrose... 78 2e-12 2 ( FE846349 ) CAFI687.rev CAFI Pichia stipitis aerobic dextrose...IH_MGC_172 Homo sapiens cDNA ... 46 2e-12 4 ( FE846884 ) CAFI969.fwd CAFI Pichia stipitis aerobic dextrose..... CAFI Pichia stipitis aerobic dextrose... 74 2e-11 2 ( CD390130 ) AGENCOURT_14339
Li, Chao; Ji, Yang; Wang, Can; Liang, Shujing; Pan, Fei; Zhang, Chunlei; Chen, Feng; Fu, Hualin; Wang, Kan; Cui, Daxiang
2014-05-01
Successful development of safe and highly effective nanoprobes for targeted imaging of in vivo early gastric cancer is a great challenge. Herein, we choose the CdSe/ZnS (core-shell) quantum dots (QDs) as prototypical materials, synthesized one kind of a new amphiphilic polymer including dentate-like alkyl chains and multiple carboxyl groups, and then used the prepared amphiphilic polymer to modify QDs. The resultant amphiphilic polymer engineered QDs (PQDs) were conjugated with BRCAA1 and Her2 monoclonal antibody, and prepared BRCAA1 antibody- and Her2 antibody-conjugated QDs were used for in vitro MGC803 cell labeling and in vivo targeted imaging of gastric cancer cells. Results showed that the PQDs exhibited good water solubility, strong photoluminescence (PL) intensity, and good biocompatibility. BRCAA1 antibody- and Her2 antibody-conjugated QD nanoprobes successfully realized targeted imaging of in vivo gastric cancer MGC803 cells. In conclusion, BRCAA1 antibody- and Her2 antibody-conjugated PQDs have great potential in applications such as single cell labeling and in vivo tracking, and targeted imaging and therapeutic effects' evaluation of in vivo early gastric cancer cells in the near future.
International Nuclear Information System (INIS)
Li, Chao; Ruan, Jing; Yang, Meng; Pan, Fei; Gao, Guo; Qu, Su; Shen, You-Lan; Dang, Yong-Jun; Wang, Kan; Jin, Wei-Lin; Cui, Da-Xiang
2015-01-01
Human induced pluripotent stem (iPS) cells exhibit great potential for generating functional human cells for medical therapies. In this paper, we report for use of human iPS cells labeled with fluorescent magnetic nanoparticles (FMNPs) for targeted imaging and synergistic therapy of gastric cancer cells in vivo. Human iPS cells were prepared and cultured for 72 h. The culture medium was collected, and then was co-incubated with MGC803 cells. Cell viability was analyzed by the MTT method. FMNP-labeled human iPS cells were prepared and injected into gastric cancer-bearing nude mice. The mouse model was observed using a small-animal imaging system. The nude mice were irradiated under an external alternating magnetic field and evaluated using an infrared thermal mapping instrument. Tumor sizes were measured weekly. iPS cells and the collected culture medium inhibited the growth of MGC803 cells. FMNP-labeled human iPS cells targeted and imaged gastric cancer cells in vivo, as well as inhibited cancer growth in vivo through the external magnetic field. FMNP-labeled human iPS cells exhibit considerable potential in applications such as targeted dual-mode imaging and synergistic therapy for early gastric cancer
ComplexViewer: visualization of curated macromolecular complexes.
Combe, Colin W; Sivade, Marine Dumousseau; Hermjakob, Henning; Heimbach, Joshua; Meldal, Birgit H M; Micklem, Gos; Orchard, Sandra; Rappsilber, Juri
2017-11-15
Proteins frequently function as parts of complexes, assemblages of multiple proteins and other biomolecules, yet network visualizations usually only show proteins as parts of binary interactions. ComplexViewer visualizes interactions with more than two participants and thereby avoids the need to first expand these into multiple binary interactions. Furthermore, if binding regions between molecules are known then these can be displayed in the context of the larger complex. freely available under Apache version 2 license; EMBL-EBI Complex Portal: http://www.ebi.ac.uk/complexportal; Source code: https://github.com/MICommunity/ComplexViewer; Package: https://www.npmjs.com/package/complexviewer; http://biojs.io/d/complexviewer. Language: JavaScript; Web technology: Scalable Vector Graphics; Libraries: D3.js. colin.combe@ed.ac.uk or juri.rappsilber@ed.ac.uk. © The Author 2017. Published by Oxford University Press.
Synchronization in node of complex networks consist of complex chaotic system
Energy Technology Data Exchange (ETDEWEB)
Wei, Qiang, E-mail: qiangweibeihua@163.com [Beihua University computer and technology College, BeiHua University, Jilin, 132021, Jilin (China); Digital Images Processing Institute of Beihua University, BeiHua University, Jilin, 132011, Jilin (China); Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian, 116024 (China); Xie, Cheng-jun [Beihua University computer and technology College, BeiHua University, Jilin, 132021, Jilin (China); Digital Images Processing Institute of Beihua University, BeiHua University, Jilin, 132011, Jilin (China); Liu, Hong-jun [School of Information Engineering, Weifang Vocational College, Weifang, 261041 (China); Li, Yan-hui [The Library, Weifang Vocational College, Weifang, 261041 (China)
2014-07-15
A new synchronization method is investigated for node of complex networks consists of complex chaotic system. When complex networks realize synchronization, different component of complex state variable synchronize up to different scaling complex function by a designed complex feedback controller. This paper change synchronization scaling function from real field to complex field for synchronization in node of complex networks with complex chaotic system. Synchronization in constant delay and time-varying coupling delay complex networks are investigated, respectively. Numerical simulations are provided to show the effectiveness of the proposed method.
Startup work on Inshas cyclotron
International Nuclear Information System (INIS)
Vorogushin, M.F.; Strokach, A.P.; Shikhov, V.Ya.; Galchuk, A.V.; Soliman, A.N.; El-Abyad, M.; Comsan, M.N.H.; Saleh, Z.A.; Azzam, A.N.
2001-01-01
Startup works on the MGC-20 variable energy cyclotron in the Inshas Nuclear Research Center (Egypt) are described. The cyclotron is intended for acceleration of hydrogen and helium ions in a wide energy range (for protons - from 5 to 20 MeV). Main units of the cyclotron and results of computer experimental acceleration of protons to 18 MeV are described. The prospects of furthers investigations are presented [ru
Generalized Combination Complex Synchronization for Fractional-Order Chaotic Complex Systems
Directory of Open Access Journals (Sweden)
Cuimei Jiang
2015-07-01
Full Text Available Based on two fractional-order chaotic complex drive systems and one fractional-order chaotic complex response system with different dimensions, we propose generalized combination complex synchronization. In this new synchronization scheme, there are two complex scaling matrices that are non-square matrices. On the basis of the stability theory of fractional-order linear systems, we design a general controller via active control. Additionally, by virtue of two complex scaling matrices, generalized combination complex synchronization between fractional-order chaotic complex systems and real systems is investigated. Finally, three typical examples are given to demonstrate the effectiveness and feasibility of the schemes.
Erdi, Peter
2008-01-01
This book explains why complex systems research is important in understanding the structure, function and dynamics of complex natural and social phenomena. Readers will learn the basic concepts and methods of complex system research.
On Measuring the Complexity of Networks: Kolmogorov Complexity versus Entropy
Directory of Open Access Journals (Sweden)
Mikołaj Morzy
2017-01-01
Full Text Available One of the most popular methods of estimating the complexity of networks is to measure the entropy of network invariants, such as adjacency matrices or degree sequences. Unfortunately, entropy and all entropy-based information-theoretic measures have several vulnerabilities. These measures neither are independent of a particular representation of the network nor can capture the properties of the generative process, which produces the network. Instead, we advocate the use of the algorithmic entropy as the basis for complexity definition for networks. Algorithmic entropy (also known as Kolmogorov complexity or K-complexity for short evaluates the complexity of the description required for a lossless recreation of the network. This measure is not affected by a particular choice of network features and it does not depend on the method of network representation. We perform experiments on Shannon entropy and K-complexity for gradually evolving networks. The results of these experiments point to K-complexity as the more robust and reliable measure of network complexity. The original contribution of the paper includes the introduction of several new entropy-deceiving networks and the empirical comparison of entropy and K-complexity as fundamental quantities for constructing complexity measures for networks.
Complex dynamical invariants for two-dimensional complex potentials
Indian Academy of Sciences (India)
Abstract. Complex dynamical invariants are searched out for two-dimensional complex poten- tials using rationalization method within the framework of an extended complex phase space characterized by x = x1 + ip3, y = x2 + ip4, px = p1 + ix3, py = p2 + ix4. It is found that the cubic oscillator and shifted harmonic oscillator ...
Complex Fuzzy Set-Valued Complex Fuzzy Measures and Their Properties
Ma, Shengquan; Li, Shenggang
2014-01-01
Let F*(K) be the set of all fuzzy complex numbers. In this paper some classical and measure-theoretical notions are extended to the case of complex fuzzy sets. They are fuzzy complex number-valued distance on F*(K), fuzzy complex number-valued measure on F*(K), and some related notions, such as null-additivity, pseudo-null-additivity, null-subtraction, pseudo-null-subtraction, autocontionuous from above, autocontionuous from below, and autocontinuity of the defined fuzzy complex number-valued measures. Properties of fuzzy complex number-valued measures are studied in detail. PMID:25093202
The complex portal--an encyclopaedia of macromolecular complexes.
Meldal, Birgit H M; Forner-Martinez, Oscar; Costanzo, Maria C; Dana, Jose; Demeter, Janos; Dumousseau, Marine; Dwight, Selina S; Gaulton, Anna; Licata, Luana; Melidoni, Anna N; Ricard-Blum, Sylvie; Roechert, Bernd; Skyzypek, Marek S; Tiwari, Manu; Velankar, Sameer; Wong, Edith D; Hermjakob, Henning; Orchard, Sandra
2015-01-01
The IntAct molecular interaction database has created a new, free, open-source, manually curated resource, the Complex Portal (www.ebi.ac.uk/intact/complex), through which protein complexes from major model organisms are being collated and made available for search, viewing and download. It has been built in close collaboration with other bioinformatics services and populated with data from ChEMBL, MatrixDB, PDBe, Reactome and UniProtKB. Each entry contains information about the participating molecules (including small molecules and nucleic acids), their stoichiometry, topology and structural assembly. Complexes are annotated with details about their function, properties and complex-specific Gene Ontology (GO) terms. Consistent nomenclature is used throughout the resource with systematic names, recommended names and a list of synonyms all provided. The use of the Evidence Code Ontology allows us to indicate for which entries direct experimental evidence is available or if the complex has been inferred based on homology or orthology. The data are searchable using standard identifiers, such as UniProt, ChEBI and GO IDs, protein, gene and complex names or synonyms. This reference resource will be maintained and grow to encompass an increasing number of organisms. Input from groups and individuals with specific areas of expertise is welcome. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.
Thiyagalingam, Jeyarajan
2013-06-01
In this paper, we present a novel visualization technique for assisting the observation and analysis of algorithmic complexity. In comparison with conventional line graphs, this new technique is not sensitive to the units of measurement, allowing multivariate data series of different physical qualities (e.g., time, space and energy) to be juxtaposed together conveniently and consistently. It supports multivariate visualization as well as uncertainty visualization. It enables users to focus on algorithm categorization by complexity classes, while reducing visual impact caused by constants and algorithmic components that are insignificant to complexity analysis. It provides an effective means for observing the algorithmic complexity of programs with a mixture of algorithms and black-box software through visualization. Through two case studies, we demonstrate the effectiveness of complexity plots in complexity analysis in research, education and application. © 2013 The Author(s) Computer Graphics Forum © 2013 The Eurographics Association and Blackwell Publishing Ltd.
Zhou, Kairui; Shi, Xiaoli; Huo, Jinling; Liu, Weihua; Yang, Dongxiao; Yang, Tengjiao; Qin, Tiantian; Wang, Cong
2017-08-01
Drug resistance and metastasis significantly hinder chemotherapy and worsen prognoses in cancer. Bone morphogenetic protein 4 (BMP4) belongs to the TGF-β superfamily, has broad biological activities in cell proliferation and cartilage differentiation and is also able to induce migration and invasion. Herein, we investigated the role of BMP4 in the regulation of metastasis in paclitaxel-resistant human esophageal carcinoma EC109 cells (EC109/Taxol) and docetaxel-resistant human gastric cancer MGC803 cells (MGC/Doc). In these drug-resistant cell lines, we found the cell motility was enhanced and BMP4 was up-regulated relative to their respective parental cell lines. Consistent with in vitro assays, migration potential and BMP4 expression were increased in EC109/Taxol nude mice. Furthermore, to address whether BMP4 was required to enhance the metastatic in EC109/Taxol cells, the pharmacological inhibitor of BMP signaling dorsomorphin was used; meanwhile, we found that the migration and invasion abilities were inhibited. Moreover, the canonical Smad signaling pathway was investigated. Overall, our studies demonstrated that BMP4 participates in the regulation of invasion and migration by EC109/Taxol cells, and inhibition of BMP4 may be a novel strategy to interfere with metastasis in cancer therapy. Copyright © 2017 Elsevier B.V. All rights reserved.
Effect of aggregates on the magnetization property of ferrofluids: A model of gaslike compression
Directory of Open Access Journals (Sweden)
Jian Li, Yan Huang, Xiaodong Liu, Yueqing Lin, Lang Bai and Qiang Li
2007-01-01
Full Text Available The effect of field-induced aggregation of particles on the magnetization property of ferrofluids is investigated. From the viewpoint of energy, magnetizability of ferrofluids is more complicated than predicted by Langevin theory because the aggregation, i.e., the transition of ferrofluid microstructure, would consume the energy of the applied magnetic field. For calculating the effect of aggregates on the magnetization of ferrofluids, a model of gaslike compression (MGC is proposed to simulate the evolution of the aggregate structure. In this model, the field-induced colloidal particles aggregating in ferrofluids is equivalent to the "gas of the particles" being compressed by the applied magnetic field. The entropy change of the ferrofluid microstructure is proportional to the particle volume fraction in field-induced aggregates phivH. On the basis of the known behavior of ferrofluid magnetization and the aggregate structure determined from the present experiments, phivH is obtained and found to depend on the aggregating characteristic parameter of ferrofluid particles γ in addition to the particle volume fraction in ferrofluids phiv and the strength of applied magnetic field H. The effect of the nonmagnetic surface layer of ferrofluid particles is also studied. The theory of MGC conforms to our experimental results better than Langevin theory.
Medical isotope production experience at the V.G. Khlopin Radium Institute cyclotron
International Nuclear Information System (INIS)
Solin, L.M.
2000-01-01
Radium Institute cyclotron MGC-20 is used since 1990. There are four cyclotrons of such type in Russia and four abroad: in Finland, in Hungary, in North Korea and in Egypt. The Radium institute cyclotron was used in different fields, such as radioisotope production, nuclear physics, physics and engineering. For ten years some improvements of the Radium Institute cyclotron operation have been made. Those are: creation of the automatic control system based on IBM PC, development of a new power supply for the ion source, creation of the deflector electronic protection from discharges, change of the main elements of the cyclotron with high induced radioactivity. Moreover we investigated the possibility of the negative ions acceleration at the MGC-20 cyclotron without ion source exchange. The maximum value of the proton beam current reached was about 30 μA for 10 MeV H - beam energy. To extract the proton beam from the cyclotron after the stripping foil we made an additional output beam line. It was used for determination of the horizontal and vertical emittance. A special device was constructed and used for measurements of emittance. The latter amounted 30 π mm mrad for horizontal direction and 16 π mm mrad for vertical direction
Li, Long-Zhu; Deng, Hong-Xia; Lou, Wen-Zhu; Sun, Xue-Yan; Song, Meng-Wan; Tao, Jing; Xiao, Bing-Xiu; Guo, Jun-Ming
2012-01-07
To investigate the growth effects of 4-phenyl butyric acid (PBA) on human gastric carcinoma cells and their mechanisms. Moderately-differentiated human gastric carcinoma SGC-7901 and lowly-differentiated MGC-803 cells were treated with 5, 10, 20, 40, and 60 μmol/L PBA for 1-4 d. Cell proliferation was detected using the MTT colorimetric assay. Cell cycle distributions were examined using flow cytometry. The proliferation of gastric carcinoma cells was inhibited by PBA in a dose- and time-dependent fashion. Flow cytometry showed that SGC-7901 cells treated with low concentrations of PBA were arrested at the G₀/G₁ phase, whereas cells treated with high concentrations of PBA were arrested at the G₂/M phase. Although MGC-803 cells treated with low concentrations of PBA were also arrested at the G₀/ G₁ phase, cells treated with high concentrations of PBA were arrested at the S phase. The growth inhibitory effect of PBA on gastric cancer cells is associated with alteration of the cell cycle. For moderately-differentiated gastric cancer cells, the cell cycle was arrested at the G₀ /G₁ and G₂/M phases. For lowly-differentiated gastric cancer cells, the cell cycle was arrested at the G₀/G₁ and S phases.
Zheng, Fangyang
2002-01-01
The theory of complex manifolds overlaps with several branches of mathematics, including differential geometry, algebraic geometry, several complex variables, global analysis, topology, algebraic number theory, and mathematical physics. Complex manifolds provide a rich class of geometric objects, for example the (common) zero locus of any generic set of complex polynomials is always a complex manifold. Yet complex manifolds behave differently than generic smooth manifolds; they are more coherent and fragile. The rich yet restrictive character of complex manifolds makes them a special and interesting object of study. This book is a self-contained graduate textbook that discusses the differential geometric aspects of complex manifolds. The first part contains standard materials from general topology, differentiable manifolds, and basic Riemannian geometry. The second part discusses complex manifolds and analytic varieties, sheaves and holomorphic vector bundles, and gives a brief account of the surface classifi...
African Journals Online (AJOL)
activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.
Redetermination of diaquatetrakis(dimethylformamide-κOmagnesium dichloride
Directory of Open Access Journals (Sweden)
Guido J. Reiss
2011-08-01
Full Text Available The crystal structure of the title compound, [Mg(C3H7NO4(H2O2]Cl2, in which the Mg ion lies on a crystallographic inversion centre, confirms that of the previous room-temperature study [Pavanello et al. (1995. Main Group Met. Chem. 18, 9–19]. This redetermination at 113 K has improved geometry precision by almost an order of magnitude [e.g. Mg—O(w (w = water distances = 2.094 (4 and 2.0899 (7 Å in the old and new structures, respectively] and allowed the water H atoms to be located and their positions refined. In the crystal, O—H...Cl hydrogen bonds between the two aqua ligands of the complex molecule and neighboring chloride counter-anions generate supramolecular chains propagating along [010]. The dicationic [Mg(DMF4(H2O2] unit (DMF is dimethylformamide adopts a slightly distorted octahedral geometry in which the Mg atom is coordinated by four DMF O atoms in a pseudo-tetragonal arrangement and two trans aqua ligands.
Workshop on Recommendation in Complex Scenarios (ComplexRec 2017)
DEFF Research Database (Denmark)
Bogers, Toine; Koolen, Marijn; Mobasher, Bamshad
2017-01-01
Recommendation algorithms for ratings prediction and item ranking have steadily matured during the past decade. However, these state-of-the-art algorithms are typically applied in relatively straightforward scenarios. In reality, recommendation is often a more complex problem: it is usually just...... a single step in the user's more complex background need. These background needs can often place a variety of constraints on which recommendations are interesting to the user and when they are appropriate. However, relatively little research has been done on these complex recommendation scenarios....... The ComplexRec 2017 workshop addressed this by providing an interactive venue for discussing approaches to recommendation in complex scenarios that have no simple one-size-fits-all-solution....
Performance of a Microgap Chamber Prototype
International Nuclear Information System (INIS)
Adeva, B.; Gomez, F.; Nunez, T.; Pazos, A.; Plo, M.; Santamaria, C.; Vazquez, P.; Navarro, Z.
1998-01-01
We describe the construction and performance of a novel type of detector concept for ionizing particles, the Microgap Gas Chamber (MGC). A prototype was a built on a SiO 2 substrate with Aluminium electrodes by a collaboration between the C.N.M. (Centro nacional de Microelectronica) in Barcelona and the Grupo de Altas Energias of the University of Santiago de Compostela. Some of the operation characteristics are discussed. (Author) 8 refs
Dynamic complexity: plant receptor complexes at the plasma membrane.
Burkart, Rebecca C; Stahl, Yvonne
2017-12-01
Plant receptor complexes at the cell surface perceive many different external and internal signalling molecules and relay these signals into the cell to regulate development, growth and immunity. Recent progress in the analyses of receptor complexes using different live cell imaging approaches have shown that receptor complex formation and composition are dynamic and take place at specific microdomains at the plasma membrane. In this review we focus on three prominent examples of Arabidopsis thaliana receptor complexes and how their dynamic spatio-temporal distribution at the PM has been studied recently. We will elaborate on the newly emerging concept of plasma membrane microdomains as potential hubs for specific receptor complex assembly and signalling outputs. Copyright © 2017 Elsevier Ltd. All rights reserved.
Revitalizing Complex Analysis: A Transition-to-Proof Course Centered on Complex Topics
Sachs, Robert
2017-01-01
A new transition course centered on complex topics would help in revitalizing complex analysis in two ways: first, provide early exposure to complex functions, sparking greater interest in the complex analysis course; second, create extra time in the complex analysis course by eliminating the "complex precalculus" part of the course. In…
3D complex: a structural classification of protein complexes.
Directory of Open Access Journals (Sweden)
Emmanuel D Levy
2006-11-01
Full Text Available Most of the proteins in a cell assemble into complexes to carry out their function. It is therefore crucial to understand the physicochemical properties as well as the evolution of interactions between proteins. The Protein Data Bank represents an important source of information for such studies, because more than half of the structures are homo- or heteromeric protein complexes. Here we propose the first hierarchical classification of whole protein complexes of known 3-D structure, based on representing their fundamental structural features as a graph. This classification provides the first overview of all the complexes in the Protein Data Bank and allows nonredundant sets to be derived at different levels of detail. This reveals that between one-half and two-thirds of known structures are multimeric, depending on the level of redundancy accepted. We also analyse the structures in terms of the topological arrangement of their subunits and find that they form a small number of arrangements compared with all theoretically possible ones. This is because most complexes contain four subunits or less, and the large majority are homomeric. In addition, there is a strong tendency for symmetry in complexes, even for heteromeric complexes. Finally, through comparison of Biological Units in the Protein Data Bank with the Protein Quaternary Structure database, we identified many possible errors in quaternary structure assignments. Our classification, available as a database and Web server at http://www.3Dcomplex.org, will be a starting point for future work aimed at understanding the structure and evolution of protein complexes.
Unraveling chaotic attractors by complex networks and measurements of stock market complexity
International Nuclear Information System (INIS)
Cao, Hongduo; Li, Ying
2014-01-01
We present a novel method for measuring the complexity of a time series by unraveling a chaotic attractor modeled on complex networks. The complexity index R, which can potentially be exploited for prediction, has a similar meaning to the Kolmogorov complexity (calculated from the Lempel–Ziv complexity), and is an appropriate measure of a series' complexity. The proposed method is used to research the complexity of the world's major capital markets. None of these markets are completely random, and they have different degrees of complexity, both over the entire length of their time series and at a level of detail. However, developing markets differ significantly from mature markets. Specifically, the complexity of mature stock markets is stronger and more stable over time, whereas developing markets exhibit relatively low and unstable complexity over certain time periods, implying a stronger long-term price memory process
Unraveling chaotic attractors by complex networks and measurements of stock market complexity.
Cao, Hongduo; Li, Ying
2014-03-01
We present a novel method for measuring the complexity of a time series by unraveling a chaotic attractor modeled on complex networks. The complexity index R, which can potentially be exploited for prediction, has a similar meaning to the Kolmogorov complexity (calculated from the Lempel-Ziv complexity), and is an appropriate measure of a series' complexity. The proposed method is used to research the complexity of the world's major capital markets. None of these markets are completely random, and they have different degrees of complexity, both over the entire length of their time series and at a level of detail. However, developing markets differ significantly from mature markets. Specifically, the complexity of mature stock markets is stronger and more stable over time, whereas developing markets exhibit relatively low and unstable complexity over certain time periods, implying a stronger long-term price memory process.
Complex Correspondence Principle
International Nuclear Information System (INIS)
Bender, Carl M.; Meisinger, Peter N.; Hook, Daniel W.; Wang Qinghai
2010-01-01
Quantum mechanics and classical mechanics are distinctly different theories, but the correspondence principle states that quantum particles behave classically in the limit of high quantum number. In recent years much research has been done on extending both quantum and classical mechanics into the complex domain. These complex extensions continue to exhibit a correspondence, and this correspondence becomes more pronounced in the complex domain. The association between complex quantum mechanics and complex classical mechanics is subtle and demonstrating this relationship requires the use of asymptotics beyond all orders.
Energy Technology Data Exchange (ETDEWEB)
J. William Munger; Steven C. Wofsy; David R. Foster
2012-01-31
The overall project goal was to quantify the trends and variability for Net ecosystem exchange of CO{sub 2}, H{sub 2}O, and energy by northeastern forests, with particular attention to the role of succession, differences in species composition, legacies of past land use, and disturbances. Measurements included flux measurements and observations of biomass accumulation using ecosystem modeling as a framework for data interpretation. Continuation of the long-term record at the Environmental Measurement Site (EMS) Tower was a priority. The final quality-assured CO{sub 2}-flux data now extend through 2010. Data through 2011 are collected but not yet finalized. Biomass observations on the plot array centered on the tower are extended to 2011. Two additional towers in a hemlock stand (HEM) and a younger deciduous stand (LPH) complement the EMS tower by focusing on stands with different species composition or age distribution and disturbance history, but comparable climate and soil type. Over the period since 1993 the forest has added 24.4 Mg-C ha{sup -1} in the living trees. Annual net carbon uptake had been increasing from about 2 Mg-C ha{sup -1}y{sup -1} in the early 1990s to nearly 6 Mg-C ha{sup -1}y{sup -1} by 2008, but declined in 2009-2010. We attribute the increasing carbon uptake to a combination of warmer temperatures, increased photosynthetic efficiency, and increased influence by subcanopy hemlocks that are active in the early spring and late autumn when temperatures are above freezing but the deciduous canopy is bare. Not all of the increased carbon accumulation was found in woody biomass. Results from a study using data to optimize parameters in an ecosystem process model indicate that significant changes in model parameters for photosynthetic capacity and shifts in allocation to slow cycling soil organic matter are necessary for the model to match the observed trends. The emerging working hypothesis is that the pattern of increasing carbon uptake over the
Belli, R.; Borsato, A.; Frisia, S.; Drysdale, R.; Maas, R.; Greig, A.
2017-02-01
The trace element and Sr isotope records in two coeval stalagmites characterized by different growth rates and flow regimes at Savi cave (Grotta Savi, NE Italy) reveal different sources and incorporation mechanisms for Mg and Sr. Mg is sourced primarily from dissolved cave host rock while particulate Mg derived from soil plays a subordinate role. The presence of particulate-borne Mg is inferred from the co-variation of Mg and particle-associated elements (Th, Al and Mn) which are preferentially concentrated in open columnar calcite layers. Variation in Mg concentrations corrected for particle-influenced components, the Mgc parameter, is controlled by water-rock interaction, with higher and lower Mgc during dry and wet phases, respectively. This is thought to reflect incongruent dissolution of Mg-rich phases. Correction of Sr concentrations for contributions from airborne exogenic Sr, based on 87Sr/86Sr ratios, yields the bedrock-only contribution (Src). Src variation in stalagmite calcite is influenced by speleothem growth rate and by variation of the calcite-water Sr partitioning in wet and dry phases, and only to a minor extent by incongruent dissolution of Mg-rich phases. Concentration profiles for Mgc and Srcg (corrected for growth rate effects) show inverse correlations and are inferred to show hydrological significance which is captured in a hydrological index, HI. We suggest HI provides robust information on water-rock interaction related to hydrological changes and can be utilized in both wet and semi-arid environments, provided the corrections for soil Mg and exogenic Sr can be applied with confidence. Application of the HI index allows correction of Grotta Savi oxygen isotope data, to yield a δ18Oc time series that shows when changes in moisture sources and atmospheric reorganization, or changes in moisture amount, were significant. This is especially evident during the Younger Dryas (YD). The Savi record supports the concept of a two-phase YD, marked by
International Nuclear Information System (INIS)
Leverd, Pascal C.
1994-01-01
This research thesis proposes a new approach to the chemistry of uranium thiolate complexes as these compounds are very promising for various uses (in bio-inorganic chemistry, in some industrial processes like oil desulphurization). It more particularly addresses the U-S bond or more generally bonds between polarizable materials and hard metals. The author thus reports the study of uranium organometallic thiolates (tricyclo-penta-dienic and mono-cyclo-octa-tetraenylic complexes), and of uranium homoleptic thiolates (tetra-thiolate complexes, hexa-thiolate complexes, reactivity of homoleptic thiolate complexes) [fr
Clinical Complexity in Medicine: A Measurement Model of Task and Patient Complexity.
Islam, R; Weir, C; Del Fiol, G
2016-01-01
Complexity in medicine needs to be reduced to simple components in a way that is comprehensible to researchers and clinicians. Few studies in the current literature propose a measurement model that addresses both task and patient complexity in medicine. The objective of this paper is to develop an integrated approach to understand and measure clinical complexity by incorporating both task and patient complexity components focusing on the infectious disease domain. The measurement model was adapted and modified for the healthcare domain. Three clinical infectious disease teams were observed, audio-recorded and transcribed. Each team included an infectious diseases expert, one infectious diseases fellow, one physician assistant and one pharmacy resident fellow. The transcripts were parsed and the authors independently coded complexity attributes. This baseline measurement model of clinical complexity was modified in an initial set of coding processes and further validated in a consensus-based iterative process that included several meetings and email discussions by three clinical experts from diverse backgrounds from the Department of Biomedical Informatics at the University of Utah. Inter-rater reliability was calculated using Cohen's kappa. The proposed clinical complexity model consists of two separate components. The first is a clinical task complexity model with 13 clinical complexity-contributing factors and 7 dimensions. The second is the patient complexity model with 11 complexity-contributing factors and 5 dimensions. The measurement model for complexity encompassing both task and patient complexity will be a valuable resource for future researchers and industry to measure and understand complexity in healthcare.
Engineering Design Handbook: Environmental Series. Part Three. Induced Environmental Factors
1976-01-20
environmental factors. Rain will wash many pollutants from the atmosphere or winds will disperse them; rain or humidity will sup- press sand and dust...atmosphere (Ref. 11). (4) Air movement. Air movement serves to disperse 2-55 AMCP 70G-117 pollutants throughout the atmosphere. Airspeed and...CaCCL MgC03 MgCO^ Pure clay, kaolin , china clay Al203-2Si02.2H20 sand or dust environment includes (1) concentration (count or weight), (2
Thinking Forbidden Thoughts: The Oedipus Complex as a Complex of Knowing.
Schein, Michael
2016-04-01
The Oedipus complex, considered by Freud the "nuclear complex of development," played a central role in the evolution of psychoanalytic thought. This paper returns to the point of transition from the seduction theory, Freud's initial theorem, to the oedipal model, and suggests that the Oedipus complex is first and foremost a text and as such contains a multiplicity of narratives. In particular, the author articulates the close relation between the Oedipus complex and the subject of knowing, postulating that underlying its surface level, the deep-level structure of this complex is one of knowing. As a complex of knowing it is of dual quality, both promoting and impeding the ability to know.
Fan, Hao; Jiang, Mingkun; Li, Bowen; He, Yu; Huang, Chi; Luo, Dakui; Xu, Hao; Yang, Li; Zhou, Jundong
2018-03-01
miR-let-7a is the most widely studied miRNA, whose functions have been well-established by scientists in both carcinogenesis and progression of human cancer, including gastric cancer (GC). However, to date there is a lack of information concerning the relationship between miR-let-7a and cellular autophagy. Using western blotting and immunofluorescence, we determined that upregulation of miR-let-7a led to increased cellular autophagic level, whereas miR-let-7a suppression decreased autophagy activity in GC cells. To further elucidate the mechanisms underlying this, we screened potential targets of miR-let-7a using bioinformatics analyses, validated by a series of assays. Our results indicated that Rptor independent companion of mTOR complex 2 (Rictor) was a direct target of miR-let-7a. In addition, rescue experiments in vitro showed that miR-let-7a promoted cellular autophagic level by inhibiting Rictor expression in GC cells. Furthermore, as an upstream executor of Akt-mTOR signaling pathway, we found that Rictor elaborated its effect on autophagy by phosphorylating Akt and mTOR, and this regulatory process could also be mediated by miR-let-7a. Taken together, our results present a novel role for miR-let-7a in GC which modulates autophagy by targeting Rictor, following the regulation of Akt-mTOR signal pathway.
Complexity-management in SME : organization of complex relationships
Gregus, M.; Mandorf, S.
2009-01-01
The complexity of companies' environment IS growmg. Complexity management and restructuring of small and medium-sized enterprises (SME) become big challenges of business studies in the next future. A chance could be seen in the use of e-business strategies and the implementation of information
DEFF Research Database (Denmark)
Maylath, Bruce; Vandepitte, Sonia; Minacori, Patricia
2013-01-01
and into French. The complexity of the undertaking proved to be a central element in the students' learning, as the collaboration closely resembles the complexity of international documentation workplaces of language service providers. © Association of Teachers of Technical Writing.......This article discusses the largest and most complex international learning-by-doing project to date- a project involving translation from Danish and Dutch into English and editing into American English alongside a project involving writing, usability testing, and translation from English into Dutch...
Energy Technology Data Exchange (ETDEWEB)
Rouxel, C. [Conservatoire National des Arts et Metiers (CNAM), 75 - Paris (France)
1999-05-01
Complex numbers are widely used in electrical engineering. This article is divided into 5 parts dealing successively with: the cartesian form of complex numbers (definition, conjugated complex numbers, graphical representation); the trigonometrical form of complex numbers (module and argument, trigonometrical form, exponential notation, multiplication and division of two complex numbers); Moivre and Euler formulae; applications (square root and second degree equation, n. roots, plan rotation and similarity); cissoidal transformation (definition, properties, applications to electricity: complex impedance in permanent sinusoidal regime, transfer function of a linear system in permanent regime, study of an example). (J.S.)
DEFF Research Database (Denmark)
a single step in the user's more complex background need. These background needs can often place a variety of constraints on which recommendations are interesting to the user and when they are appropriate. However, relatively little research has been done on these complex recommendation scenarios....... The ComplexRec 2017 workshop addressed this by providing an interactive venue for discussing approaches to recommendation in complex scenarios that have no simple one-size-fits-all-solution....
Fisher, Stephen D
1999-01-01
The most important topics in the theory and application of complex variables receive a thorough, coherent treatment in this introductory text. Intended for undergraduates or graduate students in science, mathematics, and engineering, this volume features hundreds of solved examples, exercises, and applications designed to foster a complete understanding of complex variables as well as an appreciation of their mathematical beauty and elegance. Prerequisites are minimal; a three-semester course in calculus will suffice to prepare students for discussions of these topics: the complex plane, basic
Complexity Management In Projects Between Rational Momentum And Complex Conditions
DEFF Research Database (Denmark)
Mac, Anita; Schlamovitz, Jesper
2015-01-01
Abstract: This study takes its departure in a model of complexity, developed by Stacey (1993), to test and discuss its practical benefit as perceived by practicing project managers. Based on a survey, the study finds that complexity is a phenomenon recognized by project managers, and complexity...... management is associated with benefits in the development of tasks and managing stakeholders. It is also associated with some difficulty in terms of an increased need for dialogue and a risk of creating goal ambiguity. Based on the findings, we conclude that classical project management approaches can...... benefit from incorporating complexity management....
Complexity management in projects between rational momentum and complex conditions
DEFF Research Database (Denmark)
Mac, Anita; Schlamovitz, Jesper
This study takes its departure in a model of complexity, developed by Stacey (1993), to test and discuss its practical benefit as perceived by practicing project managers. Based on a survey, the study finds that complexity is a phenomenon recognized by project managers, and complexity management...... is associated with benefits in the development of tasks and managing stakeholders. It is also associated with some difficulty in terms of an increased need for dialogue and a risk of creating goal ambiguity. Based on the findings, we conclude that classical project management approaches can benefit from...... incorporating complexity management....
International Nuclear Information System (INIS)
Naeppi, Janne; Yoshida, Hiroyuki
2003-01-01
We evaluated the effect of our novel technique of feature-guided analysis of polyps on the reduction of false-positive (FP) findings generated by our computer-aided diagnosis (CAD) scheme for the detection of polyps from computed tomography colonographic data sets. The detection performance obtained by use of feature-guided analysis in the segmentation and feature analysis of polyp candidates was compared with that obtained by use of our previously employed fuzzy clustering technique. We also evaluated the effect of a feature called modified gradient concentration (MGC) on the detection performance. A total of 144 data sets, representing prone and supine views of 72 patients that included 14 patients with 21 colorectal polyps 5-25 mm in diameter, were used in the evaluation. At a 100% by-patient (95% by-polyp) detection sensitivity, the FP rate of our CAD scheme with feature-guided analysis based on round-robin evaluation was 1.3 (1.5) FP detections per patient. This corresponds to a 70-75 % reduction in the number of FPs obtained by use of fuzzy clustering at the same sensitivity levels. Application of the MGC feature instead of our previously used gradient concentration feature did not improve the detection result. The results indicate that feature-guided analysis is useful for achieving high sensitivity and a low FP rate in our CAD scheme
The potential of Indonesian mangrove forests for global climate change mitigation
Murdiyarso, Daniel; Purbopuspito, Joko; Kauffman, J. Boone; Warren, Matthew W.; Sasmito, Sigit D.; Donato, Daniel C.; Manuri, Solichin; Krisnawati, Haruni; Taberima, Sartji; Kurnianto, Sofyan
2015-12-01
Mangroves provide a wide range of ecosystem services, including nutrient cycling, soil formation, wood production, fish spawning grounds, ecotourism and carbon (C) storage. High rates of tree and plant growth, coupled with anaerobic, water-logged soils that slow decomposition, result in large long-term C storage. Given their global significance as large sinks of C, preventing mangrove loss would be an effective climate change adaptation and mitigation strategy. It has been reported that C stocks in the Indo-Pacific region contain on average 1,023 MgC ha-1 (ref. ). Here, we estimate that Indonesian mangrove C stocks are 1,083 +/- 378 MgC ha-1. Scaled up to the country-level mangrove extent of 2.9 Mha (ref. ), Indonesia’s mangroves contained on average 3.14 PgC. In three decades Indonesia has lost 40% of its mangroves, mainly as a result of aquaculture development. This has resulted in annual emissions of 0.07-0.21 Pg CO2e. Annual mangrove deforestation in Indonesia is only 6% of its total forest loss; however, if this were halted, total emissions would be reduced by an amount equal to 10-31% of estimated annual emissions from land-use sectors at present. Conservation of carbon-rich mangroves in the Indonesian archipelago should be a high-priority component of strategies to mitigate climate change.
Lee, William H K.
2016-01-01
A complex system consists of many interacting parts, generates new collective behavior through self organization, and adaptively evolves through time. Many theories have been developed to study complex systems, including chaos, fractals, cellular automata, self organization, stochastic processes, turbulence, and genetic algorithms.
International Nuclear Information System (INIS)
Gradoz, Philippe
1993-01-01
After having reported a bibliographical study on penta-methylcyclopentadienyl uranium complexes, and a description of the synthesis and radioactivity of uranium (III) and (IV) boron hydrides compounds, this research thesis reports the study of mono and bis-tetramethyl-phospholyl uranium complexes comprising chloride, boron hydride, alkyl and alkoxide ligands. The third part reports the comparison of structures, stabilities and reactions of homologue complexes in penta-methylcyclopentadienyl and tetramethyl-phospholyl series. The last part addresses the synthesis of tris-phospholyl uranium (III) and (IV) complexes. [fr
Complex saddle points and the sign problem in complex Langevin simulation
International Nuclear Information System (INIS)
Hayata, Tomoya; Hidaka, Yoshimasa; Tanizaki, Yuya
2016-01-01
We show that complex Langevin simulation converges to a wrong result within the semiclassical analysis, by relating it to the Lefschetz-thimble path integral, when the path-integral weight has different phases among dominant complex saddle points. Equilibrium solution of the complex Langevin equation forms local distributions around complex saddle points. Its ensemble average approximately becomes a direct sum of the average in each local distribution, where relative phases among them are dropped. We propose that by taking these phases into account through reweighting, we can solve the wrong convergence problem. However, this prescription may lead to a recurrence of the sign problem in the complex Langevin method for quantum many-body systems.
Complex and symplectic geometry
Medori, Costantino; Tomassini, Adriano
2017-01-01
This book arises from the INdAM Meeting "Complex and Symplectic Geometry", which was held in Cortona in June 2016. Several leading specialists, including young researchers, in the field of complex and symplectic geometry, present the state of the art of their research on topics such as the cohomology of complex manifolds; analytic techniques in Kähler and non-Kähler geometry; almost-complex and symplectic structures; special structures on complex manifolds; and deformations of complex objects. The work is intended for researchers in these areas.
Energy Technology Data Exchange (ETDEWEB)
Wang, Shi-bing, E-mail: wang-shibing@dlut.edu.cn, E-mail: wangxy@dlut.edu.cn [School of Computer and Information Engineering, Fuyang Normal University, Fuyang 236041 (China); Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China); Wang, Xing-yuan, E-mail: wang-shibing@dlut.edu.cn, E-mail: wangxy@dlut.edu.cn [Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China); Wang, Xiu-you [School of Computer and Information Engineering, Fuyang Normal University, Fuyang 236041 (China); Zhou, Yu-fei [College of Electrical Engineering and Automation, Anhui University, Hefei 230601 (China)
2016-04-15
With comprehensive consideration of generalized synchronization, combination synchronization and adaptive control, this paper investigates a novel adaptive generalized combination complex synchronization (AGCCS) scheme for different real and complex nonlinear systems with unknown parameters. On the basis of Lyapunov stability theory and adaptive control, an AGCCS controller and parameter update laws are derived to achieve synchronization and parameter identification of two real drive systems and a complex response system, as well as two complex drive systems and a real response system. Two simulation examples, namely, ACGCS for chaotic real Lorenz and Chen systems driving a hyperchaotic complex Lü system, and hyperchaotic complex Lorenz and Chen systems driving a real chaotic Lü system, are presented to verify the feasibility and effectiveness of the proposed scheme.
A new generative complexity science of learning for a complex pedagogy
Jörg, T.
2007-01-01
Proposal for the SIG Chaos and Complexity Theories at AERA 2007 Title: A New Generative Complexity Science of Learning for a Complex Pedagogy Ton Jörg IVLOS Institute of Education University of Utrecht The Netherlands A.G.D.Jorg@ivlos.uu.nl Introduction My paper focuses on the link between thinking
Quantum complex rotation and uniform semiclassical calculations of complex energy eigenvalues
International Nuclear Information System (INIS)
Connor, J.N.L.; Smith, A.D.
1983-01-01
Quantum and semiclassical calculations of complex energy eigenvalues have been carried out for an exponential potential of the form V 0 r 2 exp(-r) and Lennard-Jones (12,6) potential. A straightforward method, based on the complex coordinate rotation technique, is described for the quantum calculation of complex eigenenergies. For singular potentials, the method involves an inward and outward integration of the radial Schroedinger equation, followed by matching of the logarithmic derivatives of the wave functions at an intermediate point. For regular potentials, the method is simpler, as only an inward integration is required. Attention is drawn to the World War II researches of Hartree and co-workers who anticipated later quantum mechanical work on the complex rotation method. Complex eigenenergies are also calculated from a uniform semiclassical three turning point quantization formula, which allows for the proximity of the outer pair of complex turning points. Limiting cases of this formula, which are valid for very narrow or very broad widths, are also used in the calculations. We obtain good agreement between the semiclassical and quantum results. For the Lennard-Jones (12,6) potential, we compare resonance energies and widths from the complex energy definition of a resonance with those obtained from the time delay definition
Karnan, C.; Jyothibabu, R.; Arunpandi, N.; Jagadeesan, L.; Muraleedharan, K. R.; Pratihari, A. K.; Balachandran, K. K.; Naqvi, S. W. A.
2017-08-01
Coastal upwelling and mud banks are two oceanographic processes concurrently operating along certain stretches of the southwest (Kerala) coast of India during the Southwest Monsoon period (June-September), facilitating significant enhancement in plankton biomass. Mud banks have scientific and societal attention from time immemorial, predominantly due to the large fisheries associated with them. In this paper, for the first time, the specific biophysical roles of these oceanographic processes have been discriminated, based on a focused 18 weekly/fortnightly time-series study (April to September 2014) in a mud bank-upwelling area (off Alappuzha, southwest coast of India). In conjunction with standard hydrographical and satellite remote sensing data, we utilised a FlowCAM to track the biophysical linkage in terms of plankton composition abundance and size structure at three locations (M1, M2 and M3) in the study area. During the Pre-Southwest Monsoon (April-May), the entire study area was warmer with low nitrate concentration in the surface waters, which caused lower biomass of autotrophs compared to the Southwest Monsoon (June-September). By the onset of the Southwest Monsoon (June), drastic hydrographical transformations took place in the study domain due to the Coastal upwelling, reflected as the surfacing of significantly cool, high nutrient and hypoxic waters. Concurrently, mud bank formed at location M2 due to the presence of relatively high-suspended sediments in the region, creating a localised calm environment conducive for fishing activities. In response to the hydrographical transformations in the entire study area during the Southwest Monsoon, the autotrophic plankton biomass and size structure experienced significant change. The micro-autotrophs biomass that was low during the Pre-Southwest Monsoon (av. 0.33 ± 0.2 mgC L- 1 at surface and av. 0.07 ± 0.04 mgC L- 1 at subsurface) noticeably increased during the Southwest Monsoon (av. 1.6 ± 0.4 mgC L- 1 at
Complex Constructivism: A Theoretical Model of Complexity and Cognition
Doolittle, Peter E.
2014-01-01
Education has long been driven by its metaphors for teaching and learning. These metaphors have influenced both educational research and educational practice. Complexity and constructivism are two theories that provide functional and robust metaphors. Complexity provides a metaphor for the structure of myriad phenomena, while constructivism…
Complexity in phonology: The complex consonants of simple CV ...
African Journals Online (AJOL)
The main objective of this article is to investigate the interplay of simplicity and complexity in the phonological structure of Zezuru. The article argues that Zezuru affricates, prenasalised consonants (NCs) and velarised consonants (Cws) are subsegmentally complex segments which function as simple onsets. Treating them ...
Indian Academy of Sciences (India)
Administrator
e, 40 µM complex, 10 hrs after dissolution, f, 40 µM complex, after irradiation dose 15 Gy. and H-atoms result in reduction of Co(III) to Co. (II). 6. It is interesting to see in complex containing multiple ligands what is the fate of electron adduct species formed by electron addition. Reduction to. Co(II) and intramolecular transfer ...
International Nuclear Information System (INIS)
Rezendes, V.S.
1991-03-01
In this book, GAO characterizes DOE's January 1991 Nuclear Weapons Complex Reconfiguration Study as a starting point for reaching agreement on solutions to many of the complex's safety and environmental problems. Key decisions still need to be made about the size of the complex, where to relocate plutonium operations, what technologies to use for new tritium production, and what to do with excess plutonium. The total cost for reconfiguring and modernizing the complex is still uncertain, and some management issues remain unresolved. Congress faces a difficult task in making test decisions given the conflicting demands for scarce resources in a time of growing budget deficits and war in the Persian Gulf
Evsukoff, Alexandre; González, Marta
2013-01-01
In the last decade we have seen the emergence of a new inter-disciplinary field focusing on the understanding of networks which are dynamic, large, open, and have a structure sometimes called random-biased. The field of Complex Networks is helping us better understand many complex phenomena such as the spread of deseases, protein interactions, social relationships, to name but a few. Studies in Complex Networks are gaining attention due to some major scientific breakthroughs proposed by network scientists helping us understand and model interactions contained in large datasets. In fact, if we could point to one event leading to the widespread use of complex network analysis is the availability of online databases. Theories of Random Graphs from Erdös and Rényi from the late 1950s led us to believe that most networks had random characteristics. The work on large online datasets told us otherwise. Starting with the work of Barabási and Albert as well as Watts and Strogatz in the late 1990s, we now know th...
Energy Technology Data Exchange (ETDEWEB)
Mei, Shengwei; Zhang, Xuemin [Tsinghua Univ., Beijing, BJ (China). Dept. of Electrical Engineering; Cao, Ming [Groningen Univ. (Netherlands). Faculty of Mathematics and Natural Sciences
2011-07-01
''Power Grid Complexity'' introduces the complex system theory known as self-organized criticality (SOC) theory and complex network theory, and their applications to power systems. It studies the network characteristics of power systems, such as their small-world properties, structural vulnerability, decomposition and coordination strategies, and simplification and equivalence methods. The book also establishes four blackout models based on SOC theory through which the SOC of power systems is studied at both the macroscopic and microscopic levels. Additionally, applications of complex system theory in power system planning and emergency management platforms are also discussed in depth. This book can serve as a useful reference for engineers and researchers working with power systems. (orig.)
Directory of Open Access Journals (Sweden)
Eric Babson
2004-12-01
Full Text Available Motivated by the Coxeter complex associated to a Coxeter system (W,S, we introduce a simplicial regular cell complex Δ(G,S with a G-action associated to any pair (G,S where G is a group and S is a finite set of generators for G which is minimal with respect to inclusion. We examine the topology of Δ(G,S, and in particular the representations of G on its homology groups. We look closely at the case of the symmetric group S n minimally generated by (not necessarily adjacent transpositions, and their type-selected subcomplexes. These include not only the Coxeter complexes of type A, but also the well-studied chessboard complexes.
Technetium complexation by macrocyclic compounds
International Nuclear Information System (INIS)
Li Fan Yu.
1983-01-01
Research in nuclear medicine are directed towards the labelling of biological molecules, however, sup(99m)Tc does not show sufficient affinity for these molecules. The aim of this study was to evaluate the ability of macrocyclic compounds to bind strongly technetium in order to be used as complexation intermediate. The reducing agents used were a stannous complex and sodium dithionite. Cryptates and polyesters are not good complexing agents. They form two complexes: a 2:1 sandwich complex or 3:2 and a 1:1 complex. Cyclams are good complexing agents for technetium their complexations strength was determined by competition with pyrophosphate, gluconate and DTPA. Using the method of ligand exchange, the oxidation state of technetium in the Tc-cyclam complex was IV or V. They are 1:1 cationic complexes, the complex charge is +1. The biodistribution in rats of labelling solutions containing (cyclam 14 ane N 4 ) C 12 H 25 shows a good urinary excretion without intoxication risks [fr
Amber Ajani; Zafar Iqbal Shams
2016-01-01
Carbon sequestration by trees is one of the most cost-effective and efficient methods to remove carbon dioxide from atmosphere since trees remove and store carbon at higher rates compared to other land covers. Carbon storage by trees typically ranges from 1 to 8 MgC ha-1 yr-1.The carbon is sequestered in different parts of the trees as biomass. The measurements of biomass provide reasonably accurate estimate of the amount of carbon that was removed from lower troposphere over the years. There...
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-05-01
As the R and D of advanced engine and energy saving use ceramics, this project is being conducted by the U.S., Germany, Sweden, Belgium and Japan under Annex II of the Committee of Energy Research Technology (CERT) established by International Energy Agency (IEA). For structure use ceramic materials, their raw material powder is tested and a method to evaluate characteristics of their sintered bodies is studied. The research was divided into Subtask 11 (test on mechanical characteristics) and Subtask 12 (evaluation of raw material powder). Each subtask decides on the details of the international joint research and the associated research assigned to each country. In the testing study on mechanical characteristics in this fiscal year, the evaluation method was studied of thermal characteristics of materials for heat resistant high temperature members. In the study for evaluation of raw material powder in this fiscal year, a method was studied for evaluation of characteristics of fine ceramic powder. The results to be obtained in this study are related to mechanical characteristics of materials for heat resistant high temperature members and to the basic evaluation method of characteristics of raw material powder. The results of the study are surely indispensable for promotion of the application of these materials. (NEDO)
[Tissue-specific nucleoprotein complexes].
Riadnova, I Iu; Shataeva, L K; Khavinson, V Kh
2000-01-01
A method of isolation of native nucleorprotein complexes from cattle cerebral cortex, thymus, and liver was developed. Compositions of these complexes were studied by means of gel-chromatography and ion-exchange chromatography. These preparations were shown to consist of several fractions of proteins and their complexes differ by molecular mass and electro-chemical properties. Native nucleoprotein complexes revealed high tissue specific activity, which was not species-specific.
Silva, Alessandro
1993-01-01
The papers in this wide-ranging collection report on the results of investigations from a number of linked disciplines, including complex algebraic geometry, complex analytic geometry of manifolds and spaces, and complex differential geometry.
Directory of Open Access Journals (Sweden)
Anwer Khurshid
2012-07-01
Full Text Available Normal 0 false false false EN-US X-NONE X-NONE In this paper, it is shown that a complex multivariate random variable is a complex multivariate normal random variable of dimensionality if and only if all nondegenerate complex linear combinations of have a complex univariate normal distribution. The characteristic function of has been derived, and simpler forms of some theorems have been given using this characterization theorem without assuming that the variance-covariance matrix of the vector is Hermitian positive definite. Marginal distributions of have been given. In addition, a complex multivariate t-distribution has been defined and the density derived. A characterization of the complex multivariate t-distribution is given. A few possible uses of this distribution have been suggested.
Complex Systems: An Introduction
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 9. Complex Systems: An Introduction - Anthropic Principle, Terrestrial Complexity, Complex Materials. V K Wadhawan. General Article Volume 14 Issue 9 September 2009 pp 894-906 ...
Simplicial complexes of graphs
Jonsson, Jakob
2008-01-01
A graph complex is a finite family of graphs closed under deletion of edges. Graph complexes show up naturally in many different areas of mathematics, including commutative algebra, geometry, and knot theory. Identifying each graph with its edge set, one may view a graph complex as a simplicial complex and hence interpret it as a geometric object. This volume examines topological properties of graph complexes, focusing on homotopy type and homology. Many of the proofs are based on Robin Forman's discrete version of Morse theory. As a byproduct, this volume also provides a loosely defined toolbox for attacking problems in topological combinatorics via discrete Morse theory. In terms of simplicity and power, arguably the most efficient tool is Forman's divide and conquer approach via decision trees; it is successfully applied to a large number of graph and digraph complexes.
Tomasello, Gianluca; Liguigli, Wanda; Poli, Rossana; Lazzarelli, Silvia; Brighenti, Matteo; Negri, Federica; Curti, Alessandra; Martinotti, Mario; Olivetti, Lucio; Rovatti, Massimo; Donati, Gianvito; Passalacqua, Rodolfo
2014-10-01
We previously studied a dose-dense TCF (TCF-dd) regimen demonstrating its feasibility and an activity comparable to epirubicin-based chemotherapy and TCF q3w in terms of overall survival and time to progression (TTP). We report here the final results of a phase II study of chemotherapy with a modified TCF-dd regimen in locally advanced or metastatic gastric cancer (MGC). Patients with histologically confirmed measurable MGC, not previously treated for advanced disease, received docetaxel 70 mg/m(2) day 1, cisplatin 60 mg/m(2) day 1, l-folinic acid 100 mg/m(2) days 1 and 2, followed by 5-fluorouracil (5-FU) 400 mg/m(2) bolus days 1 and 2, and then 600 mg/m(2) as a 22-h continuous infusion days 1 and 2, every 14 days, plus pegfilgrastim 6 mg on day 3. Patients aged ≥65 years received the same schedule with a dose reduction of 30 %. Study duration: December 2007-November 2010. Forty-six consecutive patients were enrolled (78 % male, 22 % female; median age, 66 years, range, 38-76 years; ECOG PS: 0, 48 %, 1, 46 %). Primary endpoint was overall response rate (ORR). A median of four cycles (range, one to six) was administered. Forty-three patients were evaluated for response (93.5 %) and all for toxicity: 3 complete response (CR), 25 partial response (PR), 10 stable disease (SD), and 5 progressive disease (PD) were observed, for an ORR by intention to treat (ITT) of 61 % (95 % CI 47-75). Median overall survival (OS) was 17.63 months (95 % CI, 13.67-20.67); median progression-free survival was 8.9 months (95 % CI, 6.5-13.4). Twenty-one patients (46.0 %) were treated at full doses without any delay, thus respecting the dose-dense criterion. Most frequent grade 3-4 toxicities were neutropenia (20 %), leukopenia (4 %), thrombocytopenia (2 %), anemia (2 %), febrile neutropenia (6 %), asthenia (22 %), diarrhea (4 %), nausea/vomiting (11 %), and hypokalemia (6 %). Overall, TCF-dd was shown to be safe. The TCF-dd regimen in locally advanced or MGC
Shi, Huaijie; Chen, Xiaojing; Jiang, Hao; Wang, Xujie; Yu, Hao; Sun, Pijiang; Sui, Xin
2018-04-01
Gastric cancer (GC) is the fourth most common malignant tumor globally. The highest incidence of GC is found in Eastern Asia, particularly in China. It is therefore imperative to further elucidate the molecular pathogenesis of GC in order to identify new biomarkers and targets for effective therapy. In the present study, we determined whether miR-148a was aberrantly downregulated in gastric cancer tissues and significantly correlated with aggressive clinicopathological characteristics in the MGC-803, HGC-27 and GES-1 cell lines using reverse transcription-quantitative PCR and western blot analysis. The cell lines were obtained from 60 patients who presented at our hospital between September 2010 and July 2015. The results showed that, miR-148a was aberrantly downregulated in GC tissues and its expression was relatively lower in the MGC-803 and HGC-27 GC cell lines than in the normal gastric epithelial cell line, GES-1. The clinicopathological analysis revealed that a decrease of miR-148a was significantly correlated with lymph-node metastasis (Pblot analysis. Furthermore, we found that the re-expression of DNMT1 reversed the inhibition of cell migration and invasion induced by miR-148a. Taken together, we demonstrated that miR-148a suppresses cell invasion and migration in gastric cancer by regulating DNMT1 expression. The miR-148a/DNMT1 axis may therefore be a new potential target for GC therapy.
Organic carbon stocks in Mediterranean soil types under different land uses (Southern Spain)
Energy Technology Data Exchange (ETDEWEB)
Munoz-Rojas, M. [CSIC Spin-off, Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain). Evenor-Tech; Sevilla Univ. (Spain). MED Soil Research Group; Jordan, A.; Zavala, L.M. [Sevilla Univ. (Spain). MED Soil Research Group; Rosa, D. de la [Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain); Abd-Elmabod, S.K. [Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain); National Research Centre, Cairo (Egypt). Dept. of Soil and Water Use; Anaya-Romero, M. [CSIC Spin-off, Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain). Evenor-Tech
2012-07-01
Soil C sequestration through changes in land use and management is one of the sustainable and long-term strategies to mitigate climate change. This research explores and quantifies the role of soil and land use as determinants of the ability of soils to store C along Mediterranean systems. Detailed studies of soil organic C (SOC) dynamics are necessary in order to identify factors determining fluctuations and intensity of changes. In this study, SOC contents from different soil and land use types have been investigated in Andalusia (Southern Spain). We have used soil information from different databases, as well as land use digital maps, climate databases and digital elevation models. The average SOC content for each soil control section (0-25, 25-50 and 50-75 cm) was determined and SOC stocks were calculated for each combination of soil and land use type, using soil and land cover maps. The total organic C stocks in soils of Andalusia is 415 Tg for the upper 75 cm, with average values ranging from 15.9 MgC ha{sup -1} (Solonchaks under ''arable land'') to 107.6 MgC ha{sup -1} (Fluvisols from ''wetlands''). Up to 55% of SOC accumulates in the top 25 cm of soil (229.7 Tg). This research constitutes a preliminary assessment for modelling SOC stock under scenarios of land use and climate change. (orig.)
Wang, Can; Bao, Chenchen; Liang, Shujing; Zhang, Lingxia; Fu, Hualin; Wang, Yutian; Wang, Kan; Li, Chao; Deng, Min; Liao, Qiande; Ni, Jian; Cui, Daxiang
2014-05-01
The successful development of safe and highly effective nanoprobes for targeted imaging and simultaneous therapy of in vivo gastric cancer is a great challenge. Herein we reported for the first time that anti-α-subunit of ATP synthase antibody, HAI-178 monoclonal antibody-conjugated fluorescent magnetic nanoparticles, was successfully used for targeted imaging and simultaneous therapy of in vivo gastric cancer. A total of 172 specimens of gastric cancer tissues were collected, and the expression of α-subunit of ATP synthase in gastric cancer tissues was investigated by immunohistochemistry method. Fluorescent magnetic nanoparticles were prepared and conjugated with HAI-178 monoclonal antibody, and the resultant HAI-178 antibody-conjugated fluorescent magnetic nanoparticles (HAI-178-FMNPs) were co-incubated with gastric cancer MGC803 cells and gastric mucous GES-1 cells. Gastric cancer-bearing nude mice models were established, were injected with prepared HAI-178-FMNPs via tail vein, and were imaged by magnetic resonance imaging and small animal fluorescent imaging system. The results showed that the α-subunit of ATP synthase exhibited high expression in 94.7% of the gastric cancer tissues. The prepared HAI-178-FMNPs could target actively MGC803 cells, realized fluorescent imaging and magnetic resonance imaging of in vivo gastric cancer, and actively inhibited growth of gastric cancer cells. In conclusion, HAI-178 antibody-conjugated fluorescent magnetic nanoparticles have a great potential in applications such as targeted imaging and simultaneous therapy of in vivo early gastric cancer cells in the near future.
Variation of phytoplankton biomass and primary production in Daya Bay during spring and summer
International Nuclear Information System (INIS)
Song Xingyu; Huang Liangmin; Zhang Jianlin; Huang, Xiaoping; Zhang Junbin; Yin Jianqiang; Tan Yehui; Liu Sheng
2004-01-01
Environmental factors, phytoplankton biomass (Chl a) and primary production of two water areas in Daya Bay (Dapeng'ao Bay and Aotou Bay) were investigated during the transition period from spring to summer. Chl a ranged from 3.20 to 13.62 and 13.43 to 26.49 mg m -3 in Dapeng'ao Bay and Aotou Bay respectively, if data obtained during red tides are excluded. Primary production varied between 239.7 and 1001.4 mgC m -2 d -1 in Dapeng'ao Bay. The regional distribution of Chl a and primary production were mostly consistent from spring to summer in both bays. Seasonal transition characters have been found in Daya Bay from spring to summer, including high values of DO, nitrate and silicate. Size structures of phytoplankton and its primary production do not change very much from spring to summer, with micro-phytoplankton dominating and contributing about 50% of the whole. In Daya Bay, phytoplankton is limited by nitrogen in spring, and by phosphate in summer. Artificial impacts are evident from high temperature effluent from nuclear power stations, aquaculture and sewage. During the investigation, a red tide occurred in Aotou Bay, with a maximum Chl a of 103.23 mg m -3 at surface and primary production of 2721.9 mgC m -2 d -1 in the red tide center. Raised water temperature and nutrient supply from land-sources help to stimulate annual red tides
Actinide cation-cation complexes
International Nuclear Information System (INIS)
Stoyer, N.J.; Seaborg, G.T.
1994-12-01
The +5 oxidation state of U, Np, Pu, and Am is a linear dioxo cation (AnO 2 + ) with a formal charge of +1. These cations form complexes with a variety of other cations, including actinide cations. Other oxidation states of actinides do not form these cation-cation complexes with any cation other than AnO 2 + ; therefore, cation-cation complexes indicate something unique about AnO 2 + cations compared to actinide cations in general. The first cation-cation complex, NpO 2 + ·UO 2 2+ , was reported by Sullivan, Hindman, and Zielen in 1961. Of the four actinides that form AnO 2 + species, the cation-cation complexes of NpO 2 + have been studied most extensively while the other actinides have not. The only PuO 2 + cation-cation complexes that have been studied are with Fe 3+ and Cr 3+ and neither one has had its equilibrium constant measured. Actinides have small molar absorptivities and cation-cation complexes have small equilibrium constants; therefore, to overcome these obstacles a sensitive technique is required. Spectroscopic techniques are used most often to study cation-cation complexes. Laser-Induced Photacoustic Spectroscopy equilibrium constants for the complexes NpO 2 + ·UO 2 2+ , NpO 2 + ·Th 4+ , PuO 2 + ·UO 2 2+ , and PuO 2 + ·Th 4+ at an ionic strength of 6 M using LIPAS are 2.4 ± 0.2, 1.8 ± 0.9, 2.2 ± 1.5, and ∼0.8 M -1
Conducting metal dithiolate complexes
DEFF Research Database (Denmark)
Underhill, A. E.; Ahmad, M. M.; Turner, D. J.
1985-01-01
Further work on the chemical composition of the one-dimensional metallic metal dithiolene complex Li-Pt(mnt) is reported. The electrical conduction and thermopower properties of the nickel and palladium complexes are reported and compared with those of the platinum compound......Further work on the chemical composition of the one-dimensional metallic metal dithiolene complex Li-Pt(mnt) is reported. The electrical conduction and thermopower properties of the nickel and palladium complexes are reported and compared with those of the platinum compound...
Hagbani, Turki Al; Nazzal, Sami
2017-03-30
One approach to enhance curcumin (CUR) aqueous solubility is to use cyclodextrins (CDs) to form inclusion complexes where CUR is encapsulated as a guest molecule within the internal cavity of the water-soluble CD. Several methods have been reported for the complexation of CUR with CDs. Limited information, however, is available on the use of the autoclave process (AU) in complex formation. The aims of this work were therefore to (1) investigate and evaluate the AU cycle as a complex formation method to enhance CUR solubility; (2) compare the efficacy of the AU process with the freeze-drying (FD) and evaporation (EV) processes in complex formation; and (3) confirm CUR stability by characterizing CUR:CD complexes by NMR, Raman spectroscopy, DSC, and XRD. Significant differences were found in the saturation solubility of CUR from its complexes with CD when prepared by the three complexation methods. The AU yielded a complex with expected chemical and physical fingerprints for a CUR:CD inclusion complex that maintained the chemical integrity and stability of CUR and provided the highest solubility of CUR in water. Physical and chemical characterizations of the AU complexes confirmed the encapsulated of CUR inside the CD cavity and the transformation of the crystalline CUR:CD inclusion complex to an amorphous form. It was concluded that the autoclave process with its short processing time could be used as an alternate and efficient methods for drug:CD complexation. Copyright © 2017 Elsevier B.V. All rights reserved.
Freitag, Eberhard
2005-01-01
The guiding principle of this presentation of ``Classical Complex Analysis'' is to proceed as quickly as possible to the central results while using a small number of notions and concepts from other fields. Thus the prerequisites for understanding this book are minimal; only elementary facts of calculus and algebra are required. The first four chapters cover the essential core of complex analysis: - differentiation in C (including elementary facts about conformal mappings) - integration in C (including complex line integrals, Cauchy's Integral Theorem, and the Integral Formulas) - sequences and series of analytic functions, (isolated) singularities, Laurent series, calculus of residues - construction of analytic functions: the gamma function, Weierstrass' Factorization Theorem, Mittag-Leffler Partial Fraction Decomposition, and -as a particular highlight- the Riemann Mapping Theorem, which characterizes the simply connected domains in C. Further topics included are: - the theory of elliptic functions based on...
Kast, Verena
2014-11-01
Fantasies as imaginative activities are seen by Jung as expressions of psychic energy. In the various descriptions of active imagination the observation of the inner image and the dialogue with inner figures, if possible, are important. The model of symbol formation, as Jung describes it, can be experienced in doing active imagination. There is a correspondence between Jung's understanding of complexes and our imaginations: complexes develop a fantasy life. Complex episodes are narratives of difficult dysfunctional relationship episodes that have occurred repeatedly and are internalized with episodic memory. This means that the whole complex episode (the image for the child and the image for the aggressor, connected with emotions) is internalized and can get constellated in everyday relationship. Therefore inner dialogues do not necessarily qualify as active imaginations, often they are the expression of complex-episodes, very similar to fruitless soliloquies. If imaginations of this kind are repeated, new symbols and new possibilities of behaviour are not found. On the contrary, old patterns of behaviour and fantasies are perpetuated and become cemented. Imaginations of this kind need an intervention by the analyst. In clinical examples different kinds of imaginations are discussed. © 2014, The Society of Analytical Psychology.
Leading healthcare in complexity.
Cohn, Jeffrey
2014-12-01
Healthcare institutions and providers are in complexity. Networks of interconnections from relationships and technology create conditions in which interdependencies and non-linear dynamics lead to surprising, unpredictable outcomes. Previous effective approaches to leadership, focusing on top-down bureaucratic methods, are no longer effective. Leading in complexity requires leaders to accept the complexity, create an adaptive space in which innovation and creativity can flourish and then integrate the successful practices that emerge into the formal organizational structure. Several methods for doing adaptive space work will be discussed. Readers will be able to contrast traditional leadership approaches with leading in complexity. They will learn new behaviours that are required of complexity leaders, along with challenges they will face, often from other leaders within the organization.
Imura, Jun-ichi; Ueta, Tetsushi
2015-01-01
This book is the first to report on theoretical breakthroughs on control of complex dynamical systems developed by collaborative researchers in the two fields of dynamical systems theory and control theory. As well, its basic point of view is of three kinds of complexity: bifurcation phenomena subject to model uncertainty, complex behavior including periodic/quasi-periodic orbits as well as chaotic orbits, and network complexity emerging from dynamical interactions between subsystems. Analysis and Control of Complex Dynamical Systems offers a valuable resource for mathematicians, physicists, and biophysicists, as well as for researchers in nonlinear science and control engineering, allowing them to develop a better fundamental understanding of the analysis and control synthesis of such complex systems.
International Nuclear Information System (INIS)
Zhang Fang-Fang; Liu Shu-Tang; Yu Wei-Yong
2013-01-01
To increase the variety and security of communication, we present the definitions of modified projective synchronization with complex scaling factors (CMPS) of real chaotic systems and complex chaotic systems, where complex scaling factors establish a link between real chaos and complex chaos. Considering all situations of unknown parameters and pseudo-gradient condition, we design adaptive CMPS schemes based on the speed-gradient method for the real drive chaotic system and complex response chaotic system and for the complex drive chaotic system and the real response chaotic system, respectively. The convergence factors and dynamical control strength are added to regulate the convergence speed and increase robustness. Numerical simulations verify the feasibility and effectiveness of the presented schemes. (general)
Selenophene transition metal complexes
Energy Technology Data Exchange (ETDEWEB)
White, Carter James [Iowa State Univ., Ames, IA (United States)
1994-07-27
This research shows that selenophene transition metal complexes have a chemistry that is similar to their thiophene analogs. Selenophene coordination has been demonstrated and confirmed by molecular structure in both the η5- and the η1(Se)-coordination modes. The reaction chemistry of selenophene complexes closely resembles that of the analogous thiophene complexes. One major difference, however, is that selenophene is a better donor ligand than thiophene making the selenophene complexes more stable than the corresponding thiophene complexes. The 77Se NMR chemical shift values for selenophene complexes fall within distinct regions primarily depending on the coordination mode of the selenophene ligand. In the final paper, the C-H bond activation of η1(S)-bound thiophenes, η1(S)-benzothiophene and η1(Se)-bound selenophenes has been demonstrated. The deprotonation and rearrangement of the η1(E)-bound ligand to the carbon bound L-yl complex readily occurs in the presence of base. Reprotonation with a strong acid gives a carbene complex that is unreactive towards nucleophilic attack at the carbene carbon and is stable towards exposure to air. The molecular structure of [Cp(NO)(PPh3)Re(2-benzothioenylcarbene)]O3SCF3 was determined and contains a Re-C bond with substantial double bond character. Methyl substitution for the thienylcarbene or selenylcarbene gives a carbene that rearranges thermally to give back the η1(E)-bound complex. Based on these model reactions, a new mechanism for the H/D exchange of thiophene over the hydrodesulfurization catalyst has been proposed.
Photocytotoxic lanthanide complexes
Indian Academy of Sciences (India)
Among many applications of lanthanides, gadolinium complexes are used as magnetic resonance imaging (MRI) contrast agents in clinical radiology and luminescent lanthanides for bioanalysis, imaging and sensing. The chemistry of photoactive lanthanide complexes showing biological applications is of recent origin.
Physical Complexity and Cognitive Evolution
Jedlicka, Peter
Our intuition tells us that there is a general trend in the evolution of nature, a trend towards greater complexity. However, there are several definitions of complexity and hence it is difficult to argue for or against the validity of this intuition. Christoph Adami has recently introduced a novel measure called physical complexity that assigns low complexity to both ordered and random systems and high complexity to those in between. Physical complexity measures the amount of information that an organism stores in its genome about the environment in which it evolves. The theory of physical complexity predicts that evolution increases the amount of `knowledge' an organism accumulates about its niche. It might be fruitful to generalize Adami's concept of complexity to the entire evolution (including the evolution of man). Physical complexity fits nicely into the philosophical framework of cognitive biology which considers biological evolution as a progressing process of accumulation of knowledge (as a gradual increase of epistemic complexity). According to this paradigm, evolution is a cognitive `ratchet' that pushes the organisms unidirectionally towards higher complexity. Dynamic environment continually creates problems to be solved. To survive in the environment means to solve the problem, and the solution is an embodied knowledge. Cognitive biology (as well as the theory of physical complexity) uses the concepts of information and entropy and views the evolution from both the information-theoretical and thermodynamical perspective. Concerning humans as conscious beings, it seems necessary to postulate an emergence of a new kind of knowledge - a self-aware and self-referential knowledge. Appearence of selfreflection in evolution indicates that the human brain reached a new qualitative level in the epistemic complexity.
DEFF Research Database (Denmark)
Borup, Rehannah; Thuesen, Lea Langhoff; Andersen, Claus Yding
2016-01-01
compartments. DESIGN: A case-control study. SETTING: University based facilities for clinical services and research. PATIENTS: MGC and CC samples from 60 women undergoing IVF treatment following the long GnRH-agonist protocol were collected. Samples from 16 oocytes where live birth was achieved and 16 age...... prediction analysis using machine learning algorithms (support vector machines) with performance estimation by leave-one-out cross validation and independent validation on an external data set. RESULTS: We defined a signature of 30 genes expressed in CC predictive of live birth. This live birth prediction...
Functionalized active-nucleus complex sensor
Pines, Alexander; Wemmer, David E.; Spence, Megan; Rubin, Seth
2003-11-25
A functionalized active-nucleus complex sensor that selectively associates with one or more target species, and a method for assaying and screening for one or a plurality of target species utilizing one or a plurality of functionalized active-nucleus complexes with at least two of the functionalized active-nucleus complexes having an attraction affinity to different corresponding target species. The functionalized active-nucleus complex has an active-nucleus and a targeting carrier. The method involves functionalizing an active-nucleus, for each functionalized active-nucleus complex, by incorporating the active-nucleus into a macromolucular or molecular complex that is capable of binding one of the target species and then bringing the macromolecular or molecular complexes into contact with the target species and detecting the occurrence of or change in a nuclear magnetic resonance signal from each of the active-nuclei in each of the functionalized active-nucleus complexes.
Complex Neutrosophic Subsemigroups and Ideals
Directory of Open Access Journals (Sweden)
Muhammad Gulistan
2018-01-01
Full Text Available In this article we study the idea of complex neutrosophic subsemigroups. We define the Cartesian product of complex neutrosophic subsemigroups, give some examples and study some of its related results. We also define complex neutrosophic (left, right, interior ideal in semigroup. Furthermore, we introduce the concept of characteristic function of complex neutrosophic sets, direct product of complex neutrosophic sets and study some results prove on its.
Transition Complexity of Incomplete DFAs
Directory of Open Access Journals (Sweden)
Yuan Gao
2010-08-01
Full Text Available In this paper, we consider the transition complexity of regular languages based on the incomplete deterministic finite automata. A number of results on Boolean operations have been obtained. It is shown that the transition complexity results for union and complementation are very different from the state complexity results for the same operations. However, for intersection, the transition complexity result is similar to that of state complexity.
Subsumed complexity: abiogenesis as a by-product of complex energy transduction
Adam, Z. R.; Zubarev, D.; Aono, M.; Cleaves, H. James
2017-11-01
The origins of life bring into stark relief the inadequacy of our current synthesis of thermodynamic, chemical, physical and information theory to predict the conditions under which complex, living states of organic matter can arise. Origins research has traditionally proceeded under an array of implicit or explicit guiding principles in lieu of a universal formalism for abiogenesis. Within the framework of a new guiding principle for prebiotic chemistry called subsumed complexity, organic compounds are viewed as by-products of energy transduction phenomena at different scales (subatomic, atomic, molecular and polymeric) that retain energy in the form of bonds that inhibit energy from reaching the ground state. There is evidence for an emergent level of complexity that is overlooked in most conceptualizations of abiogenesis that arises from populations of compounds formed from atomic energy input. We posit that different forms of energy input can exhibit different degrees of dissipation complexity within an identical chemical medium. By extension, the maximum capacity for organic chemical complexification across molecular and macromolecular scales subsumes, rather than emerges from, the underlying complexity of energy transduction processes that drive their production and modification. This article is part of the themed issue 'Reconceptualizing the origins of life'.
Spectroscopy of plutonium-organic complexes
International Nuclear Information System (INIS)
Richmann, M.K.; Reed, D.T.
1995-01-01
Information on the spectroscopy of plutonium-organic complexes is needed to help establish the speciation of these complexes under environmentally relevant conditions. Laser photoacoustic spectroscopy (LPAS) and absorption spectrometry were used to characterize the Pu(IV)-citrate and Pu(IV)-nitrilotriacetic acid (NTA) complexes at concentrations of 10 -3 --10 -7 M in aqueous solution. Good agreement was observed between the band shape of the LPAS and absorption spectra for the Pu(IV)-NTA complex. Agreement for the Pu(IV)-citrate complex was not quite as good. In both cases, a linear dependence of the LPAS signal on laser power and total concentration of the complexes was noted. This work is part of an ongoing research effort to study key subsurface interactions of plutonium-organic complexes
Coronges, Kate; Gonçalves, Bruno; Sinatra, Roberta; Vespignani, Alessandro; Proceedings of the 9th Conference on Complex Networks; CompleNet 2018
2018-01-01
This book aims to bring together researchers and practitioners working across domains and research disciplines to measure, model, and visualize complex networks. It collects the works presented at the 9th International Conference on Complex Networks (CompleNet) 2018 in Boston, MA in March, 2018. With roots in physical, information and social science, the study of complex networks provides a formal set of mathematical methods, computational tools and theories to describe prescribe and predict dynamics and behaviors of complex systems. Despite their diversity, whether the systems are made up of physical, technological, informational, or social networks, they share many common organizing principles and thus can be studied with similar approaches. This book provides a view of the state-of-the-art in this dynamic field and covers topics such as group decision-making, brain and cellular connectivity, network controllability and resiliency, online activism, recommendation systems, and cyber security.
What is complex in the complex world? Niklas Luhmann and the theory of social systems
Directory of Open Access Journals (Sweden)
Clarissa Eckert Baeta Neves
Full Text Available This paper discusses Niklas Luhmann's understanding of complexity, its function in the theory and the different ways of its use. It starts with the paradigmatic change that occurred in the field of general Science, with the rupture of the Newtonian model. In the 20th century, the paradigm of order, symmetry, regularity, regulation of the intellect to things, collapses.Based on new formulations of Physics, Chemistry, etc., a new universe is built on bases radically opposed to those of modern Science.Chaos, the procedural irreversibility, indeterminism, the observer and the complexity are rehabilitated.This new conceptual context served as substratum to Niklas Luhmann's theoretical reflection.With his Theory of Social Systems, he proposes the reduction of the world's complexity.Social systems have the function of reducing complexity because of their difference in relation to the environment.On the other hand, the reduction of complexity also creates its own complexity. Luhmann defines complexity as the moment when it is not possible anymore for each element to relate at any moment with all the others. Complexity forces the selection, what means contingency and risk. Luhmann expands the concept of complexity when he introduces the figure of the observer and the distinction of complexity as a unit of a multiplicity. He also deals with the limit of relations in connection, the time factor, the self-reference of operations and the representation of complexity in the form of sense. To conclude, the paper discusses the complexity in the system of science, the way it reduces internal and external complexity, in accordance in its own operative basis.
Complexity Leadership: A Theoretical Perspective
Baltaci, Ali; Balci, Ali
2017-01-01
Complex systems are social networks composed of interactive employees interconnected through collaborative, dynamic ties such as shared goals, perspectives and needs. Complex systems are largely based on "the complex system theory". The complex system theory focuses mainly on finding out and developing strategies and behaviours that…
Organotin complexes with phosphines
International Nuclear Information System (INIS)
Passos, B. de F.T.; Jesus Filho, M.F. de; Filgueiras, C.A.L.; Abras, A.
1988-01-01
A series of organotin complexes was prepared involving phosphines bonded to the organotin moiety. The series include derivatives of SnCl x Ph 4-x (where x varied from zero to four with the phosphines Ph 3 P, (Ph 2 P)CH 2 , (Ph 2 P) 2 (CH 2 ) 2 , cis-(Ph 2 P)CH 2 , and CH 3 C(CH 2 PPh 2 ) 3 . A host of new complexes was obtained, showing different stoichiometries, bonding modes, and coordination numbers around the tin atom. These complexes were characterized by several different chemical and physical methods. The 119 Sn Moessbauer parameters varied differently. Whereas isomer shift values did not great variation for each group of complexs with the same organotin parent (SnCl x Ph 4-x ), reflecting a small change in s charge distribution on the Sn atom upon complexation, quadrupole splitting results varied widely, however, when the parent organotin compound was wholly symmetric (SnCl 4 and SnPPh 4 ), the complexes also tended to show quadrupole splitting values approaching zero. (author)
International Nuclear Information System (INIS)
Rezendes, V.S.
1992-04-01
In addition to long-standing safety and environmental problems plaguing the nuclear weapons complex, this paper reports that the Department of Energy (DOE) faces a major new challenge-how to reconfigure the weapons complex to meet the nation's defense needs in the 21st century. Key decisions still need to be made about the size of the complex; where, if necessary, to relocate various operations; what technologies to use for new tritium production; and what to do with excess weapons-grade material. The choices confronting DOE and Congress are difficult given the conflicting demands for limited resources
International Nuclear Information System (INIS)
Goudis, C.
1982-01-01
This work deals with some of the most typical complexes of interstellar matter and presents a holistic view of the well studied complexes in Orion, built on information derived from various branches of modern astrophysics. A wealth of published data is presented in the form of photographs, contour maps, diagrams and numerous heavily annotated tables. Chapter 1, which is concerned with the large scale view of the Orion region, outlines the morphology of the area and examines in particular the nature of Barnard's Loop and the associated filamentary structure in addition to the origin of the I Orion OB association. Chapter 2 focuses on the Great Orion Nebula (M42 or NGC 1976) and the small H II region to the north (M43 or NGC 1982). Chapter 3 examines the Orion Complex as a whole, i.e. the H II regions M42 and M43, the associated molecular clouds OMC 1 and OMC 2 and their interrelations. Chapter 4 contains a discussion of the empirical models introduced to attempt to explain certain aspects of this very complex region, and chapter 5 investigates the second prominent H II region and molecular cloud complex, NGC 2024 (Orion B, W12). (Auth.)
Algorithmic Relative Complexity
Directory of Open Access Journals (Sweden)
Daniele Cerra
2011-04-01
Full Text Available Information content and compression are tightly related concepts that can be addressed through both classical and algorithmic information theories, on the basis of Shannon entropy and Kolmogorov complexity, respectively. The definition of several entities in Kolmogorov’s framework relies upon ideas from classical information theory, and these two approaches share many common traits. In this work, we expand the relations between these two frameworks by introducing algorithmic cross-complexity and relative complexity, counterparts of the cross-entropy and relative entropy (or Kullback-Leibler divergence found in Shannon’s framework. We define the cross-complexity of an object x with respect to another object y as the amount of computational resources needed to specify x in terms of y, and the complexity of x related to y as the compression power which is lost when adopting such a description for x, compared to the shortest representation of x. Properties of analogous quantities in classical information theory hold for these new concepts. As these notions are incomputable, a suitable approximation based upon data compression is derived to enable the application to real data, yielding a divergence measure applicable to any pair of strings. Example applications are outlined, involving authorship attribution and satellite image classification, as well as a comparison to similar established techniques.
Khan, Sobia; Vandermorris, Ashley; Shepherd, John; Begun, James W; Lanham, Holly Jordan; Uhl-Bien, Mary; Berta, Whitney
2018-03-21
Complexity thinking is increasingly being embraced in healthcare, which is often described as a complex adaptive system (CAS). Applying CAS to healthcare as an explanatory model for understanding the nature of the system, and to stimulate changes and transformations within the system, is valuable. A seminar series on systems and complexity thinking hosted at the University of Toronto in 2016 offered a number of insights on applications of CAS perspectives to healthcare that we explore here. We synthesized topics from this series into a set of six insights on how complexity thinking fosters a deeper understanding of accepted ideas in healthcare, applications of CAS to actors within the system, and paradoxes in applications of complexity thinking that may require further debate: 1) a complexity lens helps us better understand the nebulous term "context"; 2) concepts of CAS may be applied differently when actors are cognizant of the system in which they operate; 3) actor responses to uncertainty within a CAS is a mechanism for emergent and intentional adaptation; 4) acknowledging complexity supports patient-centred intersectional approaches to patient care; 5) complexity perspectives can support ways that leaders manage change (and transformation) in healthcare; and 6) complexity demands different ways of implementing ideas and assessing the system. To enhance our exploration of key insights, we augmented the knowledge gleaned from the series with key articles on complexity in the literature. Ultimately, complexity thinking acknowledges the "messiness" that we seek to control in healthcare and encourages us to embrace it. This means seeing challenges as opportunities for adaptation, stimulating innovative solutions to ensure positive adaptation, leveraging the social system to enable ideas to emerge and spread across the system, and even more important, acknowledging that these adaptive actions are part of system behaviour just as much as periods of stability are. By
Complexity in practice: understanding primary care as a complex adaptive system
Directory of Open Access Journals (Sweden)
Beverley Ellis
2010-06-01
Conclusions The results are real-world exemplars of the emergent properties of complex adaptive systems. Improving clinical governance in primary care requires both complex social interactions and underpinning informatics. The socio-technical lessons learned from this research should inform future management approaches.
Shapes of interacting RNA complexes
DEFF Research Database (Denmark)
Fu, Benjamin Mingming; Reidys, Christian
2014-01-01
Shapes of interacting RNA complexes are studied using a filtration via their topological genus. A shape of an RNA complex is obtained by (iteratively) collapsing stacks and eliminating hairpin loops.This shape-projection preserves the topological core of the RNA complex and for fixed topological...... genus there are only finitely many such shapes. Our main result is a new bijection that relates the shapes of RNA complexes with shapes of RNA structures. This allows to compute the shape polynomial of RNA complexes via the shape polynomial of RNA structures. We furthermore present a linear time uniform...... sampling algorithm for shapes of RNA complexes of fixed topological genus....
Technetium-aspirin molecule complexes
International Nuclear Information System (INIS)
El-Shahawy, A.S.; Mahfouz, R.M.; Aly, A.A.M.; El-Zohry, M.
1993-01-01
Technetium-aspirin and technetium-aspirin-like molecule complexes were prepared. The structure of N-acetylanthranilic acid (NAA) has been decided through CNDO calculations. The ionization potential and electron affinity of the NAA molecule as well as the charge densities were calculated. The electronic absorption spectra of Tc(V)-Asp and Tc(V)-ATS complexes have two characteristic absorption bands at 450 and 600 nm, but the Tc(V)-NAA spectrum has one characteristic band at 450 nm. As a comparative study, Mo-ATS complex was prepared and its electronic absorption spectrum is comparable with the Tc-ATS complex spectrum. (author)
The pervasive reach of resource-bounded Kolmogorov complexity in computational complexity theory
Czech Academy of Sciences Publication Activity Database
Allender, E.; Koucký, Michal; Ronneburger, D.; Roy, S.
2011-01-01
Roč. 77, č. 1 (2011), s. 14-40 ISSN 0022-0000 R&D Projects: GA ČR GAP202/10/0854; GA MŠk(CZ) 1M0545; GA AV ČR IAA100190902 Institutional research plan: CEZ:AV0Z10190503 Keywords : Circuit complexity * Distinguishing complexity * FewEXP * Formula size * Kolmogorov complexity Subject RIV: BA - General Mathematics Impact factor: 1.157, year: 2011 http://www.sciencedirect.com/science/article/pii/S0022000010000887
Spectral simplicity of apparent complexity. II. Exact complexities and complexity spectra
Riechers, Paul M.; Crutchfield, James P.
2018-03-01
The meromorphic functional calculus developed in Part I overcomes the nondiagonalizability of linear operators that arises often in the temporal evolution of complex systems and is generic to the metadynamics of predicting their behavior. Using the resulting spectral decomposition, we derive closed-form expressions for correlation functions, finite-length Shannon entropy-rate approximates, asymptotic entropy rate, excess entropy, transient information, transient and asymptotic state uncertainties, and synchronization information of stochastic processes generated by finite-state hidden Markov models. This introduces analytical tractability to investigating information processing in discrete-event stochastic processes, symbolic dynamics, and chaotic dynamical systems. Comparisons reveal mathematical similarities between complexity measures originally thought to capture distinct informational and computational properties. We also introduce a new kind of spectral analysis via coronal spectrograms and the frequency-dependent spectra of past-future mutual information. We analyze a number of examples to illustrate the methods, emphasizing processes with multivariate dependencies beyond pairwise correlation. This includes spectral decomposition calculations for one representative example in full detail.
Complexity of formation in holography
International Nuclear Information System (INIS)
Chapman, Shira; Marrochio, Hugo; Myers, Robert C.
2017-01-01
It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.
Complexity of formation in holography
Energy Technology Data Exchange (ETDEWEB)
Chapman, Shira [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Marrochio, Hugo [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Department of Physics & Astronomy and Guelph-Waterloo Physics Institute,University of Waterloo, Waterloo, ON N2L 3G1 (Canada); Myers, Robert C. [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada)
2017-01-16
It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.
Lanthanide complexes with pivaloylacetone
International Nuclear Information System (INIS)
Eliseeva, S.V.; Chugarov, N.V.; Kuz'mina, N.P.; Martynenko, L.I.; Nichiporuk, R.V.; Ivanov, S.A.
2003-01-01
Complexes Ln(pa) 3 ·2H 2 O (Ln=La, Gd, Lu, Hpa - pivaloylacetone) are synthesized and investigated by the methods of element, IR spectroscopic and thermal analyses. Behaviour of the complexes during heating in vacuum is compared with such one for acetylacetonates and dipivaloylmethanates. Structure of the complexes in solution is studied by 1 H NMR and MALDI-MS [ru
DEFF Research Database (Denmark)
Wu, Mo; Forchhammer, Søren; Aghito, Shankar Manuel
2007-01-01
A complexity control algorithm for H.264 advanced video coding is proposed. The algorithm can control the complexity of integer inter motion estimation for a given target complexity. The Rate-Distortion-Complexity performance is improved by a complexity prediction model, simple analysis of the pa...... statistics and a control scheme. The algorithm also works well for scene change condition. Test results for coding interlaced video (720x576 PAL) are reported.......A complexity control algorithm for H.264 advanced video coding is proposed. The algorithm can control the complexity of integer inter motion estimation for a given target complexity. The Rate-Distortion-Complexity performance is improved by a complexity prediction model, simple analysis of the past...
Aryldiazo complexes. Syntheses and reactions of new complexes of osmium and ruthenium
International Nuclear Information System (INIS)
Haymore, B.L.; Ibers, J.A.
1975-01-01
Aryldiazo complexes, [M(CO) 2 (NNPh)(PPh 3 ) 2 ][PF 6 ](M = Os, Ru; Ph = C 6 H 5 ), were prepared by allowing diazonium salts to react with M(CO) 3 (PPh 3 ) 2 . Infrared spectra of the Ru complex suggest the presence of two isomers both in solution and in the solid state. These complexes react with a variety of coordinating anions (X - ), to form MX(CO) 2 (NNPh)(PPh 3 ) 2 . The osmium derivatives have ν(NN) near 1455 cm -1 , which is the lowest value yet reported for a nonbridging aryldiazo ligand. The first aryldiazo--hydrido complexes, MH(CO) 2 (NNPh)(PPh 3 ) 2 and MH(CO)(NNPh)(PPh 3 ) 2 , were prepared by deprotonation of the respective phenyldiazene complexes, MH(CO) 2 (HNNPh)(PPh 3 ) 2 + and MH(CO)(HNNPh)(PPh 3 ) 3 + . The compound OsCl 3 (NNPh)(PPh 3 ) 2 was also prepared. A large number of the foregoing complexes were synthesized with selective 2 H and 15 N labels. Infrared and NMR spectra show MX(CO) 2 (NNPh)(PPh 3 ) 2 and the analogous hydrido complex to be pseudooctahedral with trans phosphine ligands, cis carbonyl ligands, and a doubly bent phenyldiazenido (NNPh - ) ligand. Similarly, MH(CO)(NNPh)(PPh 3 ) 2 possesses a trigonal-bipyramidal geometry with trans phosphine ligands and an equatorial, singly bent phenyldiazoniumato (NNPh + ) ligand. Isotopic substitution of the diazo ligand shows that ν(NN) is often vibrationally coupled with phenyl vibrational modes and that two or three bands sometimes shift upon 15 N substitution. Vibrational coupling was also observed in the higher energy region (1850 to 1900 cm -1 ) in the compound RuCl 3 (NNC 6 D 5 )(PPh 3 ) 2 . The wide range in the values of ν(NN), RuCl 3 (NNPh)(PPh 3 ) 2 (1882 cm -1 ) vs. RuCl(CO) 2 (NNPh)(PPh 3 ) 2 (1462 cm -1 ), indicates that the N--N stretching frequencies are sensitive to the electronic and steric environment of the diazo ligand. The aryldiazo complexes are compared with analogous, isoelectronic nitrosyl complexes of Os and Ru
Visual Short-Term Memory Complexity
DEFF Research Database (Denmark)
Sørensen, Thomas Alrik
of objective complexity, it seems that subjective complexity - which is dependent on the familiarity of the stimulus - plays a more important role than the objective visual complexity of the objects stored. In two studies, we explored how familiarity influences the capacity of VSTM. 1) In children learning...... and Cavanagh (2004) have raised the question that the capacity of VSTM is dependent on visual complexity rather than the number of objects. We hypothesise that VSTM capacity is dependent on both the objective and subjective complexity of visual stimuli. Contrary to Alvarez and Cavanagh, who argue for the role...... for letters and pictures remained similar. Our results indicate that VSTM capacity for familiar items is larger irrespective of visual complexity....
Complexity: Outline of the NWO strategic theme Dynamics of complex systems
Burgers, G.; Doelman, A.; Frenken, K.; Hogeweg, P.; Hommes, C.; van der Maas, H.; Mulder, B.; Stam, K.; van Steen, M.; Zandee, L.
2008-01-01
Dynamics of complex systems is one of the program 5 themes in the NWO (Netherlands Organisation for Scientific Research) strategy for the years 2007-2011. The ambition of the current proposal is to initiate integrated activities in the field of complex systems within the Netherlands, to provide
Complexity : outline of the NWO strategic theme dynamics of complex systems
Burgers, G.; Doelman, A.; Frenken, K.; Hogeweg, P.; Hommes, C.; Maas, van der H.; Mulder, B.; Stam, K.; Steen, van M.; Zandee, L.
2008-01-01
Dynamics of complex systems is one of the program 5 themes in the NWO (Netherlands Organisation for Scientific Research) strategy for the years 2007-2011. The ambition of the current proposal is to initiate integrated activities in the field of complex systems within the Netherlands, to provide
Coopetition and Complexity : Exploring a Coopetitive Relationship with Complexity
Wennberg, Andreas; Persson, Emil
2011-01-01
Cooperation have in previous research been seen as a negative impact on competition and vice versa. This thesis is building on a concept called coopetition in which cooperation and competition is studied simultaneously. Coopetition have been studied in terms of the level of cooperation and competition. However, we found a possible link between coopetition and complexity in previous literature. Thus, the purpose of this study is to explore whether complexity can develop an understanding f...
Complexity and Control: Towards a Rigorous Behavioral Theory of Complex Dynamical Systems
Ivancevic, Vladimir G.; Reid, Darryn J.
We introduce our motive for writing this book on complexity and control with a popular "complexity myth," which seems to be quite wide spread among chaos and complexity theory fashionistas: quote>Low-dimensional systems usually exhibit complex behaviours (which we know fromMay's studies of the Logisticmap), while high-dimensional systems usually exhibit simple behaviours (which we know from synchronisation studies of the Kuramoto model)...quote> We admit that this naive view on complex (e.g., human) systems versus simple (e.g., physical) systems might seem compelling to various technocratic managers and politicians; indeed, the idea makes for appealing sound-bites. However, it is enough to see both in the equations and computer simulations of pendula of various degree - (i) a single pendulum, (ii) a double pendulum, and (iii) a triple pendulum - that this popular myth is plain nonsense. The only thing that we can learn from it is what every tyrant already knows: by using force as a strong means of control, it is possible to effectively synchronise even hundreds of millions of people, at least for a while.
Energy Technology Data Exchange (ETDEWEB)
Du, Guodong [Iowa State Univ., Ames, IA (United States)
2003-01-01
In this work, the first examples of group 4 metalloporphyrin 1,2-diolato complexes were synthesized through a number of strategies. In general, treatment of imido metalloporphyrin complexes, (TTP)M=NR, (M = Ti, Zr, Hf), with vicinal diols led to the formation of a series of diolato complexes. Alternatively, the chelating pinacolate complexes could be prepared by metathesis of (TTP)MCl2 (M = Ti, Hf) with disodium pinacolate. These complexes were found to undergo C-C cleavage reactions to produce organic carbonyl compounds. For titanium porphyrins, treatment of a titanium(II) alkyne adduct, (TTP)Ti(η2-PhC≡CPh), with aromatic aldehydes or aryl ketones resulted in reductive coupling of the carbonyl groups to produce the corresponding diolato complexes. Aliphatic aldehydes or ketones were not reactive towards (TTP)Ti(η2-PhC≡CPh). However, these carbonyl compounds could be incorporated into a diolato complex on reaction with a reactive precursor, (TTP)Ti[O(Ph)2C(Ph)2O] to provide unsymmetrical diolato complexes via cross coupling reactions. In addition, an enediolato complex (TTP)Ti(OCPhCPhO) was obtained from the reaction of (TTP)Ti(η2-PhC≡CPh) with benzoin. Titanium porphyrin diolato complexes were found to be intermediates in the (TTP)Ti=O-catalyzed cleavage reactions of vicinal diols, in which atmospheric oxygen was the oxidant. Furthermore, (TTP)Ti=O was capable of catalyzing the oxidation of benzyl alcohol and α-hydroxy ketones to benzaldehyde and α-diketones, respectively. Other high valent metalloporphyrin complexes also can catalyze the oxidative diol cleavage and the benzyl alcohol oxidation reactions with dioxygen. A comparison of Ti(IV) and Sn(IV) porphyrin chemistry was undertaken. While chelated diolato complexes were invariably obtained for titanium porphyrins on treatment with 1,2-diols, the reaction of vicinal diols with tin porphyrins gave a number of products, including mono
Thinking in complexity the complex dynamics of matter, mind, and mankind
Mainzer, Klaus
1994-01-01
The theory of nonlinear complex systems has become a successful and widely used problem-solving approach in the natural sciences - from laser physics, quantum chaos and meteorology to molecular modeling in chemistry and computer simulations of cell growth in biology In recent times it has been recognized that many of the social, ecological and political problems of mankind are also of a global, complex and nonlinear nature And one of the most exciting topics of present scientific and public interest is the idea that even the human mind is governed largely by the nonlinear dynamics of complex systems In this wide-ranging but concise treatment Prof Mainzer discusses, in nontechnical language, the common framework behind these endeavours Special emphasis is given to the evolution of new structures in natural and cultural systems and it is seen clearly how the new integrative approach of complexity theory can give new insights that were not available using traditional reductionistic methods
Clearing the complexity: immune complexes and their treatment in lupus nephritis
Directory of Open Access Journals (Sweden)
Catherine Toong
2011-01-01
Full Text Available Catherine Toong1, Stephen Adelstein1, Tri Giang Phan21Department of Clinical Immunology, Royal Prince Alfred Hospital, Missenden Rd, Camperdown, NSW, Australia; 2Immunology Program, Garvan Institute of Medical Research and St. Vincent’s Clinical School, University of New South Wales, Darlinghurst, NSW, AustraliaAbstract: Systemic lupus erythematosus (SLE is a classic antibody-mediated systemic autoimmune disease characterised by the development of autoantibodies to ubiquitous self-antigens (such as antinuclear antibodies and antidouble-stranded DNA antibodies and widespread deposition of immune complexes in affected tissues. Deposition of immune complexes in the kidney results in glomerular damage and occurs in all forms of lupus nephritis. The development of nephritis carries a poor prognosis and high risk of developing end-stage renal failure despite recent therapeutic advances. Here we review the role of DNA-anti-DNA immune complexes in the pathogenesis of lupus nephritis and possible new treatment strategies aimed at their control.Keywords: immune complex, systemic lupus erythematosus, nephritis, therapy
Smith, Stephen D
2011-01-01
This book is intended as an overview of a research area that combines geometries for groups (such as Tits buildings and generalizations), topological aspects of simplicial complexes from p-subgroups of a group (in the spirit of Brown, Quillen, and Webb), and combinatorics of partially ordered sets. The material is intended to serve as an advanced graduate-level text and partly as a general reference on the research area. The treatment offers optional tracks for the reader interested in buildings, geometries for sporadic simple groups, and G-equivariant equivalences and homology for subgroup complexes.
Directory of Open Access Journals (Sweden)
Jian Liu
Full Text Available In this paper, adaptive control is extended from real space to complex space, resulting in a new control scheme for a class of n-dimensional time-dependent strict-feedback complex-variable chaotic (hyperchaotic systems (CVCSs in the presence of uncertain complex parameters and perturbations, which has not been previously reported in the literature. In detail, we have developed a unified framework for designing the adaptive complex scalar controller to ensure this type of CVCSs asymptotically stable and for selecting complex update laws to estimate unknown complex parameters. In particular, combining Lyapunov functions dependent on complex-valued vectors and back-stepping technique, sufficient criteria on stabilization of CVCSs are derived in the sense of Wirtinger calculus in complex space. Finally, numerical simulation is presented to validate our theoretical results.
Liu, Jian; Liu, Kexin; Liu, Shutang
2017-01-01
In this paper, adaptive control is extended from real space to complex space, resulting in a new control scheme for a class of n-dimensional time-dependent strict-feedback complex-variable chaotic (hyperchaotic) systems (CVCSs) in the presence of uncertain complex parameters and perturbations, which has not been previously reported in the literature. In detail, we have developed a unified framework for designing the adaptive complex scalar controller to ensure this type of CVCSs asymptotically stable and for selecting complex update laws to estimate unknown complex parameters. In particular, combining Lyapunov functions dependent on complex-valued vectors and back-stepping technique, sufficient criteria on stabilization of CVCSs are derived in the sense of Wirtinger calculus in complex space. Finally, numerical simulation is presented to validate our theoretical results.
Complexity a very short introduction
Holland, John H
2014-01-01
The importance of complexity is well-captured by Hawking's comment: "Complexity is the science of the 21st century". From the movement of flocks of birds to the Internet, environmental sustainability, and market regulation, the study and understanding of complex non-linear systems has become highly influential over the last 30 years. In this Very Short Introduction, one of the leading figures in the field, John Holland, introduces the key elements and conceptual framework of complexity. From complex physical systems such as fluid flow and the difficulties of predicting weather, to complex adaptive systems such as the highly diverse and interdependent ecosystems of rainforests, he combines simple, well-known examples - Adam Smith's pin factory, Darwin's comet orchid, and Simon's 'watchmaker' - with an account of the approaches, involving agents and urn models, taken by complexity theory. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost eve...
Quantifying Complexity in Quantum Phase Transitions via Mutual Information Complex Networks.
Valdez, Marc Andrew; Jaschke, Daniel; Vargas, David L; Carr, Lincoln D
2017-12-01
We quantify the emergent complexity of quantum states near quantum critical points on regular 1D lattices, via complex network measures based on quantum mutual information as the adjacency matrix, in direct analogy to quantifying the complexity of electroencephalogram or functional magnetic resonance imaging measurements of the brain. Using matrix product state methods, we show that network density, clustering, disparity, and Pearson's correlation obtain the critical point for both quantum Ising and Bose-Hubbard models to a high degree of accuracy in finite-size scaling for three classes of quantum phase transitions, Z_{2}, mean field superfluid to Mott insulator, and a Berzinskii-Kosterlitz-Thouless crossover.
Quantifying Complexity in Quantum Phase Transitions via Mutual Information Complex Networks
Valdez, Marc Andrew; Jaschke, Daniel; Vargas, David L.; Carr, Lincoln D.
2017-12-01
We quantify the emergent complexity of quantum states near quantum critical points on regular 1D lattices, via complex network measures based on quantum mutual information as the adjacency matrix, in direct analogy to quantifying the complexity of electroencephalogram or functional magnetic resonance imaging measurements of the brain. Using matrix product state methods, we show that network density, clustering, disparity, and Pearson's correlation obtain the critical point for both quantum Ising and Bose-Hubbard models to a high degree of accuracy in finite-size scaling for three classes of quantum phase transitions, Z2, mean field superfluid to Mott insulator, and a Berzinskii-Kosterlitz-Thouless crossover.
Innovation in a complex environment
Directory of Open Access Journals (Sweden)
René Pellissier
2012-11-01
Objectives: The study objectives were, firstly, to establish the determinants for complexity and how these can be addressed from a design point of view in order to ensure innovation success and, secondly, to determine how this changes innovation forms and applications. Method: Two approaches were offered to deal with a complex environment – one allowing for complexity for organisational innovation and the other introducing reductionism to minimise complexity. These approaches were examined in a qualitative study involving case studies, open-ended interviews and content analysis between seven developing economy (South African organisations and seven developed economy (US organisations. Results: This study presented a proposed framework for (organisational innovation in a complex environment versus a framework that minimises complexity. The comparative organisational analysis demonstrated the importance of initiating organisational innovation to address internal and external complexity, with the focus being on the leadership actions, their selected operating models and resultant organisational innovations designs, rather than on technological innovations. Conclusion: This study cautioned the preference for technological innovation within organisations and suggested alternative innovation forms (such as organisational and management innovation be used to remain competitive in a complex environment.
Directory of Open Access Journals (Sweden)
O. Yusupova
2015-10-01
Full Text Available Complex promotions used by retailers introduce to the consumers several rules that must be satisfied in order to get some benefits and usually refer to multiple products (e.g. “buy two, get one free”. Rules of complex promotions can be quite sophisticated and complicated themselves. Since diversity of complex promotions limited only by marketers’ imagination we can observe broad variety of promotions’ rules and representa¬tions of those rules in retailers’ commercials. Such diversification makes no good for fellow scientist who’s trying to sort all type of promotions into the neatly organized classification. Although we can simple add every single set of rules offered by retailers as a separate form of sales promotion it seems not to be the best way of dealing with such a problem. The better way is to realize that mechanisms underlying that variety of promotions are basically the same, namely changes in demand or quantity demanded. Those two concepts alone provide powerful insight into classification of complex promotions and allow us to comprehend the variety of promotions offered by marketers nowadays.
International Nuclear Information System (INIS)
Peach, J.D.
1991-02-01
In this paper, GAO provides its views on DOE's January 1991 Nuclear Weapons Complex Reconfiguration Study. GAO believes that DOE's new reconfiguration study provides a starting point for reaching agreement on solutions to many of the complex's problems. Key decisions still need to be made about the size of the complex, where to relocate plutonium operations, what technologies should be used for new tritium production, and what to do with excess plutonium. The total cost for reconfiguring and modernizing is still uncertain and some management issues remain unresolved. Congress faces a difficult task in making these decisions given the conflicting demands for scare resources in a time of growing budget deficits and war in the Persian Gulf
The SEA complex – the beginning
Directory of Open Access Journals (Sweden)
Dokudovskaya S. S.
2012-07-01
Full Text Available The presence of distinctive internal membrane compartments, dynamically connected via selective transport pathways, is a hallmark of eukaryotic cells. Many of the proteins required for formation and maintenance of these compartments share an evolutionary history. We have recently identified a new conserved protein complex – the SEA complex – that possesses proteins with structural characteristics similar to the membrane coating complexes such as the nuclear pore complex (NPC, the COPII vesicle coating complex and HOPS/CORVET tethering complexes. The SEA complex in yeast is dynamically associated to the vacuole. The data on the function of the SEA complex remain extremely limited. Here we will discuss a possible role of the SEA complex based on the data from genetic assays and a number of functional studies in both yeast and other eukaryotes.
Qubit Complexity of Continuous Problems
National Research Council Canada - National Science Library
Papageorgiou, A; Traub, J. F
2005-01-01
.... The authors show how to obtain the classical query complexity for continuous problems. They then establish a simple formula for a lower bound on the qubit complexity in terms of the classical query complexity...
Innovation in a complex environment
Directory of Open Access Journals (Sweden)
René Pellissier
2012-02-01
Full Text Available Background: As our world becomes more global and competitive yet less predictable, the focus seems to be increasingly on looking to innovation activities to remain competitive. Although there is little doubt that a nation’s competitiveness is embedded in its innovativeness, the complex environment should not be ignored. Complexity is not accounted for in balance sheets or reported in reports; it becomes entrenched in every activity in the organisation. Innovation takes many forms and comes in different shapes.Objectives: The study objectives were, firstly, to establish the determinants for complexity and how these can be addressed from a design point of view in order to ensure innovation success and, secondly, to determine how this changes innovation forms and applications.Method: Two approaches were offered to deal with a complex environment – one allowing for complexity for organisational innovation and the other introducing reductionism to minimise complexity. These approaches were examined in a qualitative study involving case studies, open-ended interviews and content analysis between seven developing economy (South African organisations and seven developed economy (US organisations.Results: This study presented a proposed framework for (organisational innovation in a complex environment versus a framework that minimises complexity. The comparative organisational analysis demonstrated the importance of initiating organisational innovation to address internal and external complexity, with the focus being on the leadership actions, their selected operating models and resultant organisational innovations designs, rather than on technological innovations.Conclusion: This study cautioned the preference for technological innovation within organisations and suggested alternative innovation forms (such as organisational and management innovation be used to remain competitive in a complex environment.
Davidson, Andrew J; Insall, Robert H
2013-11-01
The SCAR/WAVE complex drives the actin polymerisation that underlies protrusion of the front of the cell and thus drives migration. However, it is not understood how the activity of SCAR/WAVE is regulated to generate the infinite range of cellular shape changes observed during cell motility. What are the relative roles of the subunits of the SCAR/WAVE complex? What signaling molecules do they interact with? And how does the complex integrate all this information in order to control the temporal and spatial polymerisation of actin during protrusion formation? Unfortunately, the interdependence of SCAR complex members has made genetic dissection hard. In our recent paper,(1) we describe stabilization of the Dictyostelium SCAR complex by a small fragment of Abi. Here we summarize the main findings and discuss how this approach can help reveal the inner workings of this impenetrable complex.
Morrow, James
2006-01-01
This book, a revision and organization of lectures given by Kodaira at Stanford University in 1965-66, is an excellent, well-written introduction to the study of abstract complex (analytic) manifolds-a subject that began in the late 1940's and early 1950's. It is largely self-contained, except for some standard results about elliptic partial differential equations, for which complete references are given. -D. C. Spencer, MathSciNet The book under review is the faithful reprint of the original edition of one of the most influential textbooks in modern complex analysis and geometry. The classic
Hypoxia targeting copper complexes
International Nuclear Information System (INIS)
Dearling, J.L.
1998-11-01
The importance and incidence of tumour hypoxia, its measurement and current treatments available, including pharmacological and radiopharmacological methods of targeting hypoxia, are discussed. A variety of in vitro and in vivo methods for imposing hypoxia have been developed and are reviewed. Copper, its chemistry, biochemistry and radiochemistry, the potential for use of copper radionuclides and its use to date in this field is considered with particular reference to the thiosemicarbazones. Their biological activity, metal chelation, in vitro and in vivo studies of their radiocopper complexes and the potential for their use as hypoxia targeting radiopharmaceuticals is described. The reduction of the copper(II) complex to copper(l), its pivotal importance in their biological behaviour, and the potential for manipulation of this to effect hypoxia selectivity are described. An in vitro method for assessing the hypoxia selectivity of radiopharmaceuticals is reported. The rapid deoxygenation and high viability of a mammalian cell culture in this system is discussed and factors which may affect the cellular uptake of a radiopharmaceutical are described. The design, synthesis and complexation with copper and radiocopper of a range of bis(thiosemicarbazones) is reported. Synthesis of these compounds is simple giving high yields of pure products. The characteristics of the radiocopper complexes ( 64 Cu) including lipophilicity and redox activity are reported (reduction potentials in the range -0.314 - -0.590 V). High cellular uptakes of the radiocopper complexes of the ligands, in hypoxic and normoxic EMT6 and CHO320 cells, were observed. Extremes of selectivity are shown ranging from the hypoxia selective 64 Cu(II)ATSM to normoxic cell selective 64 Cu(II)GTS. The selectivities observed are compared with the physico chemical characteristics of the complexes. A good correlation exists between selectivity of the complex and its Cu(II)/Cu(I) reduction potential, with hypoxia
Complex Systems and Dependability
Zamojski, Wojciech; Sugier, Jaroslaw
2012-01-01
Typical contemporary complex system is a multifaceted amalgamation of technical, information, organization, software and human (users, administrators and management) resources. Complexity of such a system comes not only from its involved technical and organizational structure but mainly from complexity of information processes that must be implemented in the operational environment (data processing, monitoring, management, etc.). In such case traditional methods of reliability analysis focused mainly on technical level are usually insufficient in performance evaluation and more innovative meth
Complexity Management - A multiple case study analysis on control and reduction of complexity costs
DEFF Research Database (Denmark)
Myrodia, Anna
of products, with features more custom-made to cover individual needs, both regarding characteristics of products and support services. This necessity leads to a considerable increase of the complexity in the company, which affects the product portfolio, production and supply chain, market segments......, IT systems, and business processes. In order to identify and eliminate complexity, several approaches are used, both by researchers and practitioners. The purpose of this thesis is to contribute to the existing knowledge of complexity management theory. This research focuses on the relationship between......Complexity tends to be arguably the biggest challenge of manufacturing companies. The motivation of further studying complexity is a combination between the existing literature and the practical experiences from the industry. Based on the latest trend companies are trying to supply a growing mix...
International Nuclear Information System (INIS)
Poluehktov, N.S.; Meshkova, S.B.; Danilkovich, M.M.; Topilova, Z.M.
1985-01-01
Regularities in changes of stability constants of lanthanum complexes with aminopolycarboxylic acids (APA) versus their structure are studied, The stability of lathanum-APA complexes depends mainly on the number of carboxyl groups in a ligand molecule. At that, the highest stability constant is characteristic of a complex with a ligand, containing 3 nitrogen atoms and 5 carboxyl groups, in the presenoe of which the lanthanum ion coordination sphere gets satupated. The oxyethy group introduction into a ligand molecule also improves the lanthanum complex stability but to a lesser degree than during the introduction of a carboxyl group. The number of nitrogen atoms in a ligand polecule affects insignificantly the complex stability constant value, and the elongation of a chain of CH 2 groups, separating nitrogen atoms, reduces the constant to a -0.6 power
Directory of Open Access Journals (Sweden)
Xuefei Wu
2014-01-01
Full Text Available The complex projective synchronization in drive-response stochastic coupled networks with complex-variable systems is considered. The impulsive pinning control scheme is adopted to achieve complex projective synchronization and several simple and practical sufficient conditions are obtained in a general drive-response network. In addition, the adaptive feedback algorithms are proposed to adjust the control strength. Several numerical simulations are provided to show the effectiveness and feasibility of the proposed methods.
Rico-Díaz, Agustín; Ramírez-Escudero, Mercedes; Vizoso-Vázquez, Ángel; Cerdán, M Esperanza; Becerra, Manuel; Sanz-Aparicio, Julia
2017-06-01
GalGlu), 5IFT (in complex with 3GalGlu), 5JUV (in complex with 6GalGal), 5MGC (in complex with 4GalLac), and 5MGD (in complex with 6GalLac). © 2017 Federation of European Biochemical Societies.
Directory of Open Access Journals (Sweden)
Marian STAN
2015-07-01
Full Text Available The actuality of the investigated theme. Nowadays, human evolution, including his intellectual development, proves the fact that especially the creation manpower and the employment was the solution of all life’s ambitions in society. So, the fact is that in reality, man is the most important capital of the society. Also, in an individual’s life, the practice of sport plays a significant role and that’s why the initiation, the launch and the management of sports complexes activity reveal the existence of specific management features that we will identify and explain in the current study. The aim of the research refers to the elaboration of a theoretical base of the management of the sport complexes, to the pointing of the factors that influence the efficient existence and function of a sport complex in our country and to the determination of the responsibilities that have a manager who directs successfully the activity of the sport complexes. The investigation is based on theoretical methods, such as: scientific documentation, analysis, synthesis, comparison and on empirical research methods, like: study of researched literature and observation. The results of the research indicate the fact that the profitability of a sport complex must assure a particular structure to avoid the bankruptcy risk and also, that the administration of the sport complexes activity must keep in view the reliable functions of the contemporaneous management.
Directory of Open Access Journals (Sweden)
Edna Lemes Martins Pereira
2013-12-01
Full Text Available Economic globalization affects different countries on the globe, has positive effects mainly related to access to communication, which promotes the exchange of ideas, information, products and quality of life. However, extends numerous negative aspects such as marginalization, economic dependencies, political, cultural, scientific, educational accentuate social inequalities and cultural conflicts and territorial. In this article it is a dialogue with authors (Cunha 2009; BARNETT 2005; MORIN 1999, 2006, among others, who understand these changes in society from the contemporary world as conceived as the "Complexity era" or "supercomplexity". To understand and cope with this reality, they propose a paradigm that is able to overcome the fragmentation and reductionism of knowledge and to relate the multiple approaches and visions to meet the complexity of reality. Although this paper presents proposals to the aforementioned authors point to education and the university found in this tangle of interconnected global transformations, given the need to be subject to act in a complex reality that requires critical and self-critical professionals, able to think about their own ability to think, understand and act within this complex context.
Cooperativity of complex salt bridges
Gvritishvili, Anzor G.; Gribenko, Alexey V.; Makhatadze, George I.
2008-01-01
The energetic contribution of complex salt bridges, in which one charged residue (anchor residue) forms salt bridges with two or more residues simultaneously, has been suggested to have importance for protein stability. Detailed analysis of the net energetics of complex salt bridge formation using double- and triple-mutant cycle analysis revealed conflicting results. In two cases, it was shown that complex salt bridge formation is cooperative, i.e., the net strength of the complex salt bridge...
International Nuclear Information System (INIS)
Pastrnak, J.W.
1986-01-01
This eighteen-month study has been successful in providing the designer and analyst with qualitative guidelines on the occurrence of complex modes in the dynamics of linear structures, and also in developing computer codes for determining quantitatively which vibration modes are complex and to what degree. The presence of complex modes in a test structure has been verified. Finite element analysis of a structure with non-proportional dumping has been performed. A partial differential equation has been formed to eliminate possible modeling errors
Managing complexity insights, concepts, applications
Helbing, Dirk
2007-01-01
Each chapter in Managing Complexity focuses on analyzing real-world complex systems and transferring knowledge from the complex-systems sciences to applications in business, industry and society. The interdisciplinary contributions range from markets and production through logistics, traffic control, and critical infrastructures, up to network design, information systems, social conflicts and building consensus. They serve to raise readers' awareness concerning the often counter-intuitive behavior of complex systems and to help them integrate insights gained in complexity research into everyday planning, decision making, strategic optimization, and policy. Intended for a broad readership, the contributions have been kept largely non-technical and address a general, scientifically literate audience involved in corporate, academic, and public institutions.
Beneš, Martin; Riesová, Martina; Svobodová, Jana; Tesařová, Eva; Dubský, Pavel; Gaš, Bohuslav
2013-09-17
This article elucidates the practical impact of the complexation of buffer constituents with complexation agents on electrophoretic results, namely, complexation constant determination, system peak development, and proper separation of analytes. Several common buffers, which were selected based on the pH study in Part I of this paper series (Riesová, M.; Svobodová, J.; Tošner, Z.; Beneš, M.; Tesařová, E.; Gaš, B. Anal. Chem., 2013, DOI: 10.1021/ac4013804); e.g., CHES, MES, MOPS, Tricine were used to demonstrate behavior of such complex separation systems. We show that the value of a complexation constant determined in the interacting buffers environment depends not only on the analyte and complexation agent but it is also substantially affected by the type and concentration of buffer constituents. As a result, the complexation parameters determined in the interacting buffers cannot be regarded as thermodynamic ones and may provide misleading information about the strength of complexation of the compound of interest. We also demonstrate that the development of system peaks in interacting buffer systems significantly differs from the behavior known for noncomplexing systems, as the mobility of system peaks depends on the concentration and type of neutral complexation agent. Finally, we show that the use of interacting buffers can totally ruin the results of electrophoretic separation because the buffer properties change as the consequence of the buffer constituents' complexation. As a general conclusion, the interaction of buffer constituents with the complexation agent should always be considered in any method development procedures.
Quantify the complexity of turbulence
Tao, Xingtian; Wu, Huixuan
2017-11-01
Many researchers have used Reynolds stress, power spectrum and Shannon entropy to characterize a turbulent flow, but few of them have measured the complexity of turbulence. Yet as this study shows, conventional turbulence statistics and Shannon entropy have limits when quantifying the flow complexity. Thus, it is necessary to introduce new complexity measures- such as topology complexity and excess information-to describe turbulence. Our test flow is a classic turbulent cylinder wake at Reynolds number 8100. Along the stream-wise direction, the flow becomes more isotropic and the magnitudes of normal Reynolds stresses decrease monotonically. These seem to indicate the flow dynamics becomes simpler downstream. However, the Shannon entropy keeps increasing along the flow direction and the dynamics seems to be more complex, because the large-scale vortices cascade to small eddies, the flow is less correlated and more unpredictable. In fact, these two contradictory observations partially describe the complexity of a turbulent wake. Our measurements (up to 40 diameters downstream the cylinder) show that the flow's degree-of-complexity actually increases firstly and then becomes a constant (or drops slightly) along the stream-wise direction. University of Kansas General Research Fund.
International Nuclear Information System (INIS)
Androsenko, A.A.; Androsenko, P.A.
1983-01-01
A description is given of the structure, input procedure and recording rules of initial data for the BRAND programme complex intended for the Monte Carlo simulation of neutron physics experiments. The BRAND complex ideology is based on non-analogous simulation of the neutron and photon transport process (statistic weights are used, absorption and escape of particles from the considered region is taken into account, shifted readouts from a coordinate part of transition nucleus density are applied, local estimations, etc. are used). The preparation of initial data for three sections is described in detail: general information for Monte Carlo calculation, source definition and data for describing the geometry of the system. The complex is to be processed with the BESM-6 computer, the basic programming lan-- guage is FORTRAN, volume - more than 8000 operators
Identification of a small TAF complex and its role in the assembly of TAF-containing complexes.
Demény, Màté A; Soutoglou, Evi; Nagy, Zita; Scheer, Elisabeth; Jànoshàzi, Agnes; Richardot, Magalie; Argentini, Manuela; Kessler, Pascal; Tora, Laszlo
2007-03-21
TFIID plays a role in nucleating RNA polymerase II preinitiation complex assembly on protein-coding genes. TFIID is a multisubunit complex comprised of the TATA box binding protein (TBP) and 14 TBP-associated factors (TAFs). Another class of multiprotein transcriptional regulatory complexes having histone acetyl transferase (HAT) activity, and containing TAFs, includes TFTC, STAGA and the PCAF/GCN5 complex. Looking for as yet undiscovered subunits by a proteomic approach, we had identified TAF8 and SPT7L in human TFTC preparations. Subsequently, however, we demonstrated that TAF8 was not a stable component of TFTC, but that it is present in a small TAF complex (SMAT), containing TAF8, TAF10 and SPT7L, that co-purified with TFTC. Thus, TAF8 is a subunit of both TFIID and SMAT. The latter has to be involved in a pathway of complex formation distinct from the other known TAF complexes, since these three histone fold (HF)-containing proteins (TAF8, TAF10 and SPT7L) can never be found together either in TFIID or in STAGA/TFTC HAT complexes. Here we show that TAF8 is absolutely necessary for the integration of TAF10 in a higher order TFIID core complex containing seven TAFs. TAF8 forms a heterodimer with TAF10 through its HF and proline rich domains, and also interacts with SPT7L through its C-terminal region, and the three proteins form a complex in vitro and in vivo. Thus, the TAF8-TAF10 and TAF10-SPT7L HF pairs, and also the SMAT complex, seem to be important regulators of the composition of different TFIID and/or STAGA/TFTC complexes in the nucleus and consequently may play a role in gene regulation.
Complexity science and leadership in healthcare.
Burns, J P
2001-10-01
The emerging field of complexity science offers an alternative leadership strategy for the chaotic, complex healthcare environment. A survey revealed that healthcare leaders intuitively support principles of complexity science. Leadership that uses complexity principles offers opportunities in the chaotic healthcare environment to focus less on prediction and control and more on fostering relationships and creating conditions in which complex adaptive systems can evolve to produce creative outcomes.
Complex Functions with GeoGebra
Breda, Ana Maria D'azevedo; Dos Santos, José Manuel Dos Santos
2016-01-01
Complex functions, generally feature some interesting peculiarities, seen as extensions of real functions. The visualization of complex functions properties usually requires the simultaneous visualization of two-dimensional spaces. The multiple Windows of GeoGebra, combined with its ability of algebraic computation with complex numbers, allow the…
Complex DNA structures and structures of DNA complexes
International Nuclear Information System (INIS)
Chazin, W.J.; Carlstroem, G.; Shiow-Meei Chen; Miick, S.; Gomez-Paloma, L.; Smith, J.; Rydzewski, J.
1994-01-01
Complex DNA structures (for example, triplexes, quadruplexes, junctions) and DNA-ligand complexes are more difficult to study by NMR than standard DNA duplexes are because they have high molecular weights, show nonstandard or distorted local conformations, and exhibit large resonance linewidths and severe 1 H spectral overlap. These systems also tend to have limited solubility and may require specialized solution conditions to maintain favorable spectral characteristics, which adds to the spectroscopic difficulties. Furthermore, with more atoms in the system, both assignment and structure calculation become more challenging. In this article, we focus on demonstrating the current status of NMR studies of such systems and the limitations to further progress; we also indicate in what ways isotopic enrichment can be useful
Complex DNA structures and structures of DNA complexes
Energy Technology Data Exchange (ETDEWEB)
Chazin, W.J.; Carlstroem, G.; Shiow-Meei Chen; Miick, S.; Gomez-Paloma, L.; Smith, J.; Rydzewski, J. [Scripps Research Institute, La Jolla, CA (United States)
1994-12-01
Complex DNA structures (for example, triplexes, quadruplexes, junctions) and DNA-ligand complexes are more difficult to study by NMR than standard DNA duplexes are because they have high molecular weights, show nonstandard or distorted local conformations, and exhibit large resonance linewidths and severe {sup 1}H spectral overlap. These systems also tend to have limited solubility and may require specialized solution conditions to maintain favorable spectral characteristics, which adds to the spectroscopic difficulties. Furthermore, with more atoms in the system, both assignment and structure calculation become more challenging. In this article, we focus on demonstrating the current status of NMR studies of such systems and the limitations to further progress; we also indicate in what ways isotopic enrichment can be useful.
Oligocyclopentadienyl transition metal complexes
Energy Technology Data Exchange (ETDEWEB)
de Azevedo, Cristina G.; Vollhardt, K. Peter C.
2002-01-18
Synthesis, characterization, and reactivity studies of oligocyclopentadienyl transition metal complexes, namely those of fulvalene, tercyclopentadienyl, quatercyclopentadienyl, and pentacyclopentadienyl(cyclopentadienyl) are the subject of this account. Thermal-, photo-, and redox chemistries of homo- and heteropolynuclear complexes are described.
Measuring Complexity of SAP Systems
Directory of Open Access Journals (Sweden)
Ilja Holub
2016-10-01
Full Text Available The paper discusses the reasons of complexity rise in ERP system SAP R/3. It proposes a method for measuring complexity of SAP. Based on this method, the computer program in ABAP for measuring complexity of particular SAP implementation is proposed as a tool for keeping ERP complexity under control. The main principle of the measurement method is counting the number of items or relations in the system. The proposed computer program is based on counting of records in organization tables in SAP.
Exotic plant species around Jeongeup Research Complex and RFT industrial complex
International Nuclear Information System (INIS)
Kim, Jin Kyu; Cha, Min Kyoung; Ryu, Tae Ho; Lee, Yun Jong; Kim, Jin Hong
2015-01-01
In Shinjeong-dong of Jeongeup, there are three government-supported research institutes and an RFT industrial complex which is currently being established. Increased human activities can affect flora and fauna as a man-made pressure onto the region. As a baseline study, status of exotic plants was investigated prior to a full operation of the RFT industrial complex. A total of 54 species and 1 variety of naturalized or introduced plants were found in the study area. Among them, three species (Ambrosia artemisifolia var. elatior, Rumex acetocella and Aster pilosus) belong to 'nuisance species', and four species (Phytolacca americana, Iopomoea hederacea, Ereechtites hieracifolia and Rudbeckia laciniata) to ‘monitor species’ designated by the ministry of Environment. Some of naturalized trees and plants were intentionally introduced in this area, while others naturally immigrated. Physalis angulata seems to immigrate in the study area in the form of mixture with animal feeds as its distribution coincided with the transportation route of the animal feeds. Liquidambar styraciflua is amenable to the ecological investigation on the possible expansion of the species to the nearby Naejang National Park as its leave shape and autumn color are very similar to those of maple trees. The number of naturalized plants around the RFT industrial complex will increase with an increase in floating population, in human activities in association with constructions of factories and operations of the complex. The result of this study provides baseline data for assessing the ecological change of the region according to the operation of the RFT industrial complex
Exotic plant species around Jeongeup Research Complex and RFT industrial complex
Energy Technology Data Exchange (ETDEWEB)
Kim, Jin Kyu; Cha, Min Kyoung; Ryu, Tae Ho; Lee, Yun Jong; Kim, Jin Hong [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup(Korea, Republic of)
2015-08-15
In Shinjeong-dong of Jeongeup, there are three government-supported research institutes and an RFT industrial complex which is currently being established. Increased human activities can affect flora and fauna as a man-made pressure onto the region. As a baseline study, status of exotic plants was investigated prior to a full operation of the RFT industrial complex. A total of 54 species and 1 variety of naturalized or introduced plants were found in the study area. Among them, three species (Ambrosia artemisifolia var. elatior, Rumex acetocella and Aster pilosus) belong to 'nuisance species', and four species (Phytolacca americana, Iopomoea hederacea, Ereechtites hieracifolia and Rudbeckia laciniata) to ‘monitor species’ designated by the ministry of Environment. Some of naturalized trees and plants were intentionally introduced in this area, while others naturally immigrated. Physalis angulata seems to immigrate in the study area in the form of mixture with animal feeds as its distribution coincided with the transportation route of the animal feeds. Liquidambar styraciflua is amenable to the ecological investigation on the possible expansion of the species to the nearby Naejang National Park as its leave shape and autumn color are very similar to those of maple trees. The number of naturalized plants around the RFT industrial complex will increase with an increase in floating population, in human activities in association with constructions of factories and operations of the complex. The result of this study provides baseline data for assessing the ecological change of the region according to the operation of the RFT industrial complex.
Directory of Open Access Journals (Sweden)
Shibing Wang
2016-02-01
Full Text Available This paper introduces a new memristor-based hyperchaotic complex Lü system (MHCLS and investigates its adaptive complex generalized synchronization (ACGS. Firstly, the complex system is constructed based on a memristor-based hyperchaotic real Lü system, and its properties are analyzed theoretically. Secondly, its dynamical behaviors, including hyperchaos, chaos, transient phenomena, as well as periodic behaviors, are explored numerically by means of bifurcation diagrams, Lyapunov exponents, phase portraits, and time history diagrams. Thirdly, an adaptive controller and a parameter estimator are proposed to realize complex generalized synchronization and parameter identification of two identical MHCLSs with unknown parameters based on Lyapunov stability theory. Finally, the numerical simulation results of ACGS and its applications to secure communication are presented to verify the feasibility and effectiveness of the proposed method.
Complexity of Economical Systems
Directory of Open Access Journals (Sweden)
G. P. Pavlos
2015-01-01
Full Text Available In this study new theoretical concepts are described concerning the interpretation of economical complex dynamics. In addition a summary of an extended algorithm of nonlinear time series analysis is provided which is applied not only in economical time series but also in other physical complex systems (e.g. [22, 24]. In general, Economy is a vast and complicated set of arrangements and actions wherein agents—consumers, firms, banks, investors, government agencies—buy and sell, speculate, trade, oversee, bring products into being, offer services, invest in companies, strategize, explore, forecast, compete, learn, innovate, and adapt. As a result the economic and financial variables such as foreign exchange rates, gross domestic product, interest rates, production, stock market prices and unemployment exhibit large-amplitude and aperiodic fluctuations evident in complex systems. Thus, the Economics can be considered as spatially distributed non-equilibrium complex system, for which new theoretical concepts, such as Tsallis non extensive statistical mechanics and strange dynamics, percolation, nonGaussian, multifractal and multiscale dynamics related to fractional Langevin equations can be used for modeling and understanding of the economical complexity locally or globally.
Complexity and Dynamical Depth
Directory of Open Access Journals (Sweden)
Terrence Deacon
2014-07-01
Full Text Available We argue that a critical difference distinguishing machines from organisms and computers from brains is not complexity in a structural sense, but a difference in dynamical organization that is not well accounted for by current complexity measures. We propose a measure of the complexity of a system that is largely orthogonal to computational, information theoretic, or thermodynamic conceptions of structural complexity. What we call a system’s dynamical depth is a separate dimension of system complexity that measures the degree to which it exhibits discrete levels of nonlinear dynamical organization in which successive levels are distinguished by local entropy reduction and constraint generation. A system with greater dynamical depth than another consists of a greater number of such nested dynamical levels. Thus, a mechanical or linear thermodynamic system has less dynamical depth than an inorganic self-organized system, which has less dynamical depth than a living system. Including an assessment of dynamical depth can provide a more precise and systematic account of the fundamental difference between inorganic systems (low dynamical depth and living systems (high dynamical depth, irrespective of the number of their parts and the causal relations between them.
Automated technological equipment-robot complexes
International Nuclear Information System (INIS)
Zhitomirskii, S.V.; Samorodskikh, B.L.
1984-01-01
This paper surveys the types of automated technological equipment robot complexes. The principal elements of such complexes are described. Complexes are divided into two principal groups: those using simultaneously acting robots, and those using successively acting robots. The great variety of types of robots using successive action is then described
DEFF Research Database (Denmark)
Svendsen, Idamarie Leth
2017-01-01
The article reports the findings of a qualitative study of Danish legal regulation of the public initial assessment of children and young persons and municipal practitioners’ decision-making under this regulation. The regulation mirrors new and complex relations between families and society...... in the form of 7 individual vignette interviews with municipal mid-level managers and professional consultants in five Danish municipalities. The study finds that the regulation is more complex than it looks, and that the complexity is handled through simplifying decision-making patterns that can be seen...
International Nuclear Information System (INIS)
Takacs, S.; Vasvary, L.; Tarkanyi, F.
1994-01-01
Excitation functions of proton induced reactions on nat Fe(p, xn) 56 Co have been remeasured in the energy region up to 18 MeV using stacked foil technique and standard high resolution gamma-ray spectrometry at the Debrecen MGC-20E cyclotron. Compilation of the available data measured between 1959 and 1993 has been made. The corresponding excitation functions have been reviewed, critical comparison of all the available data was done to obtain the most accurate data set. The feasibility of the evaluated data set was checked by reproducing experimental calibration curves for TLA by calculation. (orig.)
Metaheuristics progress as real problem solvers
Nonobe, Koji; Yagiura, Mutsunori
2005-01-01
Metaheuristics: Progress as Real Problem Solvers is a peer-reviewed volume of eighteen current, cutting-edge papers by leading researchers in the field. Included are an invited paper by F. Glover and G. Kochenberger, which discusses the concept of Metaheuristic agent processes, and a tutorial paper by M.G.C. Resende and C.C. Ribeiro discussing GRASP with path-relinking. Other papers discuss problem-solving approaches to timetabling, automated planograms, elevators, space allocation, shift design, cutting stock, flexible shop scheduling, colorectal cancer and cartography. A final group of methodology papers clarify various aspects of Metaheuristics from the computational view point.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHH233 (Link to dictyBase) - - - Contig-U11264-1 - (Link to Or...c08.g1 Strongyloides ratti whole genome shotgun library (SRAAGSS 004) Strongyloides ratti genomic...iginal site) - - SHH233Z 563 - - - - Show SHH233 Library SH (Link to library) Clone ID SHH233 (Link to dicty...631_5( AY458631 |pid:none) Uncultured marine bacterium 159 cl... 84 3e-15 CU92816...86F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4069772 5', mRNA sequence. 46 0.86 1 AP008210 |AP008210.1 Oryza sativa (japonica culti
Cyclomatic Complexity: theme and variations
Directory of Open Access Journals (Sweden)
Brian Henderson-Sellers
1993-11-01
Full Text Available Focussing on the "McCabe family" of measures for the decision/logic structure of a program, leads to an evaluation of extensions to modularization, nesting and, potentially, to object-oriented program structures. A comparison of rated, operating and essential complexities of programs suggests two new metrics: "inessential complexity" as a measure of unstructuredness and "product complexity" as a potential objective measure of structural complexity. Finally, nesting and abstraction levels are considered, especially as to how metrics from the "McCabe family" might be applied in an object-oriented systems development environment.
The structure of complex Lie groups
Lee, Dong Hoon
2001-01-01
Complex Lie groups have often been used as auxiliaries in the study of real Lie groups in areas such as differential geometry and representation theory. To date, however, no book has fully explored and developed their structural aspects.The Structure of Complex Lie Groups addresses this need. Self-contained, it begins with general concepts introduced via an almost complex structure on a real Lie group. It then moves to the theory of representative functions of Lie groups- used as a primary tool in subsequent chapters-and discusses the extension problem of representations that is essential for studying the structure of complex Lie groups. This is followed by a discourse on complex analytic groups that carry the structure of affine algebraic groups compatible with their analytic group structure. The author then uses the results of his earlier discussions to determine the observability of subgroups of complex Lie groups.The differences between complex algebraic groups and complex Lie groups are sometimes subtle ...
Boccara, Nino
2010-01-01
Modeling Complex Systems, 2nd Edition, explores the process of modeling complex systems, providing examples from such diverse fields as ecology, epidemiology, sociology, seismology, and economics. It illustrates how models of complex systems are built and provides indispensable mathematical tools for studying their dynamics. This vital introductory text is useful for advanced undergraduate students in various scientific disciplines, and serves as an important reference book for graduate students and young researchers. This enhanced second edition includes: . -recent research results and bibliographic references -extra footnotes which provide biographical information on cited scientists who have made significant contributions to the field -new and improved worked-out examples to aid a student’s comprehension of the content -exercises to challenge the reader and complement the material Nino Boccara is also the author of Essentials of Mathematica: With Applications to Mathematics and Physics (Springer, 2007).
Tensor Product of Polygonal Cell Complexes
Chien, Yu-Yen
2017-01-01
We introduce the tensor product of polygonal cell complexes, which interacts nicely with the tensor product of link graphs of complexes. We also develop the unique factorization property of polygonal cell complexes with respect to the tensor product, and study the symmetries of tensor products of polygonal cell complexes.
Organization structures for dealing with complexity
Meijer, B.R.
2006-01-01
"Complexity is in the eye of the beholder" is a well known quote in the research field of complexity. In the world of managers the word complex is often a synonym for difficult, complicated, involving many factors and highly uncertain. A complex business decision requires careful preparation and
Epidemic modeling in complex realities.
Colizza, Vittoria; Barthélemy, Marc; Barrat, Alain; Vespignani, Alessandro
2007-04-01
In our global world, the increasing complexity of social relations and transport infrastructures are key factors in the spread of epidemics. In recent years, the increasing availability of computer power has enabled both to obtain reliable data allowing one to quantify the complexity of the networks on which epidemics may propagate and to envision computational tools able to tackle the analysis of such propagation phenomena. These advances have put in evidence the limits of homogeneous assumptions and simple spatial diffusion approaches, and stimulated the inclusion of complex features and heterogeneities relevant in the description of epidemic diffusion. In this paper, we review recent progresses that integrate complex systems and networks analysis with epidemic modelling and focus on the impact of the various complex features of real systems on the dynamics of epidemic spreading.
Provability, complexity, grammars
Beklemishev, Lev; Vereshchagin, Nikolai
1999-01-01
The book contains English translations of three outstanding dissertations in mathematical logic and complexity theory. L. Beklemishev proves that all provability logics must belong to one of the four previously known classes. The dissertation of M. Pentus proves the Chomsky conjecture about the equivalence of two approaches to formal languages: the Chomsky hierarchy and the Lambek calculus. The dissertation of N. Vereshchagin describes a general framework for criteria of reversability in complexity theory.
Complexation and molecular modeling studies of europium(III)-gallic acid-amino acid complexes.
Taha, Mohamed; Khan, Imran; Coutinho, João A P
2016-04-01
With many metal-based drugs extensively used today in the treatment of cancer, attention has focused on the development of new coordination compounds with antitumor activity with europium(III) complexes recently introduced as novel anticancer drugs. The aim of this work is to design new Eu(III) complexes with gallic acid, an antioxida'nt phenolic compound. Gallic acid was chosen because it shows anticancer activity without harming health cells. As antioxidant, it helps to protect human cells against oxidative damage that implicated in DNA damage, cancer, and accelerated cell aging. In this work, the formation of binary and ternary complexes of Eu(III) with gallic acid, primary ligand, and amino acids alanine, leucine, isoleucine, and tryptophan was studied by glass electrode potentiometry in aqueous solution containing 0.1M NaNO3 at (298.2 ± 0.1) K. Their overall stability constants were evaluated and the concentration distributions of the complex species in solution were calculated. The protonation constants of gallic acid and amino acids were also determined at our experimental conditions and compared with those predicted by using conductor-like screening model for realistic solvation (COSMO-RS) model. The geometries of Eu(III)-gallic acid complexes were characterized by the density functional theory (DFT). The spectroscopic UV-visible and photoluminescence measurements are carried out to confirm the formation of Eu(III)-gallic acid complexes in aqueous solutions. Copyright © 2016 Elsevier Inc. All rights reserved.
Complexity factors and prediction of performance
International Nuclear Information System (INIS)
Braarud, Per Oeyvind
1998-03-01
Understanding of what makes a control room situation difficult to handle is important when studying operator performance, both with respect to prediction as well as improvement of the human performance. A factor analytic approach identified eight factors from operators' answers to an 39 item questionnaire about complexity of the operator's task in the control room. A Complexity Profiling Questionnaire was developed, based on the factor analytic results from the operators' conception of complexity. The validity of the identified complexity factors was studied by prediction of crew performance and prediction of plant performance from ratings of the complexity of scenarios. The scenarios were rated by both process experts and the operators participating in the scenarios, using the Complexity Profiling Questionnaire. The process experts' complexity ratings predicted both crew performance and plant performance, while the operators' rating predicted plant performance only. The results reported are from initial studies of complexity, and imply a promising potential for further studies of the concept. The approach used in the study as well as the reported results are discussed. A chapter about the structure of the conception of complexity, and a chapter about further research conclude the report. (author)
Neurosurgical implications of Carney complex.
Watson, J C; Stratakis, C A; Bryant-Greenwood, P K; Koch, C A; Kirschner, L S; Nguyen, T; Carney, J A; Oldfield, E H
2000-03-01
The authors present their neurosurgical experience with Carney complex. Carney complex, characterized by spotty skin pigmentation, cardiac myxomas, primary pigmented nodular adrenocortical disease, pituitary tumors, and nerve sheath tumors (NSTs), is a recently described, rare, autosomal-dominant familial syndrome that is relatively unknown to neurosurgeons. Neurosurgery is required to treat pituitary adenomas and a rare NST, the psammomatous melanotic schwannoma (PMS), in patients with Carney complex. Cushing's syndrome, a common component of the complex, is caused by primary pigmented nodular adrenocortical disease and is not secondary to an adrenocorticotropic hormone-secreting pituitary adenoma. The authors reviewed 14 cases of Carney complex, five from the literature and nine from their own experience. Of the 14 pituitary adenomas recognized in association with Carney complex, 12 developed growth hormone (GH) hypersecretion (producing gigantism in two patients and acromegaly in 10), and results of immunohistochemical studies in one of the other two were positive for GH. The association of PMSs with Carney complex was established in 1990. Of the reported tumors, 28% were associated with spinal nerve sheaths. The spinal tumors occurred in adults (mean age 32 years, range 18-49 years) who presented with pain and radiculopathy. These NSTs may be malignant (10%) and, as with the cardiac myxomas, are associated with significant rates of morbidity and mortality. Because of the surgical comorbidity associated with cardiac myxoma and/or Cushing's syndrome, recognition of Carney complex has important implications for perisurgical patient management and family screening. Study of the genetics of Carney complex and of the biological abnormalities associated with the tumors may provide insight into the general pathobiological abnormalities associated with the tumors may provide insight into the general pathobiological features of pituitary adenomas and NSTs.
Is dense codeswitching complex?
Dorleijn, M.
In this paper the question is raised to what extent dense code switching can be considered complex. Psycholinguistic experiments indicate that code switching involves cognitive costs, both in production and comprehension, a conclusion that could indicate that code switching is indeed complex. In
Ternary complex formation at mineral/solution interfaces
International Nuclear Information System (INIS)
Leckie, J.O.
1995-01-01
Adsorption of trace concentrations of radionuclides and heavy metals from aqueous solution is dependent on pH, absorbent and adsorbate concentration, and speciation of the metal in solution. In particular, complexation of metal ions by organic and inorganic ligands can dramatically alter adsorption behavior compared to ligand-free systems. The presence of complexing ligands can cause the formation of ''metal like'' or ''ligand like'' ternary surface complexes depending on whether adsorption of the ternary complex increases or decreases with increasing pH, respectively. Examples of ternary surface complexes behaving ''metal like'' include uranyl-EDTA surface complexes on goethite, neptunyl-EDTA surface complexes on hematite and neptunyl-humic surface complexes on gibbsite. Examples of ''ligand like'' ternary surface complexes include uranyl-carbonato and neptunyl-carbonato surface complexes on iron oxides. The effects of complex solutions and multimineralic systems are discussed. (authors). 39 refs., 16 figs., 8 tabs
Information geometric methods for complexity
Felice, Domenico; Cafaro, Carlo; Mancini, Stefano
2018-03-01
Research on the use of information geometry (IG) in modern physics has witnessed significant advances recently. In this review article, we report on the utilization of IG methods to define measures of complexity in both classical and, whenever available, quantum physical settings. A paradigmatic example of a dramatic change in complexity is given by phase transitions (PTs). Hence, we review both global and local aspects of PTs described in terms of the scalar curvature of the parameter manifold and the components of the metric tensor, respectively. We also report on the behavior of geodesic paths on the parameter manifold used to gain insight into the dynamics of PTs. Going further, we survey measures of complexity arising in the geometric framework. In particular, we quantify complexity of networks in terms of the Riemannian volume of the parameter space of a statistical manifold associated with a given network. We are also concerned with complexity measures that account for the interactions of a given number of parts of a system that cannot be described in terms of a smaller number of parts of the system. Finally, we investigate complexity measures of entropic motion on curved statistical manifolds that arise from a probabilistic description of physical systems in the presence of limited information. The Kullback-Leibler divergence, the distance to an exponential family and volumes of curved parameter manifolds, are examples of essential IG notions exploited in our discussion of complexity. We conclude by discussing strengths, limits, and possible future applications of IG methods to the physics of complexity.
European Conference on Complex Systems 2012
Kirkilionis, Markus; Nicolis, Gregoire
2013-01-01
The European Conference on Complex Systems, held under the patronage of the Complex Systems Society, is an annual event that has become the leading European conference devoted to complexity science. ECCS'12, its ninth edition, took place in Brussels, during the first week of September 2012. It gathered about 650 scholars representing a wide range of topics relating to complex systems research, with emphasis on interdisciplinary approaches. More specifically, the following tracks were covered: 1. Foundations of Complex Systems 2. Complexity, Information and Computation 3. Prediction, Policy and Planning, Environment 4. Biological Complexity 5. Interacting Populations, Collective Behavior 6. Social Systems, Economics and Finance This book contains a selection of the contributions presented at the conference and its satellite meetings. Its contents reflect the extent, diversity and richness of research areas in the field, both fundamental and applied.
Influence of Hydrophobicity on Polyelectrolyte Complexation
Energy Technology Data Exchange (ETDEWEB)
Sadman, Kazi [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Wang, Qifeng [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Chen, Yaoyao [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Keshavarz, Bavand [Department; Jiang, Zhang [X-ray; Shull, Kenneth R. [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States
2017-11-16
Polyelectrolyte complexes are a fascinating class of soft materials that can span the full spectrum of mechanical properties from low viscosity fluids to glassy solids. This spectrum can be accessed by modulating the extent of electrostatic association in these complexes. However, to realize the full potential of polyelectrolyte complexes as functional materials their molecular level details need to be clearly correlated with their mechanical response. The present work demonstrates that by making simple amendments to the chain architecture it is possible to affect the salt responsiveness of polyelectrolyte complexes in a systematic manner. This is achieved by quaternizing poly(4-vinylpyridine) (QVP) with methyl, ethyl and propyl substituents– thereby increasing the hydrophobicity with increasing side chain length– and complexing them with a common anionic polyelectrolyte, poly(styrene sulfonate). The mechanical 1 ACS Paragon Plus Environment behavior of these complexes is compared to the more hydrophilic system of poly(styrene sulfonate) and poly(diallyldimethylammonium) by quantifying the swelling behavior in response to salt stimuli. More hydrophobic complexes are found to be more resistant to doping by salt, yet the mechanical properties of the complex remain contingent on the overall swelling ratio of the complex itself, following near universal swelling-modulus master curves that are quantified in this work. The rheological behavior of QVP complex coacervates are found to be approximately the same, only requiring higher salt concentrations to overcome strong hydrophobic interactions, demonstrating that hydrophobicity can be used as an important parameter for tuning the stability of polyelectrolyte complexes in general, while still preserving the ability to be processed “saloplastically”.
Complexity leadership: a healthcare imperative.
Weberg, Dan
2012-01-01
The healthcare system is plagued with increasing cost and poor quality outcomes. A major contributing factor for these issues is that outdated leadership practices, such as leader-centricity, linear thinking, and poor readiness for innovation, are being used in healthcare organizations. Complexity leadership theory provides a new framework with which healthcare leaders may practice leadership. Complexity leadership theory conceptualizes leadership as a continual process that stems from collaboration, complex systems thinking, and innovation mindsets. Compared to transactional and transformational leadership concepts, complexity leadership practices hold promise to improve cost and quality in health care. © 2012 Wiley Periodicals, Inc.
COMPLEX TRAINING: A BRIEF REVIEW
Directory of Open Access Journals (Sweden)
William P. Ebben
2002-06-01
Full Text Available The effectiveness of plyometric training is well supported by research. Complex training has gained popularity as a training strategy combining weight training and plyometric training. Anecdotal reports recommend training in this fashion in order to improve muscular power and athletic performance. Recently, several studies have examined complex training. Despite the fact that questions remain about the potential effectiveness and implementation of this type of training, results of recent studies are useful in guiding practitioners in the development and implementation of complex training programs. In some cases, research suggests that complex training has an acute ergogenic effect on upper body power and the results of acute and chronic complex training include improved jumping performance. Improved performance may require three to four minutes rest between the weight training and plyometrics sets and the use of heavy weight training loads
European Conference on Complex Systems
Pellegrini, Francesco; Caldarelli, Guido; Merelli, Emanuela
2016-01-01
This work contains a stringent selection of extended contributions presented at the meeting of 2014 and its satellite meetings, reflecting scope, diversity and richness of research areas in the field, both fundamental and applied. The ECCS meeting, held under the patronage of the Complex Systems Society, is an annual event that has become the leading European conference devoted to complexity science. It offers cutting edge research and unique opportunities to study novel scientific approaches in a multitude of application areas. ECCS'14, its eleventh occurrence, took place in Lucca, Italy. It gathered some 650 scholars representing a wide range of topics relating to complex systems research, with emphasis on interdisciplinary approaches. The editors are among the best specialists in the area. The book is of great interest to scientists, researchers and graduate students in complexity, complex systems and networks.
The Seis Lagos Carbonatite Complex
International Nuclear Information System (INIS)
Issler, R.S.; Silva, G.G. da.
1980-01-01
The Seis Lagos Carbonatite Complex located about 840 Km from Manaus, on the northwestern part of the Estado do Amazonas, Brazil is described. Geological reconnaissance mapping by Radam Project/DNPM, of the southwestern portion of the Guianes Craton, determined three circular features arranged in a north-south trend and outcroping as thick lateritic radioactive hills surrounded by gneisses and mignatites of the peneplained Guianense Complex. Results of core drilling samples analysis of the Seis Lagos Carbonatite Complex are compared with some igneous rocks and limestones of the world on the basis of abundance of their minor and trace elements. Log-log variation diagram of strontium and barium in carbonatite and limestone, exemplifield by South Africa and Angola carbonatites, are compared with the Seis Lagos Carbonatite Complex. The Seis Lagos Carbonatite Complex belongs to the siderite-soevite type. (E.G.) [pt
Energy Technology Data Exchange (ETDEWEB)
Chuang, Wu-yen; Kachru, Shamit; /Stanford U., ITP /SLAC; Tomasiello, Alessandro; /Stanford U., ITP
2005-10-28
We construct a class of symplectic non-Kaehler and complex non-Kaehler string theory vacua, extending and providing evidence for an earlier suggestion by Polchinski and Strominger. The class admits a mirror pairing by construction. Comparing hints from a variety of sources, including ten-dimensional supergravity and KK reduction on SU(3)-structure manifolds, suggests a picture in which string theory extends Reid's fantasy to connect classes of both complex non-Kaehler and symplectic non-Kaehler manifolds.
Disentangling Complexity from Randomness and Chaos
Directory of Open Access Journals (Sweden)
Lena C. Zuchowski
2012-02-01
Full Text Available This study aims to disentangle complexity from randomness and chaos, and to present a definition of complexity that emphasizes its epistemically distinct qualities. I will review existing attempts at defining complexity and argue that these suffer from two major faults: a tendency to neglect the underlying dynamics and to focus exclusively on the phenomenology of complex systems; and linguistic imprecisions in describing these phenomenologies. I will argue that the tendency to discuss phenomenology removed from the underlying dynamics is the main root of the difficulties in distinguishing complex from chaotic or random systems. In my own definition, I will explicitly try to avoid these pitfalls. The theoretical contemplations in this paper will be tested on a sample of five models: the random Kac ring, the chaotic CA30, the regular CA90, the complex CA110 and the complex Bak-Sneppen model. Although these modelling studies are restricted in scope and can only be seen as preliminary, they still constitute on of the first attempts to investigate complex systems comparatively.
Extending Life Concepts to Complex Systems
Directory of Open Access Journals (Sweden)
Jean Le Fur
2013-01-01
Full Text Available There is still no consensus definition of complex systems. This article explores, as a heuristic approach, the possibility of using notions associated with life as transversal concepts for defining complex systems. This approach is developed within a general classification of systems, with complex systems considered as a general ‘living things’ category and living organisms as a specialised class within this category. Concepts associated with life are first explored in the context of complex systems: birth, death and lifetime, adaptation, ontogeny and growth, reproduction. Thereafter, a refutation approach is used to test the proposed classification against a set of diverse systems, including a reference case, edge cases and immaterial complex systems. The summary of this analysis is then used to generate a definition of complex systems, based on the proposal, and within the background of cybernetics, complex adaptive systems and biology. Using notions such as ‘birth’ or ‘lifespan’ as transversal concepts may be of heuristic value for the generic characterization of complex systems, opening up new lines of research for improving their definition.
Riesová, Martina; Svobodová, Jana; Tošner, Zdeněk; Beneš, Martin; Tesařová, Eva; Gaš, Bohuslav
2013-09-17
The complexation of buffer constituents with the complexation agent present in the solution can very significantly influence the buffer properties, such as pH, ionic strength, or conductivity. These parameters are often crucial for selection of the separation conditions in capillary electrophoresis or high-pressure liquid chromatography (HPLC) and can significantly affect results of separation, particularly for capillary electrophoresis as shown in Part II of this paper series (Beneš, M.; Riesová, M.; Svobodová, J.; Tesařová, E.; Dubský, P.; Gaš, B. Anal. Chem. 2013, DOI: 10.1021/ac401381d). In this paper, the impact of complexation of buffer constituents with a neutral complexation agent is demonstrated theoretically as well as experimentally for the model buffer system composed of benzoic acid/LiOH or common buffers (e.g., CHES/LiOH, TAPS/LiOH, Tricine/LiOH, MOPS/LiOH, MES/LiOH, and acetic acid/LiOH). Cyclodextrins as common chiral selectors were used as model complexation agents. We were not only able to demonstrate substantial changes of pH but also to predict the general complexation characteristics of selected compounds. Because of the zwitterion character of the common buffer constituents, their charged forms complex stronger with cyclodextrins than the neutral ones do. This was fully proven by NMR measurements. Additionally complexation constants of both forms of selected compounds were determined by NMR and affinity capillary electrophoresis with a very good agreement of obtained values. These data were advantageously used for the theoretical descriptions of variations in pH, depending on the composition and concentration of the buffer. Theoretical predictions were shown to be a useful tool for deriving some general rules and laws for complexing systems.
Vaquero, Vanesa; Sanz, M Eugenia; Peña, Isabel; Mata, Santiago; Cabezas, Carlos; López, Juan C; Alonso, José L
2014-04-10
Two complexes of alanine with water, alanine-(H2O)n (n = 1,2), have been generated by laser ablation of the amino acid in a supersonic jet containing water vapor and characterized using Fourier transform microwave spectroscopy. In the observed complexes, water molecules bind to the carboxylic group of alanine acting as both proton donors and acceptors. In alanine-H2O, the water molecule establishes two intermolecular hydrogen bonds forming a six-membered cycle, while in alanine-(H2O)2 the two water molecules establish three hydrogen bonds forming an eight-membered ring. In both complexes, the amino acid moiety is in its neutral form and shows the conformation observed to be the most stable for the bare molecule. The microsolvation study of alanine-(H2O)n (n = 1,2) can be taken as a first step toward understanding bulk properties at a microscopic level.
Solution chemistry of lanthanide complexes
International Nuclear Information System (INIS)
Brittain, H.G.
1979-01-01
Intermolecular energy transfer from Tb 3+ to Eu 3+ , luminescence intensity measurements, potentiometric titrations, differential absorption spectroscopy, and spectroscopic titrations were all used to study the binding of lanthanide ions by serine and threonine. At low pH (3.0 to 6.0) the complexes are mononuclear and ligand is only weakly bound. In the pH interval of 6.0 to 8.5 stronger interaction takes place between the ligand and the metal (with possible coordination of the undissociated hydroxyl group), and self-association of complexes becomes important. Above pH 8.5, base hydrolysis of the complexes leads to highly associated species in solution and shortly above this pH an insoluble precipitate is formed. It was found that energy could be transferred from Tb 3+ to Eu 3+ more efficiently among complexes prepared from racemic ligands than in complexes made from resolved ligand, but this stereoselectivity was only observed at pH values greater than 6.5 and in solutions having a 1:10 ratio of metal-to-ligand. No stereoselectivity was found in solutions having 1:5 ratios, and this observation was explained by the existence of 1:2 metal-ligand complexes existing in solutions having the higher ratio of metal-to-ligand (only 1:1 complexes are then found at lower ratios of metal-to-ligand). (author)
Apelian, Christopher; Taft, Earl; Nashed, Zuhair
2009-01-01
The Spaces R, Rk, and CThe Real Numbers RThe Real Spaces RkThe Complex Numbers CPoint-Set Topology Bounded SetsClassification of Points Open and Closed SetsNested Intervals and the Bolzano-Weierstrass Theorem Compactness and Connectedness Limits and Convergence Definitions and First Properties Convergence Results for SequencesTopological Results for Sequences Properties of Infinite SeriesManipulations of Series in RFunctions: Definitions and Limits DefinitionsFunctions as MappingsSome Elementary Complex FunctionsLimits of FunctionsFunctions: Continuity and Convergence Continuity Uniform Continuity Sequences and Series of FunctionsThe DerivativeThe Derivative for f: D1 → RThe Derivative for f: Dk → RThe Derivative for f: Dk → RpThe Derivative for f: D → CThe Inverse and Implicit Function TheoremsReal IntegrationThe Integral of f: [a, b] → RProperties of the Riemann Integral Further Development of Integration TheoryVector-Valued and Line IntegralsComplex IntegrationIntroduction to Complex Integrals Fu...
Unifying Complexity and Information
Ke, Da-Guan
2013-04-01
Complex systems, arising in many contexts in the computer, life, social, and physical sciences, have not shared a generally-accepted complexity measure playing a fundamental role as the Shannon entropy H in statistical mechanics. Superficially-conflicting criteria of complexity measurement, i.e. complexity-randomness (C-R) relations, have given rise to a special measure intrinsically adaptable to more than one criterion. However, deep causes of the conflict and the adaptability are not much clear. Here I trace the root of each representative or adaptable measure to its particular universal data-generating or -regenerating model (UDGM or UDRM). A representative measure for deterministic dynamical systems is found as a counterpart of the H for random process, clearly redefining the boundary of different criteria. And a specific UDRM achieving the intrinsic adaptability enables a general information measure that ultimately solves all major disputes. This work encourages a single framework coving deterministic systems, statistical mechanics and real-world living organisms.
Workspace Program for Complex-Number Arithmetic
Patrick, M. C.; Howell, Leonard W., Jr.
1986-01-01
COMPLEX is workspace program designed to empower APL with complexnumber capabilities. Complex-variable methods provide analytical tools invaluable for applications in mathematics, science, and engineering. COMPLEX written in APL.
Is a "Complex" Task Really Complex? Validating the Assumption of Cognitive Task Complexity
Sasayama, Shoko
2016-01-01
In research on task-based learning and teaching, it has traditionally been assumed that differing degrees of cognitive task complexity can be inferred through task design and/or observations of differing qualities in linguistic production elicited by second language (L2) communication tasks. Without validating this assumption, however, it is…
Linearization Method and Linear Complexity
Tanaka, Hidema
We focus on the relationship between the linearization method and linear complexity and show that the linearization method is another effective technique for calculating linear complexity. We analyze its effectiveness by comparing with the logic circuit method. We compare the relevant conditions and necessary computational cost with those of the Berlekamp-Massey algorithm and the Games-Chan algorithm. The significant property of a linearization method is that it needs no output sequence from a pseudo-random number generator (PRNG) because it calculates linear complexity using the algebraic expression of its algorithm. When a PRNG has n [bit] stages (registers or internal states), the necessary computational cost is smaller than O(2n). On the other hand, the Berlekamp-Massey algorithm needs O(N2) where N(≅2n) denotes period. Since existing methods calculate using the output sequence, an initial value of PRNG influences a resultant value of linear complexity. Therefore, a linear complexity is generally given as an estimate value. On the other hand, a linearization method calculates from an algorithm of PRNG, it can determine the lower bound of linear complexity.
Revil, A.; Coperey, A.; Shao, Z.; Florsch, N.; Fabricus, I.L.; Deng, Y.; Delsman, J.R.; Pauw, P.S.; Karaoulis, M.; Louw, P.G.B. de; Baaren, E.S. van; Dabekaussen, W.; Menkovic, A.; Gunnink, J.L.
2017-01-01
The complex conductivity of soils remains poorly known despite the growing importance of this method in hydrogeophysics. In order to fill this gap of knowledge, we investigate the complex conductivity of 71 soils samples (including four peat samples) and one clean sand in the frequency range 0.1 Hz
Complexity Metrics for Workflow Nets
DEFF Research Database (Denmark)
Lassen, Kristian Bisgaard; van der Aalst, Wil M.P.
2009-01-01
analysts have difficulties grasping the dynamics implied by a process model. Recent empirical studies show that people make numerous errors when modeling complex business processes, e.g., about 20 percent of the EPCs in the SAP reference model have design flaws resulting in potential deadlocks, livelocks......, etc. It seems obvious that the complexity of the model contributes to design errors and a lack of understanding. It is not easy to measure complexity, however. This paper presents three complexity metrics that have been implemented in the process analysis tool ProM. The metrics are defined...... for a subclass of Petri nets named Workflow nets, but the results can easily be applied to other languages. To demonstrate the applicability of these metrics, we have applied our approach and tool to 262 relatively complex Protos models made in the context of various student projects. This allows us to validate...
International Nuclear Information System (INIS)
Drabant, B.; Schlieker, M.
1993-01-01
The complex quantum groups are constructed. They are q-deformations of the real Lie groups which are obtained as the complex groups corresponding to the Lie algebras of type A n-1 , B n , C n . Following the ideas of Faddeev, Reshetikhin and Takhtajan Hopf algebras of regular functionals U R for these complexified quantum groups are constructed. One has thus in particular found a construction scheme for the q-Lorentz algebra to be identified as U(sl q (2,C). (orig.)
Complexity Intelligence and Cultural Coaching:
Directory of Open Access Journals (Sweden)
Jan Inglis
2005-06-01
Full Text Available In this article, we present the term complexity intelligence as a useful moniker to describe the reasoning ability, emotional capacity and social cognition necessary to meet the challenges of our prevailing life conditions. We suggest that, as a society and as individuals, we develop complexity intelligence as we navigate the gap between our current capacities and the capacities needed to respond to the next stage of complex challenges in our lives. We further suggest that it is possible to stimulate and support the emergence of complexity intelligence in a society, but we need a new form of social change agent - a cultural coach, to midwife its emergence.
Complex manifolds in relativity
International Nuclear Information System (INIS)
Flaherty, E.J. Jr.
1975-01-01
Complex manifold theory is applied to the study of certain problems in general relativity. The first half of the work is devoted to the mathematical theory of complex manifold. Then a brief review of general relativity is given. It is shown that any spacetime admits locally an almost Hermitian structure, suitably modified to be compatible with the indefinite metric of spacetime. This structure is integrable if and only if the spacetime admits two geodesic and shearfree null congruences, thus in particular if the spacetime is type D vacuum or electrified. The structure is ''half-integrable'' in a suitable sense if and only if the spacetime admits one geodesic and shearfree null congruence, thus in particular for all algebraically special vacuum spacetimes. Conditions for the modified Hermitian spacetime to be Kahlerian are presented. The most general metric for such a modified Kahlerian spacetime is found. It is shown that the type D vacuum and electrified spacetimes are conformally related to modified Kahlerian spacetimes by a generally complex conformal factor. These latter are shown to possess a very rich structure, including the existence of Killing tensors and Killing vectors. A new ''explanation'' of Newman's complex coordinate transformations is given. It is felt to be superior to previous ''explanations'' on several counts. For example, a physical interpretation in terms of a symmetry group is given. The existence of new complex coordinate transformations is established: Nt is shown that any type D vacuum spacetime is obtainable from either Schwarzschild spacetime or ''C'' spacetime by a complex coordinate transformation. Finally, some related topics are discussed and areas for future work are outlined. (Diss. Abstr. Int., B)
Leadership and transitions: maintaining the science in complexity and complex systems.
Sturmberg, Joachim P; Martin, Carmel M
2012-02-01
It is the 'moral compass', however subtle, that underpins leadership. Leadership, meaning showing the way, demands as much conviction as gentile diplomacy in the discourse with supporters and detractors. In particular, leadership defends the goal by safeguarding its principles from its detractors. The authors writing in the Forum on Complexity in Medicine and Healthcare since its inception are leaders in an intellectual transition to complex systems thinking in medicine and health. © 2012 Blackwell Publishing Ltd.
Stålne, Kristian; Kjellström, Sofia; Utriainen, Jukka
2016-01-01
An important aspect of higher education is to educate students who can manage complex relationships and solve complex problems. Teachers need to be able to evaluate course content with regard to complexity, as well as evaluate students' ability to assimilate complex content and express it in the form of a learning outcome. One model for evaluating…
Managing and engineering in complex situations
Sousa-Poza, Andres
2013-01-01
With so many terms available to define the same thing, it would seem nearly irresponsible to introduce yet another term (complex situation) to describe a phenomenological state of such as a system. However, a complex situation infers both a broader meaning and imposes a different perspective. Complex in this context is dependent on understanding and reality rather than observer and knowledge. Situation imposes a gestalt that cannot be characterized within a singular perspective that relegates paradox to a superior/subordinate hierarchy. This also infers that complex situation has no monotonic definition or each definition is by default incomplete. Therefore the perennial derivations for systems such as complex systems, system of systems, federation of systems is no longer a sufficient descriptor for complex situation. Ergo system and its genealogy lack the constitution to define complex situations. The books' intent is to explore this pathology through a series of papers written by authors that work in ...
Complexation of carboxylate on smectite surfaces.
Liu, Xiandong; Lu, Xiancai; Zhang, Yingchun; Zhang, Chi; Wang, Rucheng
2017-07-19
We report a first principles molecular dynamics (FPMD) study of carboxylate complexation on clay surfaces. By taking acetate as a model carboxylate, we investigate its inner-sphere complexes adsorbed on clay edges (including (010) and (110) surfaces) and in interlayer space. Simulations show that acetate forms stable monodentate complexes on edge surfaces and a bidentate complex with Ca 2+ in the interlayer region. The free energy calculations indicate that the complexation on edge surfaces is slightly more stable than in interlayer space. By integrating pK a s and desorption free energies of Al coordinated water calculated previously (X. Liu, X. Lu, E. J. Meijer, R. Wang and H. Zhou, Geochim. Cosmochim. Acta, 2012, 81, 56-68; X. Liu, J. Cheng, M. Sprik, X. Lu and R. Wang, Geochim. Cosmochim. Acta, 2014, 140, 410-417), the pH dependence of acetate complexation has been revealed. It shows that acetate forms inner-sphere complexes on (110) in a very limited mildly acidic pH range while it can complex on (010) in the whole common pH range. The results presented in this study form a physical basis for understanding the geochemical processes involving clay-organics interactions.
An index of floodplain surface complexity
Scown, Murray W.; Thoms, Martin C.; DeJager, Nathan R.
2016-01-01
Floodplain surface topography is an important component of floodplain ecosystems. It is the primary physical template upon which ecosystem processes are acted out, and complexity in this template can contribute to the high biodiversity and productivity of floodplain ecosystems. There has been a limited appreciation of floodplain surface complexity because of the traditional focus on temporal variability in floodplains as well as limitations to quantifying spatial complexity. An index of floodplain surface complexity (FSC) is developed in this paper and applied to eight floodplains from different geographic settings. The index is based on two key indicators of complexity, variability in surface geometry (VSG) and the spatial organisation of surface conditions (SPO), and was determined at three sampling scales. FSC, VSG, and SPO varied between the eight floodplains and these differences depended upon sampling scale. Relationships between these measures of spatial complexity and seven geomorphological and hydrological drivers were investigated. There was a significant decline in all complexity measures with increasing floodplain width, which was explained by either a power, logarithmic, or exponential function. There was an initial rapid decline in surface complexity as floodplain width increased from 1.5 to 5 km, followed by little change in floodplains wider than 10 km. VSG also increased significantly with increasing sediment yield. No significant relationships were determined between any of the four hydrological variables and floodplain surface complexity.
Moessbauer study of iron-sugar complexes
International Nuclear Information System (INIS)
Tonkovic, M.; Music, S.; Hadzija, O.; Nagy-Czako, I.; Vertes, A.
1982-01-01
Ferric-fructose complex has been prepared using FeCl 3 and Fe(NO 3 ) 3 solutions. Molecular weight determination and Moessbauer spectroscopic measurements proved that the ferric-fructose complex is polymeric in solid state and also in aqueous solution. The synthesis of a new iron-sorbose complex has been performed. Its Moessbauer spectra indicate a structure similar to that of the iron-fructose complex. (author)
Energy Technology Data Exchange (ETDEWEB)
Park, Jin Kyun; Jeong, Kwang Sup; Jung, Won Dea [KAERI, Taejon (Korea, Republic of)
2004-07-01
In complex systems, it is well recognized that the provision of understandable procedures that allow operators to clarify 'what needs to be done' and 'how to do it' is one of the requisites to confirm their safety. In this regard, the step complexity (SC) measure that can quantify the complexity of procedural steps in emergency operating procedures (EOPs) of a nuclear power plant (NPP) was suggested. However, the necessity of additional complexity factors that can consider a cognitive aspect in evaluating the complexity of procedural steps is evinced from the comparisons between SC scores and operators' performance data. To this end, the comparisons between operators' performance data with their behavior in conducting prescribed activities of procedural steps are conducted in this study. As a result, two kinds of complexity factors (the abstraction level of knowledge and the level of engineering decision) that could affect operators' cognitive burden are identified. Although a well-designed experiment is indispensable in confirming the appropriateness of cognitive complexity factors, it is strongly believed that the change of an operator's performance can be more authentically explained if they are taken into consideration.
International Nuclear Information System (INIS)
Park, Jin Kyun; Jeong, Kwang Sup; Jung, Won Dea
2004-01-01
In complex systems, it is well recognized that the provision of understandable procedures that allow operators to clarify 'what needs to be done' and 'how to do it' is one of the requisites to confirm their safety. In this regard, the step complexity (SC) measure that can quantify the complexity of procedural steps in emergency operating procedures (EOPs) of a nuclear power plant (NPP) was suggested. However, the necessity of additional complexity factors that can consider a cognitive aspect in evaluating the complexity of procedural steps is evinced from the comparisons between SC scores and operators' performance data. To this end, the comparisons between operators' performance data with their behavior in conducting prescribed activities of procedural steps are conducted in this study. As a result, two kinds of complexity factors (the abstraction level of knowledge and the level of engineering decision) that could affect operators' cognitive burden are identified. Although a well-designed experiment is indispensable in confirming the appropriateness of cognitive complexity factors, it is strongly believed that the change of an operator's performance can be more authentically explained if they are taken into consideration
Three perspectives on complexity: entropy, compression, subsymmetry
Nagaraj, Nithin; Balasubramanian, Karthi
2017-12-01
There is no single universally accepted definition of `Complexity'. There are several perspectives on complexity and what constitutes complex behaviour or complex systems, as opposed to regular, predictable behaviour and simple systems. In this paper, we explore the following perspectives on complexity: effort-to-describe (Shannon entropy H, Lempel-Ziv complexity LZ), effort-to-compress (ETC complexity) and degree-of-order (Subsymmetry or SubSym). While Shannon entropy and LZ are very popular and widely used, ETC is relatively a new complexity measure. In this paper, we also propose a novel normalized complexity measure SubSym based on the existing idea of counting the number of subsymmetries or palindromes within a sequence. We compare the performance of these complexity measures on the following tasks: (A) characterizing complexity of short binary sequences of lengths 4 to 16, (B) distinguishing periodic and chaotic time series from 1D logistic map and 2D Hénon map, (C) analyzing the complexity of stochastic time series generated from 2-state Markov chains, and (D) distinguishing between tonic and irregular spiking patterns generated from the `Adaptive exponential integrate-and-fire' neuron model. Our study reveals that each perspective has its own advantages and uniqueness while also having an overlap with each other.
Ellis, Jim
1977-01-01
The Parks and Recreation Department of Montgomery, Alabama, has developed a five-field softball complex as part of a growing community park with facilities for camping, golf, aquatics, tennis, and picnicking. (MJB)
Complex centers of polynomial differential equations
Directory of Open Access Journals (Sweden)
Mohamad Ali M. Alwash
2007-07-01
Full Text Available We present some results on the existence and nonexistence of centers for polynomial first order ordinary differential equations with complex coefficients. In particular, we show that binomial differential equations without linear terms do not have complex centers. Classes of polynomial differential equations, with more than two terms, are presented that do not have complex centers. We also study the relation between complex centers and the Pugh problem. An algorithm is described to solve the Pugh problem for equations without complex centers. The method of proof involves phase plane analysis of the polar equations and a local study of periodic solutions.
International Nuclear Information System (INIS)
Braendas, E.
1986-01-01
The method of complex scaling is taken to include bound states, resonances, remaining scattering background and interference. Particular points of the general complex coordinate formulation are presented. It is shown that care must be exercised to avoid paradoxical situations resulting from inadequate definitions of operator domains. A new resonance localization theorem is presented
Calculated Electronic Behavior and Spectrum of Mg+@C60 Using a Simple Jellium-shell Model
Directory of Open Access Journals (Sweden)
H. A. Schuessler
2004-11-01
Full Text Available Abstract: We present a method for calculating the energy levels and wave functions of any atom or ion with a single valence electron encapsulated in a Fullerene cage using a jelluim-shell model. The valence electron-core interaction is represented by a one-body pseudo-potential obtained through density functional theory with strikingly accurate parameters for Mg+ and which reduces to a purely Coulombic interaction in the case of H. We find that most energy states are affected little by encapsulation. However, when either the electron in the non-encapsulated species has a high probability of being near the jellium cage, or when the cage induces a maximum electron probability density within it, the energy levels shift considerably. Mg+ shows behavior similar to that of H, but since its wave functions are broader, the changes in its energy levels from encapsulation are slightly more pronounced. Agreement with other computational work as well as experiment is excellent and the method presented here is generalizable to any encapsulated species where a one-body electronic pseudo-potential for the free atom (or ion is available. Results are also presented for off-center hydrogen, where a ground state energy minimum of -14.01 eV is found at a nuclear displacement of around 0.1 Å.
Donderi, Don C.
2006-01-01
The idea of visual complexity, the history of its measurement, and its implications for behavior are reviewed, starting with structuralism and Gestalt psychology at the beginning of the 20th century and ending with visual complexity theory, perceptual learning theory, and neural circuit theory at the beginning of the 21st. Evidence is drawn from…
Simple, complex and hyper-complex understanding - enhanced sensitivity in observation of information
DEFF Research Database (Denmark)
Bering Keiding, Tina
for construction and analysis of empirical information. A quick overview on empirical research drawing on Luhmann reveals a diverse complex of analytical strategies and empirical methods. Despite differences between strategies and methods they have in common that understanding of uttered information is crucial...... in their production of empirically founded knowledge. However research generally seems to pay more attention to production of uttered information than to selection of understanding. The aim of this contribution is to sketch out a suggestion to how selection of understanding can be systematized in order to produce...... enhanced transparency in selection of understanding as well as enhanced sensitivity and definition in dept. The contribution suggest that we distinguish between three types of understanding; simple, complex and hyper-complex understanding. Simple understanding is the simultaneous selection of understanding...
Complex Polynomial Vector Fields
DEFF Research Database (Denmark)
Dias, Kealey
vector fields. Since the class of complex polynomial vector fields in the plane is natural to consider, it is remarkable that its study has only begun very recently. There are numerous fundamental questions that are still open, both in the general classification of these vector fields, the decomposition...... of parameter spaces into structurally stable domains, and a description of the bifurcations. For this reason, the talk will focus on these questions for complex polynomial vector fields.......The two branches of dynamical systems, continuous and discrete, correspond to the study of differential equations (vector fields) and iteration of mappings respectively. In holomorphic dynamics, the systems studied are restricted to those described by holomorphic (complex analytic) functions...
Encyclopedia of Complexity and Systems Science
Meyers, Robert A
2009-01-01
Encyclopedia of Complexity and Systems Science provides an authoritative single source for understanding and applying the concepts of complexity theory together with the tools and measures for analyzing complex systems in all fields of science and engineering. The science and tools of complexity and systems science include theories of self-organization, complex systems, synergetics, dynamical systems, turbulence, catastrophes, instabilities, nonlinearity, stochastic processes, chaos, neural networks, cellular automata, adaptive systems, and genetic algorithms. Examples of near-term problems and major unknowns that can be approached through complexity and systems science include: The structure, history and future of the universe; the biological basis of consciousness; the integration of genomics, proteomics and bioinformatics as systems biology; human longevity limits; the limits of computing; sustainability of life on earth; predictability, dynamics and extent of earthquakes, hurricanes, tsunamis, and other n...
Epidemic processes in complex networks
Pastor Satorras, Romualdo; Castellano, Claudio; Van Mieghem, Piet; Vespignani, Alessandro
2015-01-01
In recent years the research community has accumulated overwhelming evidence for the emergence of complex and heterogeneous connectivity patterns in a wide range of biological and sociotechnical systems. The complex properties of real-world networks have a profound impact on the behavior of equilibrium and nonequilibrium phenomena occurring in various systems, and the study of epidemic spreading is central to our understanding of the unfolding of dynamical processes in complex networks. The t...
Bell Inequalities for Complex Networks
2015-10-26
AFRL-AFOSR-VA-TR-2015-0355 YIP Bell Inequalities for Complex Networks Greg Ver Steeg UNIVERSITY OF SOUTHERN CALIFORNIA LOS ANGELES Final Report 10/26...performance report PI: Greg Ver Steeg Young Investigator Award Grant Title: Bell Inequalities for Complex Networks Grant #: FA9550-12-1-0417 Reporting...October 20, 2015 Final Report for “Bell Inequalities for Complex Networks” Greg Ver Steeg Abstract This effort studied new methods to understand the effect
DEFF Research Database (Denmark)
Dahlberg, Rasmus
2015-01-01
This paper explores two key concepts: resilience and complexity. The first is understood as an emergent property of the latter, and their inter-relatedness is discussed using a three tier approach. First, by exploring the discourse of each concept, next, by analyzing underlying relationships and...... robust. Robustness is a property of simple or complicated systems characterized by predictable behavior, enabling the system to bounce back to its normal state following a perturbation. Resilience, however, is an emergent property of complex adaptive systems. It is suggested that this distinction...
Min, Hua; Zheng, Ling; Perl, Yehoshua; Halper, Michael; De Coronado, Sherri; Ochs, Christopher
2017-05-18
Ontologies are knowledge structures that lend support to many health-information systems. A study is carried out to assess the quality of ontological concepts based on a measure of their complexity. The results show a relation between complexity of concepts and error rates of concepts. A measure of lateral complexity defined as the number of exhibited role types is used to distinguish between more complex and simpler concepts. Using a framework called an area taxonomy, a kind of abstraction network that summarizes the structural organization of an ontology, concepts are divided into two groups along these lines. Various concepts from each group are then subjected to a two-phase QA analysis to uncover and verify errors and inconsistencies in their modeling. A hierarchy of the National Cancer Institute thesaurus (NCIt) is used as our test-bed. A hypothesis pertaining to the expected error rates of the complex and simple concepts is tested. Our study was done on the NCIt's Biological Process hierarchy. Various errors, including missing roles, incorrect role targets, and incorrectly assigned roles, were discovered and verified in the two phases of our QA analysis. The overall findings confirmed our hypothesis by showing a statistically significant difference between the amounts of errors exhibited by more laterally complex concepts vis-à-vis simpler concepts. QA is an essential part of any ontology's maintenance regimen. In this paper, we reported on the results of a QA study targeting two groups of ontology concepts distinguished by their level of complexity, defined in terms of the number of exhibited role types. The study was carried out on a major component of an important ontology, the NCIt. The findings suggest that more complex concepts tend to have a higher error rate than simpler concepts. These findings can be utilized to guide ongoing efforts in ontology QA.
I. Redox chemistry of bimetallic fulvalene complexes II. Oligocyclopentadienyl complexes
Energy Technology Data Exchange (ETDEWEB)
Brown, David Stephen [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Lawrence Berkeley Lab., CA (United States). Chemical Sciences Div.
1993-11-01
The electrochemistry of the heterobimetallic complexes (fulvalene)WFe(CO)5 (30) and (fulvalene)WRu(CO)5 (31) has been investigated. Compound 30 is reduced in two one-electron processes, and this behavior was exploited synthetically to prepare a tetranuclear dimer by selective metal reduction. Complex 31 displayed a distinction between the metals upon reoxidation of the dianion, allowing the formation of a dimer by selective metal anion oxidation. The redox behavior of 30 led to an investigation of the use of electrocatalysis to effect metal-specific ligand substitution. It was found that reduction of 30 with a catalytic amount of CpFe(C6Me6) (97) in the presence of excess P(OMe)3 or PMe5 led to the formation of the zwitterions (fulvalene)[W(CO)3-][Fe(CO)PR3+] (107, R = P(OMe)3; 108, R = PMe3). Compound 31 also displayed unique behavior with different reducing agents, as the monosubstituted zwitterion (fulvalene)[W(CO)3-][Ru(CO)2(PMe3+] was obtained when 97 was used while the disubstituted complex (fulvalene) [W(CO)3-] [Ru(CO)(PMe3)2+] was produced when Cp*Fe(C6Me6) was the catalyst. Potential synthetic routes to quatercyclopentadienyl complexes were also explored. Various attempts to couple heterobimetallic fulvalene compounds proved to be unsuccessful. 138 refs.
African Journals Online (AJOL)
1Department of Food Science and Engineering, Xinyang College of Agriculture and ... Results: The UV and IR spectra of the complex showed an additive effect of polydatin-lecithin, in which .... Monochromatic Cu Ka radiation (wavelength =.
Sierschynski, Jarek; Louie, Belinda; Pughe, Bronwyn
2015-01-01
One of the key requirements of Common Core State Standards (CCSS) in English Language Arts is that students are able to read and access complex texts across all grade levels. The CCSS authors emphasize both the limitations and lack of accuracy in the current CCSS model of text complexity, calling for the development of new frameworks. In response…
Maximizing information exchange between complex networks
International Nuclear Information System (INIS)
West, Bruce J.; Geneston, Elvis L.; Grigolini, Paolo
2008-01-01
Science is not merely the smooth progressive interaction of hypothesis, experiment and theory, although it sometimes has that form. More realistically the scientific study of any given complex phenomenon generates a number of explanations, from a variety of perspectives, that eventually requires synthesis to achieve a deep level of insight and understanding. One such synthesis has created the field of out-of-equilibrium statistical physics as applied to the understanding of complex dynamic networks. Over the past forty years the concept of complexity has undergone a metamorphosis. Complexity was originally seen as a consequence of memory in individual particle trajectories, in full agreement with a Hamiltonian picture of microscopic dynamics and, in principle, macroscopic dynamics could be derived from the microscopic Hamiltonian picture. The main difficulty in deriving macroscopic dynamics from microscopic dynamics is the need to take into account the actions of a very large number of components. The existence of events such as abrupt jumps, considered by the conventional continuous time random walk approach to describing complexity was never perceived as conflicting with the Hamiltonian view. Herein we review many of the reasons why this traditional Hamiltonian view of complexity is unsatisfactory. We show that as a result of technological advances, which make the observation of single elementary events possible, the definition of complexity has shifted from the conventional memory concept towards the action of non-Poisson renewal events. We show that the observation of crucial processes, such as the intermittent fluorescence of blinking quantum dots as well as the brain's response to music, as monitored by a set of electrodes attached to the scalp, has forced investigators to go beyond the traditional concept of complexity and to establish closer contact with the nascent field of complex networks. Complex networks form one of the most challenging areas of modern
Maximizing information exchange between complex networks
West, Bruce J.; Geneston, Elvis L.; Grigolini, Paolo
2008-10-01
Science is not merely the smooth progressive interaction of hypothesis, experiment and theory, although it sometimes has that form. More realistically the scientific study of any given complex phenomenon generates a number of explanations, from a variety of perspectives, that eventually requires synthesis to achieve a deep level of insight and understanding. One such synthesis has created the field of out-of-equilibrium statistical physics as applied to the understanding of complex dynamic networks. Over the past forty years the concept of complexity has undergone a metamorphosis. Complexity was originally seen as a consequence of memory in individual particle trajectories, in full agreement with a Hamiltonian picture of microscopic dynamics and, in principle, macroscopic dynamics could be derived from the microscopic Hamiltonian picture. The main difficulty in deriving macroscopic dynamics from microscopic dynamics is the need to take into account the actions of a very large number of components. The existence of events such as abrupt jumps, considered by the conventional continuous time random walk approach to describing complexity was never perceived as conflicting with the Hamiltonian view. Herein we review many of the reasons why this traditional Hamiltonian view of complexity is unsatisfactory. We show that as a result of technological advances, which make the observation of single elementary events possible, the definition of complexity has shifted from the conventional memory concept towards the action of non-Poisson renewal events. We show that the observation of crucial processes, such as the intermittent fluorescence of blinking quantum dots as well as the brain’s response to music, as monitored by a set of electrodes attached to the scalp, has forced investigators to go beyond the traditional concept of complexity and to establish closer contact with the nascent field of complex networks. Complex networks form one of the most challenging areas of
Maximizing information exchange between complex networks
Energy Technology Data Exchange (ETDEWEB)
West, Bruce J. [Mathematical and Information Science, Army Research Office, Research Triangle Park, NC 27708 (United States); Physics Department, Duke University, Durham, NC 27709 (United States)], E-mail: bwest@nc.rr.com; Geneston, Elvis L. [Center for Nonlinear Science, University of North Texas, P.O. Box 311427, Denton, TX 76203-1427 (United States); Physics Department, La Sierra University, 4500 Riverwalk Parkway, Riverside, CA 92515 (United States); Grigolini, Paolo [Center for Nonlinear Science, University of North Texas, P.O. Box 311427, Denton, TX 76203-1427 (United States); Istituto di Processi Chimico Fisici del CNR, Area della Ricerca di Pisa, Via G. Moruzzi, 56124, Pisa (Italy); Dipartimento di Fisica ' E. Fermi' Universita' di Pisa, Largo Pontecorvo 3, 56127 Pisa (Italy)
2008-10-15
Science is not merely the smooth progressive interaction of hypothesis, experiment and theory, although it sometimes has that form. More realistically the scientific study of any given complex phenomenon generates a number of explanations, from a variety of perspectives, that eventually requires synthesis to achieve a deep level of insight and understanding. One such synthesis has created the field of out-of-equilibrium statistical physics as applied to the understanding of complex dynamic networks. Over the past forty years the concept of complexity has undergone a metamorphosis. Complexity was originally seen as a consequence of memory in individual particle trajectories, in full agreement with a Hamiltonian picture of microscopic dynamics and, in principle, macroscopic dynamics could be derived from the microscopic Hamiltonian picture. The main difficulty in deriving macroscopic dynamics from microscopic dynamics is the need to take into account the actions of a very large number of components. The existence of events such as abrupt jumps, considered by the conventional continuous time random walk approach to describing complexity was never perceived as conflicting with the Hamiltonian view. Herein we review many of the reasons why this traditional Hamiltonian view of complexity is unsatisfactory. We show that as a result of technological advances, which make the observation of single elementary events possible, the definition of complexity has shifted from the conventional memory concept towards the action of non-Poisson renewal events. We show that the observation of crucial processes, such as the intermittent fluorescence of blinking quantum dots as well as the brain's response to music, as monitored by a set of electrodes attached to the scalp, has forced investigators to go beyond the traditional concept of complexity and to establish closer contact with the nascent field of complex networks. Complex networks form one of the most challenging areas of
COULCC: A continued-fraction algorithm for Coulomb functions of complex order with complex arguments
International Nuclear Information System (INIS)
Thompson, I.J.; Barnett, A.R.
1985-01-01
The routine COULCC calculates both the oscillating and the exponentially varying Coulomb wave functions, and their radial derivations, for complex eta(Sommerfeld parameter), complex energies and complex angular momenta. The functions for uncharged scattering (spherical Bessels) and cylindrical Bessel functions are special cases which are more easily solved. Two linearly independent solutions are found, in general, to the differential equation f''(x)+g(x)f(x)=0, where g(x) has x 0 , x -1 and x -2 terms, with coefficients 1, -2eta and -lambda(lambda+1), respectively. (orig.)
Shippee, Nathan D; Shah, Nilay D; May, Carl R; Mair, Frances S; Montori, Victor M
2012-10-01
To design a functional, patient-centered model of patient complexity with practical applicability to analytic design and clinical practice. Existing literature on patient complexity has mainly identified its components descriptively and in isolation, lacking clarity as to their combined functions in disrupting care or to how complexity changes over time. The authors developed a cumulative complexity model, which integrates existing literature and emphasizes how clinical and social factors accumulate and interact to complicate patient care. A narrative literature review is used to explicate the model. The model emphasizes a core, patient-level mechanism whereby complicating factors impact care and outcomes: the balance between patient workload of demands and patient capacity to address demands. Workload encompasses the demands on the patient's time and energy, including demands of treatment, self-care, and life in general. Capacity concerns ability to handle work (e.g., functional morbidity, financial/social resources, literacy). Workload-capacity imbalances comprise the mechanism driving patient complexity. Treatment and illness burdens serve as feedback loops, linking negative outcomes to further imbalances, such that complexity may accumulate over time. With its components largely supported by existing literature, the model has implications for analytic design, clinical epidemiology, and clinical practice. Copyright © 2012 Elsevier Inc. All rights reserved.
Reduction of Subjective and Objective System Complexity
Watson, Michael D.
2015-01-01
Occam's razor is often used in science to define the minimum criteria to establish a physical or philosophical idea or relationship. Albert Einstein is attributed the saying "everything should be made as simple as possible, but not simpler". These heuristic ideas are based on a belief that there is a minimum state or set of states for a given system or phenomena. In looking at system complexity, these heuristics point us to an idea that complexity can be reduced to a minimum. How then, do we approach a reduction in complexity? Complexity has been described as a subjective concept and an objective measure of a system. Subjective complexity is based on human cognitive comprehension of the functions and inter relationships of a system. Subjective complexity is defined by the ability to fully comprehend the system. Simplifying complexity, in a subjective sense, is thus gaining a deeper understanding of the system. As Apple's Jonathon Ive has stated," It's not just minimalism or the absence of clutter. It involves digging through the depth of complexity. To be truly simple, you have to go really deep". Simplicity is not the absence of complexity but a deeper understanding of complexity. Subjective complexity, based on this human comprehension, cannot then be discerned from the sociological concept of ignorance. The inability to comprehend a system can be either a lack of knowledge, an inability to understand the intricacies of a system, or both. Reduction in this sense is based purely on a cognitive ability to understand the system and no system then may be truly complex. From this view, education and experience seem to be the keys to reduction or eliminating complexity. Objective complexity, is the measure of the systems functions and interrelationships which exist independent of human comprehension. Jonathon Ive's statement does not say that complexity is removed, only that the complexity is understood. From this standpoint, reduction of complexity can be approached
Increasing complexity with quantum physics.
Anders, Janet; Wiesner, Karoline
2011-09-01
We argue that complex systems science and the rules of quantum physics are intricately related. We discuss a range of quantum phenomena, such as cryptography, computation and quantum phases, and the rules responsible for their complexity. We identify correlations as a central concept connecting quantum information and complex systems science. We present two examples for the power of correlations: using quantum resources to simulate the correlations of a stochastic process and to implement a classically impossible computational task.
Rhodium complexes as therapeutic agents.
Ma, Dik-Lung; Wang, Modi; Mao, Zhifeng; Yang, Chao; Ng, Chan-Tat; Leung, Chung-Hang
2016-02-21
The landscape of inorganic medicinal chemistry has been dominated by the investigation of platinum, and to a lesser extent ruthenium, complexes over the past few decades. Recently, complexes based on other metal centers such as rhodium have attracted attention due to their tunable chemical and biological properties as well as distinct mechanisms of action. This perspective highlights recent examples of rhodium complexes that show diverse biological activities against various targets, including enzymes and protein-protein interactions.
Stability constants of scandium complexes, 1
International Nuclear Information System (INIS)
Itoh, Hisako; Itoh, Naomi; Suzuki, Yasuo
1984-01-01
The stability constants of scandium complexes with some carboxylate ligands were determined potentiometrically at 25.0 and 40.0 0 C and at an ionic strength of 0.10 with potassium nitrate as supporting electrolyte. The constants of the scandium complexes were appreciably greater than those of the corresponding lanthanoid complexes, as expected. The changes in free energy, enthalpy, and entropy for the formation of the scandium complexes were calculated from the stability constants at two temperatures. (author)
Increase of Organization in Complex Systems
Georgiev, Georgi Yordanov; Daly, Michael; Gombos, Erin; Vinod, Amrit; Hoonjan, Gajinder
2013-01-01
Measures of complexity and entropy have not converged to a single quantitative description of levels of organization of complex systems. The need for such a measure is increasingly necessary in all disciplines studying complex systems. To address this problem, starting from the most fundamental principle in Physics, here a new measure for quantity of organization and rate of self-organization in complex systems based on the principle of least (stationary) action is applied to a model system -...
Early days in complex dynamics a history of complex dynamics in one variable during 1906-1942
Alexander, Daniel S; Rosa, Alessandro
2011-01-01
The theory of complex dynamics, whose roots lie in 19th-century studies of the iteration of complex function conducted by Kœnigs, Schröder, and others, flourished remarkably during the first half of the 20th century, when many of the central ideas and techniques of the subject developed. This book by Alexander, Iavernaro, and Rosa paints a robust picture of the field of complex dynamics between 1906 and 1942 through detailed discussions of the work of Fatou, Julia, Siegel, and several others. A recurrent theme of the authors' treatment is the center problem in complex dynamics. They present its complete history during this period and, in so doing, bring out analogies between complex dynamics and the study of differential equations, in particular, the problem of stability in Hamiltonian systems. Among these analogies are the use of iteration and problems involving small divisors which the authors examine in the work of Poincaré and others, linking them to complex dynamics, principally via the work of Samuel...
Complexity in White Noise Analysis
Hida, Takeyuki
We restrict our attention to random complex systems and discuss degree their degree of complexity based on a white noise. The white noise is realized as the time derivative of a Brownian motion B(t), and denoted by Ḃ(t). The collection {Ḃ(t)}, is a system of idealized elementary variables and at the same time the system is a stochastic representation of the time t, in other words it is time-oriented. Having expressed the given evolutional random phenomena in question in terms of the Ḃ(t), we introduce the notion of spectral multiplicity, which describes how much the phenomena are complex. The multiplicity is the number of cyclic subspaces that are spanned by the given random phenomena. Each cyclic subspace has further structure. Typical property is multiple Markov property, although this property appears only particular cases. As a related property, in fact as a characteristic of a complex system, one can speak of the time reversibility and irreversibility of certain random phenomena in terms of the white noise. We expect an irreversible random complex system may be decomposed into reversible systems.
Tirandaz, Hamed; Karami-Mollaee, Ali
2018-06-01
Chaotic systems demonstrate complex behaviour in their state variables and their parameters, which generate some challenges and consequences. This paper presents a new synchronisation scheme based on integral sliding mode control (ISMC) method on a class of complex chaotic systems with complex unknown parameters. Synchronisation between corresponding states of a class of complex chaotic systems and also convergence of the errors of the system parameters to zero point are studied. The designed feedback control vector and complex unknown parameter vector are analytically achieved based on the Lyapunov stability theory. Moreover, the effectiveness of the proposed methodology is verified by synchronisation of the Chen complex system and the Lorenz complex systems as the leader and the follower chaotic systems, respectively. In conclusion, some numerical simulations related to the synchronisation methodology is given to illustrate the effectiveness of the theoretical discussions.
Complexity, Modeling, and Natural Resource Management
Directory of Open Access Journals (Sweden)
Paul Cilliers
2013-09-01
Full Text Available This paper contends that natural resource management (NRM issues are, by their very nature, complex and that both scientists and managers in this broad field will benefit from a theoretical understanding of complex systems. It starts off by presenting the core features of a view of complexity that not only deals with the limits to our understanding, but also points toward a responsible and motivating position. Everything we do involves explicit or implicit modeling, and as we can never have comprehensive access to any complex system, we need to be aware both of what we leave out as we model and of the implications of the choice of our modeling framework. One vantage point is never sufficient, as complexity necessarily implies that multiple (independent conceptualizations are needed to engage the system adequately. We use two South African cases as examples of complex systems - restricting the case narratives mainly to the biophysical domain associated with NRM issues - that make the point that even the behavior of the biophysical subsystems themselves are already complex. From the insights into complex systems discussed in the first part of the paper and the lessons emerging from the way these cases have been dealt with in reality, we extract five interrelated generic principles for practicing science and management in complex NRM environments. These principles are then further elucidated using four further South African case studies - organized as two contrasting pairs - and now focusing on the more difficult organizational and social side, comparing the human organizational endeavors in managing such systems.
Mapping on complex neutrosophic soft expert sets
Al-Quran, Ashraf; Hassan, Nasruddin
2018-04-01
We introduce the mapping on complex neutrosophic soft expert sets. Further, we investigated the basic operations and other related properties of complex neutrosophic soft expert image and complex neutrosophic soft expert inverse image of complex neutrosophic soft expert sets.
Electrolytic conductivity of synthetic organomineral complexes
Directory of Open Access Journals (Sweden)
Ksiezopolska Alicja
2005-01-01
Full Text Available The mechanism of the formation of organomineral complexes in soils is very complex and still little known. Examination of the complexes in unaltered form, as isolated from the soil, is very difficult due to the dispersing effect of all extraction agents which break the complexes up, destroying their natural properties. It is much easier to perform most of the tests on preparations of organomineral complexes obtained under laboratory conditions. This paper is concerned with model research on the formation of synthetic complexes of humic acids with minerals: Na-montmorillonite, mica, kaolinite at various pH values (3-7 and in the presence of aluminum ions. The aim of the research was to develop an optimum reaction of suspension for the synthesis of organomineral complexes, to study the role of aluminum ions, and to attempt to determine the degree of their complexity on the basis of the electrolytic conductivity (EC. An important influence of the suspension pH value on the value of EC was observed. The greatest correlation was found in the organomineral preparations with kaolinite and with aluminum (r = 0.93***. Generally, it can be stated that the degree of reaction of humic acids with minerals depended most of all on the type of mineral, on the pH value, and on the presence of aluminum.
Analysis of nanoparticle biomolecule complexes.
Gunnarsson, Stefán B; Bernfur, Katja; Mikkelsen, Anders; Cedervall, Tommy
2018-03-01
Nanoparticles exposed to biological fluids adsorb biomolecules on their surface forming a biomolecular corona. This corona determines, on a molecular level, the interactions and impact the newly formed complex has on cells and organisms. The corona formation as well as the physiological and toxicological relevance are commonly investigated. However, an acknowledged but rarely addressed problem in many fields of nanobiotechnology is aggregation and broadened size distribution of nanoparticles following their interactions with the molecules of biological fluids. In blood serum, TiO 2 nanoparticles form complexes with a size distribution from 30 nm to more than 500 nm. In this study we have separated these complexes, with good resolution, using preparative centrifugation in a sucrose gradient. Two main apparent size populations were obtained, a fast sedimenting population of complexes that formed a pellet in the preparative centrifugation tube, and a slow sedimenting complex population still suspended in the gradient after centrifugation. Concentration and surface area dependent differences are found in the biomolecular corona between the slow and fast sedimenting fractions. There are more immunoglobulins, lipid binding proteins, and lipid-rich complexes at higher serum concentrations. Sedimentation rate and the biomolecular corona are important factors for evaluating any experiment including nanoparticle exposure. Our results show that traditional description of nanoparticles in biological fluids is an oversimplification and that more thorough characterisations are needed.
The multitalented Mediator complex.
Carlsten, Jonas O P; Zhu, Xuefeng; Gustafsson, Claes M
2013-11-01
The Mediator complex is needed for regulated transcription of RNA polymerase II (Pol II)-dependent genes. Initially, Mediator was only seen as a protein bridge that conveyed regulatory information from enhancers to the promoter. Later studies have added many other functions to the Mediator repertoire. Indeed, recent findings show that Mediator influences nearly all stages of transcription and coordinates these events with concomitant changes in chromatin organization. We review the multitude of activities associated with Mediator and discuss how this complex coordinates transcription with other cellular events. We also discuss the inherent difficulties associated with in vivo characterization of a coactivator complex that can indirectly affect diverse cellular processes via changes in gene transcription. Copyright © 2013 Elsevier Ltd. All rights reserved.
Convergence of Batch Split-Complex Backpropagation Algorithm for Complex-Valued Neural Networks
Directory of Open Access Journals (Sweden)
Huisheng Zhang
2009-01-01
Full Text Available The batch split-complex backpropagation (BSCBP algorithm for training complex-valued neural networks is considered. For constant learning rate, it is proved that the error function of BSCBP algorithm is monotone during the training iteration process, and the gradient of the error function tends to zero. By adding a moderate condition, the weights sequence itself is also proved to be convergent. A numerical example is given to support the theoretical analysis.
The sleeping brain as a complex system.
Olbrich, Eckehard; Achermann, Peter; Wennekers, Thomas
2011-10-13
'Complexity science' is a rapidly developing research direction with applications in a multitude of fields that study complex systems consisting of a number of nonlinear elements with interesting dynamics and mutual interactions. This Theme Issue 'The complexity of sleep' aims at fostering the application of complexity science to sleep research, because the brain in its different sleep stages adopts different global states that express distinct activity patterns in large and complex networks of neural circuits. This introduction discusses the contributions collected in the present Theme Issue. We highlight the potential and challenges of a complex systems approach to develop an understanding of the brain in general and the sleeping brain in particular. Basically, we focus on two topics: the complex networks approach to understand the changes in the functional connectivity of the brain during sleep, and the complex dynamics of sleep, including sleep regulation. We hope that this Theme Issue will stimulate and intensify the interdisciplinary communication to advance our understanding of the complex dynamics of the brain that underlies sleep and consciousness.
Directory of Open Access Journals (Sweden)
Yung-Yen Shih
2013-01-01
Full Text Available Severe tropical storms play an important role in triggering phytoplankton blooms, yet direct field observation of evidence of the effects of a typhoon is very rare. Sea surface temperature (SST, nitrate concentration, chlorophyll a (chl a concentration, and particulate organic carbon (POC flux were measured before and shortly after Typhoon Jangmi which affected the southern East China Sea (SECS on September 28 ~ 29, 2008. In situ SST (27.5 ~ 28.0°C on September 19 ~ 21, decreased to ~24.0°C (October 3 ~ 6 in the SECS 4 ~ 7 days after the passage of Typhoon Jangmi. In situ nitrate and chl a concentrations 7-days (on October 6 after the passage of Jangmi were 1.9 μM and 1.61 mg m-3, respectively, much higher than those (nitrate: 0.3 μM and chl a: 0.73 mg m-3 concentrations before the typhoon (September 21. The enhanced chl a concentration is thus caused by a nutrient supply via vertical mixing or upwelling in the euphotic zone. The POC flux 7-days after Jangmi¡¦s passage was 552 ± 28 mg-C m-2 d-1, a ~2.5-fold increases before the typhoon (224 ± 33 mg-C m-2 d-1, on September 21. Our results suggest that typhoons indeed can stimulate efficient POC export out of the euphotic zone, while it is still poorly understood with regard to the total effects of a typhoon on nutrient dynamics and detailed carbon sequestration due to sampling difficulty. Therefore, successional sea-going observations ought to be conducted in the affected area after the passage of typhoons.
Central nervous system pathology in pediatric AIDS: an autopsy study.
Dickson, D W; Belman, A L; Park, Y D; Wiley, C; Horoupian, D S; Llena, J; Kure, K; Lyman, W D; Morecki, R; Mitsudo, S
1989-01-01
The neuropathologic findings of brains and spinal cords removed at autopsy from 26 infants and children with AIDS is described; in two cases, only the spinal cords were available. The most common finding in the brains was dystrophic calcification of blood vessels of all calibers in the basal ganglia and deep cerebral white matter (21 og 24 cases). The next most frequent finding was subacute encephalitis (SE) (15 of 24 cases) with microglial nodules and multinulceated giant cells. Immunocytochemical and in situ hybridization studies showed HIV antigen or genetic sequences only in the brains of cases with SE. Multinucleated giants cells (MGC) were the most frequent cells with reaction products. MGC were labeled with ricinus lectin (RCA), but not with leukocyte common antigen (LCA) or glial fibrillary acidic protein. Many cells in microglial nodules were labeled with RCA, but not LCA; cells in the perivascular compartment were labeled with LCA, but not RCA. Corticospinal tract degeneration was noted in 15 of 20 spinal cords. In six cases tract degeneration was consistent with delayed myelination, and the remaining cases had axonal injury consistent with Wallerian degeneration. Opportunistic infections were rare (three cases). Central nervous system lymphoma occurred in three children and was the most common mass lesion. In two cases lymphoma occurred in the setting of a systemic polyclonal immunoproliferation possibly related to Epstein-Barr virus infection. Cerebrovascular accidents were noted in seven cases. Two cases had hemorrhage associated with immune thrombocytopenia; one hemorrhage was catastrophic. Two children had large vessel arteriopathy with multiple encephalomalacias. Two children had a necrotizing encephalopathy with encephalomalacia and vascular changes suggestive of a mitochondrial cytopathy.(ABSTRACT TRUNCATED AT 250 WORDS)
Complexity-aware high efficiency video coding
Correa, Guilherme; Agostini, Luciano; Cruz, Luis A da Silva
2016-01-01
This book discusses computational complexity of High Efficiency Video Coding (HEVC) encoders with coverage extending from the analysis of HEVC compression efficiency and computational complexity to the reduction and scaling of its encoding complexity. After an introduction to the topic and a review of the state-of-the-art research in the field, the authors provide a detailed analysis of the HEVC encoding tools compression efficiency and computational complexity. Readers will benefit from a set of algorithms for scaling the computational complexity of HEVC encoders, all of which take advantage from the flexibility of the frame partitioning structures allowed by the standard. The authors also provide a set of early termination methods based on data mining and machine learning techniques, which are able to reduce the computational complexity required to find the best frame partitioning structures. The applicability of the proposed methods is finally exemplified with an encoding time control system that emplo...
8th Conference on Complex Networks
Menezes, Ronaldo; Sinatra, Roberta; Zlatic, Vinko
2017-01-01
This book collects the works presented at the 8th International Conference on Complex Networks (CompleNet) 2017 in Dubrovnik, Croatia, on March 21-24, 2017. CompleNet aims at bringing together researchers and practitioners working in areas related to complex networks. The past two decades has witnessed an exponential increase in the number of publications within this field. From biological systems to computer science, from economic to social systems, complex networks are becoming pervasive in many fields of science. It is this interdisciplinary nature of complex networks that CompleNet aims at addressing. The last decades have seen the emergence of complex networks as the language with which a wide range of complex phenomena in fields as diverse as physics, computer science, and medicine (to name a few) can be properly described and understood. This book provides a view of the state-of-the-art in this dynamic field and covers topics such as network controllability, social structure, online behavior, recommend...
Anti-synchronization between different chaotic complex systems
International Nuclear Information System (INIS)
Liu Ping; Liu Shutang
2011-01-01
Many studies on the anti-synchronization of nonlinear real dynamic systems have been carried out, whereas the anti-synchronization of chaotic complex systems has not been studied extensively. In this work, the anti-synchronization between a new chaotic complex system and a complex Lorenz system and that between a new chaotic complex system and a complex Lue system were separately investigated by active control and nonlinear control methods, and explicit expressions were derived for the controllers that are used to achieve the anti-synchronization of chaotic complex systems. These expressions were tested numerically and excellent agreement was found. Concerning the new chaotic complex system, we discuss its dynamical properties including dissipation, chaotic behavior, fixed points, and their stability and invariance.
Pease, April; Mahmoodi, Korosh; West, Bruce J.
2018-03-01
We present a technique to search for the presence of crucial events in music, based on the analysis of the music volume. Earlier work on this issue was based on the assumption that crucial events correspond to the change of music notes, with the interesting result that the complexity index of the crucial events is mu ~ 2, which is the same inverse power-law index of the dynamics of the brain. The search technique analyzes music volume and confirms the results of the earlier work, thereby contributing to the explanation as to why the brain is sensitive to music, through the phenomenon of complexity matching. Complexity matching has recently been interpreted as the transfer of multifractality from one complex network to another. For this reason we also examine the mulifractality of music, with the observation that the multifractal spectrum of a computer performance is significantly narrower than the multifractal spectrum of a human performance of the same musical score. We conjecture that although crucial events are demonstrably important for information transmission, they alone are not suficient to define musicality, which is more adequately measured by the multifractality spectrum.
The kinesin–tubulin complex: considerations in structural and functional complexity
Directory of Open Access Journals (Sweden)
Olmsted ZT
2015-02-01
Full Text Available Zachary T Olmsted, Andrew G Colliver, Janet L Paluh State University of New York Polytechnic Institute, Colleges of Nanoscale Science and Engineering, College of Nanoscale Science, Nanobioscience Constellation, Albany, NY, USA Abstract: The ability of cells to respond to external cues by appropriately manipulating their internal environment requires a dynamic microtubule cytoskeleton that is facilitated by associated kinesin motor interactions. The evolutionary adaptations of kinesins and tubulins when merged generate a highly adaptable communication and infrastructure cellular network that is important to understanding specialized cell functions, human disease, and disease therapies. Here, we review the state of the field in the complex relationship of kinesin–tubulin interactions. We propose 12 mechanistic specializations of kinesins. In one category, referred to as sortability, we describe how kinesin interactions with tubulin isoforms, isotypes, or posttranslationally modified tubulins contribute to diverse cellular roles. Fourteen kinesin families have previously been described. Here, we illustrate the great depth of functional complexity that is possible in members within a single kinesin family by mechanistic specialization through discussion of the well-studied Kinesin-14 family. This includes new roles of Kinesin-14 in regulating supramolecular structures such as the microtubule-organizing center γ-tubulin ring complex of centrosomes. We next explore the value of an improved mechanistic understanding of kinesin–tubulin interactions in regard to human development, disease mechanisms, and improving treatments that target kinesin–tubulin complexes. The ability to combine the current kinesin nomenclature along with a more precisely defined kinesin and tubulin molecular toolbox is needed to support more detailed exploration of kinesin–tubulin interaction mechanisms including functional uniqueness, redundancy, or adaptations to new
Sarason, Donald
2007-01-01
Complex Function Theory is a concise and rigorous introduction to the theory of functions of a complex variable. Written in a classical style, it is in the spirit of the books by Ahlfors and by Saks and Zygmund. Being designed for a one-semester course, it is much shorter than many of the standard texts. Sarason covers the basic material through Cauchy's theorem and applications, plus the Riemann mapping theorem. It is suitable for either an introductory graduate course or an undergraduate course for students with adequate preparation. The first edition was published with the title Notes on Co
Superspace de Rham complex and relative cohomology
Energy Technology Data Exchange (ETDEWEB)
III, William D. Linch; Randall, Stephen [Center for String and Particle Theory,Department of Physics, University of Maryland at College Park,College Park, MD 20742-4111 (United States)
2015-09-28
We investigate the super-de Rham complex of five-dimensional superforms with N=1 supersymmetry. By introducing a free supercommutative algebra of auxiliary variables, we show that this complex is equivalent to the Chevalley-Eilenberg complex of the translation supergroup with values in superfields. Each cocycle of this complex is defined by a Lorentz- and iso-spin-irreducible superfield subject to a set of constraints. Restricting to constant coefficients results in a subcomplex in which components of the cocycles are coboundaries while the constraints on the defining superfields span the cohomology. This reduces the computation of all of the superspace Bianchi identities to a single linear algebra problem the solution of which implies new features not present in the standard four-dimensional, N=1 complex. These include splitting/joining in the complex and the existence of cocycles that do not correspond to irreducible supermultiplets of closed differential forms. Interpreting the five-dimensional de Rham complex as arising from dimensional reduction from the six-dimensional complex, we find a second five-dimensional complex associated to the relative de Rham complex of the embedding of the latter in the former. This gives rise to a second source of closed differential forms previously attributed to the phenomenon called “Weyl triviality”.
Critical Fluctuations in Spatial Complex Networks
Bradde, Serena; Caccioli, Fabio; Dall'Asta, Luca; Bianconi, Ginestra
2010-05-01
An anomalous mean-field solution is known to capture the nontrivial phase diagram of the Ising model in annealed complex networks. Nevertheless, the critical fluctuations in random complex networks remain mean field. Here we show that a breakdown of this scenario can be obtained when complex networks are embedded in geometrical spaces. Through the analysis of the Ising model on annealed spatial networks, we reveal, in particular, the spectral properties of networks responsible for critical fluctuations and we generalize the Ginsburg criterion to complex topologies.
Reliability of large and complex systems
Kolowrocki, Krzysztof
2014-01-01
Reliability of Large and Complex Systems, previously titled Reliability of Large Systems, is an innovative guide to the current state and reliability of large and complex systems. In addition to revised and updated content on the complexity and safety of large and complex mechanisms, this new edition looks at the reliability of nanosystems, a key research topic in nanotechnology science. The author discusses the importance of safety investigation of critical infrastructures that have aged or have been exposed to varying operational conditions. This reference provides an asympt
Holographic complexity for time-dependent backgrounds
Energy Technology Data Exchange (ETDEWEB)
Momeni, Davood, E-mail: davoodmomeni78@gmail.com [Eurasian International Center for Theoretical Physics and Department of General Theoretical Physics, Eurasian National University, Astana 010008 (Kazakhstan); Faizal, Mir, E-mail: mirfaizalmir@googlemail.com [Irving K. Barber School of Arts and Sciences, University of British Columbia, Okanagan, 3333 University Way, Kelowna, British Columbia V1V 1V7 (Canada); Department of Physics and Astronomy, University of Lethbridge, Lethbridge, Alberta, T1K 3M4 (Canada); Bahamonde, Sebastian, E-mail: sebastian.beltran.14@ucl.ac.uk [Department of Mathematics, University College London, Gower Street, London, WC1E 6BT (United Kingdom); Myrzakulov, Ratbay [Eurasian International Center for Theoretical Physics and Department of General Theoretical Physics, Eurasian National University, Astana 010008 (Kazakhstan)
2016-11-10
In this paper, we will analyze the holographic complexity for time-dependent asymptotically AdS geometries. We will first use a covariant zero mean curvature slicing of the time-dependent bulk geometries, and then use this co-dimension one spacelike slice of the bulk spacetime to define a co-dimension two minimal surface. The time-dependent holographic complexity will be defined using the volume enclosed by this minimal surface. This time-dependent holographic complexity will reduce to the usual holographic complexity for static geometries. We will analyze the time-dependence as a perturbation of the asymptotically AdS geometries. Thus, we will obtain time-dependent asymptotically AdS geometries, and we will calculate the holographic complexity for such time-dependent geometries.
The complexity paradigm in management reconceptualizing
Directory of Open Access Journals (Sweden)
Petrović Slavica P.
2005-01-01
Full Text Available Chaos and complexity theory is a special, functionalist systems approach to dealing with complex, dynamic, nonlinear systems. Through treating organizations as complex, with their environments coevolving, nonlinear systems, complexity theory is aimed at creative research of their erratic nature. When an organization is in a state of bounded instability, at the edge of chaos, order and disorder are intertwined, its behavior is irregular and unpredictable but has some pattern. According to the complexity paradigm organizations have to strive to avoid the equilibrium states of stability and instability. They have instead to strive to remain in a state of bounded instability, at the edge of chaos, where they are able to display their full potential for creativity and innovation.
Amphotericin B Lipid Complex Injection
Amphotericin B lipid complex injection is used to treat serious, possibly life-threatening fungal infections in people who did ... respond or are unable to tolerate conventional amphotericin B therapy. Amphotericin B lipid complex injection is in ...
Implicit computational complexity and compilers
DEFF Research Database (Denmark)
Rubiano, Thomas
Complexity theory helps us predict and control resources, usually time and space, consumed by programs. Static analysis on specific syntactic criterion allows us to categorize some programs. A common approach is to observe the program’s data’s behavior. For instance, the detection of non...... evolution and a lot of research came from this theory. Until now, these implicit complexity theories were essentially applied on more or less toy languages. This thesis applies implicit computational complexity methods into “real life” programs by manipulating intermediate representation languages...
Conversation, coupling and complexity
DEFF Research Database (Denmark)
Fusaroli, Riccardo; Abney, Drew; Bahrami, Bahador
We investigate the linguistic co-construction of interpersonal synergies. By applying a measure of coupling between complex systems to an experimentally elicited corpus of joint decision dialogues, we show that interlocutors’ linguistic behavior displays increasing signature of multi-scale coupling......, known as complexity matching, over the course of interaction. Furthermore, we show that stronger coupling corresponds with more effective interaction, as measured by collective task performance....
Guerra, Concettina
2015-01-01
Protein complexes are key molecular entities that perform a variety of essential cellular functions. The connectivity of proteins within a complex has been widely investigated with both experimental and computational techniques. We developed a computational approach to identify and characterise proteins that play a role in interconnecting complexes. We computed a measure of inter-complex centrality, the crossroad index, based on disjoint paths connecting proteins in distinct complexes and identified inter-complex hubs as proteins with a high value of the crossroad index. We applied the approach to a set of stable complexes in Saccharomyces cerevisiae and in Homo sapiens. Just as done for hubs, we evaluated the topological and biological properties of inter-complex hubs addressing the following questions. Do inter-complex hubs tend to be evolutionary conserved? What is the relation between crossroad index and essentiality? We found a good correlation between inter-complex hubs and both evolutionary conservation and essentiality.
Flow assurance : complex phase behavior and complex work requires confidence and vigilance
Energy Technology Data Exchange (ETDEWEB)
Brown, L.D. [ConocoPhillips, Major Projects, Advanced Integrated Simulation, Houston, TX (United States)
2008-07-01
Petroleum exploration and development projects and operations increasingly rely on flow assurance definition. Flow assurance is an integrating discipline as it follows the fluid from the reservoir to the market. Flow assurance works across complex technical and non-technical interfaces, including the reservoir, well completions, operation processes, project management, physical/organic chemistry, fluid mechanics, chemical engineering, mechanical engineering and corrosion. The phase behaviour in real fluids also has complex interfaces. The understanding and management of flow assurance of complex phase behaviour must be well communicated in order to enable proper selection, execution, and operation of development concepts designed to manage successful production within the fluid's phase behaviour. Simulation tools facilitate the translation of science into engineering. Academic, industrial, and field research is the core of these tools. The author cautioned that vigilance is required to assist and identify the right time to move innovation into the core tools.
Social complexity parallels vocal complexity: a comparison of three nonhuman primate species
Directory of Open Access Journals (Sweden)
Hélène eBOUCHET
2013-07-01
Full Text Available Social factors play a key role in the structuring of vocal repertoires at the individual level, notably in nonhuman primates. Some authors suggested that, at the species level too, social life may have driven the evolution of communicative complexity, but this has rarely been empirically tested. Here, we use a comparative approach to address this issue. We investigated vocal variability, at both the call type and the repertoire levels, in three forest-dwelling species of Cercopithecinae presenting striking differences in their social systems, in terms of social organization as well as social structure. We collected female call recordings from twelve De Brazza’s monkeys (Cercopithecus neglectus, six Campbell’s monkeys (Cercopithecus campbelli and seven red-capped mangabeys (Cercocebus torquatus housed in similar conditions. First, we noted that the level of acoustic variability and individual distinctiveness found in several call types was related to their importance in social functioning. Contact calls, essential to intra-group cohesion, were the most individually distinctive regardless of the species, while threat calls were more structurally variable in mangabeys, the most ‘despotic’ of our three species. Second, we found a parallel between the degree of complexity of the species’ social structure and the size, diversity, and usage of its vocal repertoire. Mangabeys (most complex social structure called twice as often as guenons and displayed the largest and most complex repertoire. De Brazza’s monkeys (simplest social structure displayed the smallest and simplest repertoire. Campbell’s monkeys displayed an intermediate pattern. Providing evidence of higher levels of vocal variability in species presenting a more complex social system, our results are in line with the theory of a social-vocal coevolution of communicative abilities, opening new perspectives for comparative research on the evolution of communication systems in
DEFF Research Database (Denmark)
Horn, Ivo R; Nielsen, Marianne Jensby; Madsen, Mette
2003-01-01
During intravascular hemolysis hemoglobin (Hb) binds to haptoglobin (Hp) leading to endocytosis of the complex by the macrophage receptor, CD163. In the present study, we used a phage-display Fab antibody strategy to explore if the complex formation between Hp and Hb leads to exposure of antigenic...... epitopes specific for the complex. By Hp-Hb-affinity screening of a phage-Fab library, we isolated a phage clone against the ligand complex. Surface plasmon resonance analyses of the Fab part expressed as a recombinant protein revealed a high affinity binding (KD = 3.9 nm) to Hp-Hb, whereas no binding...... was measured for non-complexed Hp or Hb. The Fab antibody completely inhibited the binding of 125I-labeled Hp-Hb complexes to CD163 and blocked their uptake in CD163-transfected cells. In conclusion, we have raised a receptor-blocking antibody specifically recognizing the Hp-Hb complex. In addition to provide...
Effects of trial complexity on decision making.
Horowitz, I A; ForsterLee, L; Brolly, I
1996-12-01
The ability of a civil jury to render fair and rational decisions in complex trials has been questioned. However, the nature, dimensions, and effects of trial complexity on decision making have rarely been addressed. In this research, jury-eligible adults saw a videotape of a complex civil trial that varied in information load and complexity of the language of the witnesses. Information load and complexity differentially affected liability and compensatory decisions. An increase in the number of plaintiffs decreased blameworthiness assigned to the defendant despite contrary evidence and amount of probative evidence processed. Complex language did not affect memory but did affect jurors' ability to appropriately compensate differentially worthy plaintiffs. Jurors assigned compensatory awards commensurate with the plaintiffs' injuries only under low-load and less complex language conditions.
Measurement methods on the complexity of network
Institute of Scientific and Technical Information of China (English)
LIN Lin; DING Gang; CHEN Guo-song
2010-01-01
Based on the size of network and the number of paths in the network,we proposed a model of topology complexity of a network to measure the topology complexity of the network.Based on the analyses of the effects of the number of the equipment,the types of equipment and the processing time of the node on the complexity of the network with the equipment-constrained,a complexity model of equipment-constrained network was constructed to measure the integrated complexity of the equipment-constrained network.The algorithms for the two models were also developed.An automatic generator of the random single label network was developed to test the models.The results show that the models can correctly evaluate the topology complexity and the integrated complexity of the networks.
Directory of Open Access Journals (Sweden)
Jian Liu
2014-11-01
Full Text Available This paper introduces a type of modified hybrid projective synchronization with complex transformationmatrix (CMHPS for different dimensional fractional-order complex chaos and fractional-order real hyper-chaos. The transformationmatrix in this type of chaotic synchronization is a non-square matrix, and its elements are complex numbers. Based on the stability theory of fractional-order systems, by employing the feedback control technique, necessary and sufficient criteria on CMHPS are derived. Furthermore, CMHPS between fractional-order real hyper-chaotic Rössler system and other two different dimensional fractional-order complex Lorenz-like chaotic systems is provided as two examples to discuss reduced order and increased order synchronization, respectively.
Synchronization in complex networks
Energy Technology Data Exchange (ETDEWEB)
Arenas, A.; Diaz-Guilera, A.; Moreno, Y.; Zhou, C.; Kurths, J.
2007-12-12
Synchronization processes in populations of locally interacting elements are in the focus of intense research in physical, biological, chemical, technological and social systems. The many efforts devoted to understand synchronization phenomena in natural systems take now advantage of the recent theory of complex networks. In this review, we report the advances in the comprehension of synchronization phenomena when oscillating elements are constrained to interact in a complex network topology. We also overview the new emergent features coming out from the interplay between the structure and the function of the underlying pattern of connections. Extensive numerical work as well as analytical approaches to the problem are presented. Finally, we review several applications of synchronization in complex networks to different disciplines: biological systems and neuroscience, engineering and computer science, and economy and social sciences.
Directory of Open Access Journals (Sweden)
Ilona Koutny
2015-04-01
Full Text Available The long accepted complexity invariance of human languages has become controversial within the last decade. In investigations of the problem, both creole and planned languages have often been neglected. After a presentation of the scope of the invariance problem and the proposition of the natural to planned language continuum, this article will discuss the contribution of planned languages. It will analyze the complexity of Esperanto at the phonological, morphological, syntactic and semantic levels, using linguistic data bases. The role of the L2 speech community and development of the language will also be taken into account when discussing the endurance of the same level of simplicity of this planned international language. The author argues that complexity can be variable and to some extent planned and maintained.
Simulation in Complex Modelling
DEFF Research Database (Denmark)
Nicholas, Paul; Ramsgaard Thomsen, Mette; Tamke, Martin
2017-01-01
This paper will discuss the role of simulation in extended architectural design modelling. As a framing paper, the aim is to present and discuss the role of integrated design simulation and feedback between design and simulation in a series of projects under the Complex Modelling framework. Complex...... performance, engage with high degrees of interdependency and allow the emergence of design agency and feedback between the multiple scales of architectural construction. This paper presents examples for integrated design simulation from a series of projects including Lace Wall, A Bridge Too Far and Inflated...... Restraint developed for the research exhibition Complex Modelling, Meldahls Smedie Gallery, Copenhagen in 2016. Where the direct project aims and outcomes have been reported elsewhere, the aim for this paper is to discuss overarching strategies for working with design integrated simulation....
Introduction to complex plasmas
International Nuclear Information System (INIS)
Bonitz, Michael; Ludwig, Patrick; Horing, Norman
2010-01-01
Complex plasmas differ from traditional plasmas in many ways: these are low-temperature high pressure systems containing nanometer to micrometer size particles which may be highly charged and strongly interacting. The particles may be chemically reacting or be in contact with solid surfaces, and the electrons may show quantum behaviour. These interesting properties have led to many applications of complex plasmas in technology, medicine and science. Yet complex plasmas are extremely complicated, both experimentally and theoretically, and require a variety of new approaches which go beyond standard plasma physics courses. This book fills this gap presenting an introduction to theory, experiment and computer simulation in this field. Based on tutorial lectures at a very successful recent Summer Institute, the presentation is ideally suited for graduate students, plasma physicists and experienced undergraduates. (orig.)
Introduction to Complex Plasmas
Bonitz, Michael; Ludwig, Patrick
2010-01-01
Complex plasmas differ from traditional plasmas in many ways: these are low-temperature high pressure systems containing nanometer to micrometer size particles which may be highly charged and strongly interacting. The particles may be chemically reacting or be in contact with solid surfaces, and the electrons may show quantum behaviour. These interesting properties have led to many applications of complex plasmas in technology, medicine and science. Yet complex plasmas are extremely complicated, both experimentally and theoretically, and require a variety of new approaches which go beyond standard plasma physics courses. This book fills this gap presenting an introduction to theory, experiment and computer simulation in this field. Based on tutorial lectures at a very successful recent Summer Institute, the presentation is ideally suited for graduate students, plasma physicists and experienced undergraduates.
Large erupted complex odontoma
Directory of Open Access Journals (Sweden)
Vijeev Vasudevan
2009-01-01
Full Text Available Odontomas are a heterogeneous group of jaw bone lesions, classified as odontogenic tumors which usually include well-diversified dental tissues. Odontoma is a term introduced to the literature by Broca in 1867. Trauma, infection and hereditary factors are the possible causes of forming this kind of lesions. Among odontogenic tumors, they constitute about 2/3 of cases. These lesions usually develop slowly and asymptomatically, and in most cases they do not cross the bone borders. Two types of odontoma are recognized: compound and complex. Complex odontomas are less common than the compound variety in the ratio 1:2.3. Eruption of an odontoma in the oral cavity is rare. We present a case of complex odontoma, in which apparent eruption has occurred in the area of the right maxillary second molar region.
The fifth adaptor protein complex.
Directory of Open Access Journals (Sweden)
Jennifer Hirst
2011-10-01
Full Text Available Adaptor protein (AP complexes sort cargo into vesicles for transport from one membrane compartment of the cell to another. Four distinct AP complexes have been identified, which are present in most eukaryotes. We report the existence of a fifth AP complex, AP-5. Tagged AP-5 localises to a late endosomal compartment in HeLa cells. AP-5 does not associate with clathrin and is insensitive to brefeldin A. Knocking down AP-5 subunits interferes with the trafficking of the cation-independent mannose 6-phosphate receptor and causes the cell to form swollen endosomal structures with emanating tubules. AP-5 subunits can be found in all five eukaryotic supergroups, but they have been co-ordinately lost in many organisms. Concatenated phylogenetic analysis provides robust resolution, for the first time, into the evolutionary order of emergence of the adaptor subunit families, showing AP-3 as the basal complex, followed by AP-5, AP-4, and AP-1 and AP-2. Thus, AP-5 is an evolutionarily ancient complex, which is involved in endosomal sorting, and which has links with hereditary spastic paraplegia.
Approaching human language with complex networks
Cong, Jin; Liu, Haitao
2014-12-01
The interest in modeling and analyzing human language with complex networks is on the rise in recent years and a considerable body of research in this area has already been accumulated. We survey three major lines of linguistic research from the complex network approach: 1) characterization of human language as a multi-level system with complex network analysis; 2) linguistic typological research with the application of linguistic networks and their quantitative measures; and 3) relationships between the system-level complexity of human language (determined by the topology of linguistic networks) and microscopic linguistic (e.g., syntactic) features (as the traditional concern of linguistics). We show that the models and quantitative tools of complex networks, when exploited properly, can constitute an operational methodology for linguistic inquiry, which contributes to the understanding of human language and the development of linguistics. We conclude our review with suggestions for future linguistic research from the complex network approach: 1) relationships between the system-level complexity of human language and microscopic linguistic features; 2) expansion of research scope from the global properties to other levels of granularity of linguistic networks; and 3) combination of linguistic network analysis with other quantitative studies of language (such as quantitative linguistics).
Complexity rating of abnormal events and operator performance
International Nuclear Information System (INIS)
Oeivind Braarud, Per
1998-01-01
The complexity of the work situation during abnormal situations is a major topic in a discussion of safety aspects of Nuclear Power plants. An understanding of complexity and its impact on operator performance in abnormal situations is important. One way to enhance understanding is to look at the dimensions that constitute complexity for NPP operators, and how those dimensions can be measured. A further step is to study how dimensions of complexity of the event are related to performance of operators. One aspect of complexity is the operator 's subjective experience of given difficulties of the event. Another related aspect of complexity is subject matter experts ratings of the complexity of the event. A definition and a measure of this part of complexity are being investigated at the OECD Halden Reactor Project in Norway. This paper focus on the results from a study of simulated scenarios carried out in the Halden Man-Machine Laboratory, which is a full scope PWR simulator. Six crews of two licensed operators each performed in 16 scenarios (simulated events). Before the experiment subject matter experts rated the complexity of the scenarios, using a Complexity Profiling Questionnaire. The Complexity Profiling Questionnaire contains eight previously identified dimensions associated with complexity. After completing the scenarios the operators received a questionnaire containing 39 questions about perceived complexity. This questionnaire was used for development of a measure of subjective complexity. The results from the study indicated that Process experts' rating of scenario complexity, using the Complexity Profiling Questionnaire, were able to predict crew performance quite well. The results further indicated that a measure of subjective complexity could be developed that was related to crew performance. Subjective complexity was found to be related to subjective work load. (author)
Complex Topographic Feature Ontology Patterns
Varanka, Dalia E.; Jerris, Thomas J.
2015-01-01
Semantic ontologies are examined as effective data models for the representation of complex topographic feature types. Complex feature types are viewed as integrated relations between basic features for a basic purpose. In the context of topographic science, such component assemblages are supported by resource systems and found on the local landscape. Ontologies are organized within six thematic modules of a domain ontology called Topography that includes within its sphere basic feature types, resource systems, and landscape types. Context is constructed not only as a spatial and temporal setting, but a setting also based on environmental processes. Types of spatial relations that exist between components include location, generative processes, and description. An example is offered in a complex feature type ‘mine.’ The identification and extraction of complex feature types are an area for future research.
Tracing Method with Intra and Inter Protocols Correlation
Directory of Open Access Journals (Sweden)
Marin Mangri
2009-05-01
Full Text Available MEGACO or H.248 is a protocol enabling acentralized Softswitch (or MGC to control MGsbetween Voice over Packet (VoP networks andtraditional ones. To analyze much deeper the realimplementations it is useful to use a tracing systemwith intra and inter protocols correlation. For thisreason in the case of MEGACO-H.248 it is necessaryto find the appropriate method of correlation with allprotocols involved. Starting from Rel4 a separation ofCP (Control Plane and UP (User Plane managementwithin the networks appears. MEGACO protocol playsan important role in the migration to the new releasesor from monolithic platform to a network withdistributed components.
Novel materials for high-efficiency solar cells
Kojima, Nobuaki; Natori, Masato; Suzuki, Hidetoshi; Inagaki, Makoto; Ohshita, Yoshio; Yamaguchi, Masafumi
2009-08-01
Our Toyota Technological Institute group has investigated various novel materials for solar cells from organic to III-V compound materials. In this paper, we report our recent results in conductivity control of C60 thin films by metal-doping for organic solar cells, and mobility improvement of (In)GaAsN compounds for III-V tandem solar cells. The epitaxial growth of Mg-doped C60 films was attempted. It was found that the epitaxial growth of Mg-doped C60 film was enabled by using mica (001) substrate in the low Mg concentration region (Mg/C60 molar ratio defects leads this improvement.
International Nuclear Information System (INIS)
Kharita, M. H.; Takeyeddin, M.; Wali, K.; Zahili, M.
2005-03-01
The Half Value Layer (HVL) of copper and aluminium for special standard x-rays beams (emitted from x-ray machine type Philips MGC30 used in Secondary Standard Dosimetry Laboratory (SSDL) have been determined. The relationship between HVL values of aluminium and copper was established. This relationship can be represented by a non-linear fit. These results are valuable for x-ray workers especially those working in the field of radiation calibration for beam energy determination. Using the results of this study, unavailable thickness of one metal can be replaced by the corresponding thickness of the other metal, for filtration and measurement of x-ray beam. (Authors)
Persistent homology of complex networks
International Nuclear Information System (INIS)
Horak, Danijela; Maletić, Slobodan; Rajković, Milan
2009-01-01
Long-lived topological features are distinguished from short-lived ones (considered as topological noise) in simplicial complexes constructed from complex networks. A new topological invariant, persistent homology, is determined and presented as a parameterized version of a Betti number. Complex networks with distinct degree distributions exhibit distinct persistent topological features. Persistent topological attributes, shown to be related to the robust quality of networks, also reflect the deficiency in certain connectivity properties of networks. Random networks, networks with exponential connectivity distribution and scale-free networks were considered for homological persistency analysis
Management of complex dynamical systems
MacKay, R. S.
2018-02-01
Complex dynamical systems are systems with many interdependent components which evolve in time. One might wish to control their trajectories, but a more practical alternative is to control just their statistical behaviour. In many contexts this would be both sufficient and a more realistic goal, e.g. climate and socio-economic systems. I refer to it as ‘management’ of complex dynamical systems. In this paper, some mathematics for management of complex dynamical systems is developed in the weakly dependent regime, and questions are posed for the strongly dependent regime.
The Complexity of Indirect Translation
DEFF Research Database (Denmark)
Wenjie, L. I.
2017-01-01
its complex nature, and thus determined that many facets of ITr remain to be studied. The present article will try to encompass the complexity of ITr by looking into the reasons for translating indirectly, the challenge of finding out mediating texts (MTs), indirectness in both translation...... of which have been translated and interpreted indirectly through major languages like English, will be employed as examples. Hopefully, this study will offer more insights into the nature of translation as a social activity and raise further interests in studying translation as a complex phenomenon....
Energy Technology Data Exchange (ETDEWEB)
Chassin, David P.; Posse, Christian; Malard, Joel M.
2004-08-01
Physical analogs have shown considerable promise for understanding the behavior of complex adaptive systems, including macroeconomics, biological systems, social networks, and electric power markets. Many of today’s most challenging technical and policy questions can be reduced to a distributed economic control problem. Indeed, economically-based control of large-scale systems is founded on the conjecture that the price-based regulation (e.g., auctions, markets) results in an optimal allocation of resources and emergent optimal system control. This paper explores the state of the art in the use physical analogs for understanding the behavior of some econophysical systems and to deriving stable and robust control strategies for them. In particular we review and discussion applications of some analytic methods based on the thermodynamic metaphor according to which the interplay between system entropy and conservation laws gives rise to intuitive and governing global properties of complex systems that cannot be otherwise understood.
STRATEGIC MANAGEMENT OF TRANSPORT CARGO COMPLEX
Directory of Open Access Journals (Sweden)
A. M. Okorokov
2014-06-01
Full Text Available Purpose. Making the qualitative administrative decisions defining strategy and tactics of transport cargo complexes development, and also its subsystems, is possible only in the presence of flexible optimization model. This model has to consider multiparametricity and multicriteriality of the given task, uncertainty and vagueness of input information, and also to provide process automation of searching the best parameters of the given production facility. The purpose of the research is to develop procedures for the strategic management of complex with view of the most important factors and their stochastic nature, which will execute the improvement of technical equipment of TCC. Methodology. The problem of strategic management is based on solving the complex of issues of the optimal number of shunting locomotives, optimal processing capability of handling the front and rational capacity of warehouses. The problem is solved on the basis of the proposed optimality criterion – the specific set of profit per unit of capital assets of freight industry. The listed problems are solved using simulation modeling of the freight industry. Findings. The use of developed procedure allows one to improve the technical equipment of the freight stations and complexes. Originality. For the first time it was developed the procedure of strategic management of development. This procedure allows taking into account the probabilistic nature of demand for services of transport freight complexes and technological processes of client services on the complex stations. The proposed procedure can be applied during when planning the investments in the creation of transport freight complexes. Practical value. Use as a basic tool of simulation models of complex cargo operation allows estimating the effectiveness of the capital investments, the level of operating costs, as well as the quality of meeting the demands of potential customers in transportations at the stage of
Radiation induced ligand loss from cobalt complexes
International Nuclear Information System (INIS)
Funston, A. M.; McFadyen, W.D.; Tregloan, P.A.
2000-01-01
Full text: Due to the rapid nature of ligand dissociation from cobalt(II) complexes the study of the rate of ligand dissociation necessitates the use of a technique such as pulse radiolysis. This allows the rapid reduction of the corresponding cobalt(III) complex by a reducing radical, such as the aquated electron, to form the cobalt(II) complex. However, to date, no systematic study of either the mechanism of reduction or the influence of the electronic structure on the rate of ligand dissociation has been carried out. In order to understand these processes more fully the mechanism of reduction of a range of related cobalt(III) complexes by the aquated electron and the subsequent rate of ligand dissociation from the resulting cobalt(II) complexes is being investigated. It has been found that a number of processes are observed following the initial rapid reaction of the cobalt(III) complex with the aquated electron. Ultimately ligand loss is observed. Depending upon the complex, the initial processes observed may include the formation of coordinated radicals and electron transfer within the complex. For complexes containing aromatic ligands such as 2,2'-bipyridine, 1,10-phenanthroline and dipyrido[3,2-a:2',3'-c]phenazine the formation of a coordinated radical is observed as the initial reduction step. The kinetics of ligand dissociation of these complexes has been determined. The loss of monodentate ligands is fast and has been indistinguishable from the reduction processes when aromatic ligands are also present in the complex. However, for diamine chelates and diimine chelates spectra of the transient species can be resolved
Large branched self-assembled DNA complexes
International Nuclear Information System (INIS)
Tosch, Paul; Waelti, Christoph; Middelberg, Anton P J; Davies, A Giles
2007-01-01
Many biological molecules have been demonstrated to self-assemble into complex structures and networks by using their very efficient and selective molecular recognition processes. The use of biological molecules as scaffolds for the construction of functional devices by self-assembling nanoscale complexes onto the scaffolds has recently attracted significant attention and many different applications in this field have emerged. In particular DNA, owing to its inherent sophisticated self-organization and molecular recognition properties, has served widely as a scaffold for various nanotechnological self-assembly applications, with metallic and semiconducting nanoparticles, proteins, macromolecular complexes, inter alia, being assembled onto designed DNA scaffolds. Such scaffolds may typically contain multiple branch-points and comprise a number of DNA molecules selfassembled into the desired configuration. Previously, several studies have used synthetic methods to produce the constituent DNA of the scaffolds, but this typically constrains the size of the complexes. For applications that require larger self-assembling DNA complexes, several tens of nanometers or more, other techniques need to be employed. In this article, we discuss a generic technique to generate large branched DNA macromolecular complexes
Generative complexity of Gray-Scott model
Adamatzky, Andrew
2018-03-01
In the Gray-Scott reaction-diffusion system one reactant is constantly fed in the system, another reactant is reproduced by consuming the supplied reactant and also converted to an inert product. The rate of feeding one reactant in the system and the rate of removing another reactant from the system determine configurations of concentration profiles: stripes, spots, waves. We calculate the generative complexity-a morphological complexity of concentration profiles grown from a point-wise perturbation of the medium-of the Gray-Scott system for a range of the feeding and removal rates. The morphological complexity is evaluated using Shannon entropy, Simpson diversity, approximation of Lempel-Ziv complexity, and expressivity (Shannon entropy divided by space-filling). We analyse behaviour of the systems with highest values of the generative morphological complexity and show that the Gray-Scott systems expressing highest levels of the complexity are composed of the wave-fragments (similar to wave-fragments in sub-excitable media) and travelling localisations (similar to quasi-dissipative solitons and gliders in Conway's Game of Life).
Complexity in electronic negotiation support systems.
Griessmair, Michele; Strunk, Guido; Vetschera, Rudolf; Koeszegi, Sabine T
2011-10-01
It is generally acknowledged that the medium influences the way we communicate and negotiation research directs considerable attention to the impact of different electronic communication modes on the negotiation process and outcomes. Complexity theories offer models and methods that allow the investigation of how pattern and temporal sequences unfold over time in negotiation interactions. By focusing on the dynamic and interactive quality of negotiations as well as the information, choice, and uncertainty contained in the negotiation process, the complexity perspective addresses several issues of central interest in classical negotiation research. In the present study we compare the complexity of the negotiation communication process among synchronous and asynchronous negotiations (IM vs. e-mail) as well as an electronic negotiation support system including a decision support system (DSS). For this purpose, transcripts of 145 negotiations have been coded and analyzed with the Shannon entropy and the grammar complexity. Our results show that negotiating asynchronically via e-mail as well as including a DSS significantly reduces the complexity of the negotiation process. Furthermore, a reduction of the complexity increases the probability of reaching an agreement.
The building blocks of economic complexity
Hidalgo, César A.; Hausmann, Ricardo
2009-01-01
For Adam Smith, wealth was related to the division of labor. As people and firms specialize in different activities, economic efficiency increases, suggesting that development is associated with an increase in the number of individual activities and with the complexity that emerges from the interactions between them. Here we develop a view of economic growth and development that gives a central role to the complexity of a country's economy by interpreting trade data as a bipartite network in which countries are connected to the products they export, and show that it is possible to quantify the complexity of a country's economy by characterizing the structure of this network. Furthermore, we show that the measures of complexity we derive are correlated with a country's level of income, and that deviations from this relationship are predictive of future growth. This suggests that countries tend to converge to the level of income dictated by the complexity of their productive structures, indicating that development efforts should focus on generating the conditions that would allow complexity to emerge to generate sustained growth and prosperity. PMID:19549871
Reynolds, Alan P.; Ross, Simon F.
2018-05-01
We consider the holographic complexity conjectures in the context of the AdS soliton, which is the holographic dual of the ground state of a field theory on a torus with antiperiodic boundary conditions for fermions on one cycle. The complexity is a non-trivial function of the size of the circle with antiperiodic boundary conditions, which sets an IR scale in the dual geometry. We find qualitative differences between the calculations of complexity from spatial volume and action (CV and CA). In the CV calculation, the complexity for antiperiodic boundary conditions is smaller than for periodic, and decreases monotonically with increasing IR scale. In the CA calculation, the complexity for antiperiodic boundary conditions is larger than for periodic, and initially increases with increasing IR scale, eventually decreasing to zero as the IR scale becomes of order the UV cutoff. We compare these results to a simple calculation for free fermions on a lattice, where we find the complexity for antiperiodic boundary conditions is larger than for periodic.
Watanabe, Osamu
2013-04-01
Various antibodies are associated with voltage-gated potassium channels (VGKCs). Representative antibodies to VGKCs were first identified by radioimmunoassays using radioisotope-labeled alpha-dendrotoxin-VGKCs solubilized from rabbit brain. These antibodies were detected only in a proportion of patients with acquired neuromyotonia (Isaacs' syndrome). VGKC antibodies were also detected in patients with Morvan's syndrome and in those with a form of autoimmune limbic encephalitis. Recent studies indicated that the "VGKC" antibodies are mainly directed toward associated proteins (for example LGI-1 and CASPR-2) that complex with the VGKCs themselves. The "VGKC" antibodies are now commonly known as VGKC-complex antibodies. In general, LGI-1 antibodies are most commonly detected in patients with limbic encephalitis with syndrome of inappropriate secretion of antidiuretic hormone. CASPR-2 antibodies are present in the majority of patients with Morvan's syndrome. These patients develop combinations of CNS symptoms, autonomic dysfunction, and peripheral nerve hyperexcitability. Furthermore, VGKC-complex antibodies are tightly associated with chronic idiopathic pain. Hyperexcitability of nociceptive pathways has also been implicated. These antibodies may be detected in sera of some patients with neurodegenerative diseases (for example, amyotrophic lateral sclerosis and Creutzfeldt-Jakob disease).
New Communitarianism Movements and Complex Utopia
Akdeniz, K. Gediz
Simulation is a rapidly growing field in social sciences. Simulation theories in social sciences are considered to critique social dynamics and societies which are mostly simulated by media, cinema, TV, internet, etc. Recently we (Akdeniz KG, Disorder in complex human system. In: Fritzsch H, Phua KK (eds) Singapore: proceedings of the conference in Honour of Murray Gell-Mann's 80th birthday quantum mechanics, elementary particles, quantum cosmology and complexity. World Scientific Publishing, Hackensack, pp 630-637, 2009) purposed a simulation theory as a critique theory to investigate disordered human behaviors. In this theory, "Disorder-Sensitive Human Behaviors (DSHB) Simulation Theory", chaotic awareness is also considered as a reality principle in simulation world to complete Baudrillard Simulation Theory (Baudrillard J, Simulacra and simulation. University of Michigan Press, Michigan, 1995). We call the emergence of this reality as zuhur which is different than simulacra. More recently we proposed the complex utopia (Akdeniz KG, From Simulacra to Zuhur in Complex Utopia. 11th International Conference of the Utopian Studies Society, Lublin, 2010; Akdeniz KG, The new identities of the physicist: cyborg-physicist and post-physicist. In: Proceedings of the conference of world international conference of technology and education, Beirut, 2010) to critique the complex societies and communities in simulation world. The challenging agents in the complex utopia are both simulacra and zuhur. In this paper we would like to review "What is the complex utopia?" And we shall critique some global events in framework of complex utopia with particular examples in socio-economic and political contexts.
Energy Technology Data Exchange (ETDEWEB)
Thakur, P.; Choppin, G.R. [Florida State Univ., Tallahassee, FL (United States). Dept. of Chemistry and Biochemistry; Conca, J.L. [RJ Lee Group, Inc., Pasco, WA (United States). Center for Lab. Sciences; Dodge, C.J. [Brookhaven National Laboratory, Upton, NY (United States); Francis, A.J. [Brookhaven National Laboratory, Upton, NY (United States); Pohang Univ. of Science and Technology (Korea, Republic of). Div. of Advanced Nuclear Engineering
2013-05-01
The protonation constants of DTPA (diethylenetriaminepentaacetic acid) and two derivatives of DTPA, 1-R(4,4-diphenyl cyclohexyl-phosphonyl-methyl diethylenentriaminepentaacetic acid) (MS-325) and (R)-hydroxymethyl-diethylenentriaminepentaacetic acid (HMDTPA) were determined by potentiometric titration in 0.1 M NaClO{sub 4}. The formation of 1: 1 complexes of Am{sup 3+}, Cm{sup 3+} and Ln{sup 3+} cations with these three ligands were investigated by potentiometric titration with competition by ethylenediaminetetraacetic acid (EDTA) and the solvent extraction method in aqueous solutions of I=0.10 M NaClO{sub 4}. The thermodynamic data of complexation were determined by the temperature dependence of the stability constants and by calorimetry. The complexation is exothermic and becomes weaker with increase in temperature. The complexation strength of these ligands follows the order: DTPA {approx} HMDTPA > MS-325. Eu{sup 3+}/Cm{sup 3+} luminescence, EXAFS (Extended X-ray Absorption Fine Structure) and DFT (Density Functional Theory) calculations suggest that all three ligands are octadentate in the complex. In the complex, M(L){sup 2-} (L = DTPA, MS-325 and HMDTPA). The M{sup 3+} binds via five carboxylates oxygen atoms, three nitrogen atoms, and the complex contains one water of hydration. (orig.)
Determinants of Complexity of Sovereign Debt Negotiation
Directory of Open Access Journals (Sweden)
Lidia Mesjasz
2016-07-01
Full Text Available The situation on all kinds of financial markets is determined by their increasing complexity. Negotiation of sovereign debt is also a complex endeavor. Its complexity results both from structural characteristics - number of actors, problems of coordination, communication, cooperation and conflict and from cognitive limitations. The survey of literature on sovereign debt management shows that no research has been done on complexity of sovereign debt management, and sovereign debt negotiation in particular. The aim of the paper is to provide initial framework concepts of complexity of sovereign debt restructuring negotiation referring to a universal collection of characteristics of negotiation. A model of debt restructuring negotiation is elaborated and a set of its complexity- related characteristics is proposed.
Computational error and complexity in science and engineering computational error and complexity
Lakshmikantham, Vangipuram; Chui, Charles K; Chui, Charles K
2005-01-01
The book "Computational Error and Complexity in Science and Engineering pervades all the science and engineering disciplines where computation occurs. Scientific and engineering computation happens to be the interface between the mathematical model/problem and the real world application. One needs to obtain good quality numerical values for any real-world implementation. Just mathematical quantities symbols are of no use to engineers/technologists. Computational complexity of the numerical method to solve the mathematical model, also computed along with the solution, on the other hand, will tell us how much computation/computational effort has been spent to achieve that quality of result. Anyone who wants the specified physical problem to be solved has every right to know the quality of the solution as well as the resources spent for the solution. The computed error as well as the complexity provide the scientific convincing answer to these questions. Specifically some of the disciplines in which the book w...
Koorehdavoudi, Hana; Bogdan, Paul
2016-06-01
Biological systems are frequently categorized as complex systems due to their capabilities of generating spatio-temporal structures from apparent random decisions. In spite of research on analyzing biological systems, we lack a quantifiable framework for measuring their complexity. To fill this gap, in this paper, we develop a new paradigm to study a collective group of N agents moving and interacting in a three-dimensional space. Our paradigm helps to identify the spatio-temporal states of the motion of the group and their associated transition probabilities. This framework enables the estimation of the free energy landscape corresponding to the identified states. Based on the energy landscape, we quantify missing information, emergence, self-organization and complexity for a collective motion. We show that the collective motion of the group of agents evolves to reach the most probable state with relatively lowest energy level and lowest missing information compared to other possible states. Our analysis demonstrates that the natural group of animals exhibit a higher degree of emergence, self-organization and complexity over time. Consequently, this algorithm can be integrated into new frameworks to engineer collective motions to achieve certain degrees of emergence, self-organization and complexity.
5th International Conference on Complex Systems
Braha, Dan; Bar-Yam, Yaneer
2011-01-01
The International Conference on Complex Systems (ICCS) creates a unique atmosphere for scientists of all fields, engineers, physicians, executives, and a host of other professionals to explore common themes and applications of complex system science. With this new volume, Unifying Themes in Complex Systems continues to build common ground between the wide-ranging domains of complex system science.
7th International Conference on Complex Systems
Braha, Dan; Bar-Yam, Yaneer
2012-01-01
The International Conference on Complex Systems (ICCS) creates a unique atmosphere for scientists of all fields, engineers, physicians, executives, and a host of other professionals to explore common themes and applications of complex system science. With this new volume, Unifying Themes in Complex Systems continues to build common ground between the wide-ranging domains of complex system science.
Rhythmic complexity and predictive coding
DEFF Research Database (Denmark)
Vuust, Peter; Witek, Maria A G
2014-01-01
Musical rhythm, consisting of apparently abstract intervals of accented temporal events,has a remarkable capacity to move our minds and bodies. How does the cognitive systemenable our experiences of rhythmically complex music? In this paper, we describe somecommon forms of rhythmic complexity...
Prediction of Biomolecular Complexes
Vangone, Anna; Oliva, Romina; Cavallo, Luigi; Bonvin, Alexandre M. J. J.
2017-01-01
Almost all processes in living organisms occur through specific interactions between biomolecules. Any dysfunction of those interactions can lead to pathological events. Understanding such interactions is therefore a crucial step in the investigation of biological systems and a starting point for drug design. In recent years, experimental studies have been devoted to unravel the principles of biomolecular interactions; however, due to experimental difficulties in solving the three-dimensional (3D) structure of biomolecular complexes, the number of available, high-resolution experimental 3D structures does not fulfill the current needs. Therefore, complementary computational approaches to model such interactions are necessary to assist experimentalists since a full understanding of how biomolecules interact (and consequently how they perform their function) only comes from 3D structures which provide crucial atomic details about binding and recognition processes. In this chapter we review approaches to predict biomolecular complexesBiomolecular complexes, introducing the concept of molecular dockingDocking, a technique which uses a combination of geometric, steric and energetics considerations to predict the 3D structure of a biological complex starting from the individual structures of its constituent parts. We provide a mini-guide about docking concepts, its potential and challenges, along with post-docking analysis and a list of related software.
Prediction of Biomolecular Complexes
Vangone, Anna
2017-04-12
Almost all processes in living organisms occur through specific interactions between biomolecules. Any dysfunction of those interactions can lead to pathological events. Understanding such interactions is therefore a crucial step in the investigation of biological systems and a starting point for drug design. In recent years, experimental studies have been devoted to unravel the principles of biomolecular interactions; however, due to experimental difficulties in solving the three-dimensional (3D) structure of biomolecular complexes, the number of available, high-resolution experimental 3D structures does not fulfill the current needs. Therefore, complementary computational approaches to model such interactions are necessary to assist experimentalists since a full understanding of how biomolecules interact (and consequently how they perform their function) only comes from 3D structures which provide crucial atomic details about binding and recognition processes. In this chapter we review approaches to predict biomolecular complexesBiomolecular complexes, introducing the concept of molecular dockingDocking, a technique which uses a combination of geometric, steric and energetics considerations to predict the 3D structure of a biological complex starting from the individual structures of its constituent parts. We provide a mini-guide about docking concepts, its potential and challenges, along with post-docking analysis and a list of related software.
Energy Technology Data Exchange (ETDEWEB)
Altenfeld, Anika; Wohlgemuth, Sabine [Max Planck Institute of Molecular Physiology, Otto Hahn Strasse 11, 44227 Dortmund (Germany); Wehenkel, Annemarie [Institut Curie, CNRS UMR 3348/INSERM U1005, Bâtiment 110, Centre Universitaire, 91405 Orsay CEDEX (France); Vetter, Ingrid R. [Max Planck Institute of Molecular Physiology, Otto Hahn Strasse 11, 44227 Dortmund (Germany); Musacchio, Andrea, E-mail: andrea.musacchio@mpi-dortmund.mpg.de [Max Planck Institute of Molecular Physiology, Otto Hahn Strasse 11, 44227 Dortmund (Germany); University of Duisburg-Essen, Universitätstrasse 1, 45141 Essen (Germany)
2015-03-20
The 800 kDa complex of the human Rod, Zwilch and ZW10 proteins (the RZZ complex) was reconstituted in insect cells, purified, crystallized and subjected to preliminary X-ray diffraction analysis. The spindle-assembly checkpoint (SAC) monitors kinetochore–microtubule attachment during mitosis. In metazoans, the three-subunit Rod–Zwilch–ZW10 (RZZ) complex is a crucial SAC component that interacts with additional SAC-activating and SAC-silencing components, including the Mad1–Mad2 complex and cytoplasmic dynein. The RZZ complex contains two copies of each subunit and has a predicted molecular mass of ∼800 kDa. Given the low abundance of the RZZ complex in natural sources, its recombinant reconstitution was attempted by co-expression of its subunits in insect cells. The RZZ complex was purified to homogeneity and subjected to systematic crystallization attempts. Initial crystals containing the entire RZZ complex were obtained using the sitting-drop method and were subjected to optimization to improve the diffraction resolution limit. The crystals belonged to space group P3{sub 1} (No. 144) or P3{sub 2} (No. 145), with unit-cell parameters a = b = 215.45, c = 458.7 Å, α = β = 90.0, γ = 120.0°.
Machining of Complex Sculptured Surfaces
2012-01-01
The machining of complex sculptured surfaces is a global technological topic in modern manufacturing with relevance in both industrialized and emerging in countries particularly within the moulds and dies sector whose applications include highly technological industries such as the automotive and aircraft industry. Machining of Complex Sculptured Surfaces considers new approaches to the manufacture of moulds and dies within these industries. The traditional technology employed in the manufacture of moulds and dies combined conventional milling and electro-discharge machining (EDM) but this has been replaced with high-speed milling (HSM) which has been applied in roughing, semi-finishing and finishing of moulds and dies with great success. Machining of Complex Sculptured Surfaces provides recent information on machining of complex sculptured surfaces including modern CAM systems and process planning for three and five axis machining as well as explanations of the advantages of HSM over traditional methods ra...
Complexity for survival of livings
Energy Technology Data Exchange (ETDEWEB)
Zak, Michail [Jet Propulsion Laboratory, California Institute of Technology, Advance Computing Algorithms and IVHM Group, Pasadena, CA 91109 (United States)]. E-mail: Michail.Zak@jpl.nasa.gov
2007-05-15
A connection between survivability of livings and complexity of their behavior is established. New physical paradigms-exchange of information via reflections, and chain of abstractions-explaining and describing progressive evolution of complexity in living (active) systems are introduced. A biological origin of these paradigms is associated with a recently discovered mirror neuron that is able to learn by imitation. As a result, an active element possesses the self-nonself images and interacts with them creating the world of mental dynamics. Three fundamental types of complexity of mental dynamics that contribute to survivability are identified. Mathematical model of the corresponding active systems is described by coupled motor-mental dynamics represented by Langevin and Fokker-Planck equations, respectively, while the progressive evolution of complexity is provided by nonlinear evolution of probability density. Application of the proposed formalism to modeling common-sense-based decision-making process is discussed.
Complexity for survival of livings
International Nuclear Information System (INIS)
Zak, Michail
2007-01-01
A connection between survivability of livings and complexity of their behavior is established. New physical paradigms-exchange of information via reflections, and chain of abstractions-explaining and describing progressive evolution of complexity in living (active) systems are introduced. A biological origin of these paradigms is associated with a recently discovered mirror neuron that is able to learn by imitation. As a result, an active element possesses the self-nonself images and interacts with them creating the world of mental dynamics. Three fundamental types of complexity of mental dynamics that contribute to survivability are identified. Mathematical model of the corresponding active systems is described by coupled motor-mental dynamics represented by Langevin and Fokker-Planck equations, respectively, while the progressive evolution of complexity is provided by nonlinear evolution of probability density. Application of the proposed formalism to modeling common-sense-based decision-making process is discussed
2011-01-01
The domain of nonlinear dynamical systems and its mathematical underpinnings has been developing exponentially for a century, the last 35 years seeing an outpouring of new ideas and applications and a concomitant confluence with ideas of complex systems and their applications from irreversible thermodynamics. A few examples are in meteorology, ecological dynamics, and social and economic dynamics. These new ideas have profound implications for our understanding and practice in domains involving complexity, predictability and determinism, equilibrium, control, planning, individuality, responsibility and so on. Our intention is to draw together in this volume, we believe for the first time, a comprehensive picture of the manifold philosophically interesting impacts of recent developments in understanding nonlinear systems and the unique aspects of their complexity. The book will focus specifically on the philosophical concepts, principles, judgments and problems distinctly raised by work in the domain of comple...
Fourth International Conference on Complex Systems
Minai, Ali A; Unifying Themes in Complex Systems IV
2008-01-01
In June of 2002, over 500 professors, students and researchers met in Boston, Massachusetts for the Fourth International Conference on Complex Systems. The attendees represented a remarkably diverse collection of fields: biology, ecology, physics, engineering, computer science, economics, psychology and sociology, The goal of the conference was to encourage cross-fertilization between the many disciplines represented and to deepen understanding of the properties common to all complex systems. This volume contains 43 papers selected from the more than 200 presented at the conference. Topics include: cellular automata, neurology, evolution, computer science, network dynamics, and urban planning. About NECSI: For over 10 years, The New England Complex Systems Institute (NECSI) has been instrumental in the development of complex systems science and its applications. NECSI conducts research, education, knowledge dissemination, and community development around the world for the promotion of the study of complex sys...
Third International Conference on Complex Systems
Minai, Ali A; Unifying Themes in Complex Systems
2006-01-01
In recent years, scientists have applied the principles of complex systems science to increasingly diverse fields. The results have been nothing short of remarkable: their novel approaches have provided answers to long-standing questions in biology, ecology, physics, engineering, computer science, economics, psychology and sociology. The Third International Conference on Complex Systems attracted over 400 researchers from around the world. The conference aimed to encourage cross-fertilization between the many disciplines represented and to deepen our understanding of the properties common to all complex systems. This volume contains over 35 papers selected from those presented at the conference on topics including: self-organization in biology, ecological systems, language, economic modeling, ecological systems, artificial life, robotics, and complexity and art. ALI MINAI is an Affiliate of the New England Complex Systems Institute and an Associate Professor in the Department of Electrical and Computer Engine...
Effective Complexity of Stationary Process Realizations
Directory of Open Access Journals (Sweden)
Arleta Szkoła
2011-06-01
Full Text Available The concept of effective complexity of an object as the minimal description length of its regularities has been initiated by Gell-Mann and Lloyd. The regularities are modeled by means of ensembles, which is the probability distributions on finite binary strings. In our previous paper [1] we propose a definition of effective complexity in precise terms of algorithmic information theory. Here we investigate the effective complexity of binary strings generated by stationary, in general not computable, processes. We show that under not too strong conditions long typical process realizations are effectively simple. Our results become most transparent in the context of coarse effective complexity which is a modification of the original notion of effective complexity that needs less parameters in its definition. A similar modification of the related concept of sophistication has been suggested by Antunes and Fortnow.
Moessbauer spectroscopic studies of alkylammonium iron(III) complexes
International Nuclear Information System (INIS)
Katada, M.; Kozawa, S.; Nakajima, Y.
2006-01-01
Alkylammonium iron(III) complexes, [(n-C n H 2n+1 )mNH 4-m ] 3 [Fe(CN) 6 ] were prepared and studied by Moessbauer spectroscopy, XRD, and DSC. In the complexes with m=2, the temperature dependences of the area intensity of Moessbauer are correlated to the motion of alkyl chains. The temperature dependence of the complex with n=4 was linear and smaller than that of other complexes. Especially in the complex with n=6, the deviation from the linear was the largest in the complexes observed. This result is attributed to the structural difference of the complex. The complexes with n≥8 consist of two-dimensional layer structure. The temperature dependence of the area intensity was similar to each other. This means that the motion of alkyl chain in these complexes are almost the same. The values of quadrupole splitting for the complexes were larger those that of the complexes (m=1). This indicates that the form of [Fe(CN) 6 ] 3- ion is affected by the differences of the number of alkyl groups. (author)
Connections and curvatures on complex Riemannian manifolds
International Nuclear Information System (INIS)
Ganchev, G.; Ivanov, S.
1991-05-01
Characteristic connection and characteristic holomorphic sectional curvatures are introduced on a complex Riemannian manifold (not necessarily with holomorphic metric). For the class of complex Riemannian manifolds with holomorphic characteristic connection a classification of the manifolds with (pointwise) constant holomorphic characteristic curvature is given. It is shown that the conformal geometry of complex analytic Riemannian manifolds can be naturally developed on the class of locally conformal holomorphic Riemannian manifolds. Complex Riemannian manifolds locally conformal to the complex Euclidean space are characterized with zero conformal fundamental tensor and zero conformal characteristic tensor. (author). 12 refs
Mohamed, Gehad G.
2005-12-01
Ternary Fe(III), Co(II), Ni(II), Cu(II), Zn(II) and UO 2(II) complexes with piroxicam (Pir) drug (H 2L 1) and dl-alanine (Ala) (HL 2) and also the binary UO 2(II) complex with Pir were studied. The structures of the complexes were elucidated using elemental, IR, molar conductance, magnetic moment, diffused reflectance and thermal analyses. The UO 2(II) binary complex was isolated in 1:2 ratio with the formula [UO 2(H 2L) 2](NO 3) 2. The ternary complexes were isolated in 1:1:1 (M:H 2L 1:L 2) ratios. The solid complexes were isolated in the general formulae [M(H 2L)(L 2)(Cl) n(H 2O) m]· yH 2O (M = Fe(III) ( n = 2, m = 0, y = 1), Co(II) ( n = 1, m = 1, y = 2) and Ni(II) ( n = 1, m = 1, y = 0)); [M(H 2L)(L 2)](X) z· yH 2O (M = Cu(II) (X = AcO, z = 1, y = 0), Zn(II) (X = AcO, z = 1, y = 3) and UO 2(II) (X = NO 3, z = 1, y = 2)). Pir behaves as a neutral bidentate ligand coordinated to the metal ions via the pyridine-N and carbonyl-O groups, while Ala behaves as a uninegatively bidentate ligand coordinated to the metal ions via the deprotonated carboxylate-O and amino-N. The magnetic and reflectance spectral data show that the complexes have octahedral geometry except Cu(II) and Zn(II) complexes have tetrahedral structures. The thermal decomposition of the complexes was discussed in relation to structure, and the thermodynamic parameters of the decomposition stages were evaluated.
Analyzing the complexity of nanotechnology
Vries, de M.J.; Schummer, J.; Baird, D.
2006-01-01
Nanotechnology is a highly complex technological development due to many uncertainties in our knowledge about it. The Dutch philosopher Herman Dooyeweerd has developed a conceptual framework that can be used (1) to analyze the complexity of technological developments and (2) to see how priorities
Complexity control in statistical learning
Indian Academy of Sciences (India)
complexity of the class of models from which we are to choose our model. In this ... As is explained in §2, we use the concept of covering numbers to quantify the complexity of a class of ..... called structural risk minimization (SRM). Vapnik ...
Thermogravimetric investigations of vanadium complexes
International Nuclear Information System (INIS)
Bechmann, W.; Uhlemann, E.; Ludwig, W.
1987-01-01
Extensive studies on oxovanadium(IV) and (V) complexes with bidentate chelating ligands include thermogravimetric investigations. TG, DTG, and DTA data provide additional facts to redox behaviour and stability of the complexes. These data also allow a critical appreciation of the given melting temperatures. (author)
Producers' Complex Risk Management Choices
Pennings, J.M.E.; Isengildina, O.; Irwin, S.H.; Garcia, P.; Good, D.L.
2008-01-01
Producers have a wide variety of risk management instruments available, making their choice(s) complex. The way producers deal with this complexity can vary and may influence the impact that the determinants, such as risk aversion, have on their choices. A recently developed choice bracketing
Team dynamics in complex projects
Oeij, P.; Vroome, E.E.M. de; Dhondt, S.; Gaspersz, J.B.R.
2012-01-01
Complexity of projects is hotly debated and a factor which affects innovativeness of team performance. Much attention in the past is paid to technical complexity and many issues are related to natural and physical sciences. A growing awareness of the importance of socioorganisational issues is
How to lead complex situations
DEFF Research Database (Denmark)
Hansen, Michael Pingel
2013-01-01
The military leader is experiencing increasingly more complex situations, whether it is as leader in a foreign combat environment or in the home-based public administration. Complex situations like these call for a special set of managerial responses and a special way of leading organisations...
Servitization, Services and Managing Complexity
DEFF Research Database (Denmark)
Harjo, Ieva; Frandsen, Thomas; Hsuan, Juliana
This paper explores how seemingly complex servitized solutions can become tradable in a customer–supplier relationship by objectification and abbreviation. The key argument is that the complexity of product-service solutions can be reduced by abbreviation of the reality in written form of contracts...
Interdisciplinary conflict and organizational complexity.
Guy, M E
1986-01-01
Most people think that conflict among the professional staff is inevitable and results from each profession's unique set of values. Each profession then defends itself by claiming its own turf. This article demonstrates that organizational complexity, not professional territorialism, influences the amount of intraorganizational conflict. In a comparison of two psychiatric hospitals, this study shows that there is not necessarily greater conflict across professions than within professions. However, there is a significantly greater amount of conflict among staff at a structurally more complex hospital than at a less-complex hospital, regardless of profession. Implications for management are discussed.
Multi-agent and complex systems
Ren, Fenghui; Fujita, Katsuhide; Zhang, Minjie; Ito, Takayuki
2017-01-01
This book provides a description of advanced multi-agent and artificial intelligence technologies for the modeling and simulation of complex systems, as well as an overview of the latest scientific efforts in this field. A complex system features a large number of interacting components, whose aggregate activities are nonlinear and self-organized. A multi-agent system is a group or society of agents which interact with others cooperatively and/or competitively in order to reach their individual or common goals. Multi-agent systems are suitable for modeling and simulation of complex systems, which is difficult to accomplish using traditional computational approaches.
Advances in computational complexity theory
Cai, Jin-Yi
1993-01-01
This collection of recent papers on computational complexity theory grew out of activities during a special year at DIMACS. With contributions by some of the leading experts in the field, this book is of lasting value in this fast-moving field, providing expositions not found elsewhere. Although aimed primarily at researchers in complexity theory and graduate students in mathematics or computer science, the book is accessible to anyone with an undergraduate education in mathematics or computer science. By touching on some of the major topics in complexity theory, this book sheds light on this burgeoning area of research.
Complexity in physics and technology
Garrido, Manuel S
1992-01-01
A system is loosely defined as complex if it is composed of a large number of elements, interacting with each other, and the emergent global dynamics is qualitatively different from the dynamics of each one of the parts. The global dynamics may be either ordered or chaotic and among the most interesting emergent global properties are those of learning and adaptation.Complex systems, in the above sense, appear in many fields ranging from physics and technology to life and social sciences. Research in complex systems involves therefore a wide range of topics, studied in seemingly disparate field
Characterization of aspartame-cyclodextrin complexation.
Sohajda, Tamás; Béni, Szabolcs; Varga, Erzsébet; Iványi, Róbert; Rácz, Akos; Szente, Lajos; Noszál, Béla
2009-12-05
The inclusion complex formation of aspartame (guest) and various cyclodextrins (host) were examined using 1H NMR titration and capillary electrophoresis. Initially the protonation constants of aspartame were determined by NMR-pH titration with in situ pH measurement to yield log K1=7.83 and log K2=2.96. Based on these values the stability of the complexes formed by aspartame and 21 different cyclodextrins (CDs) were studied at pH 2.5, pH 5.2 and pH 9.0 values where aspartame exists predominantly in monocationic, zwitterionic and monoanionic form, respectively. The host cyclodextrin derivatives differed in various sidechains, degree of substitution, charge and purity so that the effect of these properties could be examined systematically. Concerning size, the seven-membered beta-cyclodextrin and its derivatives have been found to be the most suitable host molecules for complexation. Highest stability was observed for the acetylated derivative with a degree of substitution of 7. The purity of the CD enhanced the complexation while the degree of substitution did not provide obvious consequences. Finally, geometric aspects of the inclusion complex were assessed by 2D ROESY NMR and molecular modelling which proved that the guest's aromatic ring enters the wider end of the host cavity.
Directory of Open Access Journals (Sweden)
Vladimir Modrak
2017-01-01
Full Text Available Manufacturing systems can be considered as a network of machines/workstations, where parts are produced in flow shop or job shop environment, respectively. Such network of machines/workstations can be depicted as a graph, with machines as nodes and material flow between the nodes as links. The aim of this paper is to use sequences of operations and machine network to measure static complexity of manufacturing processes. In this order existing approaches to measure the static complexity of manufacturing systems are analyzed and subsequently compared. For this purpose, analyzed competitive complexity indicators were tested on two different manufacturing layout examples. A subsequent analysis showed relevant potential of the proposed method.
Encoding of coordination complexes with XML.
Vinoth, P; Sankar, P
2017-09-01
An in-silico system to encode structure, bonding and properties of coordination complexes is developed. The encoding is achieved through a semantic XML markup frame. Composition of the coordination complexes is captured in terms of central atom and ligands. Structural information of central atom is detailed in terms of electron status of valence electron orbitals. The ligands are encoded with specific reference to the electron environment of ligand centre atoms. Behaviour of ligands to form low or high spin complexes is accomplished by assigning a Ligand Centre Value to every ligand based on the electronic environment of ligand centre atom. Chemical ontologies are used for categorization purpose and to control different hybridization schemes. Complexes formed by the central atoms of transition metal, non-transition elements belonging to s-block, p-block and f-block are encoded with a generic encoding platform. Complexes of homoleptic, heteroleptic and bridged types are also covered by this encoding system. Utility of the encoded system to predict redox electron transfer reaction in the coordination complexes is demonstrated with a simple application. Copyright © 2017 Elsevier Inc. All rights reserved.
Complexes and aggregates of chlorophylls
Kooyman, R.P.H.
1980-01-01
Chlorophyll (Chl) molecules can form complexes in two important ways: by ligation at the magnesium atom and/or by hydrogen bonding at the keto- carbonyl group. Under certain conditions these processes may give rise to dimer formation. This thesis describes some properties of complexes and dimers of
Complex Decision Making Theory and Practice
Qudrat-Ullah, Hassan; Spector, J Michael
2007-01-01
The increasingly complex environment of today's world, characterized by technological innovation and global communication, generates myriads of possible and actual interactions while limited physical and intellectual resources severely impinge on decision makers, be it in the public or private domains. At the core of the decision-making process is the need for quality information that allows the decision maker to better assess the impact of decisions in terms of outcomes, nonlinear feedback processes and time delays on the performance of the complex system invoked. This volume is a timely review on the principles underlying complex decision making, the handling of uncertainties in dynamic envrionments and of the various modeling approaches used. The book consists of five parts, each composed of several chapters: I: Complex Decision Making: Concepts, Theories and Empirical Evidence II: Tools and Techniques for Decision Making in Complex Environments and Systems III: System Dynamics and Agent-Based Modeling IV:...
Argument Complexity: Teaching Undergraduates to Make Better Arguments
Kelly, Matthew A.; West, Robert L.
2017-01-01
The task of turning undergrads into academics requires teaching them to reason about the world in a more complex way. We present the Argument Complexity Scale, a tool for analysing the complexity of argumentation, based on the Integrative Complexity and Conceptual Complexity Scales from, respectively, political psychology and personality theory.…
International Nuclear Information System (INIS)
Schreckenberg, M
2004-01-01
This book by Nino Boccara presents a compilation of model systems commonly termed as 'complex'. It starts with a definition of the systems under consideration and how to build up a model to describe the complex dynamics. The subsequent chapters are devoted to various categories of mean-field type models (differential and recurrence equations, chaos) and of agent-based models (cellular automata, networks and power-law distributions). Each chapter is supplemented by a number of exercises and their solutions. The table of contents looks a little arbitrary but the author took the most prominent model systems investigated over the years (and up until now there has been no unified theory covering the various aspects of complex dynamics). The model systems are explained by looking at a number of applications in various fields. The book is written as a textbook for interested students as well as serving as a comprehensive reference for experts. It is an ideal source for topics to be presented in a lecture on dynamics of complex systems. This is the first book on this 'wide' topic and I have long awaited such a book (in fact I planned to write it myself but this is much better than I could ever have written it!). Only section 6 on cellular automata is a little too limited to the author's point of view and one would have expected more about the famous Domany-Kinzel model (and more accurate citation!). In my opinion this is one of the best textbooks published during the last decade and even experts can learn a lot from it. Hopefully there will be an actualization after, say, five years since this field is growing so quickly. The price is too high for students but this, unfortunately, is the normal case today. Nevertheless I think it will be a great success! (book review)
MIKOS, ANTONIOS G.; HERRING, SUSAN W.; OCHAREON, PANNEE; ELISSEEFF, JENNIFER; LU, HELEN H.; KANDEL, RITA; SCHOEN, FREDERICK J.; TONER, MEHMET; MOONEY, DAVID; ATALA, ANTHONY; VAN DYKE, MARK E.; KAPLAN, DAVID; VUNJAK-NOVAKOVIC, GORDANA
2010-01-01
This article summarizes the views expressed at the third session of the workshop “Tissue Engineering—The Next Generation,” which was devoted to the engineering of complex tissue structures. Antonios Mikos described the engineering of complex oral and craniofacial tissues as a “guided interplay” between biomaterial scaffolds, growth factors, and local cell populations toward the restoration of the original architecture and function of complex tissues. Susan Herring, reviewing osteogenesis and vasculogenesis, explained that the vascular arrangement precedes and dictates the architecture of the new bone, and proposed that engineering of osseous tissues might benefit from preconstruction of an appropriate vasculature. Jennifer Elisseeff explored the formation of complex tissue structures based on the example of stratified cartilage engineered using stem cells and hydrogels. Helen Lu discussed engineering of tissue interfaces, a problem critical for biological fixation of tendons and ligaments, and the development of a new generation of fixation devices. Rita Kandel discussed the challenges related to the re-creation of the cartilage-bone interface, in the context of tissue engineered joint repair. Frederick Schoen emphasized, in the context of heart valve engineering, the need for including the requirements derived from “adult biology” of tissue remodeling and establishing reliable early predictors of success or failure of tissue engineered implants. Mehmet Toner presented a review of biopreservation techniques and stressed that a new breakthrough in this field may be necessary to meet all the needs of tissue engineering. David Mooney described systems providing temporal and spatial regulation of growth factor availability, which may find utility in virtually all tissue engineering and regeneration applications, including directed in vitro and in vivo vascularization of tissues. Anthony Atala offered a clinician’s perspective for functional tissue
Thermodynamic properties of actinide complexes
International Nuclear Information System (INIS)
Di Bernardo, P.; Tomat, G.; Bismondo, A.
1980-01-01
The present paper reports a continuation of investigations on the complexing ability of substituted polycarboxylate ligands toward the uranyl(VI) ion. The changes in free energy were computed from the stability constants determined by potentiometric measurements; the enthalpy changes were measured by direct calorimetric titrations. The acid formation constants and the complex formation constants were calculated with the aid of a CDC/CRYBER '76 computer using the programs LETAGROP VRID and MINIQUAD 75. The enthalpy changes for the proton ligand and metal ligand complex formation were calculated by the least-squares program LETAGROP KALLE. The data obtained for a relatively wide range of concentrations of the metal and hydrogen ions may be interpreted in terms of the formation of simple mononuclear, ML, and acid complexes, Msub(p)Hsub(q)Lsub(r), where p = 1; q = 1, 2; r = 1, 2. The values of free energy enthalpy, and entropy changes for the systems investigated are reported together with the logarithms of the corresponding stability constants. (author)
Mathematicians, Attributional Complexity, and Gender
Stalder, Daniel R.
Given indirect indications in sex role and soda! psychology research that mathematical-deductive reasoning may negatively relate to social acuity, Study 1 investigated whether mathematicians were less attributionally complex than nonmathematicians. Study 1 administered the Attributional Complexity Scale, a measure of social acuity, to female and male faculty members and graduate students in four Midwestern schools. Atlrihutional complexity (AC) is the ability and motivation to give complex explanations for behavior. Study 1 found a significant interaction between field and gender. Only among women did mathematicians score lower on AC. In addition, an established gender difference in AC (that women score higher than men) was present only among nonmathematicians. Studies 2 and 3 offered some preliminary support for the possibility that it is generally female students who score tow on AC who aspire to he mathematicians and for the underlying view that female students' perceived similarity to mathematicians can influence their vocational choices.
Actinide phosphonate complexes in aqueous solutions
International Nuclear Information System (INIS)
Nash, K.L.
1993-01-01
Complexes formed by actinides with carboxylic acids, polycarboxylic acids, and aminopolycarboxylic acids play a central role in both the basic and process chemistry of the actinides. Recent studies of f-element complexes with phosphonic acid ligands indicate that new ligands incorporating doubly ionizable phosphonate groups (-PO 3 H 2 ) have many properties which are unique chemically, and promise more efficient separation processes for waste cleanup and environmental restoration. Simple diphosphonate ligands form much stronger complexes than isostructural carboxylates, often exhibiting higher solubility as well. In this manuscript recent studies of the thermodynamics and kinetics of f-element complexation by 1,1 and 1,2 diphosphonic acid ligands are described
Grammatical complexity for two-dimensional maps
International Nuclear Information System (INIS)
Hagiwara, Ryouichi; Shudo, Akira
2004-01-01
We calculate the grammatical complexity of the symbol sequences generated from the Henon map and the Lozi map using the recently developed methods to construct the pruning front. When the map is hyperbolic, the language of symbol sequences is regular in the sense of the Chomsky hierarchy and the corresponding grammatical complexity takes finite values. It is found that the complexity exhibits a self-similar structure as a function of the system parameter, and the similarity of the pruning fronts is discussed as an origin of such self-similarity. For non-hyperbolic cases, it is observed that the complexity monotonically increases as we increase the resolution of the pruning front
Grammatical complexity for two-dimensional maps
Energy Technology Data Exchange (ETDEWEB)
Hagiwara, Ryouichi; Shudo, Akira [Department of Physics, Tokyo Metropolitan University, Minami-Ohsawa, Hachioji, Tokyo 192-0397 (Japan)
2004-11-05
We calculate the grammatical complexity of the symbol sequences generated from the Henon map and the Lozi map using the recently developed methods to construct the pruning front. When the map is hyperbolic, the language of symbol sequences is regular in the sense of the Chomsky hierarchy and the corresponding grammatical complexity takes finite values. It is found that the complexity exhibits a self-similar structure as a function of the system parameter, and the similarity of the pruning fronts is discussed as an origin of such self-similarity. For non-hyperbolic cases, it is observed that the complexity monotonically increases as we increase the resolution of the pruning front.
Grammatical complexity for two-dimensional maps
Hagiwara, Ryouichi; Shudo, Akira
2004-11-01
We calculate the grammatical complexity of the symbol sequences generated from the Hénon map and the Lozi map using the recently developed methods to construct the pruning front. When the map is hyperbolic, the language of symbol sequences is regular in the sense of the Chomsky hierarchy and the corresponding grammatical complexity takes finite values. It is found that the complexity exhibits a self-similar structure as a function of the system parameter, and the similarity of the pruning fronts is discussed as an origin of such self-similarity. For non-hyperbolic cases, it is observed that the complexity monotonically increases as we increase the resolution of the pruning front.
Radioimmunoassay procedure using a stabilized complex
International Nuclear Information System (INIS)
Sultanian, I.V.; Irani, J.H.
1978-01-01
An improved radioimmunoassay procedure involves the use of a stabilized complex of labelled antigen and antibody which has an extended shelf life as compared to the same complex absent the stabilizers. Since the time needed to incubate the mixture of labelled antigen and antibody is eliminated, the time for completing the assay is considerably shortened and simplified. The components for carrying out the procedure are packaged in a kit basically including standard antigen for generation of a standard curve, a stabilized labelled antigen-antibody complex and reference serum, if used. A plurality of stabilizers are used in the complex to provide a shelf life of six weeks or more. 10 claims
Solution structure of the luzopeptin-DNA complex
International Nuclear Information System (INIS)
Zhang, Xiaolu; Patel, D.J.
1991-01-01
The luzopeptin-d(C-A-T-G) complex (1 drug/duplex) has been generated in aqueous solution and its structure characterized by a combined application of two-dimensional NMR experiments and molecular dynamics calculations. Once equivalent of luzopeptin binds to the self-complementary tetranucleotide duplex with the 2-fold symmetry of the antitumor agent and the DNA oligomer retained on complex formation. The authors have assigned the exchangeable and nonexchangeable proton resonances of luzopeptin and the d(C-A-T-G) duplex in the complex and identified the intermolecular proton-proton NOEs that define the alignment of the antitumor agent at its binding site in duplex DNA. The analysis was greatly aided by a large number of intermolecular NOEs involving exchangeable protons on both the luzopeptin and the DNA in the complex. The formation of cis peptide bonds for luzopeptin in the complex results in an increased separation of the long sides of the rectangular cyclic depsipeptide backbone and reorients in the glycine amide proton so that it can form an intermolecular hydrogen bond with the 2-carbonyl of T3 in the complex. This observation explains, in part, the requirement for Watson-Crick A·T pairs to be sandwiched between the quinolines at the bisintercalation site in the luzopeptin-DNA complex. The NMR studies on the luzopeptin-d(C-A-T-G) complex unequivocally establish that antitumor agents can undergo conformational transitions on complex formation with DNA, and it is the conformation of the drug in the complex that should serve as the starting point for drug design studies. The above structural details on the solution structure of the luzopeptin-DNA complex also explain the sequence selectivity of luzopeptin for bisintercalation at d(C-A)·d(T-G) steps in the d(C-A-T-G) duplex in solution
Simple versus complex degenerative mitral valve disease.
Javadikasgari, Hoda; Mihaljevic, Tomislav; Suri, Rakesh M; Svensson, Lars G; Navia, Jose L; Wang, Robert Z; Tappuni, Bassman; Lowry, Ashley M; McCurry, Kenneth R; Blackstone, Eugene H; Desai, Milind Y; Mick, Stephanie L; Gillinov, A Marc
2018-07-01
At a center where surgeons favor mitral valve (MV) repair for all subsets of leaflet prolapse, we compared results of patients undergoing repair for simple versus complex degenerative MV disease. From January 1985 to January 2016, 6153 patients underwent primary isolated MV repair for degenerative disease, 3101 patients underwent primary isolated MV repair for simple disease (posterior prolapse), and 3052 patients underwent primary isolated MV repair for complex disease (anterior or bileaflet prolapse), based on preoperative echocardiographic images. Logistic regression analysis was used to generate propensity scores for risk-adjusted comparisons (n = 2065 matched pairs). Durability was assessed by longitudinal recurrence of mitral regurgitation and reoperation. Compared with patients with simple disease, those undergoing repair of complex pathology were more likely to be younger and female (both P values < .0001) but with similar symptoms (P = .3). The most common repair technique was ring/band annuloplasty (3055/99% simple vs 3000/98% complex; P = .5), followed by leaflet resection (2802/90% simple vs 2249/74% complex; P < .0001). Among propensity-matched patients, recurrence of severe mitral regurgitation 10 years after repair was 6.2% for simple pathology versus 11% for complex pathology (P = .007), reoperation at 18 years was 6.3% for simple pathology versus 11% for complex pathology, and 20-year survival was 62% for simple pathology versus 61% for complex pathology (P = .6). Early surgical intervention has become more common in patients with degenerative MV disease, regardless of valve prolapse complexity or symptom status. Valve repair was associated with similarly low operative risk and time-related survival but less durability in complex disease. Lifelong annual echocardiographic surveillance after MV repair is recommended, particularly in patients with complex disease. Copyright © 2018 The American Association for Thoracic Surgery
Advances in network complexity
Dehmer, Matthias; Emmert-Streib, Frank
2013-01-01
A well-balanced overview of mathematical approaches to describe complex systems, ranging from chemical reactions to gene regulation networks, from ecological systems to examples from social sciences. Matthias Dehmer and Abbe Mowshowitz, a well-known pioneer in the field, co-edit this volume and are careful to include not only classical but also non-classical approaches so as to ensure topicality. Overall, a valuable addition to the literature and a must-have for anyone dealing with complex systems.
Electrospun complexes - functionalised nanofibres
Energy Technology Data Exchange (ETDEWEB)
Meyer, T.; Wolf, M.; Dreyer, B.; Unruh, D.; Krüger, C.; Menze, M. [Leibniz University Hannover, Institute of Inorganic Chemistry (Germany); Sindelar, R. [University of Applied Science Hannover, Faculty II (Germany); Klingelhöfer, G. [Gutenberg-University, Institute of Inorganic and Analytic Chemistry (Germany); Renz, F., E-mail: renz@acd.uni-hannover.de [Leibniz University Hannover, Institute of Inorganic Chemistry (Germany)
2016-12-15
Here we present a new approach of using iron-complexes in electro-spun fibres. We modify poly(methyl methacrylate) (PMMA) by replacing the methoxy group with Diaminopropane or Ethylenediamine. The complex is bound covalently via an imine-bridge or an amide. The resulting polymer can be used in the electrospinning process without any further modifications in method either as pure reagent or mixed with small amounts of not functionalised polymer resulting in fibres of different qualities (Fig. 1).
Directory of Open Access Journals (Sweden)
Oleg Svatos
2013-01-01
Full Text Available In this paper we analyze complexity of time limits we can find especially in regulated processes of public administration. First we review the most popular process modeling languages. There is defined an example scenario based on the current Czech legislature which is then captured in discussed process modeling languages. Analysis shows that the contemporary process modeling languages support capturing of the time limit only partially. This causes troubles to analysts and unnecessary complexity of the models. Upon unsatisfying results of the contemporary process modeling languages we analyze the complexity of the time limits in greater detail and outline lifecycles of a time limit using the multiple dynamic generalizations pattern. As an alternative to the popular process modeling languages there is presented PSD process modeling language, which supports the defined lifecycles of a time limit natively and therefore allows keeping the models simple and easy to understand.
Adaptive Beamforming Based on Complex Quaternion Processes
Directory of Open Access Journals (Sweden)
Jian-wu Tao
2014-01-01
Full Text Available Motivated by the benefits of array signal processing in quaternion domain, we investigate the problem of adaptive beamforming based on complex quaternion processes in this paper. First, a complex quaternion least-mean squares (CQLMS algorithm is proposed and its performance is analyzed. The CQLMS algorithm is suitable for adaptive beamforming of vector-sensor array. The weight vector update of CQLMS algorithm is derived based on the complex gradient, leading to lower computational complexity. Because the complex quaternion can exhibit the orthogonal structure of an electromagnetic vector-sensor in a natural way, a complex quaternion model in time domain is provided for a 3-component vector-sensor array. And the normalized adaptive beamformer using CQLMS is presented. Finally, simulation results are given to validate the performance of the proposed adaptive beamformer.
Complex concentrate pretreatment
International Nuclear Information System (INIS)
Lokken, R.O.; Scheele, R.D.; Strachan, D.M.; Toste, A.P.
1991-03-01
After removal of the transuranics (TRU) by the TRUEX process, complex concentrate waste will be grouted for final storage. The purpose of this project, conducted at the Pacific Northwest Laboratory, is to support a future decision to grout the complexant waste without destruction of the organic contents. It has been demonstrated that grouts with acceptable parameters for the Transportable Grout Facility can be made using actual waste. The acceptability of these grouts from a regulatory view seems to be less of a problem than previously. None of the organics found in the waste have been found on the EPA hazardous chemicals list. Two potential problems with the processing of the complex concentrate wastes were identified during the use of the TRUEX process on samples of several milliliters. One was the amount of foam that is generated during acid addition to the alkaline waste. Some of this foam appears to be of a waxy nature but does redissolve when the waste is strongly acid. The second potential problem is that noticeable amounts of NO x gases are generated. No quantitative measure of the NO x gas generation was made. The problem relates to processing the waste in B-plant where there are no facilities to handle NO x gases. 5 refs., 4 figs., 4 tabs
Complexity and formative experiences
Directory of Open Access Journals (Sweden)
Roque Strieder
2017-12-01
Full Text Available The contemporaneity is characterized by instability and diversity calling into question certainties and truths proposed in modernity. We recognize that the reality of things and phenomena become effective as a set of events, interactions, retroactions and chances. This different frame extends the need for revision of the epistemological foundations that sustain educational practices and give them sense. The complex thinking is an alternative option for acting as a counterpoint to classical science and its reductionist logic and knowledge compartmentalization, as well as to answer to contemporary epistemological and educational challenges. It aims to associate different areas and forms of knowledge, without, however merge them, distinguishing without separating the several disciplines and instances of the realities. This study, in theoretical references, highlights the relevance of complex approaches to support formative experiences because also able to produce complexities in reflections about educational issues. We conclude that formative possibilities from complexity potentialize the resignification of human’s conception and the understanding of its singularity in interdependence; The understanding that pedagogical and educational activities is a constant interrogation about the possibilities of knowing the knowledge and reframe learning, far beyond knowing its functions and utilitarian purposes; and, as a formative possibility, places us on the trail of responsibility, not as something eventual, but present and indicative of freedom to choose to stay or go beyond.
Directory of Open Access Journals (Sweden)
Angel Garrido
2011-01-01
Full Text Available In this paper, we analyze a few interrelated concepts about graphs, such as their degree, entropy, or their symmetry/asymmetry levels. These concepts prove useful in the study of different types of Systems, and particularly, in the analysis of Complex Networks. A System can be defined as any set of components functioning together as a whole. A systemic point of view allows us to isolate a part of the world, and so, we can focus on those aspects that interact more closely than others. Network Science analyzes the interconnections among diverse networks from different domains: physics, engineering, biology, semantics, and so on. Current developments in the quantitative analysis of Complex Networks, based on graph theory, have been rapidly translated to studies of brain network organization. The brain's systems have complex network features—such as the small-world topology, highly connected hubs and modularity. These networks are not random. The topology of many different networks shows striking similarities, such as the scale-free structure, with the degree distribution following a Power Law. How can very different systems have the same underlying topological features? Modeling and characterizing these networks, looking for their governing laws, are the current lines of research. So, we will dedicate this Special Issue paper to show measures of symmetry in Complex Networks, and highlight their close relation with measures of information and entropy.
2012 Symposium on Chaos, Complexity and Leadership
Erçetin, Şefika
2014-01-01
These proceedings from the 2012 symposium on "Chaos, complexity and leadership" reflect current research results from all branches of Chaos, Complex Systems and their applications in Management. Included are the diverse results in the fields of applied nonlinear methods, modeling of data and simulations, as well as theoretical achievements of Chaos and Complex Systems. Also highlighted are Leadership and Management applications of Chaos and Complexity Theory.
Scattering methods in complex fluids
Chen, Sow-Hsin
2015-01-01
Summarising recent research on the physics of complex liquids, this in-depth analysis examines the topic of complex liquids from a modern perspective, addressing experimental, computational and theoretical aspects of the field. Selecting only the most interesting contemporary developments in this rich field of research, the authors present multiple examples including aggregation, gel formation and glass transition, in systems undergoing percolation, at criticality, or in supercooled states. Connecting experiments and simulation with key theoretical principles, and covering numerous systems including micelles, micro-emulsions, biological systems, and cement pastes, this unique text is an invaluable resource for graduate students and researchers looking to explore and understand the expanding field of complex fluids.
Theory of complex potential scattering
International Nuclear Information System (INIS)
Kok, L.P.; Haeringen, H.v.
1981-01-01
We study the effect of the addition of a complex potential lambdaV/sub sep/ to an arbitrary Schroedinger operator H = H 0 +V on the singularities of the S matrix, as a function of lambda. Here V/sub sep/ is a separable interaction, and lambda is a complex coupling parameter. The paths of these singularities are determined to a great extent by certain saddle points in the momentum (or energy) plane. We explain certain critical phenomena recently reported in the literature. Associated with these saddles are branch-type singularities in the complex lambda plane, which are dynamical in origin. Some examples are discussed in detail
7th Workshop on Complex Networks
Gonçalves, Bruno; Menezes, Ronaldo; Sinatra, Roberta
2016-01-01
The last decades have seen the emergence of Complex Networks as the language with which a wide range of complex phenomena in fields as diverse as Physics, Computer Science, and Medicine (to name just a few) can be properly described and understood. This book provides a view of the state of the art in this dynamic field and covers topics ranging from network controllability, social structure, online behavior, recommendation systems, and network structure. This book includes the peer-reviewed list of works presented at the 7th Workshop on Complex Networks CompleNet 2016 which was hosted by the Université de Bourgogne, France, from March 23-25, 2016. The 28 carefully reviewed and selected contributions in this book address many topics related to complex networks and have been organized in seven major groups: (1) Theory of Complex Networks, (2) Multilayer networks, (3) Controllability of networks, (4) Algorithms for networks, (5) Community detection, (6) Dynamics and spreading phenomena on networks, (7) Applicat...
Complexity management in the food industry
DEFF Research Database (Denmark)
Herbert-Hansen, Zaza Nadja Lee; Jacobsen, Peter
2017-01-01
The many stakeholders in the food industry with their diverse interests make this industry complex and interesting to work with. There are four main stakeholders; 1) The customers with their increased demand for customized products, quick delivery times and increased responsiveness, 2) The author......The many stakeholders in the food industry with their diverse interests make this industry complex and interesting to work with. There are four main stakeholders; 1) The customers with their increased demand for customized products, quick delivery times and increased responsiveness, 2...... this complexity and finding a method for using these complexity factors in economic calculations. The research question this paper seeks to address is therefore “Which complexity factors can be quantified in the food industry and how can they be used in economic calculations?” A case study of a SME Danish bread...... producer will address the research question due to the explorative nature of this study and the limited amount of previous research within this field....
Coping with the Complexity of Economics
Faggini, Marisa
2009-01-01
The purpose of the science of complexity is to provide, if not a unified approach, at least useful tools to tackling complex problems in various scientific domains. Generally, complexity is considered a fundamental challenge to the reductionist approach in science as a whole and to its ideas of certainty and randomness. The overall behaviour of a complex system is different from and more than the sum of its parts. The behaviour of non-linear complex systems depends on the interaction (often with retroactive effects) among its constituent parts and not so much (or not only) on the characteristics of these parts themselves; the sum of the behaviour of single parts does not necessarily provide us with an explanation of the aggregate behaviour of a system. All this is true for economic systems. These are based on the activities of single economic agents. Each individual can obtain only partial knowledge that is focussed around its "world" (local information) and react to external shocks in different ways (local r...
Korean Conference on Several Complex Variables
Byun, Jisoo; Gaussier, Hervé; Hirachi, Kengo; Kim, Kang-Tae; Shcherbina, Nikolay
2015-01-01
This volume includes 28 chapters by authors who are leading researchers of the world describing many of the up-to-date aspects in the field of several complex variables (SCV). These contributions are based upon their presentations at the 10th Korean Conference on Several Complex Variables (KSCV10), held as a satellite conference to the International Congress of Mathematicians (ICM) 2014 in Seoul, Korea. SCV has been the term for multidimensional complex analysis, one of the central research areas in mathematics. Studies over time have revealed a variety of rich, intriguing, new knowledge in complex analysis and geometry of analytic spaces and holomorphic functions which were "hidden" in the case of complex dimension one. These new theories have significant intersections with algebraic geometry, differential geometry, partial differential equations, dynamics, functional analysis and operator theory, and sheaves and cohomology, as well as the traditional analysis of holomorphic functions in all dimensions. This...
The geosystems of complex geographical atlases
Directory of Open Access Journals (Sweden)
Jovanović Jasmina
2012-01-01
Full Text Available Complex geographical atlases represent geosystems of different hierarchical rank, complexity and diversity, scale and connection. They represent a set of large number of different pieces of information about geospace. Also, they contain systematized, correlative and in the apparent form represented pieces of information about space. The degree of information revealed in the atlas is precisely explained by its content structure and the form of presentation. The quality of atlas depends on the method of visualization of data and the quality of geodata. Cartographic visualization represents cognitive process. The analysis converts geospatial data into knowledge. A complex geographical atlas represents information complex of spatial - temporal coordinated database on geosystems of different complexity and territorial scope. Each geographical atlas defines a concrete geosystem. Systemic organization (structural and contextual determines its complexity and concreteness. In complex atlases, the attributes of geosystems are modeled and pieces of information are given in systematized, graphically unique form. The atlas can be considered as a database. In composing a database, semantic analysis of data is important. The result of semantic modeling is expressed in structuring of data information, in emphasizing logic connections between phenomena and processes and in defining their classes according to the degree of similarity. Accordingly, the efficiency of research of needed pieces of information in the process of the database use is enabled. An atlas map has a special power to integrate sets of geodata and present information contents in user - friendly and understandable visual and tactile way using its visual ability. Composing an atlas by systemic cartography requires the pieces of information on concrete - defined geosystems of different hierarchical level, the application of scientific methods and making of adequate number of analytical, synthetic
Geographical National Condition and Complex System
Directory of Open Access Journals (Sweden)
WANG Jiayao
2016-01-01
Full Text Available The significance of studying the complex system of geographical national conditions lies in rationally expressing the complex relationships of the “resources-environment-ecology-economy-society” system. Aiming to the problems faced by the statistical analysis of geographical national conditions, including the disunity of research contents, the inconsistency of range, the uncertainty of goals, etc.the present paper conducted a range of discussions from the perspectives of concept, theory and method, and designed some solutions based on the complex system theory and coordination degree analysis methods.By analyzing the concepts of geographical national conditions, geographical national conditions survey and geographical national conditions statistical analysis, as well as investigating the relationships between theirs, the statistical contents and the analytical range of geographical national conditions are clarified and defined. This investigation also clarifies the goals of the statistical analysis by analyzing the basic characteristics of the geographical national conditions and the complex system, and the consistency between the analysis of the degree of coordination and statistical analyses. It outlines their goals, proposes a concept for the complex system of geographical national conditions, and it describes the concept. The complex system theory provides new theoretical guidance for the statistical analysis of geographical national conditions. The degree of coordination offers new approaches on how to undertake the analysis based on the measurement method and decision-making analysis scheme upon which the complex system of geographical national conditions is based. It analyzes the overall trend via the degree of coordination of the complex system on a macro level, and it determines the direction of remediation on a micro level based on the degree of coordination among various subsystems and of single systems. These results establish
Federal Laboratory Consortium — This 88,000 square foot complex is used to investigate basic physical science in support of missile technology development. It incorporates office space, dedicated...
Holistic education and complexity thinking
Jörg, T.
2007-01-01
Paper proposal for the SIG Holistic Education at AERA 2007 Title: Holistic Education and Complexity Thinking Ton Jörg IVLOS Institute of Education University of Utrecht The Netherlands A.G.D.Jorg@ivlos.uu.nl ABSTRACT In this paper I link complexity thinking with Holistic Education (HE). It is a
Complexing of vanadium(3) with chromotropic acid derivatives
International Nuclear Information System (INIS)
Babenko, N.L.; Busev, A.I.; Sukhorukova, N.V.; Frolova, O.S.
1976-01-01
A spectrophotometric study has been made of the complex formation of vanadium (3) with arsenazo(1), arsenazo(3) and some monosubstituted derivatives of chromotropic acid and sulphanylamides. In acid medium vanadium (3) reacts with each of these reagents to produce a 1:1 complex. Optimum conditions of the complex formation was found. The effect of H + on the complex formation of vanadium (3) with chromotropic acid derivatives was established. It was found by the graphical method that the formation of the complex is accompanied by the elimination of one proton. Patterns were found of the influence of the nature of substituents in the organic compound on the ionization constants of acid groups and stability of complexes. Molar extinction coefficients, equilibrium constants of the formation reactions and instability constants for the complexes were calculated. The structure of complexes was suggested. Similar behaviour of all the reagents was established in the complex formation with vanadium (3)
Subjective task complexity in the control room
International Nuclear Information System (INIS)
Braarud, Per Oeivind
2000-05-01
Understanding of what makes a control room situation difficult to handle is important when studying operator performance, both with respect to prediction as well as improvement of the human performance. Previous exploratory work on complexity showed a potential for prediction and explanation of operator performance. This report investigates in further detail the theoretical background and the structure of operator rated task complexity. The report complements the previous work on complexity to make a basis for development of operator performance analysis tools. The first part of the report outlines an approach for studying the complexity of the control room crew's work. The approach draws upon man-machine research as well as problem solving research. The approach identifies five complexity-shaping components: 'task work characteristics', 'teamwork characteristics', 'individual skill', 'teamwork skill', and 'interface and support systems'. The crew's work complexity is related to concepts of human performance quality and human error. The second part of the report is a post-hoc exploratory analysis of four empirical HRP studies, where operators' conception of the complexity of control room work is assessed by questionnaires. The analysis deals with the structure of complexity questionnaire ratings, and the relationship between complexity ratings and human performance measures. The main findings from the analysis of structure was the identification of three task work factors which were named Masking, Information load and Temporal demand, and in addition the identification of one interface factor which was named Navigation. Post-hoc analysis suggests that operator's subjective complexity, which was assessed by questionnaires, is related to workload, task and system performance, and operator's self-rated performance. (Author). 28 refs., 47 tabs
Nonlinear dynamics and complexity
Luo, Albert; Fu, Xilin
2014-01-01
This important collection presents recent advances in nonlinear dynamics including analytical solutions, chaos in Hamiltonian systems, time-delay, uncertainty, and bio-network dynamics. Nonlinear Dynamics and Complexity equips readers to appreciate this increasingly main-stream approach to understanding complex phenomena in nonlinear systems as they are examined in a broad array of disciplines. The book facilitates a better understanding of the mechanisms and phenomena in nonlinear dynamics and develops the corresponding mathematical theory to apply nonlinear design to practical engineering.
International Nuclear Information System (INIS)
Seifert, Sepp; Drews, Antje; Gupta, Antje; Pietzsch, Hans-Juergen; Spies, Hartmut; Johannsen, Bernd
2000-01-01
The preparation and characterisation of 3+1+1 technetium complexes of the general formula [Tc(SES)(RS)(PMe 2 Ph)] (SES=tridentate dithiol ligand, E=S, O, NMe; RSH=monothiol ligand) at the n.c.a. level is described. The Tc(III) complexes are prepared in a one-step procedure starting from pertechnetate in yields of 85-95% of radiochemical purity. A comparison of their chromatographic data with the fully characterised 99 Tc complexes indicate the identity of the investigated compounds. Stability studies show that the 99m Tc complexes undergo some alteration in solution. They are oxidised to the 3+1 oxotechnetium (V) complexes and/or decompose in aqueous solution. In challenge experiments performed with glutathione, exchange of the monothiolato ligand occurs in the same manner as known for the 3+1 complexes
Sixth International Conference on Complex Systems
Minai, Ali; Bar-Yam, Yaneer; Unifying Themes in Complex Systems
2008-01-01
The International Conference on Complex Systems (ICCS) creates a unique atmosphere for scientists of all fields, engineers, physicians, executives, and a host of other professionals to explore the common themes and applications of complex systems science. In June 2006, 500 participants convened in Boston for the sixth ICCS, exploring an array of topics, including networks, systems biology, evolution and ecology, nonlinear dynamics and pattern formation, as well as neural, psychological, psycho-social, socio-economic, and global systems. This volume selects 77 papers from over 300 presented at the conference. With this new volume, Unifying Themes in Complex Systems continues to build common ground between the wide-ranging domains of complex systems science.
18-Crown-6-polyether complexing with iodine
International Nuclear Information System (INIS)
Borovikov, Yu.Ya.
1988-01-01
Using the methods of dielectrometry, conductometry, calorimetry, UV, NMR and IR spectroscopy, 18-Crown-6-polyether complexing with iodine in chlorobenzene, benzotrifluoride, 1,2 dichloroethane is investigated. At the first stage external complexes (1) of the composition 1:1 (dipole momentum μ=7 D) is formed, which gradually regroups into internal complex (2) of the compositon 4:1. The time of 1 transition into 2 is inversely proportional to dielectric permeability of the medium. Enthalpy of 1 formation is close to 8.3 kcal/mol, which is 2,5 times higher than in cyclohexane solutions. Complex 1 is molecular, 2 is salt-like. Formation enthalpy of complex 2 of the components is not high, in dichlaroethane it is centrally symmetric and nonpolar, in chlorobenzene and benzotrifluoride-highly polar. In solid phase complex of the composition 1:2 is formed
18-Crown-6-polyether complexing with iodine
Energy Technology Data Exchange (ETDEWEB)
Borovikov, Yu Ya [AN Ukrainskoj SSR, Kiev (Ukrainian SSR). Inst. Organicheskoj Khimii
1988-01-01
Using the methods of dielectrometry, conductometry, calorimetry, UV, NMR and IR spectroscopy, 18-Crown-6-polyether complexing with iodine in chlorobenzene, benzotrifluoride, 1,2 dichloroethane is investigated. At the first stage external complexes (1) of the composition 1:1 (dipole momentum {mu}=7 D) is formed, which gradually regroups into internal complex (2) of the compositon 4:1. The time of 1 transition into 2 is inversely proportional to dielectric permeability of the medium. Enthalpy of 1 formation is close to 8.3 kcal/mol, which is 2,5 times higher than in cyclohexane solutions. Complex 1 is molecular, 2 is salt-like. Formation enthalpy of complex 2 of the components is not high, in dichlaroethane it is centrally symmetric and nonpolar, in chlorobenzene and benzotrifluoride-highly polar. In solid phase complex of the composition 1:2 is formed.
A new information dimension of complex networks
Energy Technology Data Exchange (ETDEWEB)
Wei, Daijun [School of Computer and Information Science, Southwest University, Chongqing 400715 (China); School of Science, Hubei University for Nationalities, Enshi 445000 (China); Wei, Bo [School of Computer and Information Science, Southwest University, Chongqing 400715 (China); Hu, Yong [Institute of Business Intelligence and Knowledge Discovery, Guangdong University of Foreign Studies, Guangzhou 510006 (China); Zhang, Haixin [School of Computer and Information Science, Southwest University, Chongqing 400715 (China); Deng, Yong, E-mail: ydeng@swu.edu.cn [School of Computer and Information Science, Southwest University, Chongqing 400715 (China); School of Engineering, Vanderbilt University, TN 37235 (United States)
2014-03-01
Highlights: •The proposed measure is more practical than the classical information dimension. •The difference of information for box in the box-covering algorithm is considered. •Results indicate the measure can capture the fractal property of complex networks. -- Abstract: The fractal and self-similarity properties are revealed in many complex networks. The classical information dimension is an important method to study fractal and self-similarity properties of planar networks. However, it is not practical for real complex networks. In this Letter, a new information dimension of complex networks is proposed. The nodes number in each box is considered by using the box-covering algorithm of complex networks. The proposed method is applied to calculate the fractal dimensions of some real networks. Our results show that the proposed method is efficient when dealing with the fractal dimension problem of complex networks.
An experimental-differential investigation of cognitive complexity
Directory of Open Access Journals (Sweden)
2009-12-01
Full Text Available Cognitive complexity as defined by differential and experimental traditions was explored to investigate the theoretical advantage and utility of relational complexity (RC theory as a common framework for studying fluid cognitive functions. RC theory provides a domain general account of processing demand as a function of task complexity. In total, 142 participants completed two tasks in which RC was manipulated, and two tasks entailing manipulations of complexity derived from the differential psychology literature. A series of analyses indicated that, as expected, task manipulations influenced item difficulty. However, comparable changes in a psychometric index of complexity were not consistently observed. Active maintenance of information across multiple steps of the problem solving process, which entails strategic coordination of storage and processing that cannot be modelled under the RC framework was found to be an important component of cognitive complexity.
A new information dimension of complex networks
International Nuclear Information System (INIS)
Wei, Daijun; Wei, Bo; Hu, Yong; Zhang, Haixin; Deng, Yong
2014-01-01
Highlights: •The proposed measure is more practical than the classical information dimension. •The difference of information for box in the box-covering algorithm is considered. •Results indicate the measure can capture the fractal property of complex networks. -- Abstract: The fractal and self-similarity properties are revealed in many complex networks. The classical information dimension is an important method to study fractal and self-similarity properties of planar networks. However, it is not practical for real complex networks. In this Letter, a new information dimension of complex networks is proposed. The nodes number in each box is considered by using the box-covering algorithm of complex networks. The proposed method is applied to calculate the fractal dimensions of some real networks. Our results show that the proposed method is efficient when dealing with the fractal dimension problem of complex networks.
Product development projects dynamics and emergent complexity
Schlick, Christopher
2016-01-01
This book primarily explores two topics: the representation of simultaneous, cooperative work processes in product development projects with the help of statistical models, and the assessment of their emergent complexity using a metric from theoretical physics (Effective Measure Complexity, EMC). It is intended to promote more effective management of development projects by shifting the focus from the structural complexity of the product being developed to the dynamic complexity of the development processes involved. The book is divided into four main parts, the first of which provides an introduction to vector autoregression models, periodic vector autoregression models and linear dynamical systems for modeling cooperative work in product development projects. The second part presents theoretical approaches for assessing complexity in the product development environment, while the third highlights and explains closed-form solutions for the complexity metric EMC for vector autoregression models and linear dyn...
Complexity management in engineering design a primer
Maurer, Maik
2017-01-01
The treatise supports understanding the phenomena of complexity in engineering, distinguishes complexity from other challenges and presents an overview of definitions and applied approaches. The historical background of complexity management is explained by highlighting the important epochs, their key actors and their discoveries, findings and developments. Knowing about the appearance of early system awareness in ancient Greece, the creation of mechanical philosophy in the 17th century and the discovery of classic physics enables the reader to better comprehend modern system sciences and management approaches. A classification of complexity management approaches by research fields indicates current focus areas and starting points for future discussions. In a comprehensive map, the classification points out mutual overlaps between engineering disciplines in terms of similar complexity management approaches. Finally, the treatise introduces a generic complexity management framework, which is based on structura...
Khattar, Randa
What do the new sciences of complex relationality offer education? This work draws on complexity theory, neurological understandings of biology and phenomenology, and attentiveness to study what the new sciences might offer education and the possibilities of a pedagogical understanding of embodied knowing. Complexity theory provides understandings of local-global relationality, self-organization, far-from-equilibrium conditions, and emergent dynamics that are important for describing pedagogical relationality. In itself, however, complexity theory is lacking an attention to issues of embodiment that respond directly to an ethical understanding of relationality. Phenomenology provides important views on the human experience of perception, for example, Merleau-Ponty's, whose research opens up possibilities for embodiment and attentiveness. At the level of pedagogical practice, I will pose, following biologists Humberto Maturana and Francisco Varela's autopoietic self-making understanding of life, that attentiveness perspectives, which have been largely absent from western pedagogical theory and practice, are crucial to promoting embodied knowing for education. Maturana and Varela's autopoietic perspective offers an embodied understanding of living---and therefore education---which opens up necessary attentive spaces to listen to one another in non judgmental awareness in the present moment of experience. I offer insights into a relationally complex conception of education drawing on this biological and autopoietically-grounded framework. These insights are framed in the context of five clusters of relations: (1) emergence, far-from-equilibrium, and local-global relationality; (2) autopoietic autonomy, structural determination and sensory-motor coupling; (3) triggering perturbations, structural plasticity, and autopoietic organization; (4) knowing as adequate action, domains of interaction, and blind spots; and (5) attentiveness and responsive relationality. Four
Social complexity parallels vocal complexity: a comparison of three non-human primate species.
Bouchet, Hélène; Blois-Heulin, Catherine; Lemasson, Alban
2013-01-01
Social factors play a key role in the structuring of vocal repertoires at the individual level, notably in non-human primates. Some authors suggested that, at the species level too, social life may have driven the evolution of communicative complexity, but this has rarely been empirically tested. Here, we use a comparative approach to address this issue. We investigated vocal variability, at both the call type and the repertoire levels, in three forest-dwelling species of Cercopithecinae presenting striking differences in their social systems, in terms of social organization as well as social structure. We collected female call recordings from twelve De Brazza's monkeys (Cercopithecus neglectus), six Campbell's monkeys (Cercopithecus campbelli) and seven red-capped mangabeys (Cercocebus torquatus) housed in similar conditions. First, we noted that the level of acoustic variability and individual distinctiveness found in several call types was related to their importance in social functioning. Contact calls, essential to intra-group cohesion, were the most individually distinctive regardless of the species, while threat calls were more structurally variable in mangabeys, the most "despotic" of our three species. Second, we found a parallel between the degree of complexity of the species' social structure and the size, diversity, and usage of its vocal repertoire. Mangabeys (most complex social structure) called twice as often as guenons and displayed the largest and most complex repertoire. De Brazza's monkeys (simplest social structure) displayed the smallest and simplest repertoire. Campbell's monkeys displayed an intermediate pattern. Providing evidence of higher levels of vocal variability in species presenting a more complex social system, our results are in line with the theory of a social-vocal coevolution of communicative abilities, opening new perspectives for comparative research on the evolution of communication systems in different animal taxa.
Storey, Brian; Butler, Joy
2013-01-01
Background: This article draws on the literature relating to game-centred approaches (GCAs), such as Teaching Games for Understanding, and dynamical systems views of motor learning to demonstrate a convergence of ideas around games as complex adaptive learning systems. This convergence is organized under the title "complexity thinking"…
Modification in band gap of zirconium complexes
Energy Technology Data Exchange (ETDEWEB)
Sharma, Mayank, E-mail: mayank30134@gmail.com; Singh, J.; Chouhan, S. [Department of Physics, ISLE, IPS Academy, Indore (M.P.) (India); Mishra, A. [School of Physics, Devi Ahilya Vishwavidyalaya, Indore (M.P.) (India); Shrivastava, B. D. [Govt. P. G. College, Biora (M.P.) (India)
2016-05-06
The optical properties of zirconium complexes with amino acid based Schiff bases are reported here. The zirconium complexes show interesting stereo chemical features, which are applicable in organometallic and organic synthesis as well as in catalysis. The band gaps of both Schiff bases and zirconium complexes were obtained by UV-Visible spectroscopy. It was found that the band gap of zirconium complexes has been modified after adding zirconium compound to the Schiff bases.
Correlation/Communication complexity of generating bipartite states
Jain, Rahul; Shi, Yaoyun; Wei, Zhaohui; Zhang, Shengyu
2012-01-01
We study the correlation complexity (or equivalently, the communication complexity) of generating a bipartite quantum state $\\rho$. When $\\rho$ is a pure state, we completely characterize the complexity for approximately generating $\\rho$ by a corresponding approximate rank, closing a gap left in Ambainis, Schulman, Ta-Shma, Vazirani and Wigderson (SIAM Journal on Computing, 32(6):1570-1585, 2003). When $\\rho$ is a classical distribution $P(x,y)$, we tightly characterize the complexity of gen...